(data stored in ACNUC17686 zone)

EMBL: CP001104

ID   CP001104; SV 1; circular; genomic DNA; STD; PRO; 2144190 BP.
XX
AC   CP001104;
XX
PR   Project:PRJNA29073;
XX
DT   05-JUN-2009 (Rel. 101, Created)
DT   30-AUG-2017 (Rel. 134, Last updated, Version 4)
XX
DE   [Eubacterium] eligens ATCC 27750 chromosome, complete genome.
XX
KW   .
XX
OS   [Eubacterium] eligens ATCC 27750
OC   Bacteria; Firmicutes; Clostridia; Clostridiales; Eubacteriaceae;
OC   Eubacterium.
XX
RN   [1]
RP   1-2144190
RX   DOI; 10.1073/pnas.0901529106.
RX   PUBMED; 19321416.
RA   Mahowald M.A., Rey F.E., Seedorf H., Turnbaugh P.J., Fulton R.S.,
RA   Wollam A., Shah N., Wang C., Magrini V., Wilson R.K., Cantarel B.L.,
RA   Coutinho P.M., Henrissat B., Crock L.W., Russell A., Verberkmoes N.C.,
RA   Hettich R.L., Gordon J.I.;
RT   "Characterizing a model human gut microbiota composed of members of its two
RT   dominant bacterial phyla";
RL   Proc. Natl. Acad. Sci. U.S.A. 106(14):5859-5864(2009).
XX
RN   [2]
RP   1-2144190
RA   Mahowald M.A., Henrissat B., Coutinho P.M., Cantarel B.L., Wollam A.,
RA   Fulton R.S., Fulton L.A., Wilson R.K., Gordon J.I.;
RT   "Genomic and transcriptional studies of human gut bacteria suggest
RT   mutualistic relationship between model Bacteroidetes and Firmicutes";
RL   Unpublished.
XX
RN   [3]
RP   1-2144190
RA   Mahowald M.A., Henrissat B., Coutinho P.M., Cantarel B.L., Wollam A.,
RA   Fulton R.S., Fulton L.A., Wilson R.K., Gordon J.I.;
RT   ;
RL   Submitted (03-JUN-2008) to the INSDC.
RL   Center for Genome Sciences, Washington University in St. Louis, 4444 Forest
RL   Park Ave., St. Louis, MO 63108, USA
XX
DR   MD5; dd4326b97b76a4276b5d2c0860cbc4d6.
DR   BioSample; SAMN02603083.
DR   EnsemblGenomes-Gn; EBG00001211291.
DR   EnsemblGenomes-Gn; EBG00001211292.
DR   EnsemblGenomes-Gn; EBG00001211293.
DR   EnsemblGenomes-Gn; EBG00001211294.
DR   EnsemblGenomes-Gn; EBG00001211295.
DR   EnsemblGenomes-Gn; EBG00001211296.
DR   EnsemblGenomes-Gn; EBG00001211297.
DR   EnsemblGenomes-Gn; EBG00001211298.
DR   EnsemblGenomes-Gn; EBG00001211299.
DR   EnsemblGenomes-Gn; EBG00001211300.
DR   EnsemblGenomes-Gn; EBG00001211301.
DR   EnsemblGenomes-Gn; EBG00001211302.
DR   EnsemblGenomes-Gn; EBG00001211303.
DR   EnsemblGenomes-Gn; EBG00001211304.
DR   EnsemblGenomes-Gn; EBG00001211305.
DR   EnsemblGenomes-Gn; EBG00001211306.
DR   EnsemblGenomes-Gn; EBG00001211307.
DR   EnsemblGenomes-Gn; EBG00001211308.
DR   EnsemblGenomes-Gn; EBG00001211309.
DR   EnsemblGenomes-Gn; EBG00001211310.
DR   EnsemblGenomes-Gn; EBG00001211311.
DR   EnsemblGenomes-Gn; EBG00001211312.
DR   EnsemblGenomes-Gn; EBG00001211313.
DR   EnsemblGenomes-Gn; EBG00001211314.
DR   EnsemblGenomes-Gn; EBG00001211315.
DR   EnsemblGenomes-Gn; EBG00001211316.
DR   EnsemblGenomes-Gn; EBG00001211317.
DR   EnsemblGenomes-Gn; EBG00001211318.
DR   EnsemblGenomes-Gn; EBG00001211319.
DR   EnsemblGenomes-Gn; EBG00001211320.
DR   EnsemblGenomes-Gn; EBG00001211321.
DR   EnsemblGenomes-Gn; EBG00001211322.
DR   EnsemblGenomes-Gn; EBG00001211323.
DR   EnsemblGenomes-Gn; EBG00001211324.
DR   EnsemblGenomes-Gn; EBG00001211325.
DR   EnsemblGenomes-Gn; EBG00001211326.
DR   EnsemblGenomes-Gn; EBG00001211327.
DR   EnsemblGenomes-Gn; EBG00001211328.
DR   EnsemblGenomes-Gn; EBG00001211329.
DR   EnsemblGenomes-Gn; EBG00001211330.
DR   EnsemblGenomes-Gn; EBG00001211331.
DR   EnsemblGenomes-Gn; EBG00001211332.
DR   EnsemblGenomes-Gn; EBG00001211333.
DR   EnsemblGenomes-Gn; EBG00001211334.
DR   EnsemblGenomes-Gn; EBG00001211335.
DR   EnsemblGenomes-Gn; EBG00001211336.
DR   EnsemblGenomes-Gn; EBG00001211337.
DR   EnsemblGenomes-Gn; EBG00001211338.
DR   EnsemblGenomes-Gn; EBG00001211339.
DR   EnsemblGenomes-Gn; EBG00001211340.
DR   EnsemblGenomes-Gn; EBG00001211341.
DR   EnsemblGenomes-Gn; EBG00001211342.
DR   EnsemblGenomes-Gn; EBG00001211343.
DR   EnsemblGenomes-Gn; EBG00001211344.
DR   EnsemblGenomes-Gn; EBG00001211345.
DR   EnsemblGenomes-Gn; EBG00001211346.
DR   EnsemblGenomes-Gn; EBG00001211347.
DR   EnsemblGenomes-Gn; EBG00001211348.
DR   EnsemblGenomes-Gn; EBG00001211349.
DR   EnsemblGenomes-Gn; EBG00001211350.
DR   EnsemblGenomes-Gn; EBG00001211351.
DR   EnsemblGenomes-Gn; EBG00001211352.
DR   EnsemblGenomes-Gn; EBG00001211353.
DR   EnsemblGenomes-Gn; EBG00001211354.
DR   EnsemblGenomes-Gn; EBG00001211355.
DR   EnsemblGenomes-Gn; EBG00001211356.
DR   EnsemblGenomes-Gn; EBG00001211357.
DR   EnsemblGenomes-Gn; EBG00001211358.
DR   EnsemblGenomes-Gn; EBG00001211359.
DR   EnsemblGenomes-Gn; EBG00001211360.
DR   EnsemblGenomes-Gn; EBG00001211361.
DR   EnsemblGenomes-Gn; EBG00001211362.
DR   EnsemblGenomes-Gn; EBG00001211363.
DR   EnsemblGenomes-Gn; EBG00001211364.
DR   EnsemblGenomes-Gn; EBG00001211365.
DR   EnsemblGenomes-Gn; EBG00001211366.
DR   EnsemblGenomes-Gn; EBG00001211367.
DR   EnsemblGenomes-Gn; EBG00001211368.
DR   EnsemblGenomes-Gn; EBG00001211369.
DR   EnsemblGenomes-Gn; EBG00001211370.
DR   EnsemblGenomes-Gn; EUBELI_00013.
DR   EnsemblGenomes-Gn; EUBELI_00014.
DR   EnsemblGenomes-Gn; EUBELI_00015.
DR   EnsemblGenomes-Gn; EUBELI_00016.
DR   EnsemblGenomes-Gn; EUBELI_00017.
DR   EnsemblGenomes-Gn; EUBELI_00018.
DR   EnsemblGenomes-Gn; EUBELI_00019.
DR   EnsemblGenomes-Gn; EUBELI_00020.
DR   EnsemblGenomes-Gn; EUBELI_00021.
DR   EnsemblGenomes-Gn; EUBELI_00121.
DR   EnsemblGenomes-Gn; EUBELI_00383.
DR   EnsemblGenomes-Gn; EUBELI_00385.
DR   EnsemblGenomes-Gn; EUBELI_00386.
DR   EnsemblGenomes-Gn; EUBELI_00387.
DR   EnsemblGenomes-Gn; EUBELI_00388.
DR   EnsemblGenomes-Gn; EUBELI_00389.
DR   EnsemblGenomes-Gn; EUBELI_00390.
DR   EnsemblGenomes-Gn; EUBELI_00391.
DR   EnsemblGenomes-Gn; EUBELI_00392.
DR   EnsemblGenomes-Gn; EUBELI_00393.
DR   EnsemblGenomes-Gn; EUBELI_00394.
DR   EnsemblGenomes-Gn; EUBELI_00395.
DR   EnsemblGenomes-Gn; EUBELI_00396.
DR   EnsemblGenomes-Gn; EUBELI_00402.
DR   EnsemblGenomes-Gn; EUBELI_00403.
DR   EnsemblGenomes-Gn; EUBELI_00404.
DR   EnsemblGenomes-Gn; EUBELI_00405.
DR   EnsemblGenomes-Gn; EUBELI_00406.
DR   EnsemblGenomes-Gn; EUBELI_00407.
DR   EnsemblGenomes-Gn; EUBELI_00425.
DR   EnsemblGenomes-Gn; EUBELI_00464.
DR   EnsemblGenomes-Gn; EUBELI_00465.
DR   EnsemblGenomes-Gn; EUBELI_00494.
DR   EnsemblGenomes-Gn; EUBELI_00695.
DR   EnsemblGenomes-Gn; EUBELI_00696.
DR   EnsemblGenomes-Gn; EUBELI_00697.
DR   EnsemblGenomes-Gn; EUBELI_00698.
DR   EnsemblGenomes-Gn; EUBELI_00699.
DR   EnsemblGenomes-Gn; EUBELI_00858.
DR   EnsemblGenomes-Gn; EUBELI_00859.
DR   EnsemblGenomes-Gn; EUBELI_00860.
DR   EnsemblGenomes-Gn; EUBELI_00861.
DR   EnsemblGenomes-Gn; EUBELI_00862.
DR   EnsemblGenomes-Gn; EUBELI_00889.
DR   EnsemblGenomes-Gn; EUBELI_00913.
DR   EnsemblGenomes-Gn; EUBELI_01074.
DR   EnsemblGenomes-Gn; EUBELI_01183.
DR   EnsemblGenomes-Gn; EUBELI_01203.
DR   EnsemblGenomes-Gn; EUBELI_01235.
DR   EnsemblGenomes-Gn; EUBELI_01315.
DR   EnsemblGenomes-Gn; EUBELI_01339.
DR   EnsemblGenomes-Gn; EUBELI_01400.
DR   EnsemblGenomes-Gn; EUBELI_01402.
DR   EnsemblGenomes-Gn; EUBELI_01581.
DR   EnsemblGenomes-Gn; EUBELI_01733.
DR   EnsemblGenomes-Gn; EUBELI_01820.
DR   EnsemblGenomes-Gn; EUBELI_01963.
DR   EnsemblGenomes-Gn; EUBELI_01964.
DR   EnsemblGenomes-Gn; EUBELI_01965.
DR   EnsemblGenomes-Gn; EUBELI_01966.
DR   EnsemblGenomes-Gn; EUBELI_01967.
DR   EnsemblGenomes-Gn; EUBELI_01968.
DR   EnsemblGenomes-Gn; EUBELI_02019.
DR   EnsemblGenomes-Gn; EUBELI_02037.
DR   EnsemblGenomes-Gn; EUBELI_02050.
DR   EnsemblGenomes-Tr; EBT00001780272.
DR   EnsemblGenomes-Tr; EBT00001780273.
DR   EnsemblGenomes-Tr; EBT00001780274.
DR   EnsemblGenomes-Tr; EBT00001780275.
DR   EnsemblGenomes-Tr; EBT00001780276.
DR   EnsemblGenomes-Tr; EBT00001780277.
DR   EnsemblGenomes-Tr; EBT00001780278.
DR   EnsemblGenomes-Tr; EBT00001780279.
DR   EnsemblGenomes-Tr; EBT00001780280.
DR   EnsemblGenomes-Tr; EBT00001780281.
DR   EnsemblGenomes-Tr; EBT00001780282.
DR   EnsemblGenomes-Tr; EBT00001780283.
DR   EnsemblGenomes-Tr; EBT00001780284.
DR   EnsemblGenomes-Tr; EBT00001780285.
DR   EnsemblGenomes-Tr; EBT00001780286.
DR   EnsemblGenomes-Tr; EBT00001780287.
DR   EnsemblGenomes-Tr; EBT00001780288.
DR   EnsemblGenomes-Tr; EBT00001780289.
DR   EnsemblGenomes-Tr; EBT00001780290.
DR   EnsemblGenomes-Tr; EBT00001780291.
DR   EnsemblGenomes-Tr; EBT00001780292.
DR   EnsemblGenomes-Tr; EBT00001780293.
DR   EnsemblGenomes-Tr; EBT00001780294.
DR   EnsemblGenomes-Tr; EBT00001780295.
DR   EnsemblGenomes-Tr; EBT00001780296.
DR   EnsemblGenomes-Tr; EBT00001780297.
DR   EnsemblGenomes-Tr; EBT00001780298.
DR   EnsemblGenomes-Tr; EBT00001780299.
DR   EnsemblGenomes-Tr; EBT00001780300.
DR   EnsemblGenomes-Tr; EBT00001780301.
DR   EnsemblGenomes-Tr; EBT00001780302.
DR   EnsemblGenomes-Tr; EBT00001780303.
DR   EnsemblGenomes-Tr; EBT00001780304.
DR   EnsemblGenomes-Tr; EBT00001780305.
DR   EnsemblGenomes-Tr; EBT00001780306.
DR   EnsemblGenomes-Tr; EBT00001780307.
DR   EnsemblGenomes-Tr; EBT00001780308.
DR   EnsemblGenomes-Tr; EBT00001780309.
DR   EnsemblGenomes-Tr; EBT00001780310.
DR   EnsemblGenomes-Tr; EBT00001780311.
DR   EnsemblGenomes-Tr; EBT00001780312.
DR   EnsemblGenomes-Tr; EBT00001780313.
DR   EnsemblGenomes-Tr; EBT00001780314.
DR   EnsemblGenomes-Tr; EBT00001780315.
DR   EnsemblGenomes-Tr; EBT00001780316.
DR   EnsemblGenomes-Tr; EBT00001780317.
DR   EnsemblGenomes-Tr; EBT00001780318.
DR   EnsemblGenomes-Tr; EBT00001780319.
DR   EnsemblGenomes-Tr; EBT00001780320.
DR   EnsemblGenomes-Tr; EBT00001780321.
DR   EnsemblGenomes-Tr; EBT00001780322.
DR   EnsemblGenomes-Tr; EBT00001780323.
DR   EnsemblGenomes-Tr; EBT00001780324.
DR   EnsemblGenomes-Tr; EBT00001780325.
DR   EnsemblGenomes-Tr; EBT00001780326.
DR   EnsemblGenomes-Tr; EBT00001780327.
DR   EnsemblGenomes-Tr; EBT00001780328.
DR   EnsemblGenomes-Tr; EBT00001780329.
DR   EnsemblGenomes-Tr; EBT00001780330.
DR   EnsemblGenomes-Tr; EBT00001780331.
DR   EnsemblGenomes-Tr; EBT00001780332.
DR   EnsemblGenomes-Tr; EBT00001780333.
DR   EnsemblGenomes-Tr; EBT00001780334.
DR   EnsemblGenomes-Tr; EBT00001780335.
DR   EnsemblGenomes-Tr; EBT00001780336.
DR   EnsemblGenomes-Tr; EBT00001780337.
DR   EnsemblGenomes-Tr; EBT00001780338.
DR   EnsemblGenomes-Tr; EBT00001780339.
DR   EnsemblGenomes-Tr; EBT00001780340.
DR   EnsemblGenomes-Tr; EBT00001780341.
DR   EnsemblGenomes-Tr; EBT00001780342.
DR   EnsemblGenomes-Tr; EBT00001780343.
DR   EnsemblGenomes-Tr; EBT00001780344.
DR   EnsemblGenomes-Tr; EBT00001780345.
DR   EnsemblGenomes-Tr; EBT00001780346.
DR   EnsemblGenomes-Tr; EBT00001780347.
DR   EnsemblGenomes-Tr; EBT00001780348.
DR   EnsemblGenomes-Tr; EBT00001780349.
DR   EnsemblGenomes-Tr; EBT00001780350.
DR   EnsemblGenomes-Tr; EBT00001780351.
DR   EnsemblGenomes-Tr; EUBELI_00013-1.
DR   EnsemblGenomes-Tr; EUBELI_00014-1.
DR   EnsemblGenomes-Tr; EUBELI_00015-1.
DR   EnsemblGenomes-Tr; EUBELI_00016-1.
DR   EnsemblGenomes-Tr; EUBELI_00017-1.
DR   EnsemblGenomes-Tr; EUBELI_00018-1.
DR   EnsemblGenomes-Tr; EUBELI_00019-1.
DR   EnsemblGenomes-Tr; EUBELI_00020-1.
DR   EnsemblGenomes-Tr; EUBELI_00021-1.
DR   EnsemblGenomes-Tr; EUBELI_00121-1.
DR   EnsemblGenomes-Tr; EUBELI_00383-1.
DR   EnsemblGenomes-Tr; EUBELI_00385-1.
DR   EnsemblGenomes-Tr; EUBELI_00386-1.
DR   EnsemblGenomes-Tr; EUBELI_00387-1.
DR   EnsemblGenomes-Tr; EUBELI_00388-1.
DR   EnsemblGenomes-Tr; EUBELI_00389-1.
DR   EnsemblGenomes-Tr; EUBELI_00390-1.
DR   EnsemblGenomes-Tr; EUBELI_00391-1.
DR   EnsemblGenomes-Tr; EUBELI_00392-1.
DR   EnsemblGenomes-Tr; EUBELI_00393-1.
DR   EnsemblGenomes-Tr; EUBELI_00394-1.
DR   EnsemblGenomes-Tr; EUBELI_00395-1.
DR   EnsemblGenomes-Tr; EUBELI_00396-1.
DR   EnsemblGenomes-Tr; EUBELI_00402-1.
DR   EnsemblGenomes-Tr; EUBELI_00403-1.
DR   EnsemblGenomes-Tr; EUBELI_00404-1.
DR   EnsemblGenomes-Tr; EUBELI_00405-1.
DR   EnsemblGenomes-Tr; EUBELI_00406-1.
DR   EnsemblGenomes-Tr; EUBELI_00407-1.
DR   EnsemblGenomes-Tr; EUBELI_00425-1.
DR   EnsemblGenomes-Tr; EUBELI_00464-1.
DR   EnsemblGenomes-Tr; EUBELI_00465-1.
DR   EnsemblGenomes-Tr; EUBELI_00494-1.
DR   EnsemblGenomes-Tr; EUBELI_00695-1.
DR   EnsemblGenomes-Tr; EUBELI_00696-1.
DR   EnsemblGenomes-Tr; EUBELI_00697-1.
DR   EnsemblGenomes-Tr; EUBELI_00698-1.
DR   EnsemblGenomes-Tr; EUBELI_00699-1.
DR   EnsemblGenomes-Tr; EUBELI_00858-1.
DR   EnsemblGenomes-Tr; EUBELI_00859-1.
DR   EnsemblGenomes-Tr; EUBELI_00860-1.
DR   EnsemblGenomes-Tr; EUBELI_00861-1.
DR   EnsemblGenomes-Tr; EUBELI_00862-1.
DR   EnsemblGenomes-Tr; EUBELI_00889-1.
DR   EnsemblGenomes-Tr; EUBELI_00913-1.
DR   EnsemblGenomes-Tr; EUBELI_01074-1.
DR   EnsemblGenomes-Tr; EUBELI_01183-1.
DR   EnsemblGenomes-Tr; EUBELI_01203-1.
DR   EnsemblGenomes-Tr; EUBELI_01235-1.
DR   EnsemblGenomes-Tr; EUBELI_01315-1.
DR   EnsemblGenomes-Tr; EUBELI_01339-1.
DR   EnsemblGenomes-Tr; EUBELI_01400-1.
DR   EnsemblGenomes-Tr; EUBELI_01402-1.
DR   EnsemblGenomes-Tr; EUBELI_01581-1.
DR   EnsemblGenomes-Tr; EUBELI_01733-1.
DR   EnsemblGenomes-Tr; EUBELI_01820-1.
DR   EnsemblGenomes-Tr; EUBELI_01963-1.
DR   EnsemblGenomes-Tr; EUBELI_01964-1.
DR   EnsemblGenomes-Tr; EUBELI_01965-1.
DR   EnsemblGenomes-Tr; EUBELI_01966-1.
DR   EnsemblGenomes-Tr; EUBELI_01967-1.
DR   EnsemblGenomes-Tr; EUBELI_01968-1.
DR   EnsemblGenomes-Tr; EUBELI_02019-1.
DR   EnsemblGenomes-Tr; EUBELI_02037-1.
DR   EnsemblGenomes-Tr; EUBELI_02050-1.
DR   EuropePMC; PMC2660063; 19321416.
DR   EuropePMC; PMC3584212; 23239474.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00162; SAM.
DR   RFAM; RF00168; Lysine.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00230; T-box.
DR   RFAM; RF00504; Glycine.
DR   RFAM; RF00557; L10_leader.
DR   RFAM; RF01051; c-di-GMP-I.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01699; Clostridiales-1.
DR   RFAM; RF01731; TwoAYGGAY.
DR   RFAM; RF01734; crcB.
DR   RFAM; RF01854; Bacteria_large_SRP.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   SILVA-LSU; CP001104.
DR   SILVA-SSU; CP001104.
DR   StrainInfo; 105926; 1.
XX
CC   This genome was sequenced by the Genome Sequencing Center,
CC   Washington University School of Medicine, Washington University in
CC   St. Louis.
CC   Source DNA is available from Jeffrey I. Gordon, jgordon@wustl.edu.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2144190
FT                   /organism="[Eubacterium] eligens ATCC 27750"
FT                   /strain="ATCC 27750"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:515620"
FT                   /culture_collection="ATCC:27750"
FT                   /type_material="type strain of [Eubacterium] eligens"
FT   gene            1..1356
FT                   /locus_tag="EUBELI_00001"
FT   CDS_pept        1..1356
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00001"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /note="Psort-B: Cytoplasmic, score:9.98; COG0593 ATPase
FT                   involved in DNA replication initiation; HMMPfam:IPR013159;
FT                   HMMPfam:IPR013317; HMMSmart:IPR003593; HMMSmart:IPR013159;
FT                   HMMTigr:IPR001957; ScanRegExp:IPR001957;
FT                   superfamily:IPR010921; K02313 chromosomal replication
FT                   initiator protein DnaA"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00001"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71047"
FT                   /db_xref="GOA:C4Z173"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z173"
FT                   /protein_id="ACR71047.1"
FT                   /translation="MEELDILIEKWDFILQTFKKEYDIQDISFKTWIKPLKIYSLEGNV
FT                   ITLISSEGEMGTVYIERKYLKFIEISICEVMNKEYSVRLISVEEKKEEDLKKKISSVSA
FT                   NNNNVATQNLNPNYTFDTFVVGTNNNLAHAASLAVAETPGQIYNPLFIYGGAGLGKTHL
FT                   MQAIAHFIIASDPSKKVLYVTSETFTNELIESVKTNKNTEFRNKYRNIDVLLIDDIQFI
FT                   IGKLSTQEEFFNTFNDLYLLGKQIVISSDRPPKEMETLPDRLRTRFESGLPVDIQIPTY
FT                   ETKMAIINKKSEALGIDFPYEVKDYVATNITSSIRELEGALTKLSAYSKLSHTPLTAEF
FT                   AENTLKDLISPYSKKEITPELIIEVVAEHFHIKPEDIISHRRSADIAFPRQIAMYLCRQ
FT                   MTQTPLEAIGKAMGNRDHTTVIYGADKIAKETVTNESTKNVVDILIKKLNPS"
FT   gene            1658..2761
FT                   /locus_tag="EUBELI_00002"
FT   CDS_pept        1658..2761
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00002"
FT                   /product="DNA polymerase"
FT                   /note="Psort-B: Cytoplasmic, score:8.87; COG0592 DNA
FT                   polymerase sliding clamp subunit (PCNA homolog);
FT                   HMMPfam:IPR001001; Gene3D:IPR001001; HMMSmart:IPR001001;
FT                   HMMTigr:IPR001001; K00961 DNA polymerase"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00002"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71048"
FT                   /db_xref="GOA:C4Z174"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z174"
FT                   /protein_id="ACR71048.1"
FT                   /translation="MKLVFTKSNLNKAVGIVMKAVPTRTTMNILECILIDATTNEIKFT
FT                   GNDMELGIETIVEGEIIEKGKVAIDAKLFSEIVRKLPDNDITLTTDSNNNALITCEKSK
FT                   FNIAGKSGDDFSYLPAIIKDKMITLSQFQLKEVINQTIFSIAINDNNKMMTGELFEVNE
FT                   GTLKVVGLDGHRIAIRNIKLEGRADDVRVVIPGKTLQEISKILNADAESFVNIYFTNNH
FT                   VLFEFDQTHVVSRLIEGDYFKISQMLSNDYETKVSINKKEFLDSIDRANLLIREGDKKP
FT                   IIINILNGLLQVNVNSAIGALNEDIDIDKEGKDIMIGFNPKFLMDALRVIDDENVTIYL
FT                   VNHKSPCFIRDKEENYIYLILPVNFTA"
FT   gene            2779..2988
FT                   /locus_tag="EUBELI_00003"
FT   CDS_pept        2779..2988
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00003"
FT                   /product="Hypothetical protein"
FT                   /note="Psort-B: Cytoplasmic, score:8.87; COG2501
FT                   Uncharacterized conserved protein; HMMPfam:IPR002942"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00003"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71049"
FT                   /db_xref="GOA:C4Z175"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z175"
FT                   /protein_id="ACR71049.1"
FT                   /translation="MEEIVLRNEFIKLGQAIKAAGLVESGVEAKIVIQDGEVKVNGVVE
FT                   TQRGKKLFGGEVVEYNGSSILIKK"
FT   gene            2997..4088
FT                   /locus_tag="EUBELI_00004"
FT   CDS_pept        2997..4088
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00004"
FT                   /product="DNA replication and repair protein RecF"
FT                   /note="Psort-B: Cytoplasmic, score:8.87; COG1195
FT                   Recombinational DNA repair ATPase (RecF pathway);
FT                   HMMPfam:IPR003395; HMMTigr:IPR001238; ScanRegExp:IPR001238;
FT                   K03629 DNA replication and repair protein RecF"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00004"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71050"
FT                   /db_xref="GOA:C4Z176"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038729"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4Z176"
FT                   /protein_id="ACR71050.1"
FT                   /translation="MIVESVELKDFRNYEFLDMNFNEHVNIIYGDNAQGKTNILESIYM
FT                   CSTSKSHRGSKDREIVRFGEDESHIKLNVLKHGMKYRIDMHLKKNKTKGIAVNGIPIKK
FT                   AVELFGIINIVFFSPEDLNIIKNGPSERRRFMDMELSQLDKIYLSNLVNYNKVLNQRNK
FT                   LLKDIAFSPSEQLMQTLDIWDMQLVKYGSLIIKGRKSFIEKINTIISDIHSRLTGGIEN
FT                   IKVCYVPDVDVNDFEEEVRNSRQKDIKYKVTGKGPHKDDLIFLINDNDVRKYGSQGQQR
FT                   TAALSLKLSEIELVKLVIKDTPVLLLDDVLSELDSNRQNFLINSIGDIQTIVTCTGLEE
FT                   FINNRMNINKIFKVTDGHVVNEN"
FT   gene            4124..6058
FT                   /locus_tag="EUBELI_00005"
FT   CDS_pept        4124..6058
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00005"
FT                   /product="DNA gyrase subunit B"
FT                   /note="Psort-B: Cytoplasmic, score:8.87; COG0187 Type IIA
FT                   topoisomerase (DNA gyrase/topo II, topoisomerase IV), B
FT                   subunit; HMMPfam:IPR002288; HMMPfam:IPR003594;
FT                   HMMPfam:IPR006171; HMMPfam:IPR013506;
FT                   BlastProDom:IPR011558; FPrintScan:IPR000565;
FT                   FPrintScan:IPR001241; Gene3D:IPR003594; Gene3D:IPR013759;
FT                   Gene3D:IPR014721; HMMSmart:IPR001241; HMMSmart:IPR003594;
FT                   HMMTigr:IPR011557; ScanRegExp:IPR001241;
FT                   superfamily:IPR003594; superfamily:IPR013760; K02470 DNA
FT                   gyrase subunit B"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00005"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71051"
FT                   /db_xref="GOA:C4Z177"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR034160"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z177"
FT                   /protein_id="ACR71051.1"
FT                   /translation="MADQNAEKNYGGDQIQVLEGLEAVRKRPGMYIGSTSGRGLHHLVY
FT                   EIVDNAIDEALAGFCTHIEVMINKDNSITVIDNGRGVPVDINHKTGRPAIEVVYTVLHA
FT                   GGKFGGGGYKVSGGLHGVGASVVNALSEWLEVQVKRNGHIYQQRYERGKICYDLKIVGD
FT                   CDIEDTGTQVTFLPDSEIFQETTVFEFDILMHRLREMAFLTKGIKITLTDLREGLEQQK
FT                   VFHYEGGIKEFVQYLNKSKEPLYSQIIYCEGVKDNVQVEVAFQHNDGYNEVVDSFVNNI
FT                   KTPEGGTHLTGFRNSLTKTFNDYARKNKILKDSDQGLSGDDIREGLTAIVSVKIEDPQF
FT                   EGQTKQKLGNTVARGAVDSIVSEQLTYFLEQNPAVAKSICEKSLLAQRAREAARKARDL
FT                   TRRKTALESTSLPGKLADCSDKDPKNCEIYIVEGDSAGGSAKTARSRATQAILPLRGKI
FT                   LNVEKARLDRILGNAEIKAMITAFGTGIHEDFDISKLRYHKIIIMTDADVDGAHIATLL
FT                   LTFLYRFMPDLIREGHVYLAQPPLYKVEKNKKVWYAYNDDELNAIMTEIGRDQNNKVQR
FT                   YKGLGEMDAEQLWETTMDPHKRVLLRVNMNEDDDSELDVTFSTLMGDKVEPRRDFIEAN
FT                   AKFVKNLDI"
FT   gene            6285..8804
FT                   /locus_tag="EUBELI_00006"
FT   CDS_pept        6285..8804
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00006"
FT                   /product="DNA gyrase subunit A"
FT                   /note="Psort-B: Cytoplasmic, score:8.87; COG0188 Type IIA
FT                   topoisomerase (DNA gyrase/topo II, topoisomerase IV), A
FT                   subunit; HMMPfam:IPR002205; HMMPfam:IPR006691;
FT                   BlastProDom:IPR002205; Gene3D:IPR013757; Gene3D:IPR013758;
FT                   HMMSmart:IPR002205; HMMTigr:IPR005743;
FT                   ScanRegExp:IPR001360; superfamily:IPR013760; K02469 DNA
FT                   gyrase subunit A"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00006"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71052"
FT                   /db_xref="GOA:C4Z178"
FT                   /db_xref="InterPro:IPR002205"
FT                   /db_xref="InterPro:IPR005743"
FT                   /db_xref="InterPro:IPR006691"
FT                   /db_xref="InterPro:IPR013757"
FT                   /db_xref="InterPro:IPR013758"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR035516"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z178"
FT                   /protein_id="ACR71052.1"
FT                   /translation="MDEHIFDKVQEVDMQKTMENYYIDYAMSVIASRALPDVRDGLKPV
FT                   QRRILYSMIELNNGPDKPHRKCARIVGDTMGKYHPHGDSSIYEALVKLAQDFNTRYPLV
FT                   DGHGNFGSVDGDGAAAMRYTEARLSKISMEMTRDLNKDTVDFIPNFDETEKEPTVLPSR
FT                   YPNLLCNGTSGIAVGMATNIPPHNLREVIGAVVKMIDNKVEEDRDTTIEEILDIVKGPD
FT                   FPTGGTIIGKLGIEEAYRTGRAKIKVRAVTNIEPMNNGKNRIVVTELPYMVNKAKLIEK
FT                   IAELVRDKKIDGITDLRDESDREGMRIAIELRRDVNPNIVLNQLYKHTQLQDTFGVIML
FT                   ALVDNQPKVLNLYDMLKYYLLHQEEVVTRRTKFDLNKAEERAHILEGLMIALDNIDRVI
FT                   SIIRGSANVQIAKESLIAEFALSEAQAQAIVDMRLRALTGLERSKLEAELKELHEKIKE
FT                   YKAILADKKLLLGVIKNEISEIADKYGDDRRTSIGYDEYDISMEDLIPDEPCVIARTNL
FT                   GYVKRMTPDNFKSQHRGGKGIKGMQTIDDDYIKDLFMTTSHHVLTFFTNTGRAYKLKAY
FT                   EIPEASRTSRGTAIINLLQLAPGETITAVVPVKIDTLQDTDYLFMATKKGIVKKTPVKE
FT                   FANIRKTGIQAINLREDDELIEVKLTDDQAEILMVTMLGQCIRFKETDVRPTGRSAMGV
FT                   IGMSLMDEDEVVGVQVSTQGDTMLIVSENGMGKRTDIDEYTVQHRGGKGVKCYKITEKT
FT                   GNVVGAKAVDDSREVMLITTEGIIIRLQCSDISNLGRITSGVKLINLDEGIKVATIAKV
FT                   RKQPADEDGKDAEGFEEDTDKTVESED"
FT   gene            8863..9645
FT                   /locus_tag="EUBELI_00007"
FT   CDS_pept        8863..9645
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00007"
FT                   /product="Hypothetical protein"
FT                   /note="Psort-B: Unknown cell location; COG0627 Predicted
FT                   esterase; HMMPfam:IPR000801"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00007"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71053"
FT                   /db_xref="InterPro:IPR000801"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z179"
FT                   /protein_id="ACR71053.1"
FT                   /translation="MALININYESKKLGMPVMINAIIPQGRGNYKTLYLLHGMGGDYTT
FT                   WITKSRVADYVDNTDIAVIMISGDNKCFVDNVHGRKYFTFLTEELIETCTNWFGLSCDR
FT                   KDRYIAGMSMGGYGAVHAALIKPDVYGKVFSYSGLLDIEKRFDNPQGINTYQIFGDREK
FT                   LSDNQFDIMNCLKEDNFKTNVENYPEFYIRCGLSDQILTMSRQWNKYASDAGLKVNYYE
FT                   TAGSHDFIFWDKCIHETVNIIKDQSYRMEDIYGNSNEC"
FT   gene            9623..10390
FT                   /locus_tag="EUBELI_00008"
FT   CDS_pept        9623..10390
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00008"
FT                   /product="putative tributyrin esterase"
FT                   /note="Psort-B: Cytoplasmic, score:8.87; COG0627 Predicted
FT                   esterase; HMMPfam:IPR000801; K03930 putative tributyrin
FT                   esterase"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00008"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71054"
FT                   /db_xref="InterPro:IPR000801"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z180"
FT                   /protein_id="ACR71054.1"
FT                   /translation="MATVMNVNHFSIYLKRNMECTVILPSHIKNDEKLPVLWLYHGGSG
FT                   DNTAWLYHSPIIEYVDEGRFAAVLPNVQNSCYVNMNIGDKYESYVGKELFNIIMNMFPC
FT                   FSDKRENNYVSGFSNGGYGCLHIALRYPEKYGTVGAFSAGDKADSEFLNDGSEKSIRRI
FT                   ELYGDGDLHKTEYGITYQADRLIEQKSIKPEIYHACGELDPWIDMNHILRDYFMSHIEY
FT                   NYVYDEIEQIGHEWKFWREELKRFLEFTGLINN"
FT   gene            10412..11254
FT                   /locus_tag="EUBELI_00009"
FT   CDS_pept        10412..11254
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00009"
FT                   /product="fumarate hydratase"
FT                   /note="Psort-B: Cytoplasmic, score:8.87; COG1951 Tartrate
FT                   dehydratase alpha subunit/Fumarate hydratase class I,
FT                   N-terminal domain; HMMPfam:IPR004646; HMMTigr:IPR004646;
FT                   K01675 fumarate hydratase"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00009"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71055"
FT                   /db_xref="GOA:C4Z181"
FT                   /db_xref="InterPro:IPR004646"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z181"
FT                   /protein_id="ACR71055.1"
FT                   /translation="MREVNVSIITDNIKEMCIEANHFLTDDMKNVFENAVKKEESALGK
FT                   QVLGQLEENLKVAGEDMIPICQDTGMAVVFINVGQDVHLTGGDITDAINEGVRRGYVDG
FT                   YLRKSVVKDPIYRENTKDNTPAVIHFNIVPGDKVDITVAPKGFGSENMSRVFMLKPADG
FT                   IEGVKEAILTAVKDAGPNACPPMVVGVGIGGTFEKCAYLAKKALTRDLNEESPVEYVRD
FT                   LEKEMLEKINKLGIGPGGLGGTQTALAINIETYPTHIAGLPVAVNICCHVNRHSHRVI"
FT   gene            11270..11821
FT                   /locus_tag="EUBELI_00010"
FT   CDS_pept        11270..11821
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00010"
FT                   /product="fumarate hydratase"
FT                   /note="Psort-B: Cytoplasmic, score:8.87; COG1838 Tartrate
FT                   dehydratase beta subunit/Fumarate hydratase class I,
FT                   C-terminal domain; HMMPfam:IPR004647; Gene3D:IPR004647;
FT                   HMMTigr:IPR004647; K01675 fumarate hydratase"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00010"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71056"
FT                   /db_xref="GOA:C4Z182"
FT                   /db_xref="InterPro:IPR004647"
FT                   /db_xref="InterPro:IPR036660"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z182"
FT                   /protein_id="ACR71056.1"
FT                   /translation="MDKYINAPISDEDAKSLHSGDYVYITGTIYTARDAAHKRMAEALS
FT                   AGQPLPIDMKNNIIYYMGPSPAREGRPIGSAGPTTASRMDKYAPDLLDLGLKGMIGKGK
FT                   RSQAVIDGIVRNGAVYFAAVGGAGAILSKCIKKSTVIAYDDLGTEAIRELEVENLPVIV
FT                   VIDSDGNNLYETAIKEYSRV"
FT   gene            11893..14130
FT                   /locus_tag="EUBELI_00011"
FT   CDS_pept        11893..14130
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00011"
FT                   /product="Hypothetical protein"
FT                   /note="Psort-B: Cellwall, score:9.26; KOG1181 FOG:
FT                   Low-complexity; HMMSmart:IPR002035"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00011"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71057"
FT                   /db_xref="GOA:C4Z183"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z183"
FT                   /protein_id="ACR71057.1"
FT                   /translation="MGGKAMKKKMTLRIIVGMLTIILIVTGILPFMTNKALAAENVLSD
FT                   NIILVTENEVSDTAKDGYSKVTFKIGDHTKDVYIKNGNTVKLKSSNKDYGVIAGGIENG
FT                   EAITENTVIYAKSYSYQGTLSLEKSIQSETPDENGYYTLQFSAKSQNLPSIKSENQNVI
FT                   LVLDRSFSMACSVDEDVDSDAMAPTYEKTRWSVTINAVEKFLNEFLPEGTSNKVSVISY
FT                   CGSARTEITNESSKDKIMSKLNSIYNRNMYNEDYKNSSKRYNVTQIGRGLGSATNIQQG
FT                   LKQVSEIAGDTTGASVILFTDGGANRYDNGEIGGYYYIKNNNETNRYNKPRDEVNGSYY
FT                   AGKAGEELKAAGADIYTIVLMSKESDITDLVKVSLGNKSLTYEKSWEKTYFTFSDGGYA
FT                   KEFYTAANAEQLNNRFKQIMTEMTSLPFETSSVTDTLDKHFELVAGQENITDNKDGTFT
FT                   VKYPEKISATDQTVTVKIKAKDGDTGYSYTNDGCQFDGTIDGLTYTQQFEETPAAVILP
FT                   NAVDDEYTVNQNEVLDASTVLVNDNNKIVNNPKRNLQLKTEIKKDVNNGKIKFNEDGTF
FT                   QYIPDKGFSGKDTFEYNVVLVIDGKEYIKSAKVTINVIPKQPETPSETASEKETPTPTE
FT                   TASEKETPTPTETASEKETPTPTETASEKEIPSESGTPTQTETPAVSQNDEITSQNIRT
FT                   PEVAANEEEVIAKTSVKTGDRSNMMYFIMLMLSVGTAMTTTVVVYKKKKEE"
FT   gene            14537..15142
FT                   /locus_tag="EUBELI_00012"
FT   CDS_pept        14537..15142
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00012"
FT                   /product="galactoside O-acetyltransferase"
FT                   /note="Psort-B: Cytoplasmic, score:9.65; COG0110
FT                   Acetyltransferase (isoleucine patch superfamily);
FT                   ScanRegExp:IPR001451; superfamily:IPR011004; K00633
FT                   galactoside O-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00012"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71058"
FT                   /db_xref="GOA:C4Z184"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR024688"
FT                   /db_xref="InterPro:IPR039369"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z184"
FT                   /protein_id="ACR71058.1"
FT                   /translation="MWNMTERQKMISGQLYKSGVKELVNDRMLCKEQCYDFNALRPSQT
FT                   EEQTAMIKKIFGKVGSNCFITAPFWCDYGYNIEAGDNFYANHNLIILDCAKVTFGNNVF
FT                   IAPDCGFYTAGHPVDAASRNEGWEYAYPINVGNDVWIGGGVKVMPGVTIGNNVVIGGGS
FT                   VVVKDIPDNSIAVGNPCKVIKKIESGKAREYNIEEKHI"
FT   gene            15561..17079
FT                   /locus_tag="EUBELI_00013"
FT   rRNA            15561..17079
FT                   /locus_tag="EUBELI_00013"
FT                   /product="16S ribosomal RNA"
FT   gene            17167..17283
FT                   /locus_tag="EUBELI_00014"
FT   rRNA            17167..17283
FT                   /locus_tag="EUBELI_00014"
FT                   /product="5S ribosomal RNA"
FT   gene            17617..20502
FT                   /locus_tag="EUBELI_00015"
FT   rRNA            17617..20502
FT                   /locus_tag="EUBELI_00015"
FT                   /product="23S ribosomal RNA"
FT   gene            20665..20738
FT                   /locus_tag="EUBELI_00016"
FT   tRNA            20665..20738
FT                   /locus_tag="EUBELI_00016"
FT                   /product="tRNA-Asp"
FT   gene            20792..20864
FT                   /locus_tag="EUBELI_00017"
FT   tRNA            20792..20864
FT                   /locus_tag="EUBELI_00017"
FT                   /product="tRNA-Val"
FT   gene            20873..20944
FT                   /locus_tag="EUBELI_00018"
FT   tRNA            20873..20944
FT                   /locus_tag="EUBELI_00018"
FT                   /product="tRNA-Thr"
FT   gene            20990..21071
FT                   /locus_tag="EUBELI_00019"
FT   tRNA            20990..21071
FT                   /locus_tag="EUBELI_00019"
FT                   /product="tRNA-Tyr"
FT   gene            21121..21194
FT                   /locus_tag="EUBELI_00020"
FT   tRNA            21121..21194
FT                   /locus_tag="EUBELI_00020"
FT                   /product="tRNA-Met"
FT   gene            21199..21271
FT                   /locus_tag="EUBELI_00021"
FT   tRNA            21199..21271
FT                   /locus_tag="EUBELI_00021"
FT                   /product="tRNA-Phe"
FT   gene            21364..22404
FT                   /locus_tag="EUBELI_00022"
FT   CDS_pept        21364..22404
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00022"
FT                   /product="Hypothetical protein"
FT                   /note="Psort-B: Unknown cell location; COG1376
FT                   Uncharacterized protein conserved in bacteria;
FT                   HMMPfam:IPR005490"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00022"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71059"
FT                   /db_xref="GOA:C4Z185"
FT                   /db_xref="InterPro:IPR005490"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR032179"
FT                   /db_xref="InterPro:IPR038063"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z185"
FT                   /protein_id="ACR71059.1"
FT                   /translation="MSKGNINYKYLKRRKSWFRRNLTLVIFIAVVVIAIAGAVTAGIML
FT                   SHYNKEKQDDNHGSNDEQTVVSTEETTAAREVVWIDNKEPESKEQEYIAPEGVYLPYFI
FT                   KVNRAANCATVYGIDENGEYTIPVKAFATSCGKAGDETIVGDNYVTSDKYEWGYMVDGT
FT                   YGRYAFRISGGYLFHSVPYYSMNKGDLEDGQYNKLGDYASLGCVRMCVRDVKWIYDNCP
FT                   SGTGVTIYDDAVNPGPLGKPDSIKISEDSAYAGWDPTDPDENNPWNAYSAKIEGAKDIQ
FT                   TKIGQSIDVMTGVTATDTCGNDITAKIVTVGRYTFDQTGTYDIKYEVTDAIGSHDEVTV
FT                   KLMVTE"
FT   gene            22425..23828
FT                   /locus_tag="EUBELI_00023"
FT   CDS_pept        22425..23828
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00023"
FT                   /product="lysine decarboxylase"
FT                   /note="Psort-B: Cytoplasmic, score:8.87; COG1982
FT                   Arginine/lysine/ornithine decarboxylases;
FT                   HMMPfam:IPR000310; HMMPfam:IPR008286; Gene3D:IPR008286;
FT                   Gene3D:IPR015421; superfamily:IPR015424; K01582 lysine
FT                   decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00023"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71060"
FT                   /db_xref="GOA:C4Z186"
FT                   /db_xref="InterPro:IPR000310"
FT                   /db_xref="InterPro:IPR008286"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036633"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z186"
FT                   /protein_id="ACR71060.1"
FT                   /translation="MGNIDILEKLEEYSKAGYVPMHMPGGKRNTEYASTSELDITEIDG
FT                   FDNMHNADGIIKNASDRAAKLYGADKTLMLVNGSTAGILSAICGATKRKGKIIVARNCH
FT                   VSVYNALIMAQLEPVYVIPEVDNDTGIYRGLSLEQIRKCVENNRDAQAVIITSPTYEGV
FT                   VSEVREIASYLHEKGIPLIVDEAHGAHFEFSEEFPESAVKAGADIVINSIHKTLPALTQ
FT                   TALLHISGNYVDYDKVERFWNIYQTTSPSYILMASIDRCMRIIEEQGDYIFKDYIKRLK
FT                   NLRENIAKLNNIRLMDSDDISKIILICDDGKYLYDRLLDEYKVQLEMASFKYVIAMTSV
FT                   ADKQEYYDRFLSALKEIDESWKVESKDSENDVGESLGYAINNKPEVCMCPADAIDLMDE
FT                   NGYEDLSVNSPDICGRISMSSVLIYPPGMPVVNVGERITGDVCRIIKSAINAGLEVPGL
FT                   KEGKIRCLR"
FT   gene            23816..24418
FT                   /locus_tag="EUBELI_00024"
FT   CDS_pept        23816..24418
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00024"
FT                   /product="Hypothetical protein"
FT                   /note="Psort-B: Cytoplasmic, score:8.87; COG0194 Guanylate
FT                   kinase; HMMPfam:IPR008144; HMMSmart:IPR008145;
FT                   ScanRegExp:IPR008144"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00024"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71061"
FT                   /db_xref="InterPro:IPR008144"
FT                   /db_xref="InterPro:IPR008145"
FT                   /db_xref="InterPro:IPR020590"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z187"
FT                   /protein_id="ACR71061.1"
FT                   /translation="MPEIAFIMGKSASGKDKIYKNLIEDESLKLNTVILYTTRPMRAGE
FT                   TDGVEYFFVNDETAVKMQESGRIVELREYNTVYGVWKYFTADDGQIDLNSGNRYLVIGT
FT                   LEAYDKFCEFYGKQHIMPIYIEVEDGLRLTRAIHREQKQDNPHYEEMCRRFLADSEDFS
FT                   EENIAKAGITRRFSNNGELEDCISEVKSAILGGMYGY"
FT   gene            24408..24848
FT                   /locus_tag="EUBELI_00025"
FT   CDS_pept        24408..24848
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00025"
FT                   /product="hypothetical protein"
FT                   /note="Psort-B: Cytoplasmic, score:8.87; COG1728
FT                   Uncharacterized protein conserved in bacteria;
FT                   HMMPfam:IPR005585; BlastProDom:IPR005585; K09770
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00025"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71062"
FT                   /db_xref="InterPro:IPR005585"
FT                   /db_xref="InterPro:IPR024042"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z188"
FT                   /protein_id="ACR71062.1"
FT                   /translation="MDIKVKDIAPANQTTPVKAQEKSDDSFKFTLISNIEEKDLQEKLG
FT                   NMMQEITEQGEKIAKHMDIRDMKKYRELVKGFLNEVVNRSHKFSRENFLDRRGRHRVYG
FT                   IVKMVDENLDNLARELVKDEKDHLAIVGAIDDIRGLLLDIST"
FT   gene            24900..25895
FT                   /locus_tag="EUBELI_00026"
FT   CDS_pept        24900..25895
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00026"
FT                   /product="DNA polymerase"
FT                   /note="Psort-B: Cytoplasmic, score:8.87; COG2812 DNA
FT                   polymerase III, gamma/tau subunits; ScanRegExp:IPR000629;
FT                   K00961 DNA polymerase"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00026"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71063"
FT                   /db_xref="GOA:C4Z189"
FT                   /db_xref="InterPro:IPR015199"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z189"
FT                   /protein_id="ACR71063.1"
FT                   /translation="MGNFSDIYGYETIKEHLQSAISMGKVSHAYVISGGLGSGKKLIAS
FT                   TFAQTLQCEAGGVEPCGVCHSCVQAAGRNQPDIIWVGHEKPGSIGVDDIRDQLVSDMQI
FT                   KPYSSPYKIYIIDEADKLTVAAQNAMLKTIEEPPAYGIVILLANNPDVFLQTILSRCVV
FT                   LDLKPLKDDIVIKYLKDHYDNISDYECKFAARFAAGRIGRAMTMVESTEFAELRRDVMD
FT                   VIKNAKDMDSTDIMTSVKRVTNYKLTIDDYLDLMLMWYRDVLMFKSTNDTNLLIFNDQM
FT                   TLIKSQAQTMSYEGLQDIINSIDRVKVRLQANVNFDLVIELLIMAIKENS"
FT   gene            25910..26824
FT                   /locus_tag="EUBELI_00027"
FT   CDS_pept        25910..26824
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00027"
FT                   /product="Hypothetical protein"
FT                   /note="Psort-B: Cytoplasmic, score:8.87; COG1774
FT                   Uncharacterized homolog of PSP1; HMMPfam:IPR007557"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00027"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71064"
FT                   /db_xref="InterPro:IPR007557"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z190"
FT                   /protein_id="ACR71064.1"
FT                   /translation="MTKVVGVRFRQVGKIYFFAPGKYSVETGQHVIVETARGVEYGQVV
FT                   LGEREVEDTAVIQPLKAIIRIATPEDDERELKNREKEKEAFKICLEKIAKHNLDMKLIK
FT                   AEYTFDNNKVLFYFTADGRIDFRELVKDLAAVFKTRIELRQIGVRDETKILGGIGSCGR
FT                   PLCCATFLPEFNPVSIKMAKEQNLSLNPTKISGVCGRLMCCLKNEQDTYEELNSHLPNV
FT                   GDSVTTPDKLVGEVSSVNVLRQRVKVLITHDNDEKELKEYPVEELRFKRKRRFDKVRID
FT                   DDKELKALEELERKEGKAHISDD"
FT   gene            26817..27536
FT                   /locus_tag="EUBELI_00028"
FT   CDS_pept        26817..27536
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00028"
FT                   /product="Hypothetical protein"
FT                   /note="Psort-B: Unknown cell location; COG4123 Predicted
FT                   O-methyltransferase; HMMPfam:IPR013216"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00028"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71065"
FT                   /db_xref="GOA:C4Z191"
FT                   /db_xref="InterPro:IPR007848"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z191"
FT                   /protein_id="ACR71065.1"
FT                   /translation="MINERIDDLMRDGLKLIQNTDIFCFGMDAVLLSTYAMAGKKDRVL
FT                   DMGTGNGIIPVLMQSKNPGSTYSALEIQEGSAQLARRNVELNHLEDRISVVKGDIKEAS
FT                   TIFGEASFNVVTSNPPYMNENHGIVNPDSAKAIARHELLCSLDDVIREASRCLKSKGKM
FT                   YMVHRPNRLVDIFDTMRKYHLEPKRMRLVYPYVNKAANMVLIEAVKGGNSQLIVEEPLI
FT                   VYKTDGTYTDALLKMYE"
FT   gene            27550..28428
FT                   /locus_tag="EUBELI_00029"
FT   CDS_pept        27550..28428
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00029"
FT                   /product="Hypothetical protein"
FT                   /note="Psort-B: Cytoplasmic, score:8.87; COG0313 Predicted
FT                   methyltransferases; HMMPfam:IPR000878; Gene3D:IPR014777;
FT                   HMMTigr:IPR008189; superfamily:IPR000878"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00029"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71066"
FT                   /db_xref="GOA:C4Z192"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR008189"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z192"
FT                   /protein_id="ACR71066.1"
FT                   /translation="MDNEKNVKKDGPGMLYLCATPIGNLEDITYRVLRVLSEADLIAAE
FT                   DTRNSIKLLNHFEIKTPMTSYHEFNKYDKAKVLVDKILGGMDVAVITDAGTPGISDPGE
FT                   ELVKQCRAAGIRVTSLPGPAACITALTMSGRETRRFAFEAFLPADKNERKEVLAELACE
FT                   TRTMIIYEAPHRLTKTLAELQDTLGGDRLITICKELTKRYENSMEFTLESACEYYENNE
FT                   PRGEYVLVIAGKSREQLKAEARKQWENMSVAEHVQMYMSQGMDKKEAMKAAAKDRGVSK
FT                   RDIYQELEGKA"
FT   gene            complement(28433..29059)
FT                   /locus_tag="EUBELI_00030"
FT   CDS_pept        complement(28433..29059)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00030"
FT                   /product="Hypothetical protein"
FT                   /note="Psort-B: Cytoplasmic, score:8.87; COG1309
FT                   Transcriptional regulator; HMMPfam:IPR001647;
FT                   FPrintScan:IPR001647; Gene3D:IPR012287;
FT                   ScanRegExp:IPR001647; superfamily:IPR009057"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00030"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71067"
FT                   /db_xref="GOA:C4Z193"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z193"
FT                   /protein_id="ACR71067.1"
FT                   /translation="MIDMGKLEANKQQKLTSLLNTAFNLFTTQGVTKTSIAEISQKAGI
FT                   AKGTFYLYFKDKYDIRNRLISHESSKLFKNAVADLEEFSKEKNEQLGFEEKIIFIINHI
FT                   VDELNSNQTLLTFISKNLSWGIFKEALTTKVASDDINFKDVYYEMINAEDISLEEPEIM
FT                   LFLIVELVSSTCYSAILYKEPADIDTIKPYLFKTVRAIIREHTIQ"
FT   gene            29452..31542
FT                   /locus_tag="EUBELI_00031"
FT   CDS_pept        29452..31542
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00031"
FT                   /product="Hypothetical protein"
FT                   /note="Psort-B: CytoplasmicMembrane, score:9.99; COG1033
FT                   Predicted exporters of the RND superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00031"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71068"
FT                   /db_xref="GOA:C4Z194"
FT                   /db_xref="InterPro:IPR000731"
FT                   /db_xref="InterPro:IPR004869"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z194"
FT                   /protein_id="ACR71068.1"
FT                   /translation="MKKFGKVVVKLRIPILVLSFLLLIPSVLGYFNTRVNYDILYYLPS
FT                   DIDTMQGQDILLDDFGKGAYAMVVVDGMNKSNVSKLVKKVEGVDHVASVISYSGIVGDD
FT                   VPSEILPDKFRSYFENEDSGATLFAIFFDDTTSSDDTMKAIQEVRDVTDNQCYIAGMSA
FT                   VVTDTKTMAEKETPFYVLVAVVLVCIVLAIFMDSFLVPVFFMLSIGMAIVYNLGSNYFL
FT                   GEVSYITKALAAVLQLGVTLDYSIFLWHSYKEAKEETPDDHQEAMAVAIGNTLTSVVGS
FT                   SITTVAGFIALCFMSFTLGLDLGVVMAKGVVLGVIGCVTILPSLILTFDKALEKTMHRE
FT                   IMPNFDKPARWIVNHSWIFLIIFVLLLGPAIYGYNNTKVYYDLSDTLPEKLNCSQANKL
FT                   LADNFDGTNSIYMILADSNLSAEDSNAMMNEVNDLDGISFALSIDSALGGEIPTEMLPD
FT                   SLVSELKGDEYQIMMVSTNYTIASDEINDQINKVDAIAKKYDAKSMVIGEAPCTKDLIT
FT                   ITDKDFKTVSAVSIVAIFFIIFFVLKSISLPVILVAAIEFAIFVNMGIPYYTGTTIPFI
FT                   SSVVIGTIQLGATVDYAILMTTRYKRERAAGNSKKEAISIALGTSIPSIIVSALGFFAA
FT                   TFGVGMIASVDMIASLCTLMARGAIISMFVVIFVLPSLFVLLDKVIIHTSLGFKPKKNS
FT                   QN"
FT   gene            31559..33943
FT                   /locus_tag="EUBELI_00032"
FT   CDS_pept        31559..33943
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00032"
FT                   /product="putative membrane protein"
FT                   /note="Psort-B: Unknown cell location; COG2409 Predicted
FT                   drug exporters of the RND superfamily; HMMPfam:IPR006059;
FT                   K01421 putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00032"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71069"
FT                   /db_xref="InterPro:IPR023908"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z195"
FT                   /protein_id="ACR71069.1"
FT                   /translation="MVKKNLFRYSSVLMCVVLTAASLVGCGANTAATTGTDTAYVTEMA
FT                   AGSTEATITQAITNELAVSNKSTLATNTRQETVYVFNDASGNKNHITVNEKITDANGNE
FT                   TLNKTESSENAPVTMKVTYKLDGKEIKPEDLAGKSGKVTIRFDYTNNQKKTVTINGKKQ
FT                   TVAVPFTMITGMMLPTDVFSNVEVTNGKLTKVGDNIVAVGMTMPGLKDTMNLKFNDKSL
FT                   DLDIPEYFELTADVKNFSLDMTMSVATSNLLSDMNADDITLDDLKKTVASLDDAATQLA
FT                   DGTVTLQDGTQQLSDAIPALTDGVDQLNTGASSLKDGIYAYADGAASAYEGSVSLNDNM
FT                   KTYADGIGTLYNTLKDNNLDSSVASAAKGAGDLAAGAATLDAGIDSALSGAGALVTGAK
FT                   SLTDGTGELATGAAALAEGADKIGGTLTSGMTEAKQKYDNAYDSFYQLAMAVIGGKLGY
FT                   NPAAMTGEQKITAATTLANVGISATADITDENQCTKAAAFIMQNYNDTDITTGKIGIRT
FT                   AMVSALTAKYAAADTEHKYTLDQLKAKANSDSDANLVAISSGLSQAYKAYGLLNDTMTS
FT                   LTAGGENSFFNGITKLNEGAGQVNTGANALKAGIDQLSAGAGQLSAGSKQLKAGLGTLS
FT                   TGLNTLSTSVGSFSTYKEGTLCSSLYALNLNAGKLQQEGTEALQSGLSQLTANNDTLKS
FT                   GASQLADGTATLKDSSGTLADGVTQLNEGAITLKDGMAQFNSEAIEPITKLVDSDAQTA
FT                   VDTIKAVVKAGQEYNSFLGKSDDKAGSVTFVYKTAGITANK"
FT   gene            34209..35549
FT                   /locus_tag="EUBELI_00033"
FT   CDS_pept        34209..35549
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00033"
FT                   /product="Hypothetical protein"
FT                   /note="Psort-B: Cytoplasmic, score:8.87; COG1373 Predicted
FT                   ATPase (AAA+ superfamily)"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00033"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71070"
FT                   /db_xref="InterPro:IPR025420"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041682"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z196"
FT                   /protein_id="ACR71070.1"
FT                   /translation="MGKPVFKRKIYEEILEWKEKRSNKYALLIKGARRVGKSTIAEEFA
FT                   KNEFKSYILIDFAHTSKEIIELFDDTYNLDFFFLKLQQLTGVRLYKNESVIIFDEVQLL
FT                   PKARQAIKYLVADGRYKYIETGSLLSIKKNTRDILIPSEEHKISMYPMDFEEFLWAIGD
FT                   DITADTIKMLLKNKKAAGNAMHRNLMRVFRLYMLIGGMPQAVETYIEQNNLQAVDEVKR
FT                   EIVDLYEEDFTKIDGTGLAGDIYDAIPANLSSNASRYVLSNAREGTRAEQVRELIPDML
FT                   SSFTVNIAYHANNPGVGMSLTKDSGRYKLFLSDVGLFVTLAFKDKNYIDNVIYNKLLSD
FT                   KLDANLGYIYENVVAQMLTAKGNNLFYYTMDSDTSNHLYEIDFLISVRDKICPIEVKSG
FT                   NYRSHKSLDVFCDKFSNRISDKYVVHTKDYKWENAINYIPVYMVPFL"
FT   gene            complement(35595..35753)
FT                   /locus_tag="EUBELI_00034"
FT   CDS_pept        complement(35595..35753)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00034"
FT                   /product="Hypothetical protein"
FT                   /note="Psort-B: Unknown cell location"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00034"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71071"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z197"
FT                   /protein_id="ACR71071.1"
FT                   /translation="MPDNKNLLNLDDLADVFAQLNDIEDAPEELTEEEKASQRRYEEII
FT                   KKHKNNN"
FT   gene            complement(35784..36221)
FT                   /locus_tag="EUBELI_00035"
FT   CDS_pept        complement(35784..36221)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00035"
FT                   /product="MarR family transcriptional regulator"
FT                   /note="Psort-B: Cytoplasmic, score:8.87; COG1846
FT                   Transcriptional regulators; HMMPfam:IPR000835;
FT                   FPrintScan:IPR000835; Gene3D:IPR011991; HMMSmart:IPR000835;
FT                   K03712 MarR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00035"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71072"
FT                   /db_xref="GOA:C4Z198"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z198"
FT                   /protein_id="ACR71072.1"
FT                   /translation="MDIFESLNSVLVDLFNDILNIEERALITEEFKDISVTDMHIIEAI
FT                   GIEEPRTMSTISKSLGVTMGTLTVGINGLVKKGYVIRKRGEKDRRIVYASLTDKGIAAY
FT                   RHHENFHKDMIGHITKDLTKEEAEVLTKTFIRLEDFFHQIP"
FT   gene            36363..37394
FT                   /locus_tag="EUBELI_00036"
FT   CDS_pept        36363..37394
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00036"
FT                   /product="2-dehydro-3-deoxygluconokinase"
FT                   /note="Psort-B: Cytoplasmic, score:8.87; COG0524 Sugar
FT                   kinases, ribokinase family; HMMPfam:IPR011611; K00874
FT                   2-dehydro-3-deoxygluconokinase"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00036"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71073"
FT                   /db_xref="GOA:C4Z199"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z199"
FT                   /protein_id="ACR71073.1"
FT                   /translation="MTLEEDMKFIAIGELMLRLSPPNYEKLVTTHDFRVNYGGAEANVA
FT                   VSLANLGVDSTFFTVLPNSDLGKSTINYLKSNDVHTKHIIRSEGRMGLYYLEEGVSVRP
FT                   SQVIYDRADSAFAEYDYKDVDFEEILKDYDWLHISGITPALSYNCRKMMDMAVKAAKKM
FT                   GLTVSFDPNWRSTLWSFETARDVLSKYLPYVDVLIGIEPIHVYREDGTDVKDGLTMDPS
FT                   FKDMDRVFKAIDEQYHMKAIARTVRYVHSGSNNSLKAFYYTNGETYESKTINFEIVDRV
FT                   GGGDAFSSGLIYALMDNMTPEDTVNFAVASSVMKHAIRGDTNITCVDHIKRLMKNSSFD
FT                   VQR"
FT   gene            37476..38846
FT                   /locus_tag="EUBELI_00037"
FT   CDS_pept        37476..38846
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00037"
FT                   /product="Hypothetical protein"
FT                   /note="Psort-B: CytoplasmicMembrane, score:9.99; COG1055
FT                   Na+/H+ antiporter NhaD and related arsenite permeases;
FT                   HMMPfam:IPR004680"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00037"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71074"
FT                   /db_xref="GOA:C4Z1A0"
FT                   /db_xref="InterPro:IPR031566"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z1A0"
FT                   /protein_id="ACR71074.1"
FT                   /translation="MVALAAELTNVPLWLCIPFACLLLCIAIIPLVKGEWWEKYRPFAV
FT                   IFWSLLFIIPFAVKYGAGTAAETVLECLVNDYLTFIVLLFGLFCVAGNITVEGSLVGSP
FT                   RVNVILLGIGTFLSSWIGTTGASMLLVRPVIKMNSWRRNKAHIMVFFIFLISNMGGSLT
FT                   PIGDPPLLMGFSRGVPFFWSIRFFPILLLNMIILLTVLYFIDKRAYRKDIAAGYMPEIK
FT                   ENEPLIRFEGLHNIIFIVIIVVAVILSGVLPDVSFFQNAAGEVISIPIFGEVKLAITSL
FT                   IEVVMILLAAFLSFKTTNAEIRKKNHFTWGAIQEVAVLFIGIFITMQPALMILKSAGAE
FT                   LGLTHPSQMFWVTGALSSFLDNTPTYLVFLTTAGSMGFVSGLTTALGVVPAKMLTAISC
FT                   GAVFMGAITYIGNAPNFMVKSISDENGVKMPSFFGYIVWSLCCLVPVFLIDTLLFFI"
FT   gene            38863..39846
FT                   /locus_tag="EUBELI_00038"
FT   CDS_pept        38863..39846
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00038"
FT                   /product="cytidylate kinase"
FT                   /note="Psort-B: Cytoplasmic, score:8.87; NOG14451 non
FT                   supervised orthologous group; K00945 cytidylate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00038"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71075"
FT                   /db_xref="GOA:C4Z1A1"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z1A1"
FT                   /protein_id="ACR71075.1"
FT                   /translation="MADNDKITELANRIYALDEKVYKATGSNLGRVYQGNKEKCINDLR
FT                   DLLKSSADSSVLRSELALISNMARTTKKNPQLHKEIMHEYGEIFDEAMAMQEAREGNDI
FT                   IDPEHAELNMSNLANRFGKDDNLIICIGRSYGCAGTDIGFKLADKLRISYYDVSIMNEI
FT                   LQRNEEHEETDRALFQNKTARTPAQWWRDFRKYHGLSRSDVQFFNTSKKLVDLAKQEPY
FT                   VIMGRYADNILTKNHIPHISIFITAPKKLRIQRTYHTSKEKLTYKQAAKYVSKEDKAHL
FT                   KRYAFYTGKKWGEADNYDLTINSSTYGIDGSVDLIMRIVAKNQLDN"
FT   gene            40083..43433
FT                   /locus_tag="EUBELI_00039"
FT   CDS_pept        40083..43433
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00039"
FT                   /product="isoleucyl-tRNA synthetase"
FT                   /note="Psort-B: Cytoplasmic, score:9.98; COG0060
FT                   Isoleucyl-tRNA synthetase; HMMPfam:IPR002300;
FT                   HMMPfam:IPR013155; FPrintScan:IPR015905; Gene3D:IPR014729;
FT                   HMMPanther:IPR002301; HMMTigr:IPR002301;
FT                   ScanRegExp:IPR001220; ScanRegExp:IPR001412;
FT                   superfamily:IPR009008; superfamily:IPR009080; K01870
FT                   isoleucyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00039"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71076"
FT                   /db_xref="GOA:C4Z1A2"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002301"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR023586"
FT                   /db_xref="InterPro:IPR033709"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z1A2"
FT                   /protein_id="ACR71076.1"
FT                   /translation="MLPLCCITAEGFFVRNESAGSHQACLYDRFMTNARNVLENISHKA
FT                   RKEAAMIYQKVSADMKFVDREKEVEKFWKDNDIFQKSIDNRKEGPTYTFYDGPPTANGK
FT                   PHIGHVLTRVIKDMIPRYRTMKGYMVPRKAGWDTHGLPVELEVEKMLGLDGKEQIEEYG
FT                   IEPFIKHCKESVWKYKGMWEDFSSTVGFWADMDNPYVTYDNNFIESEWWALKQIWDKGL
FT                   LYKGFKIVPYCPRCGTPLSSHEVAQGYKTLKERTAVVRFKIVGEDAYFLAWTTTPWTLC
FT                   SNIALCVNPDETYARVKAADGFTYIMAKALLDKVLGGIEREEGTPAYEIIEEYKGKDLE
FT                   YKEYEPLYQCAKDAADKQHKKAFFVYCDNYVTMEDGTGIVHIAPAFGEDDARVGRKYDA
FT                   PFVQMVDEAGVMKPETPFAGMRAKPTKKEMEAGAINCDVEVLKELEGRGILFSAPKVEH
FT                   EYPHCWRCDTPLIYYARESWFIKMTDPEVKANLIANNKTINWIPETIGTGRFGAWLENV
FT                   QDWGISRNRYWGTPLNIWQCEDCGEMMSIGSIEELKEKSDNCPDNIELHRPYVDAVTCK
FT                   CPKCQGTMKRVPEVIDCWFDSGSMPFAQHHYPFENKELFEQQFPAKFISEAVDQTRGWF
FT                   YSLLAISTLLFNKAPYENVIVLGHVQDADGQKMSKSKGNAVDPFDALQKHGADAIRWYF
FT                   YENSAPWVPNRFKDEWVSEGQRKFMGTFWNTYAFFVLYANIDNFDATKYQLEYDKLSVM
FT                   DKWLLSKLNSLVKFVDNNLENYKITETARALEDFTDELSNWYVRRSRERFWAKGMEQDK
FT                   INAYMTLYTTLVTLAKISAPMVPFMTESIYRNLVCSIDKNAPISIHLCDFPKVNEQFID
FT                   KKLEETMDDVLDAVVIGRACRNSTNIKNRQPIGKMFIKADWKLDEFYTAIIADELNVKE
FT                   VEYTDDVRAFTSYSFKPQMKTLGPKYGKLLNAIRTALTEVDGNATMDKLNESGSFELNV
FT                   EGQAIELSKDDVLIEMTQKEGFVASSDKGITVVLDTNLTPELIEEGFVREVISKVQTMR
FT                   KDAGFEVMDKINLYVSGNDKIADIVNKNAAQVKTVVLAQDIITDKTAGFEKEWDINGEK
FT                   VTLAVEKLA"
FT   gene            43952..44437
FT                   /locus_tag="EUBELI_00040"
FT   CDS_pept        43952..44437
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00040"
FT                   /product="Hypothetical protein"
FT                   /note="Psort-B: Cytoplasmic, score:8.87"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00040"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71077"
FT                   /db_xref="GOA:C4Z1A3"
FT                   /db_xref="InterPro:IPR019635"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z1A3"
FT                   /protein_id="ACR71077.1"
FT                   /translation="MTTFTQIGAVGTTDNLEVAPHWLGVLILTVFAVVVIAIFIFMAKD
FT                   FIMQVLSKRITTTATLASKFQEEYVNKRMYAGTGAIQEGLAEKGIAYYFTMNLDTGKIV
FT                   TFPVSKDMYDVYAEGTKGILTYKYKTLMSFEAETEGTKVRKDISDLEGYFVSMQDKL"
FT   gene            44527..45897
FT                   /locus_tag="EUBELI_00041"
FT   CDS_pept        44527..45897
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00041"
FT                   /product="Hypothetical protein"
FT                   /note="Psort-B: Unknown cell location;
FT                   superfamily:IPR008985"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00041"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71078"
FT                   /db_xref="InterPro:IPR011047"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z1A4"
FT                   /protein_id="ACR71078.1"
FT                   /translation="MKKAVLAILIAGMAVLTACSNNNTVKKDDNVYKYSDYEYKDEAQF
FT                   YMKKNAAAAEKGYYYLSNSPVSGENYKFMYYYDMINNNSVALCSKVDCAHDDAECEAYL
FT                   SDYECLGSAVWYYDGRIYMIEKTKEKDILVSYDKTLRDKKTEKTLSIDGMSISSAWGEI
FT                   KYADVVNGYMYYLLYSDSGMLMCKANLDNSSEPEIVKKYNAPFSGGTDFIVTDLASLNA
FT                   IDNKIYINRRMSISLEAEEYIVECLDTDTGNIDCFIDITSDDELSEKAESKYWVTSELF
FT                   YDKDDNMYFAGVDSSAWCLYRMNLKTQEISEVFKLDNKSNRNYTKLAGYDGQYFYVFDK
FT                   PDLSKGKKNITTDDKNIVYIVDTNGEIKDTLEFNKDRTKMIADVDILGGDRRYLLVTTT
FT                   DTDIQQFKASSGLMDKYEKMVKELGNKPKIIKVCLSAVLDKADIGTGNKEWIQITPE"
FT   gene            45905..48001
FT                   /locus_tag="EUBELI_00042"
FT   CDS_pept        45905..48001
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00042"
FT                   /product="Hypothetical protein"
FT                   /note="Psort-B: CytoplasmicMembrane, score:9.99"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00042"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71079"
FT                   /db_xref="GOA:C4Z1A5"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z1A5"
FT                   /protein_id="ACR71079.1"
FT                   /translation="MELLRVLRKSVVFIAIFLGIIIWLSIFKINNTNDKKVYAYYNQLM
FT                   YEYANQTEMIGSLTYSRYAHDKGDDYEADREYIEEAIKLLQEKYKYVNASDMSRAENNY
FT                   KKIISSTLFAEEQSYYVLNAQKYMADLESRGEINFSITNTTAIEKLVSDKQLPVIFLMM
FT                   MIFVLITFMEEFENNMFLQIRGSKNSRKVLPVKRCFIILLISIVLSFVFNGVILAIYKN
FT                   IYGCNMGSPIQNSYMFNMFPLKTNVAAFFIIYCITFAIAMSVLSWLVYFVFLITGNYKL
FT                   SIAGTGLFLVFEYIININISSKSAFSFLKYINFSNVLFPGQSYYIYENWGTDNFITDIQ
FT                   STAWILTILLAITGLIGVYITYSHKYAQGRKSAITKIIEKCSQFIQMLLGKVPLFVSEL
FT                   YKTFILQKGIILLAAAVYLLISCRMYRGVDYSNTDFSMNNFYSMFSGNTGDKECEAYIE
FT                   ECRNAVEELGKKSETDANYKYKFREASQTLENMENCLKYVRKVNEEKGIEARIVNPAAY
FT                   EDIFGSRKYQNTESQNLVCVIFLILIISGEYVYEKRCHMIAFLNTSKERSSVKAVKLLK
FT                   ILIISFLIWGLSAFIDIFNICQLYRLEQLSAPIQSLQIFYDLPFNISIAGYMVIGQAFR
FT                   LVLLLIMSIGIYGITRALDYKGCLVITFMVFVMPYMLFKLGINSMRYFSVEILMDFGRI
FT                   IGKY"
FT   gene            48156..50630
FT                   /locus_tag="EUBELI_00043"
FT   CDS_pept        48156..50630
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00043"
FT                   /product="starch phosphorylase"
FT                   /note="Psort-B: Cytoplasmic, score:8.87; COG0058 Glucan
FT                   phosphorylase; HMMPfam:IPR000811; HMMPIR:IPR000811;
FT                   HMMPanther:IPR000811; HMMTigr:IPR011833;
FT                   ScanRegExp:IPR000811; K00688 starch phosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00043"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71080"
FT                   /db_xref="GOA:C4Z1A6"
FT                   /db_xref="InterPro:IPR000811"
FT                   /db_xref="InterPro:IPR011833"
FT                   /db_xref="InterPro:IPR035090"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z1A6"
FT                   /protein_id="ACR71080.1"
FT                   /translation="MATSLTQNFSKEEFKKNVISNCKSLYRKNIEEANDQEVFQAVSYA
FT                   VKDIIIDKWIATHKQYEKDDPKMVYYMSMEFLMGRALGNNMINLCAYDEIKEALDELGL
FT                   DINVIEDQEPDAALGNGGLGRLAACFMDSLATLEYPAYGCGIRYKYGMFKQEIKDGYQV
FT                   EVPDNWLKDGNPFEIKRSEYRYEVKFGGYVRSYRDEKTGRDMFVQEDYRSVIAVPYDIP
FT                   VLGYGNNTVNSLRIWDAEPVNTFNLNSFDKGDYQKAIEEENLAKNIVEVLYPNDNHYAG
FT                   KELRLKQQYFFVSASVQRAVDRYKSMNNGDVKNIYKKVTFQLNDTHPTVAVAELMRILM
FT                   DENGLEWDEAWDITTKTVAYTNHTIMAEALEKWPIELFSRLLPRIYQIVEEINRRFVEE
FT                   IKAKYPGNQEKVRKMAIIYDGQVKMANLAIVAGYSVNGVAKLHTEILKKQELRDFYEMM
FT                   PEKFNNKTNGITQRRFLKHANPLLSDWITDKIGDGWVTDLSQLEKLMLYVDDPKAQQDF
FT                   MQIKYKNKVRLAKYIKENNGIDVDPNSIFDVQVKRLHEYKRQLLNILHVMYLYNQIKRN
FT                   PDYDMVPRTFIFGAKAAAGYKIAKQTIKLINNVANVINNDASIKGKIKVVFIENYRVSN
FT                   GEIIFAAADVSEQISTASKEASGTGNMKFMLNGAITLGTMDGANVEIVNEVGAENAQIF
FT                   GLSSDEVIRFENEGGYDPMEIFNNDQEIRDVLMELINGKYSPEDTEMFRDIYNSLLNND
FT                   GGRRADTYFILKDFRSYAEAQRKIDERYRDTNGWAKTVMTNTAKAGKFSSDRTIEEYAT
FT                   EIWKLTKTPVEM"
FT   gene            50772..51575
FT                   /locus_tag="EUBELI_00044"
FT   CDS_pept        50772..51575
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00044"
FT                   /product="Hypothetical protein"
FT                   /note="Psort-B: Unknown cell location; COG0739 Membrane
FT                   proteins related to metalloendopeptidases;
FT                   HMMPfam:IPR002886; superfamily:IPR011055"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00044"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71081"
FT                   /db_xref="GOA:C4Z1A7"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z1A7"
FT                   /protein_id="ACR71081.1"
FT                   /translation="MANVRTRGTDKVKVVSAVITLAVIVALVFGIFSVAQNVKKSKNNN
FT                   LVNLNETEGNVAIKTDDDPDIPVEEPTVGDDDIINANARASMSDDGDGTEDEVTEQTKE
FT                   SQTEEQTVKPMTEAEVMANAISKYTFDQGELIYWPVSGTVTLGYNMDSTVYFKTLGMYK
FT                   CSPGMVVASDVGTKVCAAASGVVVDVAENTETGLTVRLAVGNGYEMTTGMLSDVNVKIG
FT                   DTVTAGQLLGTVAEPTAYYKEEGPGIYFAMTKDGIPVNPMDFLGE"
FT   gene            51576..51755
FT                   /locus_tag="EUBELI_00045"
FT   CDS_pept        51576..51755
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00045"
FT                   /product="Hypothetical protein"
FT                   /note="Psort-B: Unknown cell location"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00045"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71082"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z1A8"
FT                   /protein_id="ACR71082.1"
FT                   /translation="MLTIRVKPAPVNDFTSNVCGETAGSLHYISGITPERAKQVLNIDK
FT                   GGGNPPLTYFMGVW"
FT   gene            complement(51756..52472)
FT                   /locus_tag="EUBELI_00046"
FT   CDS_pept        complement(51756..52472)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00046"
FT                   /product="Hypothetical protein"
FT                   /note="Psort-B: CytoplasmicMembrane, score:9.99; COG1272
FT                   Predicted membrane protein, hemolysin III homolog;
FT                   HMMPfam:IPR004254; HMMPanther:IPR004254;
FT                   HMMPanther:IPR005744; HMMTigr:IPR005744;
FT                   ScanRegExp:IPR000585"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00046"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71083"
FT                   /db_xref="GOA:C4Z1A9"
FT                   /db_xref="InterPro:IPR004254"
FT                   /db_xref="InterPro:IPR005744"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z1A9"
FT                   /protein_id="ACR71083.1"
FT                   /translation="MTTFAPALHLQNDNIHTKIKAQMIIKDPGSSITHFIGMLCAIAGL
FT                   FPLILKAASYGTTVSIVSMTVFMVSMILLYAASTTYHTFDISSNVNIVLKRLDHCMIPV
FT                   LIAGSYTPVCLIVLHNIYGYVMFGIVWGIAILAITFKLLWVTCPKWISSVLYIVMGWTC
FT                   VMALPQIYSALAGAAFFWLLAGGIFYTIGGVIYAIKMPAFNAKHPNFGTHEIFHVFVMA
FT                   GSLCHFILMYNFVAIM"
FT   gene            52646..53446
FT                   /locus_tag="EUBELI_00047"
FT   CDS_pept        52646..53446
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00047"
FT                   /product="Hypothetical protein"
FT                   /note="Psort-B: Cytoplasmic, score:8.87; COG1179
FT                   Dinucleotide-utilizing enzymes involved in molybdopterin
FT                   and thiamine biosynthesis family 1; HMMPfam:IPR000594;
FT                   superfamily:IPR009036"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00047"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71084"
FT                   /db_xref="GOA:C4Z1B0"
FT                   /db_xref="InterPro:IPR000594"
FT                   /db_xref="InterPro:IPR035985"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z1B0"
FT                   /protein_id="ACR71084.1"
FT                   /translation="MLNQFSRTELLFGKEAMDILENSRVAVFGVGGVGGYTVEALVRSG
FT                   VGAIDVIDDDKVCLTNLNRQIIATRKTIGQYKTDVCKERIHDINPNCEVTVHKCFFLPE
FT                   TKDQFDFSKYDYVVDAVDTVTAKIALVMACQEAGTPIISSMGAGNKLNPAEFEVADIYK
FT                   TSVCPLAKVMRRELKKRNVKHLKVVYSKEKPVRPIEDMGISCRTNCICPPGAAHKCTER
FT                   RDIPGSTAFVPSVVGLIIASEVIKDITHDAMVKTRHENGVDIEG"
FT   gene            53554..54492
FT                   /locus_tag="EUBELI_00048"
FT   CDS_pept        53554..54492
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00048"
FT                   /product="cysteine synthase"
FT                   /note="Psort-B: Cytoplasmic, score:8.87; COG0031 Cysteine
FT                   synthase; HMMPfam:IPR001926; HMMTigr:IPR005856;
FT                   HMMTigr:IPR005859; ScanRegExp:IPR001216; K01738 cysteine
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00048"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71085"
FT                   /db_xref="GOA:C4Z1B1"
FT                   /db_xref="InterPro:IPR001216"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR005856"
FT                   /db_xref="InterPro:IPR005859"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z1B1"
FT                   /protein_id="ACR71085.1"
FT                   /translation="MSKVINSALELIGNTPLLNASRYAKNAGIEGVTLLTKLEYLNPAG
FT                   SVKDRVALAMIEDAEKKGELKPGAMIIEPTSGNTGIGLAAVAVAKGYRAVLTLPDTMSV
FT                   ERRNLLKAYGAEIVLTEGAKGMKGAIAKAEELKEQNPGSVILGQFVNPANPAVHKATTG
FT                   PEIWEQTEGKVDIFVAGVGTGGTVTGVGEYLKSQNPDVKIVAVEPATSPVLSKGEAGPH
FT                   KIQGIGAGFVPDTLNTKIYDEVIAIENEDAFVEGRSFAKSEGILVGISSGAALKAAQIL
FT                   AARPENAGKTIVALLPDSGDRYLSTALFNEQ"
FT   gene            complement(54546..56126)
FT                   /locus_tag="EUBELI_00049"
FT   CDS_pept        complement(54546..56126)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00049"
FT                   /product="glucose-6-phosphate isomerase"
FT                   /note="Psort-B: Cytoplasmic, score:9.65; COG0166
FT                   Glucose-6-phosphate isomerase; HMMPfam:IPR001672;
FT                   FPrintScan:IPR001672; HMMPanther:IPR001672;
FT                   ScanRegExp:IPR001672; K01810 glucose-6-phosphate isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00049"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71086"
FT                   /db_xref="GOA:C4Z1B2"
FT                   /db_xref="InterPro:IPR001672"
FT                   /db_xref="InterPro:IPR018189"
FT                   /db_xref="InterPro:IPR023096"
FT                   /db_xref="InterPro:IPR035476"
FT                   /db_xref="InterPro:IPR035482"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z1B2"
FT                   /protein_id="ACR71086.1"
FT                   /translation="MVSWNNLDTLSSYKELADVKPACLTEVMSGDNGAERVKNYSVPMA
FT                   AGLSYNYASKQVNENVLAALEKLADEAQLADKFKALYNGEVVNTGEKRLVLHHMTRGQL
FT                   GDAVEADGVDKRTFYKTQQERIAEFANKVHNGEITNAAGEKFTTVVQIGIGGSDLGPRA
FT                   MYIALENWAKKNNAFKMEAKFISNVDPDDAAAVLASTDVAHSIFVLVSKSGTTLETLTN
FT                   ESFVKDALKKAGLDPSKHMIAVTSETSPLAKSDDYLDAFFMDDYIGGRFSSTSSVGGAV
FT                   LSLAFGPEVFAEFLDGAAEEDKLSANPDMRKNPEMLDALIGVYERNVLGYPCTAVLPYS
FT                   QALSRFPAHLQQLDMESNGKSVNRFGEPVTYPTGPVIFGEPGTNGQHSFYQLLHQGTDI
FT                   VPLQFIGFKNNQLETDVTIQDSTSQQKLCANVAAQIVAFACGKSDENLNKNFKGGRPSS
FT                   IIIGDKLTPKTLGALLAHFENKIMFQGFVWNINSFDQEGVQLGKVLAKKVLAHDTDGAL
FT                   KVYSDLLNI"
FT   gene            complement(56296..56841)
FT                   /locus_tag="EUBELI_00050"
FT   CDS_pept        complement(56296..56841)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00050"
FT                   /product="ferredoxin hydrogenase"
FT                   /note="Psort-B: Cytoplasmic, score:8.87; COG1592
FT                   Rubrerythrin; HMMPfam:IPR003251; HMMPfam:IPR004039;
FT                   BlastProDom:IPR004039; Gene3D:IPR004039; Gene3D:IPR012347;
FT                   superfamily:IPR009078; K00532 ferredoxin hydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00050"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71087"
FT                   /db_xref="GOA:C4Z1B3"
FT                   /db_xref="InterPro:IPR003251"
FT                   /db_xref="InterPro:IPR009040"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="InterPro:IPR024934"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z1B3"
FT                   /protein_id="ACR71087.1"
FT                   /translation="MKYVCTVCGYVYEGESLPADFVCPVCKAPASKFAAQTGEREWAAE
FT                   HVVGVAKGVSEDIVADLRANFEGECSEVGMYLAMARVAHREGYPEIGLYYEKAAWEEAE
FT                   HASKFAELLGEVVTDSTKKNLEMRVEAENGATAGKTDLAKRAKAANLDAIHDTVHEMAR
FT                   DEARHGKAFEGLLKRYFG"
FT   gene            complement(57013..57414)
FT                   /locus_tag="EUBELI_00051"
FT   CDS_pept        complement(57013..57414)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00051"
FT                   /product="Fur family transcriptional regulator, peroxide
FT                   stress response regulator"
FT                   /note="Psort-B: Cytoplasmic, score:8.87; COG0735 Fe2+/Zn2+
FT                   uptake regulation proteins; HMMPfam:IPR002481;
FT                   BlastProDom:IPR002481; K09825 Fur family transcriptional
FT                   regulator, peroxide stress response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00051"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71088"
FT                   /db_xref="GOA:C4Z1B4"
FT                   /db_xref="InterPro:IPR002481"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z1B4"
FT                   /protein_id="ACR71088.1"
FT                   /translation="MGAVKHSRQRDAIKTFLMSRKDHPTADVVYTFVKNDFPSISLGTV
FT                   YRNLSFLVEHGEAVTVPCEDGFVHYDANTKPHLHFQCRRCKCLIDITNPSDNEILENLG
FT                   ANVSSHFPGKIEAGSVCFYGLCEKCASEN"
FT   gene            complement(57433..58497)
FT                   /locus_tag="EUBELI_00052"
FT   CDS_pept        complement(57433..58497)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00052"
FT                   /product="Hypothetical protein"
FT                   /note="Psort-B: Unknown cell location; COG0707
FT                   UDP-N-acetylglucosamine:LPS N-acetylglucosamine
FT                   transferase; HMMPfam:IPR004276; HMMPfam:IPR007235;
FT                   HMMTigr:IPR006009"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00052"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71089"
FT                   /db_xref="GOA:C4Z1B5"
FT                   /db_xref="InterPro:IPR004276"
FT                   /db_xref="InterPro:IPR006009"
FT                   /db_xref="InterPro:IPR007235"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4Z1B5"
FT                   /protein_id="ACR71089.1"
FT                   /translation="MKKIVLTGGGTAGHVTPNIALLPSLKEAGYEVFYIGSYTGIEKTL
FT                   IEDLGIPYYGISSGKLRRYRSLKNLSDPFRVLHGLFQAKRLMKKIKPDIVFSKGGFVSV
FT                   PVVLAAGSRHIPVIIHESDMTPGLANKIAMRKATKICCNFPETLKYLPEGKAVLTGSPI
FT                   RQELLLGNKAAGLDLCNFTTDKPIILVVGGSTGAVHVNDAVRSILPELLKDFQVVHLCG
FT                   KGKMDDSLNGTPGYVQFEYISEQMRDLFAISSIVISRAGANAICELLALKKPNLLIPLS
FT                   ANASRGDQILNANSFKEHGYSMVLTEEDMNKDTLLAAVRKLYADRHQYIINMEKSEQQD
FT                   SIDKIMNLIKDNSK"
FT   gene            complement(58550..59251)
FT                   /locus_tag="EUBELI_00053"
FT   CDS_pept        complement(58550..59251)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00053"
FT                   /product="Hypothetical protein"
FT                   /note="Psort-B: Cytoplasmic, score:8.87; NOG11206 non
FT                   supervised orthologous group; HMMPfam:IPR007197"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00053"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71090"
FT                   /db_xref="GOA:C4Z1B6"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR023885"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z1B6"
FT                   /protein_id="ACR71090.1"
FT                   /translation="MSVDEFRTVIERIGHYTNYIYLHVKGEPLLHPQLGEILKICQDAD
FT                   MTVNLTTNATLIKEKLPVLLEYPVHQINVSLHSADDNDCIDMDSYIHNLFESCETLLDK
FT                   TETEISLRLWNTKKEPFLFGEKNCTIKRHLYINVQSPFEWPDVNSTYCNERGFCQGLRQ
FT                   HMAILCDGTVVPCCLDGNGVMALGNILDSTLEEILSSPRSVAFMEGFKKKTAVEPLCMH
FT                   CSFKERFAHKM"
FT   gene            complement(59346..59594)
FT                   /locus_tag="EUBELI_00054"
FT   CDS_pept        complement(59346..59594)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00054"
FT                   /product="Hypothetical protein"
FT                   /note="Psort-B: Cytoplasmic, score:8.87; NOG17478 non
FT                   supervised orthologous group"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00054"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71091"
FT                   /db_xref="InterPro:IPR023806"
FT                   /db_xref="InterPro:IPR024434"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z1B7"
FT                   /protein_id="ACR71091.1"
FT                   /translation="MKFKTSGVCSRAIDFDVVDGKVVNVHFTGGCAGNTQGVAALIEGM
FT                   DIDEAIKRMDGIKCGYKDTSCPDQLAKALKEYKKDNE"
FT   gene            59778..60470
FT                   /locus_tag="EUBELI_00055"
FT   CDS_pept        59778..60470
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00055"
FT                   /product="S-adenosylhomocysteine nucleosidase"
FT                   /note="Psort-B: Cytoplasmic, score:8.87; COG0775 Nucleoside
FT                   phosphorylase; HMMPfam:IPR000845; HMMPanther:IPR000845;
FT                   HMMTigr:IPR010049; K01243 S-adenosylhomocysteine
FT                   nucleosidase"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00055"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71092"
FT                   /db_xref="GOA:C4Z1B8"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR010049"
FT                   /db_xref="InterPro:IPR035994"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z1B8"
FT                   /protein_id="ACR71092.1"
FT                   /translation="MIGIIGAMDEEVEQLVEVMEITREETKACMTFKAGKLAGKDVVIV
FT                   RSGIGKVNAAACTQILVDDFKADYIINTGIAGSLKAEIDIADVVISSDVLHHDMDATGF
FT                   GYPLGQIPRMDTLSFAADERLIKLAGEACKNAVPEIGVHVGRVVSGDQFISDKAVKERI
FT                   SSNFDGFCTEMEGAAIAQVSYLNKVPFVILRTISDKADDSATMDYPAFEKLAIANNVKV
FT                   MKELVANI"
FT   gene            60507..60743
FT                   /locus_tag="EUBELI_00056"
FT   CDS_pept        60507..60743
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00056"
FT                   /product="Hypothetical protein"
FT                   /note="Psort-B: Unknown cell location"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00056"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71093"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z1B9"
FT                   /protein_id="ACR71093.1"
FT                   /translation="MYNAVVFNVFWEVCMQTVLIAIRNYADDDSGNVDIHSRLTVKPFK
FT                   KMKGAGRLFLLKNVDRELVKLNKQYREIIKNVR"
FT   gene            60777..61739
FT                   /locus_tag="EUBELI_00057"
FT   CDS_pept        60777..61739
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00057"
FT                   /product="(R)-2-hydroxyacid dehydrogenase"
FT                   /note="Psort-B: Cytoplasmic, score:9.98; COG1052 Lactate
FT                   dehydrogenase and related dehydrogenases;
FT                   HMMPfam:IPR006139; HMMPfam:IPR006140; ScanRegExp:IPR006140;
FT                   K05884 (R)-2-hydroxyacid dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00057"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71094"
FT                   /db_xref="GOA:C4Z1C0"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR029753"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z1C0"
FT                   /protein_id="ACR71094.1"
FT                   /translation="MKILMLETMTYGDDISLEQFNRLGEVVTYSLSSYEEAVARMKEHN
FT                   PDVVIINKTNMNAECMAAAPNLKMVAEAATGYNNIDIEYAKAHGIRVANVAGYSTQSVI
FT                   QHTFALAFYLIEKMRYYDDFVKSGEYAEWPCFSHFANVFHELAGKTWGIVGLGNIGRGV
FT                   AKIAADFGCNVIYYSASGHSYDVPYERYELDEFLKKSDIVSIHAPLNKYTENLFNYETL
FT                   KKMKSSAVILNLGRGPIVNDADLVKALNEGVIAAAGLDVITTEPVVKDNPLLTIKDSNK
FT                   LIVTPHVAWATYEARTRLMDEIYLNIRAYMDGEERNVIV"
FT   gene            complement(61838..62110)
FT                   /locus_tag="EUBELI_00058"
FT   CDS_pept        complement(61838..62110)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00058"
FT                   /product="Hypothetical protein"
FT                   /note="Psort-B: Cytoplasmic, score:8.87"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00058"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71095"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z1C1"
FT                   /protein_id="ACR71095.1"
FT                   /translation="MFRMWCKLFDDRGHLIKDTVIKNADSDLNRTRKIFAAIHDACYEF
FT                   DLAEPIWLDSNVSEFQRHSKVRFTKDNFVEDIEFAYMEIEVIEED"
FT   gene            complement(62112..62558)
FT                   /locus_tag="EUBELI_00059"
FT   CDS_pept        complement(62112..62558)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00059"
FT                   /product="D-tyrosyl-tRNA(Tyr) deacylase"
FT                   /note="Psort-B: Cytoplasmic, score:8.87; COG1490
FT                   D-Tyr-tRNAtyr deacylase; HMMPfam:IPR003732;
FT                   BlastProDom:IPR003732; Gene3D:IPR003732;
FT                   HMMPanther:IPR003732; HMMTigr:IPR003732;
FT                   superfamily:IPR003732; K07560 D-tyrosyl-tRNA(Tyr)
FT                   deacylase"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00059"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71096"
FT                   /db_xref="GOA:C4Z1C2"
FT                   /db_xref="InterPro:IPR003732"
FT                   /db_xref="InterPro:IPR023509"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4Z1C2"
FT                   /protein_id="ACR71096.1"
FT                   /translation="MRFVIQRVNHANVKIDGEVVGNIGHGLLILFGAGQDDTEEMLPKY
FT                   VDKICKMRIFEDENGKTNLSLADVGGELLIVSQFTLYADCRKGNRPSFTNAGAPDMANA
FT                   LYEKFVAMCRERVPKVETGRFGADMKVSLENDGPFTILIDSEDF"
FT   gene            62956..64191
FT                   /locus_tag="EUBELI_00060"
FT   CDS_pept        62956..64191
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00060"
FT                   /product="6-phosphofructokinase"
FT                   /note="Psort-B: Unknown cell location; COG0205
FT                   6-phosphofructokinase; HMMPfam:IPR000023;
FT                   BlastProDom:IPR015913; FPrintScan:IPR000023;
FT                   HMMPIR:IPR011404; HMMPanther:IPR000023; K00850
FT                   6-phosphofructokinase"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00060"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71097"
FT                   /db_xref="GOA:C4Z1C3"
FT                   /db_xref="InterPro:IPR000023"
FT                   /db_xref="InterPro:IPR011404"
FT                   /db_xref="InterPro:IPR022953"
FT                   /db_xref="InterPro:IPR035966"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z1C3"
FT                   /protein_id="ACR71097.1"
FT                   /translation="MSMLKNILVGQSGGPTSVINSSLYGVIEEGLRNKEKIGTVYGMVH
FT                   GIEGFLAGNFINLSEVADNEPIDRLKITPASFLGSCRYMLPEDLGDNVYDKLFDTFAQM
FT                   NIGYVFYIGGNDSMDTVSKLSRVALLKKSDIRFIGVPKTIDNDLVMTDHTPGYGSTAKY
FT                   VASTLKEIILDATCYAHPSVTIVELMGRHAGWVTAASVLARTEYSRNPYLIYMPEHAFD
FT                   MEEFKKSLKAALEQETAVVVCVSEGIADKDGRFICEYADAASVDGFGHKMLTGCGKYLE
FT                   NYVKAEFGIKCRSIELNLPQRCSSLLASATDIDEAEKAGKAAVVAALDGETGKMITFVR
FT                   DDTNGYEINYGLADVNDICNKEKKFPAEWITADGTDISDEYIKYVRPLIQGTNIAEYSD
FT                   GVPVHLKPAYYR"
FT   gene            64332..64787
FT                   /locus_tag="EUBELI_00061"
FT   CDS_pept        64332..64787
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00061"
FT                   /product="Hypothetical protein"
FT                   /note="Psort-B: Cytoplasmic, score:8.87; COG1846
FT                   Transcriptional regulators; HMMPfam:IPR000835;
FT                   FPrintScan:IPR000835; Gene3D:IPR011991; HMMSmart:IPR000835"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00061"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71098"
FT                   /db_xref="GOA:C4Z1C4"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z1C4"
FT                   /protein_id="ACR71098.1"
FT                   /translation="MQRESLHCGELIKRLNDILGRCSNEELRADDMTSSQVKMLMMINE
FT                   TKDECITLKELEKHFGVAQATIAGTAARLEKKGMIESFYDPSDKRVKHVRITDKGRTMC
FT                   VHAGKAMHDKEKWFLSSLSADEKEELHRLLQKVYDDVNNCERKCKKC"
FT   gene            64781..66526
FT                   /locus_tag="EUBELI_00062"
FT   CDS_pept        64781..66526
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00062"
FT                   /product="ATP-binding cassette, subfamily B, bacterial"
FT                   /note="Psort-B: CytoplasmicMembrane, score:10.00; COG1132
FT                   ABC-type multidrug transport system, ATPase and permease
FT                   components; HMMPfam:IPR001140; HMMPfam:IPR003439;
FT                   BlastProDom:IPR003439; HMMSmart:IPR003593;
FT                   ScanRegExp:IPR003439; K06147 ATP-binding cassette,
FT                   subfamily B, bacterial"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00062"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71099"
FT                   /db_xref="GOA:C4Z1C5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z1C5"
FT                   /protein_id="ACR71099.1"
FT                   /translation="MLKTLSAYIGEYKKVSIKTPIYIIVEVLMEILIPFVTASIIDKGI
FT                   QAGDMSKVLMYGGLMLVLAFISLFAGIQAGKYSALASTGFACNLREGIYSNIQNFAFSN
FT                   IDKYSTAGLITRMTTDVTNVQNAYQMILRIAVRAPLMMICSMVMCFIINPTLSFIFLGA
FT                   LILLGFVLFFIIYKVTPIFTEGFAKYDDLNASVQENVTGIRVVKAFVREDHENKKFSKA
FT                   AGNLYKIFVKAESWLAFNNPIMMFVIYGSIIALSWFAAHFITDGTMTTGNLTSMFCYVM
FT                   SMMMSLMMLSMIFVMVSMSVASARRIAEVLNEKADITNPENPVMEVPDGRIDFNHVNFT
FT                   YKKDSDKDALEDIDIHINAGETIGIIGGTGCGKSSFVNLISRLYDVKDGSVCVGGIDVR
FT                   DYDLETLRNEVSVVLQKNVLFSGTILDNLRWGDENASEEDCIEACRQACADEFIERMPD
FT                   KYNTWIEQGGSNVSGGQRQRLCIARALLKHPKVLILDDSTSAVDTATDAKIKKAFATKI
FT                   PGTTKIIVSQRISSIQDADRILVLENGCVSGFDTHENLVENNKVYREIYEVQTQGGGDF
FT                   DEAGE"
FT   gene            66537..68435
FT                   /locus_tag="EUBELI_00063"
FT   CDS_pept        66537..68435
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00063"
FT                   /product="ATP-binding cassette, subfamily B, bacterial"
FT                   /note="Psort-B: CytoplasmicMembrane, score:9.99; COG1132
FT                   ABC-type multidrug transport system, ATPase and permease
FT                   components; HMMPfam:IPR001140; HMMPfam:IPR003439;
FT                   BlastProDom:IPR003439; HMMSmart:IPR003593;
FT                   ScanRegExp:IPR003439; K06147 ATP-binding cassette,
FT                   subfamily B, bacterial"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00063"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71100"
FT                   /db_xref="GOA:C4Z1C6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z1C6"
FT                   /protein_id="ACR71100.1"
FT                   /translation="MDKNIDMKNKKNKENPLHLMKRLLGYILKNYKFSCIAVLVCILVS
FT                   ALTTLIATLFIQKLIDSYIIPLTQSAVHDYAPLAGALIKLAAVLMVGVLCSYCYNRIMV
FT                   NVGQGTLKKLRLELFTNMESLPIKYFDTHAHGDIMSVYTNDIDTLRQLISQSIPQVINS
FT                   CITLVSTFVSMIVLDIPLTIVSVVMVVIMLYVTSKLSALSGKYFVEQQKDIGKVNAYIE
FT                   EMMEGQKVVKVFCHEDKSIEQFKEINNRLRESANNANKVANITMPVNGNIGNISYVLCA
FT                   IVGGILALSDFSGLTIGTLVAFLSLNKSFTQPVTQISQQVSSIVMAMAGAGRVFELCDE
FT                   KPEVDEGFVELVNVRYNKNNELIETKENTEMWAWKKPAKDGSSAEYTRLAGDVTFDGVD
FT                   FGYNPDKMVLHDIKMYATPGQKIAFVGSTGAGKTTITNLINRFYDIQDGKIRYDGININ
FT                   NIKKNDLRRSLGIVLQDTNLFTGTIMDNIRYGRLEASDEECIAAARLANADGFIKRLPD
FT                   GYNTVLYGGGANLSQGQRQLLAIARAAVADPPVLILDEATSSIDTRTERLVQKGMDALM
FT                   SGRTSFVIAHRLSTVRNADCIMVMEQGRIIERGTHDQLMEEKGRYYQLYTGKSISA"
FT   gene            complement(68499..69722)
FT                   /locus_tag="EUBELI_00064"
FT   CDS_pept        complement(68499..69722)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00064"
FT                   /product="6-phosphofructokinase"
FT                   /note="Psort-B: Cytoplasmic, score:8.87; COG0205
FT                   6-phosphofructokinase; HMMPfam:IPR000023;
FT                   BlastProDom:IPR015913; FPrintScan:IPR000023;
FT                   HMMPIR:IPR011404; HMMPanther:IPR000023; K00850
FT                   6-phosphofructokinase"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00064"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71101"
FT                   /db_xref="GOA:C4Z1C7"
FT                   /db_xref="InterPro:IPR000023"
FT                   /db_xref="InterPro:IPR011404"
FT                   /db_xref="InterPro:IPR022953"
FT                   /db_xref="InterPro:IPR035966"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z1C7"
FT                   /protein_id="ACR71101.1"
FT                   /translation="MDGNVIVGQSGGPTSVINSSLAGVYKTAIDRGAKKVYGMLHGIKG
FT                   LLDGQYVDLSEKINSTMDIDLLKRTPSSYLGSCRYKLPEISEDRETFDKIFKILDDLDI
FT                   KYFFYIGGNDSMDTIKKLSDYAIVTGSDIKFMGVPKTIDNDLAVTDHTPGFGSAAKFIA
FT                   ATMKEIIRDGLVYDYPTVTIVEIMGRNAGWLTAAAALAKSDDCEGVDLIYLPEKVFDID
FT                   HFMARVKEIAAKGRSMVIAVSEGIKVADGRYVFELSEHVEFVDAFGHKQLAGSAKFLAN
FT                   KIGAELGIKTRAIELSTLQRCAAHMTSRTDITEAYNVGGAAVKAAFEGETGKVVVLKRV
FT                   SDDPYMCITETNDVHQIANIEKKVPLEWITDDDFVTDDLIHYIRPLIQAELSPIMVDGL
FT                   PRHLNINA"
FT   gene            69894..70589
FT                   /locus_tag="EUBELI_00065"
FT   CDS_pept        69894..70589
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00065"
FT                   /product="Hypothetical protein"
FT                   /note="Psort-B: Cytoplasmic, score:8.87; COG1418 Predicted
FT                   HD superfamily hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00065"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71102"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z1C8"
FT                   /protein_id="ACR71102.1"
FT                   /translation="MYKIMRLCLWAGMEINMSVKINSYKGRSIRQVYKERIKKDEYSNA
FT                   IDRICNRYKLGHIKQNESGREYKNRMNKLFSDDVIQSMKKYSHHGRTSLFGHSVHVSYY
FT                   NYLVCKKLHLDEKAGAKAGLLHDLFLYDWHKYSPGKGERLHGFEHPTKALKNAGKYFDI
FT                   TEKEGDMIAKHMFPLTVTPPKYKETFVIVLVDKFCSFNEVLDDFIHRKFCGAKDTRIKW
FT                   FGAGKGEKR"
FT   gene            70586..71278
FT                   /locus_tag="EUBELI_00066"
FT   CDS_pept        70586..71278
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00066"
FT                   /product="Hypothetical protein"
FT                   /note="Psort-B: Cytoplasmic, score:8.87; COG1051 ADP-ribose
FT                   pyrophosphatase; HMMPfam:IPR000086; FPrintScan:IPR000086;
FT                   Gene3D:IPR000086; ScanRegExp:IPR000086;
FT                   superfamily:IPR015797"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00066"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71103"
FT                   /db_xref="GOA:C4Z1C9"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z1C9"
FT                   /protein_id="ACR71103.1"
FT                   /translation="MKYLSEEQNKCFVGTGELNKAGDSLAVFLDKYDPDKYQNPCNTVD
FT                   TLVFTKEDSQVKRILLIKRGNHPCIGLWACPGGFVEFKENLYDAALRELQEETGLHDIE
FT                   AEQLKSYGDYDRDPRTRIITTAFVALIDEGSQKAQAGDDAREAGWFDISDELVNKTEDK
FT                   SLIKEEWLCRLSNADKNINICARVEVTYRKGILKNRTYKVVDGDGLAADHAAIILEGYH
FT                   HVKEAFNA"
FT   gene            71275..71898
FT                   /locus_tag="EUBELI_00067"
FT   CDS_pept        71275..71898
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00067"
FT                   /product="Hypothetical protein"
FT                   /note="Psort-B: Cytoplasmic, score:8.87; COG1853 Conserved
FT                   protein/domain typically associated with flavoprotein
FT                   oxygenases, DIM6/NTAB family; HMMPfam:IPR002563;
FT                   Gene3D:IPR012349; superfamily:IPR009002"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00067"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71104"
FT                   /db_xref="GOA:C4Z1D0"
FT                   /db_xref="InterPro:IPR002563"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z1D0"
FT                   /protein_id="ACR71104.1"
FT                   /translation="MSEKIKKNEKAKKQTWRAGNMLYPVPAVMVSCARKGEKPNIITVA
FT                   WAGTVCSDPAMVSISVRKERYSHDIIKETGEFVINLTTRKLARATDYCGVKSGRDVDKF
FT                   ADMHLTAAPSVKIEAPAIAESPVNIECKVKQVLELGSHDMFIAEVMAVNVDESLLDEKG
FT                   TLHLSDADLIAYSHGRYYGLGDFIGKFGYSVQKPSKPKSSRKKK"
FT   gene            72032..73534
FT                   /locus_tag="EUBELI_00068"
FT   CDS_pept        72032..73534
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00068"
FT                   /product="Hypothetical protein"
FT                   /note="Psort-B: Extracellular, score:9.55; COG0739 Membrane
FT                   proteins related to metalloendopeptidases;
FT                   HMMPfam:IPR002482; HMMPfam:IPR002886; HMMPfam:IPR011098;
FT                   HMMPanther:IPR002886; HMMSmart:IPR002482;
FT                   superfamily:IPR011055"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00068"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71105"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR011098"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z1D1"
FT                   /protein_id="ACR71105.1"
FT                   /translation="MKLTMINTMTVASLVCIIAIPFLTKNLLKTEADYYSITINGMKVG
FT                   AANTEEEVIIALASARQELSAQYSDVVYMDPDIEINKESRNVAQRMSVNQLSGAIYSYM
FT                   FDNVMDVDFHMYYTVRLGDFVVTLESKEDVIKLFEKLIQKYDPNNAFTVSLDTLDAATG
FT                   TYTVSVNEKAKESTAAEIVSSAISGTAVSQDGQTVADGDGLTGIGFSNDVVVVEVPADN
FT                   AVTTSVTDAYENITKEHAEKTVYTVQAGDVLSVIAQNNGLTISELLSLNSNLTENSVIA
FT                   PGDSIIITVPKSEISVITTYQMSYEEDYEAEPNYEDDNTNYRGTNTVISEGTVGHRAVI
FT                   AEVTYTNGNETGRTYVKEDIIKESVPKTIAVGTLTPPTYLKPVAGGSFSSGYGYRWGSL
FT                   HKGVDWSVTQGTTVTAAAAGTVTRAGWFADYGYCVDITHSNGTMTRYGHLSSINVSVGQ
FT                   SVSQGQAIAASGNTGYSTGPHLHFEIWVGGSPVNPLNYVNKY"
FT   gene            73740..75035
FT                   /locus_tag="EUBELI_00069"
FT   CDS_pept        73740..75035
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00069"
FT                   /product="UDP-N-acetylglucosamine
FT                   1-carboxyvinyltransferase"
FT                   /note="Psort-B: Cytoplasmic, score:8.87; COG0766
FT                   UDP-N-acetylglucosamine enolpyruvyl transferase;
FT                   HMMPfam:IPR001986; BlastProDom:IPR001986; Gene3D:IPR001986;
FT                   HMMPanther:IPR005750; HMMTigr:IPR005750;
FT                   superfamily:IPR013792; K00790 UDP-N-acetylglucosamine
FT                   1-carboxyvinyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00069"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71106"
FT                   /db_xref="GOA:C4Z1D2"
FT                   /db_xref="InterPro:IPR001986"
FT                   /db_xref="InterPro:IPR005750"
FT                   /db_xref="InterPro:IPR013792"
FT                   /db_xref="InterPro:IPR036968"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z1D2"
FT                   /protein_id="ACR71106.1"
FT                   /translation="MEQYVVKGGVPLRGKVSIGGAKNAALGILAAAIMTDDTVTIENVP
FT                   NVRDTRVLLQAIEGIGAKVKYVYNNSVQINGGSICDTNVEYDYIRKIRASYYLLGALLG
FT                   KYNEAHVALPGGCNIGSRPIDQHIKGFKALGADVDIDCGVVHAKAEKLTGAHVYFDVVT
FT                   VGATINLMMASCMAEGDTILENAAKEPHIVDVANFLNSMGANIKGAGTDVIRIKGVKRL
FT                   HGCTYSIIPDQIEAGTFMMAAAATHGDVVIQDIIPKHMESISAKLIEMGCRIEEGDDSL
FT                   RVIAEGCTLRSTNVKTLPYPGFPTDMQPQISVVLALAEGSSMVTESIFENRFKYVDELG
FT                   RMGAKIKVEGNTAYIEGVKSFCGVQLNAPDLRAGAALVIAALAADGISEIDDIEYIQRG
FT                   YEDFEGKITNLGGIIKRVDSERELQKFRLKIG"
FT   gene            75157..76665
FT                   /locus_tag="EUBELI_00070"
FT   CDS_pept        75157..76665
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00070"
FT                   /product="Hypothetical protein"
FT                   /note="Psort-B: CytoplasmicMembrane, score:9.49; COG0642
FT                   Signal transduction histidine kinase; HMMPfam:IPR003594;
FT                   HMMPfam:IPR003660; HMMPfam:IPR003661; FPrintScan:IPR004358;
FT                   Gene3D:IPR003594; HMMSmart:IPR003594; HMMSmart:IPR003660;
FT                   HMMSmart:IPR003661; superfamily:IPR003594;
FT                   superfamily:IPR009082"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00070"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71107"
FT                   /db_xref="GOA:C4Z1D3"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z1D3"
FT                   /protein_id="ACR71107.1"
FT                   /translation="MKLKNKLYISFCIMVILPVLLSGLALGGLYCVQKESIERTYNVDD
FT                   GAILVGVYSPIILFGKITDSIYKDMKTEVDTSPEQFTNKEYLDELSGELSSKMSCLVVR
FT                   RNGIIIYNSTEAPDSEIVKILPDYSADEENVSDVGTYKGGEYQSLIKQLNFKDSEDNFY
FT                   SVSIVTSLKQILPQVKTFIMQVIFVIIMVLIITSLGLTLWIYSSIVKPLNKLKLATDNI
FT                   KEGNMDFEMPKVSNNEIGDVCRDFEEMRVVLKQSAEDKIKSDAEEKELIRNISHDLKTP
FT                   LTAIKGYVEGLRDGIANTPEKQAKYIQTIANKVNDMDKLIDELTIYSRLDTNRVPYTFV
FT                   RCNVSDYFGDCCEEIGTELEASQIELEYNDHLTEPAYMNVDPEQLKRVVNNIISNSVKY
FT                   MAEGRQGKIKIDLYDEGDYIHAIFSDNGIGIAAKDVERIFERFYRTDESRNSKHGGSGI
FT                   GLAIVKKIVEDHKGKIWAESVEGEGTTMHLNLLKAKDEENPENA"
FT   gene            76665..77381
FT                   /locus_tag="EUBELI_00071"
FT   CDS_pept        76665..77381
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00071"
FT                   /product="two-component system, OmpR family, phosphate
FT                   regulon response regulator OmpR"
FT                   /note="Psort-B: Cytoplasmic, score:9.98; COG0745 Response
FT                   regulators consisting of a CheY-like receiver domain and a
FT                   winged-helix DNA-binding domain; HMMPfam:IPR001789;
FT                   HMMPfam:IPR001867; BlastProDom:IPR001789;
FT                   BlastProDom:IPR001867; HMMSmart:IPR001789;
FT                   superfamily:IPR011006; K07659 two-component system, OmpR
FT                   family, phosphate regulon response regulator OmpR"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00071"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71108"
FT                   /db_xref="GOA:C4Z1D4"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z1D4"
FT                   /protein_id="ACR71108.1"
FT                   /translation="MKLHERGLAMSKILIVEDEESIADIEKDYLELNGYEVEVCNDGTS
FT                   GLAAALHEDIDMCILDIMLPGTDGFEICKQVREVKDIPIIMVSAKKEDIDKIRGLGVGA
FT                   DDYMTKPFSPSELVARVKAHLARYDRLVSNSKNNNNIIEIRGIKIDKTARRVFVNGEEK
FT                   PFTTKEFDLLTFLAENPNHVFTKEELFKEIWDMDSIGDIATVTVHIKKIREKIELDTSK
FT                   PQYIETIWGVGYRFKM"
FT   gene            complement(77510..78187)
FT                   /locus_tag="EUBELI_00072"
FT   CDS_pept        complement(77510..78187)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00072"
FT                   /product="ribosomal large subunit pseudouridine synthase D"
FT                   /note="Psort-B: Unknown cell location; COG0564
FT                   Pseudouridylate synthases, 23S RNA-specific;
FT                   HMMPfam:IPR006145; BlastProDom:IPR006145;
FT                   ScanRegExp:IPR006224; K06180 ribosomal large subunit
FT                   pseudouridine synthase D"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00072"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71109"
FT                   /db_xref="GOA:C4Z1D5"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR006224"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z1D5"
FT                   /protein_id="ACR71109.1"
FT                   /translation="MLNIIHETKDIIIVNKPAGQLSQGAKGFDLDLVSEVMTYNASQGK
FT                   PAYAAIINRLDRPVSGLVLIAKNKSAAAKYSTLMQKEGGFNKQYEALICGKLSESKGTF
FT                   VDYLKKDGRTNTSAIVPADAAANDKEAKLSKLEYEVISYDEVKDITHVRIHLITGRHHQ
FT                   IRVQFASRRHPLVGDYKYATADCGMDNAVKAVAFKRNQIALCAVSLTIENETFRVTPEF
FT                   SIG"
FT   gene            78320..79390
FT                   /locus_tag="EUBELI_00073"
FT   CDS_pept        78320..79390
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00073"
FT                   /product="Hypothetical protein"
FT                   /note="Psort-B: CytoplasmicMembrane, score:9.99; COG0628
FT                   Predicted permease; HMMPfam:IPR002549;
FT                   HMMPanther:IPR002549"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00073"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71110"
FT                   /db_xref="GOA:C4Z1D6"
FT                   /db_xref="InterPro:IPR002549"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z1D6"
FT                   /protein_id="ACR71110.1"
FT                   /translation="MGENVWDFRKRLTLLFGSAVIIAVVFFIFKVLFYYVWPFMLAFCF
FT                   AVLLQKPIVGLAKLLREKKTLAASIVVTMVTLIILSVLLYVGYMAFRELKDFIANFDEN
FT                   INSLDGQFKLVCCRIDGWIKLKEGCSYAFFEKCKGIIIDGDGQQMFFTIMRKHSVPVIT
FT                   WCVMAVAGLVVCFIGTIYAAAGIEKYRSWRENTIFKGEVGAVHVGLRNLINVYFRVQLI
FT                   IMSINIVVCSTAFLMIGNPYAILLGVLTGIIDALPIFGTGTVLIPWAVGSLLFGHVKNA
FT                   VILVVLYIVTYFVREIMESKCMGDRMGIAPFTMLAVIYIGILVYGVVGFILGPISYCII
FT                   KALVLYLKSILEHDKL"
FT   gene            79484..80923
FT                   /locus_tag="EUBELI_00074"
FT   CDS_pept        79484..80923
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00074"
FT                   /product="prolyl-tRNA synthetase"
FT                   /note="Psort-B: Cytoplasmic, score:10.00; COG0442
FT                   Prolyl-tRNA synthetase; HMMPfam:IPR002314;
FT                   HMMPfam:IPR004154; HMMPfam:IPR015263; FPrintScan:IPR002316;
FT                   Gene3D:IPR004154; HMMPanther:IPR004499; HMMTigr:IPR004499;
FT                   superfamily:IPR004154; K01881 prolyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00074"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71111"
FT                   /db_xref="GOA:C4Z1D7"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002316"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR004499"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR016061"
FT                   /db_xref="InterPro:IPR017449"
FT                   /db_xref="InterPro:IPR033721"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4Z1D7"
FT                   /protein_id="ACR71111.1"
FT                   /translation="MAEDKKLVEAITSMKEDFAQWYTDVCKKAELMSYSSVKGCMIFKP
FT                   AGYAIWENIKNEMDRRFKETGVENVYLPMFIPESLLEVEKDHVEGFAPEVAWVTYGGLN
FT                   PLQERMCVRPTSETLFCDFYKDEIQSYRDLPKVYNQWCSVVRWEKETRPFLRSREFLWQ
FT                   EGHTAHATAEEAEARTQQMLNLYADFCEEVLAIPVIKGRKTDKEKFAGAEATYTIEALM
FT                   HDGKALQSGTSHNFGDGFAKAFGIQYTDKDNKLKYVHQTSWGTTTRLIGAVIMTHGDDS
FT                   GLVLPPKVAPVQVDVIPIMQKKAGVLDKAYEVGQALKAAGLRVKVDDSDKNPGWKFSEQ
FT                   EMRGIPVRVEMGPRDIEANQAVIVRRDTREKITVSIDELADRIPEILDTIQKDMLERAR
FT                   AHREAHTYTALNYDEFKDTAANKAGFIKAMWCGDQACEDKIKEDTTCTSRCMPFAQEKL
FT                   SDVCVCCGKPAKAMVYWGKAY"
FT   gene            complement(81001..82254)
FT                   /locus_tag="EUBELI_00075"
FT   CDS_pept        complement(81001..82254)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00075"
FT                   /product="tRNA nucleotidyltransferase (CCA-adding enzyme)"
FT                   /note="Psort-B: Cytoplasmic, score:8.87; COG0617 tRNA
FT                   nucleotidyltransferase/poly(A) polymerase;
FT                   HMMPfam:IPR002646; K00974 tRNA nucleotidyltransferase
FT                   (CCA-adding enzyme)"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00075"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71112"
FT                   /db_xref="GOA:C4Z1D8"
FT                   /db_xref="InterPro:IPR002646"
FT                   /db_xref="InterPro:IPR032810"
FT                   /db_xref="InterPro:IPR032828"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z1D8"
FT                   /protein_id="ACR71112.1"
FT                   /translation="MPENFHIDMPEAVRNIIHTIEEHGFKAYAVGGCIRDSILGRNPDD
FT                   WDITTSAVPSQIKTFFKRTVDTGIAHGTVTIMIDKTGYEVTTYRIDGEYEDGRHPKSVE
FT                   FSDRLVDDLCRRDFTINAMAYNDTDGFVDEFNGLDDLDAKIIRCVGEPELRFTEDALRM
FT                   MRAIRFSAQLGFTIDEATWNAIKKLAPSISKISMERVHVELGKTLMSAHPDYVAQYSEA
FT                   GLFEPILPVIDNSLKSRYKRKILATLQHTPDNIYLRYAALFIASTPDEAAKTLRALKLD
FT                   NKTVDTVSKLVKLSKIDIEETEPAVRTALNQYGRDFLPLWHELMMAVIQASEDITGISN
FT                   PAKVKHLLTLKRLGTDILARGDCFTIKALDISGNDLIEYGLQGHEIGETLKSLLDIVIE
FT                   NPKLNDKATLIAMIEHIK"
FT   gene            82276..82395
FT                   /locus_tag="EUBELI_00076"
FT   CDS_pept        82276..82395
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00076"
FT                   /product="Hypothetical protein"
FT                   /note="Psort-B: Unknown cell location"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00076"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71113"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z1D9"
FT                   /protein_id="ACR71113.1"
FT                   /translation="MIYMWIQIPYLSIIREKCIFIKIMIVVNRRNIEAFNFIR"
FT   gene            82456..83577
FT                   /locus_tag="EUBELI_00077"
FT   CDS_pept        82456..83577
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00077"
FT                   /product="spore coat protein I"
FT                   /note="Psort-B: Cytoplasmic, score:8.87; NOG09979 non
FT                   supervised orthologous group; superfamily:IPR011009; K06331
FT                   spore coat protein I"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00077"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71114"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z1E0"
FT                   /protein_id="ACR71114.1"
FT                   /translation="MNEKSLECLKFYDMQIKKMVKGRGGVILFTDRGCRLFLECTRNDG
FT                   FYYRDDAVTNAVREAGFNRVDTYVRNDDGELFTSGEDGRRYVMKKWFSGRECDVKSAND
FT                   VTEAVRTLARLHICLNVVSAKGVKYVCDNGSQNINKQWECMALSELEGEKPEAELKASE
FT                   SCVQNVVRFDKGSGIRQNVDRHTREIKKAANYMRGKKKKNEFEQIALGAIDQFYDEASE
FT                   AGACIKSQRFDARFERMEQTNELVHGSYNYHNVFLDADGSENAVTNFEKCHNDCQVADL
FT                   YQFLRKVMEKHDWDINIAYRLVDEYDKLKPLDDDDLDMLAAMLSFPEKFWKIINQYYNA
FT                   GKAWVPAKNIEKLKTVIAQNMRRRELIDKMCGL"
FT   gene            83618..85012
FT                   /locus_tag="EUBELI_00078"
FT   CDS_pept        83618..85012
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00078"
FT                   /product="Hypothetical protein"
FT                   /note="Psort-B: Unknown cell location; COG3210 Large
FT                   exoproteins involved in heme utilization or adhesion"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00078"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71115"
FT                   /db_xref="InterPro:IPR013229"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z1E1"
FT                   /protein_id="ACR71115.1"
FT                   /translation="MLMKRMYNWIHILRQAAVIGMMLVLFLSQTACTASGSKKGNAMVP
FT                   GSSITPAPTVNKDIKGDGENPTFTGVLSLQDFSGFKMRFVDINSGTEYEVPYSGGTDIQ
FT                   DAYGKVKAASTMDVGGIYDVYVDKKGKAAKIYGSSNSWVRYDVSGITVDESSRKISIGA
FT                   SNMVYESYTVVLSGDERISIAQLVDQDKMVIRGIGDKVYSVEVTDGHGYLKVTGTDALN
FT                   GGYISIGNRQLLGITRDMLVTAPVGTFTVNVRNGSLSASKTVTISKDATTTVDFSEVQT
FT                   DPVKTGAVNFSVTPSGAVMSIDGTEVDYSSPVSLTYGTHRIKLVANNYQEYSEIINVNS
FT                   AYVTKVIDMTSSGTSTSTAADNTSGYKVSITAPKGAVLYVNSEYIGTVPCSFDKSSGKK
FT                   TITLSQNGYNTVSYTISIANTAGDLTYAFPEMISGGTQETTTQVQVPTVTPATTKSSTK
FT                   QSTKRR"
FT   gene            85018..86208
FT                   /locus_tag="EUBELI_00079"
FT   CDS_pept        85018..86208
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00079"
FT                   /product="Hypothetical protein"
FT                   /note="Psort-B: Cytoplasmic, score:8.87; COG0399 Predicted
FT                   pyridoxal phosphate-dependent enzyme apparently involved in
FT                   regulation of cell wall biogenesis; HMMPfam:IPR000653;
FT                   Gene3D:IPR015421; Gene3D:IPR015422; HMMPIR:IPR000653;
FT                   superfamily:IPR015424"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00079"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71116"
FT                   /db_xref="GOA:C4Z1E2"
FT                   /db_xref="InterPro:IPR000653"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z1E2"
FT                   /protein_id="ACR71116.1"
FT                   /translation="MNILFSPPDITEEEIQAVSEALRSGWITTGPRTKEFERNIAQFTG
FT                   CNRAACLNSATACLETALRLLGIGEGDEVIVPAYTYTASASVVAHVNAKLVLIDVEKDT
FT                   YHLDYDALEAAINESTKAVIPVDIGGVMVDYDRIRKIVESKKNIFKASTPLQEALGRVA
FT                   IVADSAHGFGASEGGVMSGMKADFTSFSFHAVKNLTTAEGGALTWRSIPGVDDEDIYKQ
FT                   IMLYSLHGQSKDALAKTKLGAWEYDIKGTYYKCNMTDIMASIGLVQLKRYPGLLKRRRD
FT                   IIERYTQGIAADDVDIMKHFTDEYTSSGHLYLVRLLGKDVKERNELITRLAEAGVATNV
FT                   HYKPLPMHTAYKNMGFDIKDFPHSYNMYRNEITLPLHTCLTDEQVEYVIEQFNRMK"
FT   gene            86251..86970
FT                   /locus_tag="EUBELI_00080"
FT   CDS_pept        86251..86970
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00080"
FT                   /product="Hypothetical protein"
FT                   /note="Psort-B: CytoplasmicMembrane, score:9.82; COG2148
FT                   Sugar transferases involved in lipopolysaccharide
FT                   synthesis; HMMPfam:IPR003362"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00080"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71117"
FT                   /db_xref="GOA:C4Z1E3"
FT                   /db_xref="InterPro:IPR003362"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z1E3"
FT                   /protein_id="ACR71117.1"
FT                   /translation="MELRPWQLLPDEMRTKEVRKYYNILMKHRMWLEMKRVLDVIVAGI
FT                   MLAVLIIPMGIIALAIRLDSPGPVFFRQARVTQYGRIFRIYKFRTMVDNASKLGAAVTV
FT                   DNDSRITKVGAFLRKYRMDEFPQLFNILAGDMTLVGTRPEVPKYVKKYTKEMYATLLLP
FT                   AGLTSRTSIAYKDEDKLLGEAVDEKSTDNIYLNEVLPAKMRYNLESMKHFGVKADAAVL
FT                   WDTFTSVVGSERMTVKK"
FT   gene            86978..88033
FT                   /locus_tag="EUBELI_00081"
FT   CDS_pept        86978..88033
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00081"
FT                   /product="Hypothetical protein"
FT                   /note="Psort-B: CytoplasmicMembrane, score:7.63; COG0463
FT                   Glycosyltransferases involved in cell wall biogenesis;
FT                   HMMPfam:IPR001173"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00081"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71118"
FT                   /db_xref="GOA:C4Z1E4"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z1E4"
FT                   /protein_id="ACR71118.1"
FT                   /translation="MFITIAVIAYNEESTIKNILDDISRQDYDHSLMEVVLVDSASTDG
FT                   TKAVMQKFADENKMGARQIIVLDNPKKTLPCGWNVLLDNYAGEAVIRVDAHAHIPVDFV
FT                   SKNVKVLEEGEMVVGGVRPNIVDEETPWKDTLLLAESSMFGSSIAPYRNGGNGTEEKIY
FT                   MKSLFHAAYRREVFEKIGHYNEALARTEDNEIHYRMRKAGFKLRFCPDIISYQHTRSSL
FT                   PKMLKQKYANGYWIGKTSKVCPGCLSIYHFVPWAFVMAIIVTTVASVSCKLLAVKSIFS
FT                   RIVYGLTGLMWGAYWLLAVVMSIVAVIGAKKERNKTCFALPFLFFLLHISYGIGTVCGL
FT                   AAKKPAKETRN"
FT   gene            88033..89898
FT                   /locus_tag="EUBELI_00082"
FT   CDS_pept        88033..89898
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00082"
FT                   /product="Hypothetical protein"
FT                   /note="Psort-B: Cytoplasmic, score:8.87; COG1086 Predicted
FT                   nucleoside-diphosphate sugar epimerases; HMMPfam:IPR003869;
FT                   HMMPanther:IPR003869; K00100 K01726"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00082"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71119"
FT                   /db_xref="GOA:C4Z1E5"
FT                   /db_xref="InterPro:IPR003869"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z1E5"
FT                   /protein_id="ACR71119.1"
FT                   /translation="MMGETKKDRIQLLVRRFFLFLTDTFLLNACVYLSLIMRFDVGIVS
FT                   IEPQYINNYVDNMLFYTIISLLIFWVFRLYHSLWQYASIAEVYRIAEACITVEVVHFLS
FT                   NKMVGNMLPRSCYFNAAIYLIIAICASRFMYRMIRTVLNKYRNIKTSNNVMIIGAGEAT
FT                   NVIMREIQNSSYLANSNIACIIDDDRRKVGKYIRGVKVIGTRDKIKEAAKLYDIDEIIF
FT                   AIPSASNEVKRDILNICKETDCTLKILPGVYQMVDGEINVNSIRNVDVLDLLGRDPIEV
FT                   DIESIMGYVKDKVIMVTGGGGSIGSELCRQLVSHKPKQLIIFDIYENNAYDIQQELKIN
FT                   YPDANVVTLIGSIRNVSRLESVFAQYKPDIVYHAAAHKHVPLMEVSPDEAVKNNVVGTW
FT                   NVARMADKYGVKKFVMISTDKAVNPTNVMGATKRICEMIVQTYNGISKTDFVAVRFGNV
FT                   LGSNGSVIPLFKRQIEAGGPVTVTDPNIIRYFMTIPEAVSLVLQAGAYAKGGEIFILDM
FT                   GEPVKIDDLAKNLIRLSGYTLGVDMEIKYTGLRPGEKLYEELLMKEEGLQETDNKLIHI
FT                   GKPIEFDKENFFNNLEKLKEEAYSETGNIRESLKKVVVTYHPDEH"
FT   gene            89942..91252
FT                   /locus_tag="EUBELI_00083"
FT   CDS_pept        89942..91252
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00083"
FT                   /product="Hypothetical protein"
FT                   /note="Psort-B: CytoplasmicMembrane, score:9.99;
FT                   ScanRegExp:IPR000612"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00083"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71120"
FT                   /db_xref="GOA:C4Z1E6"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z1E6"
FT                   /protein_id="ACR71120.1"
FT                   /translation="MGIYQKLKFFIGKVTVLIMAVIFPFAVIVQNRKVSSFFCNVFIVM
FT                   ALLVLLCAVINELVNSKDAFKDFIAADVKSRYVVSGILIFLAIMWCFISPAIGCEFSGA
FT                   GSRIQGMLFFIGCACIYIVISECYSYEETDMAIMIFASVIINIITILRFLISAKGCTDE
FT                   YCMYTVMMFAVCVYSFLLSDDNKKIYYLAAACLCEMGLISATGNMAVTGMVIVLLVMLP
FT                   IALRKYECFTRYELIVLMIFILGRLFAYINVFTNKVTALPVSSAFLTSYKTTAFIIAGC
FT                   IIYMMLIIFDDRVKGCIKNIRKVVLNRIYMCITGLDIIGIITIVMINNYRNNYTFYLMI
FT                   FIGIIQILMSVAVFIFTTHSVLESIEDRTKPEKDISNSNDDYLLQGYGSRYMITAIGIA
FT                   AIAYILQGTGNLFEFEVFPVFICFVAIMSTYNKNCGS"
FT   gene            complement(91277..91888)
FT                   /locus_tag="EUBELI_00084"
FT   CDS_pept        complement(91277..91888)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00084"
FT                   /product="dTDP-4-dehydrorhamnose 3,5-epimerase"
FT                   /note="Psort-B: Cytoplasmic, score:8.87; COG1898
FT                   dTDP-4-dehydrorhamnose 3,5-epimerase and related enzymes;
FT                   HMMPfam:IPR000888; BlastProDom:IPR000888; Gene3D:IPR014710;
FT                   HMMPanther:IPR000888; HMMTigr:IPR000888;
FT                   superfamily:IPR011051; K01790 dTDP-4-dehydrorhamnose
FT                   3,5-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00084"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71121"
FT                   /db_xref="GOA:C4Z1E7"
FT                   /db_xref="InterPro:IPR000888"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z1E7"
FT                   /protein_id="ACR71121.1"
FT                   /translation="MGQITIEKNVAGIEGLCVITPAVHGDNRGYFMETYSQRDMEEAGI
FT                   NINFVQDNQSMSTKGVLRGLHFQKHFPQTKLVRAIKGAVFDVAVDLRTDSETYGKWYGI
FT                   LLTEENKKQFLIPKGFAHGFLVLTDTAEFCYKCDDFYHPNDEGGLAWNDPAIGIEWPEL
FT                   TGTYNGSASGEGYALSDGTKLNLSDKDQLWDTLENTFKFD"
FT   gene            complement(91910..92827)
FT                   /locus_tag="EUBELI_00085"
FT   CDS_pept        complement(91910..92827)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00085"
FT                   /product="dTDP-4-dehydrorhamnose reductase"
FT                   /note="Psort-B: Unknown cell location; COG1091
FT                   dTDP-4-dehydrorhamnose reductase; HMMPfam:IPR005913;
FT                   HMMTigr:IPR005913; K00067 dTDP-4-dehydrorhamnose reductase"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00085"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71122"
FT                   /db_xref="GOA:C4Z1E8"
FT                   /db_xref="InterPro:IPR005913"
FT                   /db_xref="InterPro:IPR029903"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z1E8"
FT                   /protein_id="ACR71122.1"
FT                   /translation="MKILVTGVGGQLGHDVMNELIGRGHTGVGSDIAPEYSGVADGSAV
FT                   TTAEYVPMDITDAAQVSEVITKVSPDVVIHCAAWTAVDAAEDDDKKAKVKAINADGTQN
FT                   IANVCKQLDCKMVYISTDYVFDGQGETPWEPDCKDYKPLNVYGETKLAGELAVSNTLDK
FT                   YFIVRIAWVFGVNGKNFIKTMLNVGKTHDEVRVVNDQIGTPTYTLDLARLLVDMVETDK
FT                   YGYYHATNEGGYISWYDFTKEIYAQAGLSTKVTPVTTAEYGISKAARPFNSRLDKSKLT
FT                   ANGFTPLPTWQDALHRFLKEIGEI"
FT   gene            complement(92859..93878)
FT                   /locus_tag="EUBELI_00086"
FT   CDS_pept        complement(92859..93878)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00086"
FT                   /product="dTDP-glucose 4,6-dehydratase"
FT                   /note="Psort-B: Cytoplasmic, score:8.87; COG1088
FT                   dTDP-D-glucose 4,6-dehydratase; HMMPfam:IPR001509;
FT                   HMMTigr:IPR005888; K01710 dTDP-glucose 4,6-dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00086"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71123"
FT                   /db_xref="GOA:C4Z1E9"
FT                   /db_xref="InterPro:IPR005888"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z1E9"
FT                   /protein_id="ACR71123.1"
FT                   /translation="MTIIVTGGAGFIGSNFIFHMLNKYPDYRIICLDCLTYAGNLSTLE
FT                   PVMSNPNFRFVKESITDREAVYKLFEEEHPDMVVNFAAESHVDRSIENPEVFLITNILG
FT                   TQVLMDACRKYGIQRYHQVSTDEVYGDLPLDRPDLFFTEETPIHTSSPYSSSKAGADLL
FT                   VLAYHRTYGLPVTISRCSNNYGPYHFPEKLIPLMIANALNDKPLPVYGEGLNVRDWLYV
FT                   EDHCKAIDLIIHKGRVGEVYNVGGHNEKRNIDIVKLICKELGKPESLIVHVGDRKGHDM
FT                   RYAIDPTKIHNELGWLPETKFEDGIKKTIQWYLDNKEWWETIISGEYQNYYEKMYSNR"
FT   gene            complement(93944..94843)
FT                   /locus_tag="EUBELI_00087"
FT   CDS_pept        complement(93944..94843)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00087"
FT                   /product="glucose-1-phosphate thymidylyltransferase"
FT                   /note="Psort-B: Cytoplasmic, score:8.87; COG1209
FT                   dTDP-glucose pyrophosphorylase; HMMPfam:IPR005835;
FT                   HMMTigr:IPR005907; K00973 glucose-1-phosphate
FT                   thymidylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00087"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71124"
FT                   /db_xref="GOA:C4Z1F0"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR005907"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z1F0"
FT                   /protein_id="ACR71124.1"
FT                   /translation="MKGIILAGGSGTRLYPLTMVTSKQLLPIYDKPMIYYPLSVLMSAG
FT                   IRDILIISTPQDTPRFKELLKDGSQFGVNLTYAVQPSPDGLAQAFIIGEEFIGDDTVAM
FT                   VLGDNIFAGHGLKKRLKAAVENAESGKGATVFGYYVDDPERFGIVEFNNEGKAVSIEEK
FT                   PAQPKSNYCVTGLYFYDNKVVEYAKNLKPSARGELEITDLNRIYLDKGTLNVELLGQGF
FT                   TWLDTGTHESLVEATNFVKTVETHQHRKIACLEEIAYLNGWINKDDVLKVYEVLKKNQY
FT                   GQYLKDVLDGKYVDKLHE"
FT   gene            94979..96223
FT                   /locus_tag="EUBELI_00088"
FT   CDS_pept        94979..96223
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00088"
FT                   /product="7-cyano-7-deazaguanine reductase"
FT                   /note="Psort-B: Cytoplasmic, score:8.87; COG0500
FT                   SAM-dependent methyltransferases; HMMPfam:IPR000551;
FT                   HMMPfam:IPR013216; FPrintScan:IPR000551;
FT                   HMMSmart:IPR000551; ScanRegExp:IPR000551;
FT                   superfamily:IPR009061; K06879 7-cyano-7-deazaguanine
FT                   reductase K09457"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00088"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71125"
FT                   /db_xref="GOA:C4Z1F1"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z1F1"
FT                   /protein_id="ACR71125.1"
FT                   /translation="MHKEGYYSSGEFAKKANVSVRTIRYYDQQNILKPSLLTDEGVRFY
FT                   TDSDFTRLQQILLLKYLGFTLDDIRNMTIGDSDYHVLKNSLELQKRMIQDKIAQMQLVC
FT                   KAIEETEDSIKEGKGVDWSNMLEIIHLTNMEDSMKNQYINAGNISARINLHNRFSVNKQ
FT                   GWFPWVYEQCGIVKGMRILEIGCGDGTLWVDNIGQLAMTGKRNEFSGKKKNIYIELTDI
FT                   SEGMISDARRNIKKATESWKERDIDVSFRFRVASCEKTGAKDESYDLVIANHVLFYCKN
FT                   VNKALDEIVRVLKPGGVLVCSTYGSRHMQEISRLVSGYDKRIALEADKLFEKFGLDNGD
FT                   KILKKHFSDVERRDYKDALVVDEAEPLVDYILSCHGNQKEYLVDKYTDFKKYVEKKLVK
FT                   PMTITKEAGVFVCRK"
FT   gene            96322..97479
FT                   /locus_tag="EUBELI_00089"
FT   CDS_pept        96322..97479
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00089"
FT                   /product="Hypothetical protein"
FT                   /note="Psort-B: Cytoplasmic, score:8.87; COG0438
FT                   Glycosyltransferase; HMMPfam:IPR001296"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00089"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71126"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z1F2"
FT                   /protein_id="ACR71126.1"
FT                   /translation="MKDYLLGAENTVMKKLKIAVDARTLGSRPSGVGMYLNDFLEQLIT
FT                   YDEFEWILFTDVKESEYIKRFEARGIKVIEWGKPVYKSVGVYAYFAFVKKELKQVKPDI
FT                   FWEVNSIIPINLSGSFKTLITIHDMFPIQYVRYFGKIYSYYFKFNLGVTLRHTDMILYN
FT                   SEQTKDDTEMYFPKAKKIPSCNAYIISNPLTRYVPPKDENYFLYVGNMEKRKGVDILIK
FT                   AYRRYREEGGTRPLILAGKMQEDDIEQLLETALTEVEGLTYLGYVSHTTRYDLYNNCSC
FT                   FVFPSMAEGFGMPILEVMKHNKPILASNLKIFDEVVGDCVERFSLAGDDDDKVISLANG
FT                   MKNIDKKINSGLVDENAYRHALDKYTPERLGGMVRDFINSQMNNR"
FT   gene            97495..98787
FT                   /locus_tag="EUBELI_00090"
FT   CDS_pept        97495..98787
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00090"
FT                   /product="Hypothetical protein"
FT                   /note="Psort-B: Unknown cell location; COG0438
FT                   Glycosyltransferase; HMMPfam:IPR001296"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00090"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71127"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z1F3"
FT                   /protein_id="ACR71127.1"
FT                   /translation="MGLSKFFLNTGEALRPVLTKIIPMKLLSKMKAGIINNATDKLSAD
FT                   SIEKYEAGRYKCGANIIGNIKGDNGLGQSARIMCRLLDENKEPHVIRDFFVPPGGSRSN
FT                   DTYDDRFTEELPFDVNIIHVNASEFMVAYLSLGKEVWDYRYNIGYWAWELETFPEEWLP
FT                   AFKLVDEVWTPSDFVTNTLKKYTDKPVITVPHCVAPQTDTVKFDRKHFNLPEDKFLFLV
FT                   MYNSGSVMERKNPLAAIKAFKEAFCKDEQMKEKYKDVGLVIKISEAELSAEDEKIIGSV
FT                   IEDCDNIYYMCGHMGRCEVNTLLADVDVYVSLHRSEGFGLVMAESMYVGTPVIATDWSG
FT                   NTEFMNSDTACMVGYDMIELDKDYEPFKKGNVWADAHVDEAADYMRRLYEDKDFYERIA
FT                   GNGQKYAREHLAYKRSADIVSERLKKIHGEN"
FT   gene            98861..99946
FT                   /locus_tag="EUBELI_00091"
FT   CDS_pept        98861..99946
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00091"
FT                   /product="Hypothetical protein"
FT                   /note="Psort-B: Cytoplasmic, score:8.87;
FT                   superfamily:IPR013830"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00091"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71128"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z1F4"
FT                   /protein_id="ACR71128.1"
FT                   /translation="MKKFKPIIRCVIFLAGLAAIMGVIDFACVQTGYVNYILRNVCAKD
FT                   NGTDYDTVVIGASHARASSDPEQIDKNAGTYSINMAIPGETVKDSYYVLEETCRTNDIK
FT                   TVILDIDYQYYFNPPKEGFYTEQFIQCQMNWGSYVKWQYIYDNMNRMEIRNVFTRRQAC
FT                   DFTLTSMKENIKQKLSKGYKDADIYSLDVDGGTYAGRGYFYIKPVSGELAGKELIKSWS
FT                   VRSREQITGYPLKYIKKIIKYCRDNDIDLIAVTSPITPSSVGTLHMENVHNTINNLLVE
FT                   NGIFYYDFNMARQDVLPRTDSDFVDKEGHMNGEFAKEYSEFLGKVIKEHKQGTKDINRY
FT                   FYSSYQEMYDTDAGLYGVVEK"
FT   gene            99948..101546
FT                   /locus_tag="EUBELI_00092"
FT   CDS_pept        99948..101546
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00092"
FT                   /product="Hypothetical protein"
FT                   /note="Psort-B: CytoplasmicMembrane, score:9.99; COG1696
FT                   Predicted membrane protein involved in D-alanine export;
FT                   HMMPfam:IPR004299"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00092"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71129"
FT                   /db_xref="GOA:C4Z1F5"
FT                   /db_xref="InterPro:IPR004299"
FT                   /db_xref="InterPro:IPR024194"
FT                   /db_xref="InterPro:IPR028362"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z1F5"
FT                   /protein_id="ACR71129.1"
FT                   /translation="MSFTTALFWFFILIGVVIYYVLPSKVRWMWLLVLSYLYYFSFNVK
FT                   NSLFMVAASLVIYLAALAMEYIQDKSDAYLKEHKAEIDREQKKKLKNSVKHKKRIILVI
FT                   AMLINFGVLAVLKYGGFITGNITAVLNKIGIDKTVYALSNYVMPLGLSFFTFQSISYVI
FT                   DIYQGKYRAERNPFRICLFVSFFPQIMQGPIGRFDKLQKTLFAGNAFNLQNIQFGIQRI
FT                   FWGLFKKMILADRAGVFVAMIFNKPDEYGGAMAIIAVLMYSIQLYADFSGGIDIVIGVA
FT                   QLFGVTMDENFRQPYFSKSIGEFWRRWHITLGTWMKDYVFYPFCLSKAMNKFGKWGKKH
FT                   LGEHVGKTLPICLSNLLIFFIVGIWHGAEWRYIMYGMYNGVIIAFSNLVEPLYKKCLHA
FT                   CHINPHKKWWQCVQILRTFILVNIGWVFDCSAAGMGSAVRMIKRMITDLRFDQLNAVMF
FT                   KSIGLKSADYIILAIGCVVVLIISILKERGVQIRAAVAAKPIAVRWLIYYGLIVAIFVL
FT                   GYASDAGSGFLYANF"
FT   gene            101571..102362
FT                   /locus_tag="EUBELI_00093"
FT   CDS_pept        101571..102362
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00093"
FT                   /product="lipopolysaccharide transport system permease
FT                   protein"
FT                   /note="Psort-B: CytoplasmicMembrane, score:10.00; COG1682
FT                   ABC-type polysaccharide/polyol phosphate export systems,
FT                   permease component; HMMPfam:IPR013525;
FT                   FPrintScan:IPR013526; K09690 lipopolysaccharide transport
FT                   system permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00093"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71130"
FT                   /db_xref="GOA:C4Z1F6"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z1F6"
FT                   /protein_id="ACR71130.1"
FT                   /translation="MKHLKEMYEYREMIFSLVKKDLRGRYKGSVLGFMWTFINPLLQLL
FT                   VFTLVFSIIMRANYEQYYLFLFVALVPWMFFGSSVQDGSTCIMRESNMVKKIYFPREVI
FT                   PISTVTSAFINMILTFVVVFIVLLISGRGINPVALLYLPVVMIVEYILCLGIGLIVSAL
FT                   TVYLRDLQYILGIVVMALQYMTPVMYGADMVENANVPQILKTIFNLNPMTPIINIYRQI
FT                   LYYKEIPDLSTLLVAIITGVVFVILGAIIFRRLQRGFAEEF"
FT   gene            102385..103653
FT                   /locus_tag="EUBELI_00094"
FT   CDS_pept        102385..103653
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00094"
FT                   /product="lipopolysaccharide transport system ATP-binding
FT                   protein"
FT                   /note="Psort-B: CytoplasmicMembrane, score:9.49; COG1134
FT                   ABC-type polysaccharide/polyol phosphate transport system,
FT                   ATPase component; HMMPfam:IPR003439; BlastProDom:IPR003439;
FT                   HMMSmart:IPR003593; K09691 lipopolysaccharide transport
FT                   system ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00094"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71131"
FT                   /db_xref="GOA:C4Z1F7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029439"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z1F7"
FT                   /protein_id="ACR71131.1"
FT                   /translation="MLNNENSIEVRNVSKSFKVYFDKGNELKEKMLFWKRNRYENRVVL
FT                   NNISFTVKKGEAVGLIGRNGCGKSTTLKLLTKIIYPDSGSIEMCGRVSSLLELGAGFHP
FT                   DMSGRENIYTNAAIFGLTKKEIDERLEDIIEFSELQQFIDNPVRTYSSGMYMRLAFSVA
FT                   INVNADILLIDEILAVGDANFQAKCFNKLREIKANGTTIIIVSHALGQIEEICDKSIWI
FT                   KDGQIEQEGDPREVDIAYLDYMNQERLSKDEQERARILRIEAEQRRLKKAEEENKEGGN
FT                   DKRYGSFEARINDVILSCDDGNRTETLETGRKAVIEIDYSVETPVKEVHARYMIYRIDG
FT                   QLCSGSSTKIDRLDAFDLEKDGKIVIEFDSMTLTRSQYWVDIVLEKADGTPIDYYKEAA
FT                   RFNVVSGIEDMGVARIEHTWKNC"
FT   gene            103670..106171
FT                   /locus_tag="EUBELI_00095"
FT   CDS_pept        103670..106171
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00095"
FT                   /product="Hypothetical protein"
FT                   /note="Psort-B: CytoplasmicMembrane, score:9.49; COG0463
FT                   Glycosyltransferases involved in cell wall biogenesis;
FT                   HMMPfam:IPR001173"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00095"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71132"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z1F8"
FT                   /protein_id="ACR71132.1"
FT                   /translation="MKKSDNVINIQLSDNQGKLHIRIAGWYIPKDFDDYSFELFINGGK
FT                   IECSVEHITREDKLDLLISNNLKRDSKIGFIIKTDVNKSDVKTIELYVVDAGVRSKIAS
FT                   ADEKDVVYTVQDQILQYNIDRIWPEKTIDDKHVYRVAGWVVAQEGDVVINMTDTSNNPL
FT                   EFKNVRCERLDLIDNGYTEDEKKAVGFTITIDEKPGYVLHFKSDAKSIDINIDEEIKRQ
FT                   RRIYNIDKTKRMIKAVTPHNVARLCHHIRLYGFKDLKEYVYGGLYGVMDQAEIYKKWFA
FT                   IHKATQEELDNQKKVKFAYEPKVSIIVPTYNTPIKYLEEMIQSVINQSYSNWQLCIADG
FT                   SCGNAKLEKVLEDYHKKDSRIVYKLLDSNKGIAGNTNAALELADGEITGLLDHDDTLEP
FT                   DALYEVVKAFQDKMVDAVYTDEDKILGPDWINVDPNFKTDYNIDLLRSHNYITHFFCVK
FT                   TELLKEIGGFKADYDGAQDYDVILRCTEKARKTEHIAKILYHWRMHDNSTAANPASKAY
FT                   CHEAGRKAVEDHLKRLGIPAKVELCKLFGGSRVIYETPGNPLVSIVIPNKDHIDDLDKC
FT                   VRSLFNVNTYKNIEVIIVENNSTQKETFEYYDSIQKEYSNVKVLVWKREFNYSAINNFG
FT                   VKEAKGDYILLLNNDTEMIAPDSISDMLGYCMRPDVGIVGAKLLYPDGTIQHAGVIIGL
FT                   GGIAGHAFIGLDANQYGYMSRAYLSSDYSAVTAACLMISKEIYNEVGGLCEQYAVAFND
FT                   VDFCMKVRSKGYLVVYDAFSQWYHYESKSRGYEDTEEKQLRFKGEIDTFKSKWQKELDE
FT                   GDPFYNRNFPLNTESYTLELE"
FT   gene            106187..108181
FT                   /locus_tag="EUBELI_00096"
FT   CDS_pept        106187..108181
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00096"
FT                   /product="Hypothetical protein"
FT                   /note="Psort-B: Cytoplasmic, score:8.87; COG0463
FT                   Glycosyltransferases involved in cell wall biogenesis;
FT                   HMMPfam:IPR001173"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00096"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71133"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z1F9"
FT                   /protein_id="ACR71133.1"
FT                   /translation="MFLTRAAQIIGKEGFKTFGYALQQKMHQNMTDEKAYSIYQKKIAP
FT                   KQRITDNKADCTAICRHSGSYESMLAAVSGMDAEYIAVCDESCEFDKDYTAIVSHYIRI
FT                   QKRAGRSLIYIYTDSEKYNQEAGCGLPDCKPDYSWDTLLSYNYIGDAFVAKKNALIDAI
FT                   NECKNHGAVDNINYYELSLIILSKCKTSDVGHIHQVLVKDIRTDSKSYRTADDGMAAFK
FT                   KMILESSEINVNIVADKHDSAVEHVHYITNEYDLVSIIIPSKDNPDILKCCLQSIRKFT
FT                   KYINYEIVVVDNGSNDSNRKEYEKLVDTFEGQASYVYEKADFNFSHMCNIGAAKAKGNL
FT                   LLFLNDDIEIIGQDYEDTDWLSVLVGQAKQESTGAVGAKLLYPDSSYIQHVGVINYESS
FT                   CFAHLYAKAVDDENIKAHRNYADYDCLCVTGACFMIEKAKFDKAGGFDEAFEVTHNDVD
FT                   ICLTLYEQGYYNVLRNDVVLFHHESFSRGDDEVDEEKNRRNMHARDMTYEKHPKLEKYD
FT                   PFYSPLLTQTENNYRFGDEIYSVIYRKPQKADRLRPAAGYMEVSPTVKVTETGYHDDMQ
FT                   LRGFAYNGNKVYYNPVIFLWNEQNCYRIKVQSVCDRVFHLRKGVDKNINYAPFFCGIDT
FT                   TDMESGTYRCAIRADGKYYDAQTDVVIDG"
FT   gene            108174..109280
FT                   /locus_tag="EUBELI_00097"
FT   CDS_pept        108174..109280
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00097"
FT                   /product="mannose-1-phosphate guanylyltransferase"
FT                   /note="Psort-B: Unknown cell location; COG0836
FT                   Mannose-1-phosphate guanylyltransferase; HMMPfam:IPR001538;
FT                   HMMPfam:IPR005835; BlastProDom:IPR013794; K00971
FT                   mannose-1-phosphate guanylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00097"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71134"
FT                   /db_xref="GOA:C4Z1G0"
FT                   /db_xref="InterPro:IPR001538"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z1G0"
FT                   /protein_id="ACR71134.1"
FT                   /translation="MVKTIWQNKEEFMKTTALIMAGGKGERFWPKSRVNMPKQFLSLTD
FT                   DGKTMIQLTVERISPLVDIKDVYVATNKNYRELVKQQLPGIPEENILCEPVGRNTAPCV
FT                   GLGAVHVASKYDDAVMIVLPSDHLIKNNEVFADTFKEAVQIAEEGANLVTVGITPNYPE
FT                   TGYGYIKYNQDDKKNNAYSVEKFVEKPDLETAKSYLADGTYLWNSGMFVWKVSTILDCF
FT                   KKFMPDTYEGLLKIKAAVGTADENAVLEAEFPNLESQSVDYGIMEKADSIYTLPGNFGW
FT                   DDVGSWLAVGRIKKNDDNSNVINGNVVAVNTRGCVIEGGEKLIATVGLRDIVVVDTKDA
FT                   TLITTKENAGEIKQVLAKLREEGKNEYL"
FT   gene            109333..110145
FT                   /locus_tag="EUBELI_00098"
FT   CDS_pept        109333..110145
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00098"
FT                   /product="Hypothetical protein"
FT                   /note="Psort-B: Unknown cell location; COG0463
FT                   Glycosyltransferases involved in cell wall biogenesis;
FT                   HMMPfam:IPR001173"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00098"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71135"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z1G1"
FT                   /protein_id="ACR71135.1"
FT                   /translation="MTKEHVNTNHTFAICAYKESPYLEECITSLMEQTVKSEIFIATST
FT                   PNKYIDDIAAKYNLKVYVNEGESGITQDWNFAYSKVQTDYVTIAHQDDKYAPEYVENLL
FT                   AYTAKAKKPLLFFTDYAEIRNGEIVTTNKILKVKRIMLFIMRPKAMWGSRFIRRRVLSL
FT                   GSPICCPSATYYRPNLMKQVFLNGFRADEDWEAWERLSKLKGDFIFCNKILTYHRIHED
FT                   SETTKILNDNKRSEEDYIMYQKFWPKCIAKMLTKAYSKSEESNNMKQG"
FT   gene            110155..110997
FT                   /locus_tag="EUBELI_00099"
FT   CDS_pept        110155..110997
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00099"
FT                   /product="lipopolysaccharide cholinephosphotransferase"
FT                   /note="Psort-B: Cytoplasmic, score:8.87; COG3475 LPS
FT                   biosynthesis protein; HMMPfam:IPR007074; K07271
FT                   lipopolysaccharide cholinephosphotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00099"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71136"
FT                   /db_xref="GOA:C4Z1G2"
FT                   /db_xref="InterPro:IPR007074"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z1G2"
FT                   /protein_id="ACR71136.1"
FT                   /translation="MKEYDEATLKKVQQTEMEILRDFIKVCDENNLTWFGDAGSGIGAI
FT                   RHKGFIPWDDDIDVMLPRKDFDKMMEVIKRDYSDKYSIANVETMKNYPLMTTRIMMKGT
FT                   TFIEEPLKNIKCDLGIFLDVYPLDNISDDEEELKKQAKAAWFWSKLLILRHVAFPVLPY
FT                   KGVKAKITHIATAIIHAGLVVFRISHNWIAGKCLKIASRYNDVDTKRMAFLFDTDPYYH
FT                   IMLKDEIYPLQMYDFEDIKMPLPANEDEKLRNMYGDYMQLPPVEKRKNHYPYKLEFKD"
FT   gene            111007..112269
FT                   /locus_tag="EUBELI_00100"
FT   CDS_pept        111007..112269
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00100"
FT                   /product="Hypothetical protein"
FT                   /note="Psort-B: CytoplasmicMembrane, score:9.99; COG2244
FT                   Membrane protein involved in the export of O-antigen and
FT                   teichoic acid; HMMPfam:IPR002797"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00100"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71137"
FT                   /db_xref="GOA:C4Z1G3"
FT                   /db_xref="InterPro:IPR002797"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z1G3"
FT                   /protein_id="ACR71137.1"
FT                   /translation="MNIISRIMGVDKTPEDKYKYIWFTMGTACFALATLVMTIVISRFL
FT                   GEAKAGMFSIGLSIAQWLVTIAYFEIRTYQVTDVKNEYPFGYYFTLRLMMCLITFLASI
FT                   VYVVFNGYSPEKVTVILLVCIYKILDSVADTFEGEFQKEERIDMSGKSEFYRIFFSILV
FT                   LVVTVIITRNLIFSLICMNVVALLIILCLDASVAAGRVKICIVRDYRRVFVLFKVCLPL
FT                   AISTFLSNYIINSSKLSVDRMLGDAAQLYYTAVFMPNMVINLFSGIIFKPMQTSMAVNY
FT                   YEKKYKNFWHIIFRMFAIIAGFTLICEVGAYILGIPVLSWLYGVNLKDYKMTLLLLLLC
FT                   GGVNAVNIIFYYVLAIMRKQKYMTILYLIVCGVALIIMDPITGRLGLNGAALGYLILVV
FT                   LLGVLLMGYILYQIRKDRKRQ"
FT   gene            112266..113150
FT                   /locus_tag="EUBELI_00101"
FT   CDS_pept        112266..113150
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00101"
FT                   /product="lipopolysaccharide cholinephosphotransferase"
FT                   /note="Psort-B: Cytoplasmic, score:8.87; COG3475 LPS
FT                   biosynthesis protein; HMMPfam:IPR007074; K07271
FT                   lipopolysaccharide cholinephosphotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00101"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71138"
FT                   /db_xref="GOA:C4Z1G4"
FT                   /db_xref="InterPro:IPR007074"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z1G4"
FT                   /protein_id="ACR71138.1"
FT                   /translation="MSQNEQYDPKVLRKLQLAELEVFKDFIKICDENGLSYFLFAGCAI
FT                   GVERHKGFIPWDDDIDIGMLRDDYEKVLKIYREKYTDKYVVLDIDSQETFPFYNAEIAR
FT                   IGTKNIPYVFKDANVPMGIDIALYPYDNVPDDAKKRRRQRSSVFFWSKLRILREFKKPV
FT                   LFMHGWKRKVVSAMCIVMNRLLTWTHFSRKFINRRYMKSALKYNNEKTRWVACFFGEMD
FT                   PLKQAIKLDDLFPLVEKPFEDIMVKVPKNNDVFLKRMFGDYMKMPPVESRKNHVPEVLE
FT                   FGPFDEELKDIDI"
FT   gene            113154..113876
FT                   /locus_tag="EUBELI_00102"
FT   CDS_pept        113154..113876
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00102"
FT                   /product="Hypothetical protein"
FT                   /note="Psort-B: Cytoplasmic, score:8.87; COG0463
FT                   Glycosyltransferases involved in cell wall biogenesis;
FT                   HMMPfam:IPR001173"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00102"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71139"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z1G5"
FT                   /protein_id="ACR71139.1"
FT                   /translation="MDNYGENMKKLIIIPAYNESESIEKTVRDIIENAPSFDYVVINDC
FT                   STDNTRQICEDNGFNIVNLPVNLGIGGAVQTGYLYAERYGYDIAVQVDGDGQHDAKFLG
FT                   EMADYLEKNDLDMVIGSRFIEKQGFQSSKARRIGINYFTGLIKLCTGQKITDPTSGLRL
FT                   IGRRTIVQFAKKYPKDYPEPETVVAILKKGFKVAEIPVVMRERQGGSSSITLKKSVYYM
FT                   VKVTLAILFENFRGDKHR"
FT   gene            113873..114241
FT                   /locus_tag="EUBELI_00103"
FT   CDS_pept        113873..114241
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00103"
FT                   /product="Hypothetical protein"
FT                   /note="Psort-B: CytoplasmicMembrane, score:9.99"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00103"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71140"
FT                   /db_xref="GOA:C4Z1G6"
FT                   /db_xref="InterPro:IPR019277"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z1G6"
FT                   /protein_id="ACR71140.1"
FT                   /translation="MSIRIKCVIIVVLILGLLKILGLIKKNKLELKYALSWLFLEVGIL
FT                   IITLIPNLLNVISKALGIYNEINMLFFLGFVFIILVIFSLTMSLSRNSERVRKMVQEIA
FT                   LNSYANDKKESGEITKEV"
FT   gene            114263..116029
FT                   /locus_tag="EUBELI_00104"
FT   CDS_pept        114263..116029
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00104"
FT                   /product="Hypothetical protein"
FT                   /note="Psort-B: CytoplasmicMembrane, score:9.99; COG4713
FT                   Predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00104"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71141"
FT                   /db_xref="GOA:C4Z1G7"
FT                   /db_xref="InterPro:IPR018674"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z1G7"
FT                   /protein_id="ACR71141.1"
FT                   /translation="MSEVKMINKRKKLIVTFIIMLILVFLFNRAMYWSEFSTWKNKLFV
FT                   GVISIFGVICIPLLLTYIKAASDYIDTFIANKINQIKYLAAHWKKTLLFTCIFAIIIAA
FT                   AVLLEKIIFSRIYDGYSNLRMYFFVGTGILIFAIVLCGKIAYKRVEVLFAAAALIMGLT
FT                   YIMVSPRHLLVTWDDETHYLRSVSLADVFDNTKFNAEGLFYDSQPAAYMYTQGDLTQEE
FT                   FKAILDNVEYQYEQKRTDNRFGSEVGKEFVAYTPAAIGIIMGKALRLSFFHTFLLSKMV
FT                   ILCTYVLLMYFAIKKLKNGKVLLAVIGLSTTTMFMASSMSYDFWVIGFTTLGYSFFISE
FT                   LQNRDKKLEYRNIIMMNICFLLGIAPKAIYFVIMFVLLFMPVDKFKDKKQRRIYYSIIV
FT                   GVAIFLMMTFLLPMLINSPGTGDSRGGSDVNSTEQIKYILSNPIEYSGTLLNFLKDYLN
FT                   LDYASEFISSMAYMGYGIGTAITLMLIAALMYIDRGEEKVRMPYVRASYFFSAAVCVVL
FT                   VATALYISFTAVGADYIAGCQPRYLLPLLFPMAYFIGVDGVTTKINKNAMAVAAVSIMS
FT                   YFFMNNMWATCF"
FT   gene            116083..117747
FT                   /locus_tag="EUBELI_00105"
FT   CDS_pept        116083..117747
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00105"
FT                   /product="Hypothetical protein"
FT                   /note="Psort-B: CytoplasmicMembrane, score:9.99;
FT                   HMMPfam:IPR000917; Gene3D:IPR001952"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00105"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71142"
FT                   /db_xref="GOA:C4Z1G8"
FT                   /db_xref="InterPro:IPR000917"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z1G8"
FT                   /protein_id="ACR71142.1"
FT                   /translation="MKKIKDKLITIYPQLIFLIVTFCIFMPASLFLGNLDEFAVGFTAL
FT                   IPLLIAASLITAAVVILIGLIVPKKICNIYAAVIFGGALAAYVQGNFLNPDFGVLNGRQ
FT                   IQWSQFRVNAIISTVVWIVLIVVPAVVVCFKKDIMTKIMKWGSLFLSSIQIVTLVVLIV
FT                   ASKRTVDYSYVVTKNDEFALSSQGNVVVFIVDTLDNDDAQNYVIDRYSEELKDFTYFDN
FT                   MIGGGAPTALGVPLMLTGYQYDTTQSLADYRKKAYEEGSLIQDMSDNGYDVKLYTSSEY
FT                   LNGVNQEAVANTAGGQKYRISDKVQFFKNIYKMSAFYAFPQIIKQYFWFYGDDFAACQA
FT                   PKNNNIIQYELDDSQLYADFNNNGGITVDAGNKTFTLYHMVGAHAPYEMNEQCVDVGET
FT                   ETSLDKQIQGVFRYINEYMQQMKDKGVYDNSTVIITADHGGYRLYERPAVFVKMADTHN
FT                   DVMQVNSDSVTFKNLYATYGKAALGQKSNYGNTLFDMDGVSQSRYHVAPWDVSKGMYPA
FT                   DEYLKNRDYSVFRIDGYAVNPQISVIKDEQQMKNINN"
FT   gene            117893..119368
FT                   /locus_tag="EUBELI_00106"
FT   CDS_pept        117893..119368
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00106"
FT                   /product="basic amino acid/polyamine antiporter, APA
FT                   family"
FT                   /note="Psort-B: CytoplasmicMembrane, score:10.00; COG0531
FT                   Amino acid transporters; HMMPfam:IPR004841;
FT                   HMMPanther:IPR002293; K03294 basic amino acid/polyamine
FT                   antiporter, APA family"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00106"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71143"
FT                   /db_xref="GOA:C4Z1G9"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z1G9"
FT                   /protein_id="ACR71143.1"
FT                   /translation="MNENNQLVRALGLKESISMTIGTVVGVGLFTCGSAQIGSVGSWII
FT                   GFTFVALLISIWPCLIYGEMSAALPCAGGTYNYAKRGLNRVWANMAGWHYIVSVVAIGA
FT                   GETLAFANYFKILMEQLGISIVKLDSRIIAIILVAVFLILNFRGIEQSGKAQTAFMFFF
FT                   WGCSVCWFLYMIPKVHVEYFGGIAMNSLPPFNEMMYIFGLVWWCYTGFETCVSMGAETK
FT                   YPQYTLPRALKISVFMVFALNALFQWFLVGLVPKEFYGILAAADAPYAEGLKAVGLVGF
FT                   PIILLCIGIAFGGDLSTINPGIAAPARYIYTMAEDGALPKFLGKIHPKFKTPYVAVIVV
FT                   GVINFILIATGSINYIASVSLISLAICYMIGCLSYMGLKKKYPDMKRPYKAPLGVVGCI
FT                   FTIVVYCFMLIFADKAALITSGIITVLCVIFYFAYSHRKECVMPTIEEEIGVIEEPDEQ
FT                   TKAKMDRQYTIWKVCTIIVTCIALGIYIIPMVL"
FT   gene            119378..120298
FT                   /locus_tag="EUBELI_00107"
FT   CDS_pept        119378..120298
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00107"
FT                   /product="choline kinase / choline-phosphate
FT                   cytidylyltransferase"
FT                   /note="Psort-B: Cytoplasmic, score:8.87; COG0510 Predicted
FT                   choline kinase involved in LPS biosynthesis;
FT                   HMMPfam:IPR005835; K00866 choline kinase K00968
FT                   choline-phosphate cytidylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00107"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71144"
FT                   /db_xref="GOA:C4Z1H0"
FT                   /db_xref="InterPro:IPR025877"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z1H0"
FT                   /protein_id="ACR71144.1"
FT                   /translation="MNRYQFEVLTYIEKNGKKDYPMRTLSDTLKISGTAISKALDELEN
FT                   DVLIKRCEDQMEITEKGLEALEPYRVKRAVIMAAGFGSRMVPVTLDRPKPMVAVNGVRI
FT                   IDTLLDALVSVGIKDITLVRGYKKEKFDEILDKYPFINLIDNDIYDKTNNISSAMAALE
FT                   HIDQCYLCEADLYISNPAIITKYQYCSNILGSYSLETDDWSFKLDNGHITDYQKGNTYC
FT                   FNYYGISYWTKEDSARLREDFAQVYNEEPEGNDYFWEFIPLVLRKERYAVEVRPCEKSD
FT                   IMEIDNFYELVQLDSSYKDYPGQEQ"
FT   gene            120328..121899
FT                   /locus_tag="EUBELI_00108"
FT   CDS_pept        120328..121899
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00108"
FT                   /product="Hypothetical protein"
FT                   /note="Psort-B: Cytoplasmic, score:8.87; COG1574 Predicted
FT                   metal-dependent hydrolase with the TIM-barrel fold;
FT                   HMMPfam:IPR013108; BlastProDom:IPR011550;
FT                   superfamily:IPR011059"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00108"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71145"
FT                   /db_xref="GOA:C4Z1H1"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR013108"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z1H1"
FT                   /protein_id="ACR71145.1"
FT                   /translation="MICYKGKVLTVDSNDTVAGYLVEDKGRIVYVGNELPEQYKNVQTV
FT                   ELGKKVLVPAFVDTHQHMASFSTFHAGLNVMDAESNEEIAQMVKEFVQSSGNKKTLIAF
FT                   GASPYSVKEGRLISRKELDKVCPDKEIMVVKYDGHACVINSKLLDKLKGKVSKLRGYHE
FT                   DTGEMNQEAFFECSNYITNSLSIIELFKNMQSAIDFQASHGIGCIHTVSGVGFTGNLDI
FT                   TFEKIFAKSLTNGFQVRVFPQSMNVDVALKRKLPRIGGCFECALDGCFGSHDAAMNEPY
FT                   IDSLGGDGVLYYDDEKVIDFCKKANRAGLQIEMHAIGDKAFDQACRALKAALDDYPRKD
FT                   HRHGIIHDCLPTEEGIKICRDYNIQMPVQSAFINWKQEPDEYLESIMDKERTERLNPLR
FT                   TFNENGIVVSCGSDAPCTSPDPIVWIDKAVNNMNQSQAVSVQEALRMCTYNGYYVTFDE
FT                   KERGSLEAGKIADMVVLSDDLYSVDKKDIKNIKVEGLILSGKKYELCRENVIKAVIRGV
FT                   FSGNMA"
FT   gene            121913..123673
FT                   /locus_tag="EUBELI_00109"
FT   CDS_pept        121913..123673
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00109"
FT                   /product="choline kinase / choline-phosphate
FT                   cytidylyltransferase"
FT                   /note="Psort-B: Cytoplasmic, score:8.87; COG0510 Predicted
FT                   choline kinase involved in LPS biosynthesis;
FT                   HMMPfam:IPR002573; HMMPfam:IPR005835;
FT                   superfamily:IPR011009; K00866 choline kinase K00968
FT                   choline-phosphate cytidylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00109"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71146"
FT                   /db_xref="GOA:C4Z1H2"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR025877"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z1H2"
FT                   /protein_id="ACR71146.1"
FT                   /translation="MRKEEFYVLNSLYNGSIGRAGCTYDVEETKALNDTNIYNKLVKTG
FT                   YIEKESGSLTKTGLEALEPYRVNNAVILAAGASTRFIPLSLEQPKGLFEVKGERLIERQ
FT                   IKQLQDAGIKNITVVLGYKKEMFYYLEDKYGVKFIINDSFNIKNNIESLYLARKELKNT
FT                   YICVSDSYYIENPFNQFEYHTFYSGYYGKETTDEVYARADGFGKITRIAKDNKIDGYVL
FT                   MGHSFWRKEFSEAFINQVEAVRESGVYNNCYWEILVKDKLDELPDIFFKEYLPGNIFEF
FT                   DYFDELRKFDSQYLGHTHSEIIRNIKLVFRCDEEDIIDFRNVSEGMTNTSFIFKIDGID
FT                   YIYRHPGDGTESIINRRNEKKSLIKAKEAGVDPTYIYADVNEGWKISIFIPEFREPDYN
FT                   SFEDSKKILAVLRKLHKADITADYGMKPWEDALDMEKLLEKKDPVCFVQYEGLKNNIGQ
FT                   LYKMTLADGVEKCFCHGDTYKPNWMIRPDGSVILIDWEYSGYSDPGIDVGYYVVDAMYD
FT                   FDKAEEFIKEYLQEDYNETTRFHYMAYVAIIAYYWFVWAMYRESCGADMGEALENWRDM
FT                   AVKYAEYLLK"
FT   gene            123876..125777
FT                   /locus_tag="EUBELI_00110"
FT   CDS_pept        123876..125777
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00110"
FT                   /product="preprotein translocase YidC subunit"
FT                   /note="Psort-B: CytoplasmicMembrane, score:9.99; COG0706
FT                   Preprotein translocase subunit YidC; HMMPfam:IPR001708;
FT                   HMMPfam:IPR007554; HMMPanther:IPR001708; K03217 preprotein
FT                   translocase YidC subunit"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00110"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71147"
FT                   /db_xref="GOA:C4Z1H3"
FT                   /db_xref="InterPro:IPR001708"
FT                   /db_xref="InterPro:IPR007554"
FT                   /db_xref="InterPro:IPR028055"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z1H3"
FT                   /protein_id="ACR71147.1"
FT                   /translation="MEILSTALGYVMNFCYKLLHDYGLAIILFTLISKIVLLPVSIWVQ
FT                   KNSIKMVKMQPDINRILIKHYGDKDEIAEEQSKLYKKEKYNPLASLIPLIIQIILLLGV
FT                   VAVIKDGINEGVANMKFCGYDLTWITTKQWGLSIITPIIAGVSAWLLCVAQNASNVLQA
FT                   EQSKLNKYGMMIFSVGLSLYLGCFVYAGVALYWTASNIFAILQLYLLNWAINPKNYVDY
FT                   EALEETKKELAEIEALGTKKGKRNKEDIKREKADYKKFFSVVNKHLVFYSEGSGFYKYF
FT                   KGIIEYILNNTNITIHYVTSDPDDQIFRIAEKESKIKPYYIGEKKLITLMMKMDADVVV
FT                   MTMPDIENYHIKRSYIRKDINYVYVPHGMDSLNMTMRTGSMDHYDSVLCTGKIQKEEIE
FT                   KTEEVYNLPKKELVEWGYSLLDEMREDYAKMPKKENDIKSILIAPSWQKDNIVDSCLED
FT                   ILDNLKGHGYKITVRPHPQHVRHMPEKMERLKERYKDDTDIEIQTDFSSNSTVFEADLM
FT                   ITDWSGIAYEYAYTTCKPVLFIDTPMKIMNPEYKKIGIEPLNIWMRYEIGRVLKLDEID
FT                   KTADTAAKMLAASDTYKDSIDQFVKEYVYNLGSSASVGAKYIIQEIQKAIKRHKEQE"
FT   gene            125800..127611
FT                   /locus_tag="EUBELI_00111"
FT   CDS_pept        125800..127611
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00111"
FT                   /product="threonine-phosphate decarboxylase"
FT                   /note="Psort-B: Cytoplasmic, score:8.87; COG4750
FT                   CTP:phosphocholine cytidylyltransferase involved in choline
FT                   phosphorylation for cell surface LPS epitopes;
FT                   HMMPfam:IPR004839; HMMPfam:IPR005835; FPrintScan:IPR001176;
FT                   Gene3D:IPR015421; ScanRegExp:IPR004838;
FT                   superfamily:IPR015424; K04720 threonine-phosphate
FT                   decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00111"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71148"
FT                   /db_xref="GOA:C4Z1H4"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR025877"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z1H4"
FT                   /protein_id="ACR71148.1"
FT                   /translation="MQAIILAAGMGKRLKELTQNNTKCMVKVNGVSLIDRLLHQLEKHH
FT                   LSRIVIVVGYEGQKLIDYIATLGIKTPISYVDNAVYDKTNNIYSLALAKNYLMEEDTLL
FT                   FESDVIIEDSAIDELVKDPRDTLAMVDKYESWMDGTCVKLDEYDNIVAFVPGKSFDFKE
FT                   KEEYYKTVNIYKFSKHFSQDIYVPFLEAYCSALGENEYYEQVLRVITMLDTPGIKGMRL
FT                   SGQKWYEIDDEQDLDIATTLFAPDDETRINLMHKRYGGFWRYPGLLDFCYLVNPYYPPK
FT                   KLKDELRASFDTLLTEYPSGMGVNSLLAAKNFGVHKDNIIVGNGAAELIKSLMESFSGK
FT                   TGVIRPTFEEYPNRYAVEDEVVFTPVNDNYTYSVEELIEFYTCNKVDNIIIINPDNPSG
FT                   NYLKKEEIIRLIKWTDSQGIKLVVDESFADFSDEPDNSLIEQKLIETYSRLYVMKSISK
FT                   SYGVPGLRLGVLVSSDTEAIAAMKKDVAIWNINSFGEYYLQVAEKYKKDYAAAMDKFRV
FT                   ERKRFYNELEQISGIRVIPSQANYFMIEITNGMTAKELMIKLFKNHYLLIKDLTSKVHD
FT                   GKQYIRIAIRNDVDNNKMIEALKKELN"
FT   gene            127628..127846
FT                   /locus_tag="EUBELI_00112"
FT   CDS_pept        127628..127846
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00112"
FT                   /product="Hypothetical protein"
FT                   /note="Psort-B: Unknown cell location;
FT                   ScanRegExp:IPR002048"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00112"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71149"
FT                   /db_xref="GOA:C4Z1V9"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z1V9"
FT                   /protein_id="ACR71149.1"
FT                   /translation="MLTLLNLNVAGYIDPSVMTYAIQAIAGVIIAVGAFLGIYLRKAKK
FT                   KLNNKLGIDENRNKEVETDDIVINESK"
FT   gene            127956..128456
FT                   /locus_tag="EUBELI_00113"
FT   CDS_pept        127956..128456
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00113"
FT                   /product="Hypothetical protein"
FT                   /note="Psort-B: CytoplasmicMembrane, score:9.99; COG2246
FT                   Predicted membrane protein; HMMPfam:IPR007267"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00113"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71150"
FT                   /db_xref="GOA:C4Z1W0"
FT                   /db_xref="InterPro:IPR007267"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z1W0"
FT                   /protein_id="ACR71150.1"
FT                   /translation="MSNNTDNNMQETKPDIFDKIMHLPGLRVFEPLYKKYKEVLLYLFF
FT                   GVLTTVVSIGSYALFNVAMGINELIANVISWVLAVLFAFFTNRIWVFAAPTKTVEEFMK
FT                   QLVSFAGGRVLTLVIEEIILLVFITMLHFNSMLIKFIAQVVVIILNYVISKLLVFRKDK
FT                   SEK"
FT   gene            128469..130028
FT                   /locus_tag="EUBELI_00114"
FT   CDS_pept        128469..130028
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00114"
FT                   /product="Hypothetical protein"
FT                   /note="Psort-B: Cytoplasmic, score:9.98; COG1020
FT                   Non-ribosomal peptide synthetase modules and related
FT                   proteins; HMMPfam:IPR000873; ScanRegExp:IPR002048"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00114"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71151"
FT                   /db_xref="GOA:C4Z1W1"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR010071"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z1W1"
FT                   /protein_id="ACR71151.1"
FT                   /translation="MEKNVLEFLENSQRMYGEKTACADMNNELTYTQLMNQAEFIGSCL
FT                   SLKIKPTQGVPVYMDKTCNTLSLFMGIVYAGGYYCMLDTTHPAERINLILDTIQADILV
FT                   VDNKSAKKAEKLGFQGEIINLDELLEEYDGQAVDSEAQERLEKIREQALDTDPLYSIFT
FT                   SGSTGVPKGVIVNHRSTIDFIDCFTETFGITNEDVIGNQAPFDFDVSVKDIYSSLKTGA
FT                   TLQLIPKMCFSFPTKLLDFLDDRKVTTIIWAVSALCIVTTLNGFEYKRPSSLNKIMFSG
FT                   EVMPIKHLNAWRVQYPDAMFVNLYGPTEITCNCTYYIIDREFGLDEKLPMGKPFANERV
FT                   FLLDDEDKLVDAGRPGELGEICVSGTAVTMGYLRNPEKTAAAFVQNPLNDRYLETIYRT
FT                   GDLGYYSEDGELFFSSRKDFQIKHMGHRIELGEIETYMNAIEGLLRSCCIFDTDENKIL
FT                   GFFEIEGASELDRKGVTHALKDKVPQWMIPNVLVKVETMPITKNGKIDRKELMKIYKEQ
FT                   EA"
FT   gene            130030..131268
FT                   /locus_tag="EUBELI_00115"
FT   CDS_pept        130030..131268
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00115"
FT                   /product="diaminopimelate decarboxylase"
FT                   /note="Psort-B: Cytoplasmic, score:8.87; COG0019
FT                   Diaminopimelate decarboxylase; HMMPfam:IPR000183;
FT                   superfamily:IPR009006; K01586 diaminopimelate
FT                   decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00115"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71152"
FT                   /db_xref="GOA:C4Z1W2"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR022643"
FT                   /db_xref="InterPro:IPR022644"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z1W2"
FT                   /protein_id="ACR71152.1"
FT                   /translation="MVGVNELKEIAIKCGTPSYIFDTDELCARIDAMQQILGCGVTVCY
FT                   AMKANPFLISVLDKKLDKFEVCSPGEFAICEKEGINREKIVLSGVNKEKKDILYTMKTG
FT                   AVGIYTVESLNQLELINSCAVECGIKVKVLIRVTSGNQFGINERQVYEIADRKDELKGI
FT                   ILEGIQCYSGTQKKKLSQIEAEVVWLQAIAHTCEAEHGVELKEIEYGPGLSVDYFVTDK
FT                   CDAMNTDFDELKEFAVMIKEMSEKFNVTLEMGRYIAATCGILISRIADMKMNDTTRYAI
FT                   IDSGINHINYYGQAMAMKKPRCEFIPMEYTEGFADGVDHEVEVYSQGVQPYNICGSLCT
FT                   VGDVIVKNLELKDAKIGDMIAFYNIGAYSVTEGIYLFLSRRMPAIVMYSMKNGYRIVRN
FT                   PVDTFLINSVSTQ"
FT   gene            131322..131597
FT                   /locus_tag="EUBELI_00116"
FT   CDS_pept        131322..131597
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00116"
FT                   /product="Hypothetical protein"
FT                   /note="Psort-B: Cytoplasmic, score:8.87; Gene3D:IPR009081;
FT                   superfamily:IPR009081"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00116"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71153"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z1W3"
FT                   /protein_id="ACR71153.1"
FT                   /translation="MFSVHRCVINNFFARFIMDQLLDILNEINSDVDYEVCDTLIDDGI
FT                   FSSFDIVSLVGELNDAFDIDITPVDIVPENFNSAEAMWEMIQRLQD"
FT   gene            131621..133210
FT                   /locus_tag="EUBELI_00117"
FT   CDS_pept        131621..133210
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00117"
FT                   /product="Hypothetical protein"
FT                   /note="Psort-B: CytoplasmicMembrane, score:10.00; COG1696
FT                   Predicted membrane protein involved in D-alanine export;
FT                   HMMPfam:IPR004299; ScanRegExp:IPR000568"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00117"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71154"
FT                   /db_xref="GOA:C4Z1W4"
FT                   /db_xref="InterPro:IPR004299"
FT                   /db_xref="InterPro:IPR024194"
FT                   /db_xref="InterPro:IPR028362"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z1W4"
FT                   /protein_id="ACR71154.1"
FT                   /translation="MSLVSTGFLVFLLVGVIVYYLIPKKAQWAWLLILSYAYYLCSGYK
FT                   TVVFILLTTIVTFTSGILLERTEDNLAKSLKAEGLAREDKKALKEKAKTYKKRVVVLAL
FT                   LLVFGVLAVVKYHNFAIENVNGIIKAFGGNGRISTFTLLLPLGISFYSFQSISYVIDVY
FT                   RGKVKACNNIFKYALFVSYFPQITQGPIGRYDRLAPQFFAEHKYDLVVIQHGLQRMAWG
FT                   LFKKFIIADRAGVVSDLVFNNPGQYHGIYVIIGVLAYCAQLYGDFAGGIDMVMGASEMF
FT                   GIHLDDNFRQPFFSHSIGEFWRRWHITLGTWMKDYVFYPFSLSKAMNKLGKFFKKHSKT
FT                   RFGKYMAKALPICLADLLIFFIVGVWHGAAWKYIVYGMYNGIIMSFSSIMAPVYEKMFK
FT                   ITHINKNARWYRGWQIIRTFILVNISWYFDNAATLTDAFRLMGNTFKHASLSMDAVVKM
FT                   SGSQLDLIILLVGCFVWLIISILKEKGIVIREALDRKPLIIRWAVYIALVMSVAMLGYI
FT                   SNTSGGFMYAQF"
FT   gene            133229..134305
FT                   /locus_tag="EUBELI_00118"
FT   CDS_pept        133229..134305
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00118"
FT                   /product="Hypothetical protein"
FT                   /note="Psort-B: Cytoplasmic, score:8.87;
FT                   superfamily:IPR013830"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00118"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71155"
FT                   /db_xref="GOA:C4Z1W5"
FT                   /db_xref="InterPro:IPR036514"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z1W5"
FT                   /protein_id="ACR71155.1"
FT                   /translation="MKKKAFKEILKYVRVIVFFAVITILVEAVNYVMVQPGYARYIIHT
FT                   VDNPDDGSDYDCIVVGASHGRASIDPHYFLEMEYAVNPINMCIQGATVIDNYYMIREAC
FT                   NNNDVKKIILELDYQYWDKNLKRDSDFGDLLVYGQLPFTSLKMEYIVNQLMDKDFRTIY
FT                   FRRYAFAKNWKTAKKYMATKKTDEYKNFQIEGVAGIDTEGPYQGLGFFYRTKVTDKKGK
FT                   INPSPWTYDDLNPKVQKYFQKIVKYCKDNGIELICVTTPIPPSSVASGAANEANTYFRQ
FT                   ICDENNVKYIDGNLIKNEVLDVSDDDFSDWEGHMNGELAEQFSEILTEILMKEDNSEYF
FT                   YSGYDECIEAIKVRGNEN"
FT   gene            134295..135350
FT                   /locus_tag="EUBELI_00119"
FT   CDS_pept        134295..135350
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00119"
FT                   /product="Hypothetical protein"
FT                   /note="Psort-B: Cytoplasmic, score:8.87"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00119"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71156"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z1W6"
FT                   /protein_id="ACR71156.1"
FT                   /translation="MKTKVLKYIRVVVFIAVIAGLVKCIDFAMMPSGYIRYIIHAAGNP
FT                   GTEEGYDCIILGASHGRSSINPKYMIKSGYAKNPLSLCIPGESVVNSYYLLKEACRNNA
FT                   VKKVVLEMDYQYWTNDEARDSEFGDLFEYVQLPMSKVKLEYIRDELIDKDFRTVYFKKL
FT                   AYTSDFSEVKYNIKTKLTKEYRDYDISAVKVCDANGPYMGRGFFYRENNNDNKCDFWVQ
FT                   EWTEDDISRKVIKYFQKIVDYCKDNHIEMVCITEPITPTAVVKGPSRDANTFFKDICSN
FT                   NNVRYIDFTLLKNDVFDITDNDFCDWEGHMYGEAAERFSGIMSEVLANGNEEYFYDSYK
FT                   AKIDEIERKKP"
FT   gene            135374..136396
FT                   /locus_tag="EUBELI_00120"
FT   CDS_pept        135374..136396
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00120"
FT                   /product="Hypothetical protein"
FT                   /note="Psort-B: Cytoplasmic, score:8.87;
FT                   superfamily:IPR013830"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00120"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71157"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z1W7"
FT                   /protein_id="ACR71157.1"
FT                   /translation="MAVIAGMILIMDYALVPSGYIRYIIHETNNAGSDDGYDNIIIGAS
FT                   HARSAINPVKLDEAGVSDNAFNLAIPGETVTDSYYLLMESDRHNNVKRVIYDLDYQYWC
FT                   NYAEREFEDCFIYTWLPFSNVKLKYIADNLLTKDFRTVYSKRWAYEISPSAIMNNLKVK
FT                   SSAAYRNYSMDAVEIHDAGGPYAAKGFFYRDMKMDSLVPSDIVAWDESGISDKVLDSFE
FT                   KTVQYCKKNNIELVCVTSPITPTTSVNGYSEQAGAYFTRLCEEYGVEYYDFNLLTMDTL
FT                   PRTDDDFFDEEGHMLGELADRYSDILASVLLDKCDKSTAFYGTYAQLELAVYENYVTKQ
FT                   "
FT   gene            136581..136667
FT                   /locus_tag="EUBELI_00121"
FT   tRNA            136581..136667
FT                   /locus_tag="EUBELI_00121"
FT                   /product="tRNA-Leu"
FT   gene            137064..142259
FT                   /locus_tag="EUBELI_00122"
FT   CDS_pept        137064..142259
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00122"
FT                   /product="Polysaccharide Lyase Family 9 candidate pectate
FT                   lyase with C-terminal cell surface anchor"
FT                   /note="Psort-B: Extracellular, score:9.75; NOG06154 non
FT                   supervised orthologous group; HMMPfam:IPR003961;
FT                   Gene3D:IPR008957; Gene3D:IPR012334; HMMSmart:IPR003961;
FT                   superfamily:IPR008957; superfamily:IPR011050"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00122"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71158"
FT                   /db_xref="GOA:C4Z1W8"
FT                   /db_xref="InterPro:IPR003961"
FT                   /db_xref="InterPro:IPR006626"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR036116"
FT                   /db_xref="InterPro:IPR039448"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z1W8"
FT                   /protein_id="ACR71158.1"
FT                   /translation="MKKNRKRIVAAFMTVLMALTLVPTWLLGGVFATTAKADDAVYTAT
FT                   SGTIGDYFKLQNKVVDDAGNSAKVYLLDGKEVKSKGRIKLGTVESSKDTGSITFTVAEG
FT                   KKAKVEVWAISANSTTDSEIGIFTSSGDVKAKAISYATKNKKLGDIEYGKAKNGIELTV
FT                   SADELTAGDYYIATVKGAAQPSNVYYVRVTETSAGPVVGDKPSVKADSVKAVYNSETGK
FT                   IDVTWEAAVEGSGSSVFNIYVNDSKNPVKSVPCTEYSYSYEPTASGEYTFTVKGALGTD
FT                   EEETGATGKTTCTLPLSAPTVKATRVPTDGTKINVEASGSEAEKYEFSVYDSDKKLVKT
FT                   VEAEAKDGKAATTVEGLKEGYKYYVSATAVRGEEKKESDGEKMASVMPYAEKDTSQAIP
FT                   GMTVINTNDADNSKTVSLTIVRENGTIKAGQTSGKSSKIEKTGIKYGSLIAAPATTKDF
FT                   TFSATIKVTGAERGTSTSKQQGVYLGAFADTKQATKDIISAELGTDGKAYSAYIGIKKD
FT                   GEFDRDGGVDAKLDTEYKVTITRTGSVYTYSVKNKNDDVVMQESVTATADALKEGGAAI
FT                   PAIALVGATATITNIKLTVDGKAEVDAANFTGSFNPFVDNWAIVDAPVLSDVTTEENKK
FT                   DGKITIKVDEEISPVGAAEVSVDMIDAEGKVVDTKVASSTGASVTFEPKASGDYSFKAY
FT                   ATRPTETTKKESESITVKGFVLPIKAPVVNARTATDSKVEVYWDAVPEANTYKVEYKKN
FT                   GDESFAVLTEGTTALSAMTPSLTAGETYIFKVTATRTSDGQSKTSNDVIFTVADHEQFV
FT                   WKFSAFGQGVTINEDKLNDKKKSNNGYSGSVNTGDGSVNVWSVGSKGKLVPASTDGVAF
FT                   YYATIPANKNFTLTATANVNSWTYTNGQEGFGLMAADAVGTNGDSSVFWNNSYMASATK
FT                   VEYYSSVDEETGVASVSKTSGDKISMKLGIGSQEKIGVTNDNIDKLKDNDTDTVTNEFK
FT                   TSMSTLDTSKLGSEAGTYNLIGNYTNTDSTFVGTTVENPITTIKLTIQKNNTGYFVSYT
FT                   DANGNTTTKKYYDTEALSKLDADNVYVGMFASRTCDVTYTDISLTTIDPADDAPAEERP
FT                   VEYKDVVLSVSSASTSSSENYKLKGMSNVDGHVVVTKGEEVVGEGDVKASEAFAFDTKL
FT                   KVGDNKFVVTLTPDENFKFGDYELPTSYDPVEVSKTVTYAYFTGDLIYVSAEATAAVDE
FT                   AKANETYSSKAQINSGKGTKGNPIDIYNAVAYAKAGQKILLLAGDYKVANNLLIPFGID
FT                   GTSEKPIYMMPEQAGTRVVLDFAGTTGEGITLCGNYWYIQNIDVTNSANGKDGIHVAGS
FT                   YNVLDSVNTYNNGNTGIQISRFSNVQAKSDWPAYNTIKNCTSHNNADAGYEDADGFAAK
FT                   LTIGKGNVFVGCIAHNNADDGWDLFAKVETGNIPAVVIMNCVAYANGYLEDGTDAGNGN
FT                   GFKMGGSSLAGGHVLLNSVAFENKAKGIDSNSCPDNVVVSSTSYNNNNYNIALYTNDAK
FT                   NTDYTAYGALSYRNKYQSVSDSFKAKGTQDAAKLYQATDYYWKAASGDANEASTALTDS
FT                   SFVSVNTNSVNVDTATALTETATLLADTASAIKYTAEPVTRNADGTINMNGIMMLTAET
FT                   RAALGAGVGADALDKAPQLTAESKQILINALGEEEFNRIASLSFASPVLSREGNEGTLT
FT                   KDSSNMALMMILLMASVAAAAGVVVFEKKRRMAR"
FT   gene            142373..143353
FT                   /locus_tag="EUBELI_00123"
FT   CDS_pept        142373..143353
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00123"
FT                   /product="Hypothetical protein"
FT                   /note="Psort-B: Unknown cell location; COG5279
FT                   Uncharacterized protein involved in cytokinesis, contains
FT                   TGc (transglutaminase/protease-like) domain;
FT                   HMMSmart:IPR002931; ScanRegExp:IPR001680"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00123"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71159"
FT                   /db_xref="GOA:C4Z1W9"
FT                   /db_xref="InterPro:IPR002931"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z1W9"
FT                   /protein_id="ACR71159.1"
FT                   /translation="MKRRIVSAGFVLIITACMWISMTTFAADVDIKAESEDKGYVYCES
FT                   GEQALAKVNEYLDDVCWDDRTGIYVVYPGNDVSGSVTVNNNHSIADSYADFIFDVQVSN
FT                   EKITLQGAGYNLLNVKRCAYETHSYGLTREQALEADAVADEIVNKCNAESTLDKISYIY
FT                   NYLCENVVYDSAYEFGSIYDALVGGKTVCSGYAAAFQVMMEKLGIPCKIMAGNVNGTAH
FT                   AWNAVNVSGKWYYVDATFANTMGMRADYLLFGSDRRADVYGIGVVGRDYDSSDETVAEE
FT                   VSENIDDNGNEADKNSLVYVAVIAAGVLAAGAAAGWGVLRKRNKM"
FT   gene            143460..146255
FT                   /locus_tag="EUBELI_00124"
FT   CDS_pept        143460..146255
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00124"
FT                   /product="Hypothetical protein"
FT                   /note="Psort-B: Unknown cell location; COG3291 FOG: PKD
FT                   repeat; HMMPfam:IPR000668; BlastProDom:IPR000668;
FT                   HMMPanther:IPR013128; HMMSmart:IPR000668;
FT                   ScanRegExp:IPR000169"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00124"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71160"
FT                   /db_xref="GOA:C4Z1X0"
FT                   /db_xref="InterPro:IPR000169"
FT                   /db_xref="InterPro:IPR000668"
FT                   /db_xref="InterPro:IPR025660"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="InterPro:IPR040528"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z1X0"
FT                   /protein_id="ACR71160.1"
FT                   /translation="MKRKNLLGVLLSAVLSISAMGVIPHMVYADTNSDMGNDYTGYAGG
FT                   YIAGNLDDNTPIYEPEYVTYADSLIPEKYPDNMDEFKVKYPALRDQGSYGACWAFSSIG
FT                   LAEFDLINDKTKDSKVDLSELQLAYFTYNSVLDPLGGTEGDYTKYHSENTNTSYLNAGG
FT                   NYQWAMKRFSQWVGTVNENDVPYDNALDSISYGLDDKYAYGYDVAHLQNAFEIDIKSQT
FT                   QDVKQQIIEHGAVGVSYTHKNAGVNYINKSYYDTSDTVIGYGDGGHAVMVVGWDDNYSK
FT                   DNFTSTNSAGETVKPSNNGAWLVRNSWGESTSYYNQLDYFWMSYETYSLNTTAWVFDFS
FT                   ANDGFDNNYQIDGGLENQVDYYYDNVANVFTVGSKEGVKSETLKSVSLLFSQTANVGYT
FT                   IDIYTDMTDSLNPLSGTRTSGANGVTSYAGYYTIPLDNEVELKPGSTFAVVVKTDKKAI
FT                   EYEYTWSTQQDINSSNSTVIWEREVSKNFDGNQRSLYYSYGKFGVSPWNNYCIKAFTSD
FT                   NYYKSDAEEVKIAKTVIENALKDVEADNELTDTDIQRIIDEALSKAGILEIKTKVTDFK
FT                   KAEATIEKAGSIDASIAVTYGSAADTVVYSTVIKQLPKPAPEPVKRNGLCKADDGNYYY
FT                   YVNNVIDTGFTDIIPFEDEWVYVENGKLNFDYTGIRENMNGWWRIENGKVNFNFTGLAN
FT                   NENGRFYIENGRVNFNYTDVIPDGNDWVYVQDSKVMYDYTGIRENMNGWWRIENGKVNF
FT                   NFTGLANNENGRFYIENGRVNFNYTDIIPDGNDWVYVQDSKVMYDYTGIRENMNGWWRI
FT                   ENGKVNFNFTGLANNENGRFYIENGRVNFNYTDIIPDGNDWVYVQDSKVMYDYTGIREN
FT                   MNGWWRIENGRVNFNFTGIASNENGEFYIVNGKVDFGYNGSYIKDGISYMVLNGKVVYK
FT                   Y"
FT   gene            146347..150027
FT                   /locus_tag="EUBELI_00125"
FT   CDS_pept        146347..150027
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00125"
FT                   /product="Polysaccharide Lyase Family 1-like pectate lyase"
FT                   /note="Psort-B: Extracellular, score:9.73; COG3866 Pectate
FT                   lyase; HMMPfam:IPR002022; Gene3D:IPR012334;
FT                   HMMSmart:IPR002022; superfamily:IPR011050;
FT                   superfamily:IPR013784; K01728 pectate lyase"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00125"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71161"
FT                   /db_xref="GOA:C4Z1X1"
FT                   /db_xref="InterPro:IPR002022"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="InterPro:IPR041253"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z1X1"
FT                   /protein_id="ACR71161.1"
FT                   /translation="MKRFFRKGVGVIASIALAVGTITSMVTPGIVASGASLTDNNFSSV
FT                   GGFNESIYAQITGIKDADVTGVSYTGTSSGTLTGQDLEYLVRDKNNGVRVDIPGVTPGT
FT                   YTLTVTTKNGTITKSGITVDAQDRSGYAHFNYTDGVGAYNDDGTLKNNAIVLYVTDENK
FT                   NDVTLTYGGVTVKGIGNILNSVGKACGEAGHETDCKKVSDGKTYYAKGNTNQGIIEKLA
FT                   EAGIPLDIRFIGTVSDSGLYKSGTFDLKSNSGLIDGLTAYDSNDFGGSDGDNGHMARIK
FT                   SGKDITLEGIGTDAVIDGWGFHYMSESAKPDLGKSFEVRNLTFINTPEDAIGMEGVQEK
FT                   ANVSSDLSASVERCWIHNNEFYCPDVSSPAESDKSEGDGSVDFKRGQYFTCSYNYFEGC
FT                   HKTNLVGSSDASLQFNLTYHHNYWKLCKARGPLTRNANVHMYNNIFEGQTDYAMNVRVN
FT                   AYIFSEYNLFYMSKNPQRDDTDAGVIKSYNDSFSSCIGSMDGVKVTDKSQTVDNKCRFA
FT                   ARNIDYSKFDTDSNLSYIPTGDYQLQTSITEARKVIESKTGVLNENPVAASVVTMSQIS
FT                   YLPSGVTPENITSLPTTLTPGKVSKTVYAFTVGGTVDVTINYASDALSDTGVLVNEAGE
FT                   SFLIASGTAVNLPAGTYMIQPYNVQAGDGKKMQNPTFKTVTINSIEIRANDPNAHYHDF
FT                   KLVSTTDATCDKEGSKIYKCSCGEKKIEIIAKTAHKYGEWVIEKEATETETGIKIRTCT
FT                   VCNNKETQTIPVKGTVDPTPTPTPGGTYSYNFTSPETGSDIYKIKGNTSTSKGSVQYAG
FT                   LTLTTCLKMEGSTSVDFTAPSDGTLTLVFGANGSAVSGKKVKVNETVYTCDSDGIVTVP
FT                   VKAGSVSITKGDAIFLFYMNYEPDSTTPDPTPDPDPTPDPTPTPEVKNGLQKADDGNYY
FT                   YYVDGKVDTSFTDIIPDGDDWVYVENGKLNFDYTGIRENMNGWWRIENGKVNFNFTGLA
FT                   NNENGRFYIENGRVNFNYTDIIPDGNDWVYVQDSKVMYDYTGIRENMNGWWRIENGKVN
FT                   FNFTGLANNENGRFYIENGRVNFNYTDIIPDGNDWVYVQDSKVVYDYTGIRENMNGWWR
FT                   IENGKVNFNFTGLANNENGRFYIENGRVNFNYTDIIPDGNDWVYVQDSKVMYDYTGIRE
FT                   NMNGWWRIENGKVNFNFTGIASNENGEFYIKNGRVDFGYSGLYRQWNTTYIIVNGKVVG
FT                   K"
FT   gene            150147..150926
FT                   /locus_tag="EUBELI_00126"
FT   CDS_pept        150147..150926
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00126"
FT                   /product="Hypothetical protein"
FT                   /note="Psort-B: Unknown cell location; NOG09872 non
FT                   supervised orthologous group"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00126"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71162"
FT                   /db_xref="InterPro:IPR025536"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z1X2"
FT                   /protein_id="ACR71162.1"
FT                   /translation="MNKDIKIIIAAHKKYDMPSDKMYIPVQVGSEGKKDIGYQRDNIGE
FT                   NISAKNPMYCELTGLYWAWKNLDADYIGLAHYRRHFKGKNKSANIMDNVLSYKEASDLL
FT                   DKHDILVTKKRNYIIETLYSHYAHTHHVETLDCTRDVIKDIYPDYLDSFDKTMKKTHMH
FT                   AFNMFVMKKELLNDYCDWLFNILFEVEKRLKDKTYDAFQARYPGRLSEMLLDVWINKNE
FT                   LGYKEVPFMYTEKIDRVKKVKSFLKAKFLKQKYNGSF"
FT   gene            150955..152070
FT                   /locus_tag="EUBELI_00127"
FT   CDS_pept        150955..152070
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00127"
FT                   /product="Hypothetical protein"
FT                   /note="Psort-B: Cytoplasmic, score:8.87; COG0438
FT                   Glycosyltransferase; HMMPfam:IPR001296"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00127"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71163"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z1X3"
FT                   /protein_id="ACR71163.1"
FT                   /translation="MCIKVLVFGMTDNPGGMESCVMNYYRNIDNKQVHFDFLCNWEHMV
FT                   YEDEVKSNGSVVYTIPQKSSDFKAYKKAMHDFFSQHAKDYDVLWYNTCTLANIDYLMYA
FT                   KKYGIKKRIIHAHNSGNETSKLRGILHYINKTRLKKYATDYWSCSMSASNYFYNNKIIM
FT                   SHRHHVINNAIQVKQYAYNEHVRNDMREELGLKDKYVIGHVGRFQYQKNHEFLIDIFNE
FT                   YLKLDSDAFLMLVGQGENEGVIRDKVKELGIQDNVMFMGVRSDVHKLMQVMDVFLLPSR
FT                   FEGLPLVLVEAQAAGLKCFTSKDVVSDECNVTQSVRFISLDSGAKVWADNILSFKEDTE
FT                   FISRDDYAYKVTQAGFDINAETDKIKKYLNE"
FT   gene            152085..152366
FT                   /locus_tag="EUBELI_00128"
FT   CDS_pept        152085..152366
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00128"
FT                   /product="Hypothetical protein"
FT                   /note="Psort-B: Unknown cell location"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00128"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71164"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z1X4"
FT                   /protein_id="ACR71164.1"
FT                   /translation="MGNKYYINIKMKENNNAGSKAVNDCNNILKQCGIEPYTLNIKGEG
FT                   LLGKINKVFEFEKLKKIPENSVLFIQHPIYINKNYYIDVLKNTKKKKI"
FT   gene            152408..153130
FT                   /locus_tag="EUBELI_00129"
FT   CDS_pept        152408..153130
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00129"
FT                   /product="Hypothetical protein"
FT                   /note="Psort-B: Cytoplasmic, score:8.87; NOG17355 non
FT                   supervised orthologous group"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00129"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71165"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z1X5"
FT                   /protein_id="ACR71165.1"
FT                   /translation="MFPESQHIFEHIDETMYEIADYVIAHNSKMKRYLIEHGVEESKIY
FT                   ELGIFDYLTNINPNNKSIRYSKTLNIAGNLDANKSNYIRELNGVDKTINFNLYGLNFDK
FT                   NVLTSEAIHYKGAFPSDEIPSQLTEGFGLVWDGNTASCCAGNTGEYLKYNNPHKLSLYM
FT                   VSGLPVVIWSQAAEAEFVKCNNVGLVVDSIEDFSIKFDNLSENDYYKMVENAKNVSYKL
FT                   RNGEYLRKVIQDIIKDLK"
FT   gene            153165..154382
FT                   /locus_tag="EUBELI_00130"
FT   CDS_pept        153165..154382
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00130"
FT                   /product="Hypothetical protein"
FT                   /note="Psort-B: CytoplasmicMembrane, score:9.99; NOG33934
FT                   non supervised orthologous group"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00130"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71166"
FT                   /db_xref="GOA:C4Z1X6"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z1X6"
FT                   /protein_id="ACR71166.1"
FT                   /translation="MKKIFKKKEFFMYTLLSAYIFLTTFSNTAWYVINEGTKVYALLKL
FT                   IRYVCYIMFVAIVIGKNVKHRYSIESIIFMMGLLIFSGIAACTGKEKVLLFMVLFLAAS
FT                   YGVKSDKILKCALGVQGGLLFLTIFAAFLGITDNSLLDVERKRYSLGFAWSSLAPILYF
FT                   FVIMLYIYARKTKITLIECLVLEIINIFIYKYTNTRMSFWVSTILLAVLATCLFSIKFK
FT                   DALYRLIIRLKKMIVLIPVISSVISCMLPLYTANGGVWEKLNTILSGRLWQCKNAIFTY
FT                   GFSLFGVHMSVDGFTVANKGATDTSCFIDMGYLHIAIEYGLFVLVMIVSIYTICIWKAY
FT                   KNNDICMVCIIVVLSLFCINDRFLLHAFNVFIIYAFCDNDVFKEINILKSMSKPIYKII
FT                   GMKRDN"
FT   gene            154387..155844
FT                   /locus_tag="EUBELI_00131"
FT   CDS_pept        154387..155844
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00131"
FT                   /product="polysaccharide transporter, PST family"
FT                   /note="Psort-B: CytoplasmicMembrane, score:9.99; COG2244
FT                   Membrane protein involved in the export of O-antigen and
FT                   teichoic acid; HMMPfam:IPR002797; K03328 polysaccharide
FT                   transporter, PST family"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00131"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71167"
FT                   /db_xref="GOA:C4Z1X7"
FT                   /db_xref="InterPro:IPR002797"
FT                   /db_xref="InterPro:IPR029303"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z1X7"
FT                   /protein_id="ACR71167.1"
FT                   /translation="MGKQKSLKLNFIMNAILTMSSFLFPLITFPYVSRVLLPAGTGRVS
FT                   FANSVITYFVMISQLGIPTYGIRACAVVRDNREKLKKTVNELLIINTVMSVFAYVVFFA
FT                   ALFSVPRLRSDKTLFVVMSLLIFFNTIGVEWLYKALEYYTYITVRSIIFKFIALIAMFV
FT                   LIHDVNDYVIYGGISIFAASASNVFNFIRLRKIVGSEKVGKLDFKQHLKPVFTFFIISC
FT                   ATTIYTNLDNVMLGFMKDDVEVGYYNAATKIKNILVSIVTSLGTVLMPRASYYIQQDMW
FT                   DEFYALSKKAIKFVLLAATSMMVYFMIFAREGVLFLSGDAFEGAIMPMIIIMPTLLFIG
FT                   LTNIMGIQMLIPMGQENAVMISTFVGAIVDLVLNTILIPQLGANGAAIGTLAAELVVLI
FT                   VQMVYLRKDISFLYAKQSYIKILLALVISSAVAYIIKILSVGIFIKLVISAIVFFGIYV
FT                   VALYLMKEEIVRDNADKVIKKVFKRNK"
FT   gene            155801..156982
FT                   /locus_tag="EUBELI_00132"
FT   CDS_pept        155801..156982
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00132"
FT                   /product="UDP-galactopyranose mutase"
FT                   /note="Psort-B: Cytoplasmic, score:8.87; COG0562
FT                   UDP-galactopyranose mutase; HMMPfam:IPR006076;
FT                   HMMPfam:IPR015899; HMMTigr:IPR004379; K01854
FT                   UDP-galactopyranose mutase"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00132"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71168"
FT                   /db_xref="GOA:C4Z1X8"
FT                   /db_xref="InterPro:IPR004379"
FT                   /db_xref="InterPro:IPR015899"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z1X8"
FT                   /protein_id="ACR71168.1"
FT                   /translation="MQIKLLKKFSKEINKRRKEDIFMYDYLVVGSGLYGAIFAHEAKKA
FT                   GKSVLVVDKRPNIAGNIYTEKQEGINVHMYGAHIFHTNNKKVWDYITQFAEFNRFTNSP
FT                   VANYKGELYSMPFNMYTFNKMWGVVTPEEAAAKIEEQKKEITGEPKNLEEQAISLVGRD
FT                   IYEKLVKGYTEKQWGRDCKELPAFIIKRLPVRLTFDNNYFNALYQGIPMGGYTKMIENI
FT                   LDGIEVRLNTDYLEHKEELDAIADKVVYTGPIDAYFDYKLGTLEYRSVRFENETLDKPN
FT                   FQGNAAVNYTDRETPWTRIIEHKWFEFGKDEDGNDLPKTIISREYSSEWKPGDEPYYPV
FT                   NDEKNGKLYEEYKKLADSEDKVIFGGRLGEYKYYDMDTTIASVLDKCESVFGK"
FT   gene            157002..158012
FT                   /locus_tag="EUBELI_00133"
FT   CDS_pept        157002..158012
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00133"
FT                   /product="Hypothetical protein"
FT                   /note="Psort-B: Cytoplasmic, score:8.87; COG0463
FT                   Glycosyltransferases involved in cell wall biogenesis;
FT                   HMMPfam:IPR001173"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00133"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71169"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z1X9"
FT                   /protein_id="ACR71169.1"
FT                   /translation="MEKSKVKQTDISVIIPAHNASDYIERAIKSIITQTDMSWEIIIVE
FT                   NGSTDDTYIKSMKYAEKYSNINIFQSEKGVSKARNYGLKKATGKWICFLDADDYIYPDA
FT                   FNEIYKYMEDESDLILFGHNSETHMVKGKCVKFDGNEEYQNLRCEMIKNPTQNMTVWGK
FT                   LFKHQIIEKNKIEFDEQLELAEDSDFTFRYMQNASKALRITSQLYHYSKDNASTVRTYK
FT                   AGSEEKYIKSLNHTKEYTIKDTKEIQEAYNQYIIANLLIILVHDIYCHENPESSKQRRN
FT                   HLKKLVRENIFSEAIKNIKFSDCRNIRMIPALCLKLKMYFLTIIMIKIRVYQNTK"
FT   gene            158032..159114
FT                   /locus_tag="EUBELI_00134"
FT   CDS_pept        158032..159114
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00134"
FT                   /product="Hypothetical protein"
FT                   /note="Psort-B: CytoplasmicMembrane, score:9.99; COG3274
FT                   Uncharacterized protein conserved in bacteria;
FT                   HMMPfam:IPR002656"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00134"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71170"
FT                   /db_xref="GOA:C4Z1Y0"
FT                   /db_xref="InterPro:IPR002656"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z1Y0"
FT                   /protein_id="ACR71170.1"
FT                   /translation="MTNNRIIKLDIARTFAIICVVLCHCSQMVYTQQSVLIKDLGFMSR
FT                   VFFMATFTIGRLGVPIFLYLSGVLLLEKSIEKDEDIFRFYKNNLLPLLIVNEVWIVIYN
FT                   VYNIFVLKGTFLVTNFIKELLLLKNSDMLNMWYMPMIIGVYIGVPFLAKIVKSFSFKSF
FT                   KPIMIVMFIFFFIVPALNVFSSIFGINQTFGSGMNVAYMGGTYGLYLLVGYYIYNRKCD
FT                   RLKNWMLVVLSLISFFIILYVEVYSLYNAYGSIYYVWYDFPFLLICTGGLFVLFTRIKD
FT                   EYVNKNIARLFTYISRISMGIYFVHSLIILAEIKYIGQMTGKLSLDVFLLMAITIITSV
FT                   FIVWIFSKNRCLRKYMFMIK"
FT   gene            159285..159629
FT                   /locus_tag="EUBELI_00135"
FT   CDS_pept        159285..159629
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00135"
FT                   /product="Hypothetical protein"
FT                   /note="Psort-B: CytoplasmicMembrane, score:9.99"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00135"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71171"
FT                   /db_xref="GOA:C4Z1Y1"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z1Y1"
FT                   /protein_id="ACR71171.1"
FT                   /translation="MYKKLLILASVSPMWQIGNGIFILISGYFMANKGKDIDLTKMSKK
FT                   LLIQMGFTSITLTVMSMIYSFVSQSHQAKILNFNIFNDMAWFIGYYFAVIVLVKVSLTI
FT                   GFLNGIKRIK"
FT   gene            159684..159944
FT                   /locus_tag="EUBELI_00136"
FT   CDS_pept        159684..159944
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00136"
FT                   /product="Hypothetical protein"
FT                   /note="Psort-B: Unknown cell location"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00136"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71172"
FT                   /db_xref="GOA:C4Z1Y2"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z1Y2"
FT                   /protein_id="ACR71172.1"
FT                   /translation="MAIKTSRVINYLGASTFMVYLIHDNQFFYDIWRNLDWLAILHNNP
FT                   GLYIIKNIYWVIIMFALGVASYTAYILIEKLFKLIKPIAIK"
FT   gene            160099..161529
FT                   /locus_tag="EUBELI_00137"
FT   CDS_pept        160099..161529
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00137"
FT                   /product="undecaprenyl-phosphate galactose
FT                   phosphotransferase"
FT                   /note="Psort-B: CytoplasmicMembrane, score:10.00; COG2148
FT                   Sugar transferases involved in lipopolysaccharide
FT                   synthesis; HMMPfam:IPR003362; K00996 undecaprenyl-phosphate
FT                   galactose phosphotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00137"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71173"
FT                   /db_xref="GOA:C4Z1Y3"
FT                   /db_xref="InterPro:IPR003362"
FT                   /db_xref="InterPro:IPR017475"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z1Y3"
FT                   /protein_id="ACR71173.1"
FT                   /translation="MFEYTNKTRDNIQNMILFFTDSLCMLLAYYISGVLWLIAYRKYSV
FT                   YDTLSMLRGSFVTVLFAVIITALFVNVSSDFVIRGKFEELKSVLQKSLVFAACVAVYEL
FT                   IRKTSEIPRGVYIFTIIVGGILMYLTRYIVKWYLVARNKSKMHASRVILVTMKDRAQLD
FT                   VKLINKDEDWVRTVAGIVIVDDNMVGEEFEGINVVANTHTMMRYIKNEVVDEVFIDLDY
FT                   KLREQIRPMVMELEDMGIMVHLRVEVLDSFKDFDTSLGHLGRIPVITFANRIFDYKELL
FT                   VKRCIDIFGGIIGIVIMFIAMIFVAPALKLESKGPLFFKQKRVGKNGRYFYIYKFRSMY
FT                   VDAEDRLKDLMEQNEMSGLMFKMTDDPRITKVGKFIRKTSIDELPQFINVLKGDMSLVG
FT                   TRPPTVNEFKQYEGHHKRRLSMKPGLTGMWQAYGRNTVQDFEDVVKMDLEYIDNWNIGL
FT                   DFRIIFKTILTVITVGGK"
FT   gene            161519..163021
FT                   /locus_tag="EUBELI_00138"
FT   CDS_pept        161519..163021
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00138"
FT                   /product="Hypothetical protein"
FT                   /note="Psort-B: CytoplasmicMembrane, score:9.99; COG1316
FT                   Transcriptional regulator; HMMPfam:IPR004474;
FT                   HMMTigr:IPR004474"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00138"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71174"
FT                   /db_xref="GOA:C4Z1Y4"
FT                   /db_xref="InterPro:IPR004474"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z1Y4"
FT                   /protein_id="ACR71174.1"
FT                   /translation="MASKVWIMSSKTAKKRKKKNSQALMISGLVLSAVQFIVSVVMIVF
FT                   IHYIGLIPTSIKVAAGIILIGCSLITAITQRWKVLGIITKVLSVILSVIMVVGCAYLGF
FT                   TRGYLGKMTGKKTQTDIVGVYVLSGDVAQSLEEINGYTCGRIPTLDSDNLEKMLDDISN
FT                   KDVALSYKDYTSIMDAVDALLNKEVKSIIINESYLGVFEDMDGYENLESRIRCIYSEKY
FT                   VTQVEDSNSKYMSNENVIGIYISGIDTSGPPNTTSRSDVNILLFMNTKTHQILMINTPR
FT                   DYYVPLSISNGVRDKLTHAGIYGIDCSRETLEMLYGINVEYYLKVNFTGFLNVIDALGG
FT                   VDITLDYDATLSQTGNLTVHKGVNHFNAQQALTFSRERHAYADGDRQRGKNQMMVINAV
FT                   IKKMASPSMITNYTSILNTVSDNMITNMSYDKISELAQLQISKNIDWDIQSYSVSGEGA
FT                   SATTFSAGKQKLYVMVPYEDQVKQATAYLEQMCRDEIINVSE"
FT   gene            163051..164814
FT                   /locus_tag="EUBELI_00139"
FT   CDS_pept        163051..164814
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00139"
FT                   /product="Hypothetical protein"
FT                   /note="Psort-B: Cytoplasmic, score:8.87; NOG35854 non
FT                   supervised orthologous group"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00139"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71175"
FT                   /db_xref="GOA:C4Z1Y5"
FT                   /db_xref="InterPro:IPR025101"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z1Y5"
FT                   /protein_id="ACR71175.1"
FT                   /translation="MNSRKESGFTYIVRTAFCYALSILIAIAFITIVSMGLDTMQMAGK
FT                   AKSLKADLGELTASINEKDFERADVATDKLDSTVDDIDELLAGKTWRTAAKMPVVGEYV
FT                   GAVDSLVDIVKIATGRMIKPALTVIQDYPLDSIKVGDEGFNTYTMEAYIGLLEELNPAI
FT                   NDIIGYLDDINIPDSLGGKVTEYTDKMTLITDAYAVAEDYLPLLKAFLGGGSDRTYLLA
FT                   AQNSTEIRAGGGFPGSIGTITIVDGVLTIGDFNSVYDVLPYGTPASVGPSELENTLFGN
FT                   WMHYPRDASFNPDFERVAEIWAKAYGNKSNTTVDGVISLTPTIIQRLLSYMGEVQLSDG
FT                   TVLNGENATQMLQHDLYYKYFNNASYTDGTNDVVDSLFAETAKTTMSRLVDDFDLNKIA
FT                   GYLSVFNAGAEDRTIMMWMADETEQQYVRDVGCSGGLNDNPENPEIGVYISGSDPCKLG
FT                   WYVNVNTQIGEAQVNEDGTRTYDVTVTVENTIDNNTIKTAGTYILGSYEGAWRGYIHLF
FT                   APAGGTISDVKADSNGGFRKSKYENLEVAYNLNVMIYPQKSMNITYKVTTAEGVTTVPK
FT                   VSMTPTLQGYR"
FT   gene            164862..165398
FT                   /locus_tag="EUBELI_00140"
FT   CDS_pept        164862..165398
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00140"
FT                   /product="Hypothetical protein"
FT                   /note="Psort-B: CytoplasmicMembrane, score:9.99"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00140"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71176"
FT                   /db_xref="GOA:C4Z1Y6"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z1Y6"
FT                   /protein_id="ACR71176.1"
FT                   /translation="MEVCIVNRVIKKLNITMIIGILAVWVSGSLFHFVYDWTGHNTLVG
FT                   LFFPTNESTWEHMKLAFLPMNLYGIYTWYALKDRFAASGFAILLGANVATWAIPFLYYT
FT                   YMGVLGFSKMWLDIATFFVAVLTGFAVEYHVLRHAGHESFVLGTWIMAIVDFVMAAAFV
FT                   SCSYGAPALGIFAKP"
FT   gene            165516..165884
FT                   /locus_tag="EUBELI_00141"
FT   CDS_pept        165516..165884
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00141"
FT                   /product="GntR family transcriptional regulator"
FT                   /note="Psort-B: Cytoplasmic, score:8.87; COG1725 Predicted
FT                   transcriptional regulators; HMMPfam:IPR000524;
FT                   Gene3D:IPR011991; HMMSmart:IPR000524; K07979 GntR family
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00141"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71177"
FT                   /db_xref="GOA:C4Z1Y7"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z1Y7"
FT                   /protein_id="ACR71177.1"
FT                   /translation="MFTIDVMSRVPVYEQLIKQVEDQVLKGIMKEGDKMPSVRSLSMEL
FT                   STNPNTIQKAYMELDRRGILVSVPGKGSFISAEALKIVGNQSKEKLSDLKEIVRKLAYA
FT                   GVSKSEITDMIEEVYKKI"
FT   gene            165881..166792
FT                   /locus_tag="EUBELI_00142"
FT   CDS_pept        165881..166792
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00142"
FT                   /product="antibiotic transport system ATP-binding protein"
FT                   /note="Psort-B: CytoplasmicMembrane, score:9.49; COG1131
FT                   ABC-type multidrug transport system, ATPase component;
FT                   HMMPfam:IPR003439; BlastProDom:IPR003439;
FT                   HMMSmart:IPR003593; K09687 antibiotic transport system
FT                   ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00142"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71178"
FT                   /db_xref="GOA:C4Z1Y8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z1Y8"
FT                   /protein_id="ACR71178.1"
FT                   /translation="MIEVKGVTKSFDDFTALDNVTCNIAEGCIYGMVGSNGAGKSTLLR
FT                   VLSGIYKADKGEAIIDGINVYENTYMKNKLVFVADELFFLAGANMKSMAKFYSSIYDNF
FT                   DMDRFAELTKTFGLDPSKSISNFSKGMKRQAAIILALSTRAKYMFFDETFDGLDPVMRN
FT                   LVKKLICGDVAENNATVIVTSHSLRELEDLCDHLSLLHKGGLVLDSDVFELKTSQFKVQ
FT                   VAFKDDFDESKFEGIRITRYRQEGSVANMIVSGDREQTMDIINAMNPVVFDVLPLTLEE
FT                   VFTYEMEALGYTFDVKGDKTHE"
FT   gene            166785..168890
FT                   /locus_tag="EUBELI_00143"
FT   CDS_pept        166785..168890
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00143"
FT                   /product="Hypothetical protein"
FT                   /note="Psort-B: CytoplasmicMembrane, score:9.99"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00143"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71179"
FT                   /db_xref="GOA:C4Z1Y9"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z1Y9"
FT                   /protein_id="ACR71179.1"
FT                   /translation="MNNKKVFSFHMFLQTLKQTRLAGFIMMAVITLISVVPIISSLSYI
FT                   KEYKQVNNVGGISGNYFLVLVFIIVVPVISLIVWSFLNKRSSSDFYHSIPYTRLCIYLS
FT                   KTAAILTWIAGILVVSYVSQAVLFMANRQYFNVDYATMFRMYLSIFICSLLCMAIINVS
FT                   ISITGNILSNICVTGLIMFLPRFIALMVTELTVFHGETYMISNSGVGLLDSSNNMIVGW
FT                   VFSVFDIYNGPSGIADMVLSLTSNLYTLVLALIYIALGALLFVKRKSETAGKAANGKVL
FT                   PMIIRTLIGFSIAFIGVMIAYTSIDNDETIAVVVLFIVSALVVFVYECIVSKKMNVIKQ
FT                   CIPSILLGYVLAVVIGTGANSFGKYEASYEPDASKLAYVSIQPMDMYYASDNGYFSSIS
FT                   SKVQFTDEEILKYVSEKFGAYKDKCISNGVHNYIYNGRGSVTNYKVGFRQNGVTHYRRI
FT                   QLTDSDANKLSSLLKKDEKFVKAYMDLPDSDKISVNYITGNMEDSDCKDIYETITSEIK
FT                   QIGFEKWYQTVTSDVDTFLMSVRFSKKGVTYDMVLPISKNMPQSYNKYIGIRNEYAIRN
FT                   NEKELGTMSDILKQYLNDSSRTWDKYTSGYETLSAVLVYNDTRTYINMDSYVRKDEEKA
FT                   QKVLNGLIESLDKKNFNKNINADNPCIVLNYEKYNPDNGETVLADAIIQLNGYTRTEDY
FT                   ISDIDYY"
FT   gene            complement(169082..169336)
FT                   /locus_tag="EUBELI_00144"
FT   CDS_pept        complement(169082..169336)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00144"
FT                   /product="Hypothetical protein"
FT                   /note="Psort-B: Unknown cell location"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00144"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71180"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z1Z0"
FT                   /protein_id="ACR71180.1"
FT                   /translation="MNNSENLPTDNNNKSIVKGQTMYNWETHDNQDKVILDSINAIERK
FT                   REHMTDEQLRKAYTELQTGLGPDIYSQLCDRKASDNFQG"
FT   gene            169464..170204
FT                   /locus_tag="EUBELI_00145"
FT   CDS_pept        169464..170204
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00145"
FT                   /product="Hypothetical protein"
FT                   /note="Psort-B: Cytoplasmic, score:8.87; COG0463
FT                   Glycosyltransferases involved in cell wall biogenesis;
FT                   HMMPfam:IPR001173"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00145"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71181"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z1Z1"
FT                   /protein_id="ACR71181.1"
FT                   /translation="MVNLDGMLSIVMPAYNEEKLIYNSIKETLRIVEKFVPELEIVVVN
FT                   DGSRDNTKSEIEKAVKEDDRVRMISSTKNRGKGNAIIAGVSQVEGKYVAFVDADLELNP
FT                   SQLEGYLQKMLDDNKDVVIGCKFHKDSKLDYPFKRKVISMGYYIMLLVMFHLNVRDTQT
FT                   GLKVFRVEAIKPVAHLVRTSGFAYDIELLVAIHRRGFTIAQMPVEVVYVRDSGSRRIGM
FT                   KDIWQAFIDTWAIFGRVYFKHYYD"
FT   gene            170245..172059
FT                   /locus_tag="EUBELI_00146"
FT   CDS_pept        170245..172059
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00146"
FT                   /product="Glycoside Hydrolase Family 25-like
FT                   lysozyme/endolysin"
FT                   /note="Psort-B: Unknown cell location; COG3757 Lyzozyme M1
FT                   (1,4-beta-N-acetylmuramidase); HMMPfam:IPR002053;
FT                   BlastProDom:IPR002053; Gene3D:IPR013781;
FT                   HMMSmart:IPR002053; K07273 lysozyme"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00146"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71182"
FT                   /db_xref="GOA:C4Z1Z2"
FT                   /db_xref="InterPro:IPR002053"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR018077"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z1Z2"
FT                   /protein_id="ACR71182.1"
FT                   /translation="MKGFIEGLAGKLAVVWKSVFVAHAKICIITGAVAVSGTAATVTGV
FT                   EYVKHNNTKNVVQAQETEHESETETESERLDKLNKILAETQEETAEEESSSVEELESLM
FT                   EEALSSDDTTSEELNQIIEAVADSGAGPVAVKDIEELEVVEDNSSEPSREDAEVSDSGT
FT                   EETSSSDQIYEVNQLVYGIDVSRWQGDIDWSKVAADGITFAMIKCGGGDDGLYEDRKFK
FT                   QNIQGALANGIQVGIYFYSGATDAKTAYDEASFCINLIKDYQITYPVAFDWELDGDYNS
FT                   VTEACETFCNVIKSYGYQPMVYSNRNRWYNNFNGEKLSNKFKVWMAAYWSEYYYTSTRW
FT                   TYGDDLASFKWHYDMWQYGVTDTVDGIDGYVDMNIAFFGYANYKVNGAQDAALTVTNTN
FT                   ITRYLGHDSGKLNEGVDFMSGVKGVNSIGYEMDVDYDIINSSGNSVDEEDALSQPGRYT
FT                   VRYSFKDPKSGNITKDAVLNIVDVTAKFVTPDINVQSDVSGRLPAGFSFVNGVSGTNSL
FT                   SENATLTQYEVIKRNIATGEEITMSPEQALANVYDVKNYTYSVVYYFDVPKDGTVKQTA
FT                   VMTVIVKETETEKETQKETTEETVINNK"
FT   gene            172141..174129
FT                   /locus_tag="EUBELI_00147"
FT   CDS_pept        172141..174129
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00147"
FT                   /product="Glycoside Hydrolase Family 25-like
FT                   lysozyme/endolysin"
FT                   /note="Psort-B: Unknown cell location; COG3757 Lyzozyme M1
FT                   (1,4-beta-N-acetylmuramidase); HMMPfam:IPR002053;
FT                   BlastProDom:IPR002053; Gene3D:IPR013781; K07273 lysozyme"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00147"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71183"
FT                   /db_xref="GOA:C4Z1Z3"
FT                   /db_xref="InterPro:IPR002053"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR018337"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z1Z3"
FT                   /protein_id="ACR71183.1"
FT                   /translation="MFSLKKLFKKDTISEQEVVSQDSEYEILEITELSFIQTAKIWLQN
FT                   FFRVKKHVIITAVSGGAVVVAVAGIVITVSVVSRIGKQKSTDVAAAIEDTSTQMETAEE
FT                   MKAPVLSLYLEAVADENTITASVYGEDGEILSGHNLVFNLLSGSKEDNEEQIEKLKSAY
FT                   AGQNVEDVDKEVYEDDDKDGTVLMPDLETGTYTLVVQAEEGYKTPDAAEATVETFAVMD
FT                   DIMEKVVADSAATQKEDPSKNRSNSSPAVSVPETTASAGEVNVTVLKKSGDNIIYKITG
FT                   RSTMQLTDDEAARYTAGPVLIDDHSVSAYSGYIYETGKIQITGGQADVVTKFLVPERNI
FT                   SAENVEMINNTTVFADNLKETAAGTKETQSETKTTGESTKSEETSKTEETTKGENTKPS
FT                   DNQSMAARKNYVLLSLEAETETVYADGWQNIQGKTYYFRNSQAVTGWNQIDALQYYFNG
FT                   DGSLGSHLVIDVSTYNGDIDWNRVKAAGIDYAIIRVGYRGYETARLVKDKRFDTNMRNA
FT                   TAAGVKVGAYIVTQAVNTNEAVEEASFIISACSGYNVSLPLAIDVESAGNGSGRGDKIS
FT                   VAERTAVINAFVQTIRGAGYSAMVYANKDWMTNRINAGGLASGSTVWLAQYRSSCTYGG
FT                   SYQMWQFTESGSIPGISGNVDMSAWKY"
FT   gene            174203..175666
FT                   /locus_tag="EUBELI_00148"
FT   CDS_pept        174203..175666
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00148"
FT                   /product="Hypothetical protein"
FT                   /note="Psort-B: Cytoplasmic, score:8.87; COG5651 PPE-repeat
FT                   proteins"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00148"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71184"
FT                   /db_xref="GOA:C4Z1Z4"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z1Z4"
FT                   /protein_id="ACR71184.1"
FT                   /translation="MRSNMSKNDEQLVKLIKDVVSGNQDKEVFCKEFYKEVYALVYPVF
FT                   GDNSKKVTSRAFIYLCNNIDKIDVSKNIHRQVATLVSAFMFGLIDKNTIKNNVTGLEYE
FT                   FNRIKEDAELYNIIRDNVKMFRNPADYDNTSEAIRSLSRVQTILLELYGYEMHSVDEIE
FT                   ELLDVDSAFICELIVKTKAQMLGVELETEESEYEEENGSDDEYEADRYETEDGAQPDAL
FT                   YYESEETDDDSEPEDDEKSYFEDDDIEDDSDEHPFRRTKADRSAAMRRADASNPVVRKL
FT                   AGVVGKLFPSLSQAARRIVVYVAGGVILFAIVLCVFLSAVLSGDSKTAAKKNNNSNNTR
FT                   VTTAETTTSKEKVTQAKATKKADDTTAADNEAVKETTKADESTEENTKRPNKATIKDAE
FT                   EETVEDSASGIDDNNGGEEEKDEKETEPSTEATEATTKVTEETEATEETTKATEATKAT
FT                   ETTKATDETKTTEAVDNTTVAADVNANNN"
FT   gene            175720..178092
FT                   /locus_tag="EUBELI_00149"
FT   CDS_pept        175720..178092
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00149"
FT                   /product="mannose-1-phosphate guanylyltransferase"
FT                   /note="Psort-B: Cytoplasmic, score:8.87; COG0662
FT                   Mannose-6-phosphate isomerase; HMMPfam:IPR001250;
FT                   HMMPfam:IPR001538; HMMPfam:IPR005835;
FT                   BlastProDom:IPR013794; Gene3D:IPR014710; HMMTigr:IPR001250;
FT                   superfamily:IPR011051; K00971 mannose-1-phosphate
FT                   guanylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00149"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71185"
FT                   /db_xref="GOA:C4Z1Z5"
FT                   /db_xref="InterPro:IPR001250"
FT                   /db_xref="InterPro:IPR001538"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z1Z5"
FT                   /protein_id="ACR71185.1"
FT                   /translation="MKCVILAGGSGDSLWPLSRRQFPKQFMKIKEGRSILQETVVRNMP
FT                   FCEEFIIVTNESYKNIVNGQMKAFQSLKYRVILEGTPKGTGAAVLLGTMFANPSELVLV
FT                   VNSDNLIEGDGYKDSIIEAKEYAKEGYLAVLGIKPESQSSTYGYILRDKENVKKFIARM
FT                   DFDEDETEGLLGYDYDEGYLWNSGILVFRAGDMTNAARRLASELYTTCKTAKRKVPAIR
FT                   RSVRFSETVMKSMPHGSIETLLLEKCDSIKVVEAHFEWMDVGNASDLAEFGNNIKSECV
FT                   IKNDCDNVNIINNAPKRLVVANDLRDLVVVNTDDATYVSSKKSADNIKQIMKDNMDTYE
FT                   AFFDYNRTTYKEWGIQEILNYSQGYKVRKLTVFPGMSMSLHRHEKRTEHWSIVEGIATI
FT                   TLGNETADYNKYESVFIPVGTKHRIANKTDKNVVVIEVGIGDNISDTDLVKIYNKDNPQ
FT                   ASANYVRLDKSPIAKLEPAFKDNLWGGTKIRDVYGKKCDYDVIGESWELSAHPDGQSRI
FT                   ADGRYKGMLFNEYLNIIGKEALGWKCQAQDRFPILIKFIDAKQALSIQIHPDDEYALEN
FT                   ENEYGKNEMWYVVDSEPGSYLYCGLSRDASKEEILERINNNTITDILNKIEVKAGDVVM
FT                   VKAGTIHAIGAGVFICEIQQNSNCTYRMYDYDRRDKFGNPRELHVKKALDVVDNHKYVK
FT                   DNKTEVVIARNEHFTEERLVQCKYFEVYKYDVNDEAKITVDEASFVSVLFINGSGTIET
FT                   DDYEKTMEFKAGDSFFVSAGLRSIIVKGQATMVVTRV"
FT   gene            178163..178909
FT                   /locus_tag="EUBELI_00150"
FT   CDS_pept        178163..178909
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00150"
FT                   /product="dolichol-phosphate mannosyltransferase"
FT                   /note="Psort-B: Cytoplasmic, score:8.87; COG0463
FT                   Glycosyltransferases involved in cell wall biogenesis;
FT                   HMMPfam:IPR001173; K00721 dolichol-phosphate
FT                   mannosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00150"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71186"
FT                   /db_xref="GOA:C4Z1Z6"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR039528"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z1Z6"
FT                   /protein_id="ACR71186.1"
FT                   /translation="MLSVVIPTFNESKNIRNLVAQIDVALKGVDYEIVFVDDSKDNTPD
FT                   VITEVAKEYPQVRMEHRKNGTGLATAVLDGFKLAKGEYMACMDADLQHPPIVLKYMYKA
FT                   MESGADFCIPSRLIPGGDDGGLNWYRKFVSGTARKIGQVMLPCLRKISDPTSGLFMFRR
FT                   EVIENADLQPIGWKIMVEVLAMGTYSKVVEIPYKFQQRTEGESKLSGKVTLEYLKQLKN
FT                   LRKRYNKSNRYEVEIWSTERMMKGDK"
FT   gene            179001..180017
FT                   /locus_tag="EUBELI_00151"
FT   CDS_pept        179001..180017
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00151"
FT                   /product="UDP-glucose 4-epimerase"
FT                   /note="Psort-B: Unknown cell location; COG1087 UDP-glucose
FT                   4-epimerase; HMMPfam:IPR001509; HMMPanther:IPR005886;
FT                   HMMTigr:IPR005886; K01784 UDP-glucose 4-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00151"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71187"
FT                   /db_xref="GOA:C4Z1Z7"
FT                   /db_xref="InterPro:IPR005886"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z1Z7"
FT                   /protein_id="ACR71187.1"
FT                   /translation="MAILVTGGAGFIGSHTVVELQNAGYDVVVVDNLVNSSRKSLDRVE
FT                   KITGKKATFYEADINDAAALNEIFEKESIDSVIHFAGLKAVGESVAKPLEYYMNNISGS
FT                   LTLFDVMRNHGVKNIIFSSSATVYGDPAFVPITEECPKGEITNPYGKTKGMLEEILTDI
FT                   QKADPEWNVILLRYFNPIGAHESGTIGENPNGVPNNLMPYITQVAVGKLKELGVFGNDY
FT                   DTHDGTGVRDYIHVVDLALGHVKAIEKLNDNPGIAIYNLGTGNGYSVLDIVKNFEAATG
FT                   IHIPYVIKARRPGDIATCYCDAGKAERELHWKAERDLKTMCADSWRWQKNNPNGYDD"
FT   gene            180028..181380
FT                   /locus_tag="EUBELI_00152"
FT   CDS_pept        180028..181380
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00152"
FT                   /product="phosphoglucosamine mutase"
FT                   /note="Psort-B: Cytoplasmic, score:8.87; COG1109
FT                   Phosphomannomutase; HMMPfam:IPR005843; HMMPfam:IPR005844;
FT                   HMMPfam:IPR005845; HMMPfam:IPR005846; FPrintScan:IPR005841;
FT                   HMMTigr:IPR006352; ScanRegExp:IPR005841; K03431
FT                   phosphoglucosamine mutase"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00152"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71188"
FT                   /db_xref="GOA:C4Z1Z8"
FT                   /db_xref="InterPro:IPR005841"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR006352"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR016066"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4Z1Z8"
FT                   /protein_id="ACR71188.1"
FT                   /translation="MGKYFGTDGFRGEANVTLTVDHAFKVGRFLGWYYGKNHEDGKAKI
FT                   VIGKDTRRSSYMFEYSLVAGLTASGANAYLLHVTTTPSVSYVARTEDFDCGIMISASHN
FT                   PFYDNGIKLINAAGEKMKEDVIAEIEKYLDGELGEIPYATRENIGCTVDYTAGRNRYMG
FT                   YLMSLAIYSFKGIRVGLDASNGSAWTLAKAVFDALGAKTYVINAAPDGTNINANCGSTH
FT                   IEGLQDLVRREHLDVGFAFDGDADRCLCVDEKGEVITGDHILYIYGCYMKDRDKLVGNK
FT                   VVTTVMSNFGLYKAFDAVGIEYEKTKVGDKYVYECMSENGYRIGGEQSGHIIFSKYATT
FT                   GDGIITALKMMEVMLAKKKTLSELAAPLVIYPQVLKNIRVTDKTQAQDDADVKAAVEAV
FT                   ANALGTDGRILVRESGTEPVVRVMVEAGSTEECEKYVDQVIDVIKSKGYAV"
FT   gene            181747..182178
FT                   /locus_tag="EUBELI_00153"
FT   CDS_pept        181747..182178
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00153"
FT                   /product="Hypothetical protein"
FT                   /note="Psort-B: Unknown cell location"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00153"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71189"
FT                   /db_xref="InterPro:IPR025748"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z1Z9"
FT                   /protein_id="ACR71189.1"
FT                   /translation="MCGKLWGKVVTVVLALLIIMPACAMTGCSGSKEPDNKTSVDYTVV
FT                   ENADLPEELKKLIESKKDKVMRLTYTTKDYTYVVAGYGTRETSGYSIKVNDVYTGDNAL
FT                   YIDLNLIGPAAGEAVNEVETYPVIVLKMERREESVVFKM"
FT   gene            182250..183782
FT                   /locus_tag="EUBELI_00154"
FT   CDS_pept        182250..183782
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00154"
FT                   /product="Hypothetical protein"
FT                   /note="Psort-B: Cytoplasmic, score:8.87; COG1388 FOG: LysM
FT                   repeat"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00154"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71190"
FT                   /db_xref="InterPro:IPR024300"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z200"
FT                   /protein_id="ACR71190.1"
FT                   /translation="MAQITLDDDFNVPDTKDDIELIVKEWGNVQTDSVKVNKDKATVDG
FT                   ELKFSLLYIGASSDSERMQPVKMTGKMSFSENVNLSGDCTGDYVTCQASIEDLSIKAIN
FT                   SRKISVKAIVTLKLICESLQDIQMITGVDETENTDIQQLKEELEFVQLAVNQRDNFRIR
FT                   ENVSLPAGKPEIQEIIWDDVDVRNLNTRLADDGLKLAGDLDIFVMYIGNGETGNVQWYE
FT                   TTASFEGSLDISGCNADMIPYVNFQIIGKTVEERPDLDGENRDIAVEVVLDMDVKAYEE
FT                   RKKDVIADIYSPSYDMEIENADTQLRCLVVRNNVSSRVSGNLQLENYADLMQICNCTAT
FT                   VQLDDVTYKEGELVAEGVVSANVFYITSSDSQPLGSVHTIIPFAGTVKIDGVSNDSLEY
FT                   NIKPSVQQLSATINSAGVIEVKSSVSLDVIVFRNFEYSGIKSAYMSEEKCDLSKMPSMT
FT                   GYIADGTKTLWDVSKMYHTTADSIKASNPKCADGLSESVIIPRGTKLLLVKA"
FT   gene            complement(183833..184435)
FT                   /locus_tag="EUBELI_00155"
FT   CDS_pept        complement(183833..184435)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00155"
FT                   /product="Hypothetical protein"
FT                   /note="Psort-B: Unknown cell location; NOG19502 non
FT                   supervised orthologous group"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00155"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71191"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z201"
FT                   /protein_id="ACR71191.1"
FT                   /translation="MSLNGVNSNYQAYETNTVSGSDKKVSTKEISKTTAYSDVAATYEH
FT                   ASQSEGLVATVNKKASNASIVAQLKADQETRMAQMQSLVTKMFSKQGITIGTAVDMWKA
FT                   LAGGNFTADADTIAQAKEDISENGYWGVKQTSERIFSFAQALAGDDEEKMTKMKEAFEK
FT                   GFKEATKTWGKELPDISQNTRDAVLKKFDDYFAGKNS"
FT   gene            complement(184502..185884)
FT                   /locus_tag="EUBELI_00156"
FT   CDS_pept        complement(184502..185884)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00156"
FT                   /product="multidrug resistance protein, MATE family"
FT                   /note="Psort-B: CytoplasmicMembrane, score:9.99; COG0534
FT                   Na+-driven multidrug efflux pump; HMMPfam:IPR002528;
FT                   HMMPanther:IPR002528; HMMPanther:IPR015522;
FT                   HMMTigr:IPR002528; K03327 multidrug resistance protein,
FT                   MATE family"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00156"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71192"
FT                   /db_xref="GOA:C4Z202"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z202"
FT                   /protein_id="ACR71192.1"
FT                   /translation="MAKPISEDKRNMILNGNLFHAILMLAIPVMINSFIQSMYNLTDTF
FT                   WLGRIGTENQSAITLVSPFQNILINFGNGITTAGAILISQYLGAREDEQANSMANHICL
FT                   TSLAFSVLCALICWLVSPGLVKWLGAEGSIYKYGLTYIRIVVLDLPFLFTINLFTSVKQ
FT                   SQGDTVKPMLLNMFGVVINLILDPLFLMVFKWGIGGAALATLIAKIPCAVIALIVLTRP
FT                   GQLIRIDFRGFKFDKSKMGSIVKIGLPTAIGGSTMQLGFLLMTKNVNAYGFIATSAYGI
FT                   GNKINSIITMPANGIGSAISTIVGQNIGARQKDRADKAYHYALRMGALFLLFFGLILSR
FT                   RFISQTMVTFFSTDERVIPLATDFLSLMAFWCWSNAFYNVTQGLFQGSGHTMITMIVDA
FT                   SRIWIFRLLTLWVCANVLNMGVESVWYAVVISNGTSAAILYGLYWTGIWKKSTIKIEKT
FT                   EG"
FT   gene            complement(185971..186183)
FT                   /locus_tag="EUBELI_00157"
FT   CDS_pept        complement(185971..186183)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00157"
FT                   /product="Hypothetical protein"
FT                   /note="Psort-B: Unknown cell location"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00157"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71193"
FT                   /db_xref="GOA:C4Z203"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z203"
FT                   /protein_id="ACR71193.1"
FT                   /translation="MCPYPCTTTGITSFYPLNIKILRHILEHIISPYLKYICVYYSNFS
FT                   VLLAIFFRLIVEITVFYAYIMYKRL"
FT   gene            186100..186933
FT                   /locus_tag="EUBELI_00158"
FT   CDS_pept        186100..186933
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00158"
FT                   /product="AraC family transcriptional regulator, L-rhamnose
FT                   operon transcriptional activator RhaR"
FT                   /note="Psort-B: Cytoplasmic, score:9.98; COG2207 AraC-type
FT                   DNA-binding domain-containing proteins; HMMPfam:IPR000005;
FT                   HMMPfam:IPR013096; FPrintScan:IPR000005; Gene3D:IPR012287;
FT                   Gene3D:IPR014710; HMMSmart:IPR000005; ScanRegExp:IPR000005;
FT                   superfamily:IPR009057; superfamily:IPR011051; K02854 AraC
FT                   family transcriptional regulator, L-rhamnose operon
FT                   transcriptional activator RhaR"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00158"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71194"
FT                   /db_xref="GOA:C4Z204"
FT                   /db_xref="InterPro:IPR003313"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="InterPro:IPR037923"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z204"
FT                   /protein_id="ACR71194.1"
FT                   /translation="MFQDMSKDFDIKRIKRSNTSCSTGVGAHVHPFNEIFYLSSGECTS
FT                   FIDHNIYKFGKGDLVIVPSGCLHRTTYNGKGMHERIVISFRNEATEWIQNQTGKELMEN
FT                   CMKPGVVNIPEKRRDYVVALLDKLIFENDSPDELSPAFIKVGLIELLLFIIRCKNYEEN
FT                   VIKEIDVDNRIIQEVATYIYEHYADNLSLEYVADKFNLSRSYLSKKFKTATGFGFKEYI
FT                   INVRIQNACNLLLETNKSITDIAFECGFNDSNYFGDAFRKAKGISPHKYRKNETF"
FT   gene            187024..187890
FT                   /locus_tag="EUBELI_00159"
FT   CDS_pept        187024..187890
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00159"
FT                   /product="4-diphosphocytidyl-2-C-methyl-D-erythritol
FT                   kinase"
FT                   /note="Psort-B: Cytoplasmic, score:8.87; COG1947
FT                   4-diphosphocytidyl-2C-methyl-D-erythritol 2-phosphate
FT                   synthase; HMMPfam:IPR006204; HMMPfam:IPR013750;
FT                   Gene3D:IPR014721; HMMPIR:IPR004424; HMMPanther:IPR004424;
FT                   HMMTigr:IPR004424; K00919
FT                   4-diphosphocytidyl-2-C-methyl-D-erythritol kinase"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00159"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71195"
FT                   /db_xref="GOA:C4Z205"
FT                   /db_xref="InterPro:IPR004424"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4Z205"
FT                   /protein_id="ACR71195.1"
FT                   /translation="MESIRLKARAKINLGLDVIGRRENGYHDVRMVMQTVGLYDRIIMT
FT                   RIPEEEIRIKTNIGFLPVNENNLVYKAIMLMKNKYKLDGGIEVDLNKFIPVAAGMAGGS
FT                   SDAACALFGMNRLFELNVPMRELMKLGVEIGADVPYCLMRGTALAEGIGEKLTRLPDMP
FT                   FCHILIAKPPVNVSTKLVYEKLDNTDVKLHPDIDGIIEAIKLKDVALVASRMGNVLESV
FT                   TIPLYPVIDSIKKDMIEHGAINAMMSGSGPTVFGIFPDEQSMIACQQFLRQKGEARQVY
FT                   TTETFTP"
FT   gene            187943..188611
FT                   /locus_tag="EUBELI_00160"
FT   CDS_pept        187943..188611
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00160"
FT                   /product="Mn-dependent transcriptional regulator"
FT                   /note="Psort-B: Cytoplasmic, score:8.87; COG1802
FT                   Transcriptional regulators; HMMPfam:IPR000524;
FT                   HMMPfam:IPR011711; FPrintScan:IPR000485;
FT                   FPrintScan:IPR000524; Gene3D:IPR011991; HMMSmart:IPR000524;
FT                   K03709 Mn-dependent transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00160"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71196"
FT                   /db_xref="GOA:C4Z206"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z206"
FT                   /protein_id="ACR71196.1"
FT                   /translation="MKGELKMDVNDYLPLRDVVFNTLRQAILRGEMEPGERLMEIQLAD
FT                   KLGVSRTPIREAIRKLELEGLVIMIPRKGAEVAHITEKDMRDVLEVRAALEELAATLAC
FT                   RNVTPERIEELKMANKRFEAAIISKDVVAIVDADVNFHDIIYAMTDNQRLIQIINNLRE
FT                   QMYRYRLEYVKDARAHSILISEHNDIIDKLSKKDEENTKIVIRQHITNQEKGIIRLLNK
FT                   "
FT   gene            188688..189371
FT                   /locus_tag="EUBELI_00161"
FT   CDS_pept        188688..189371
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00161"
FT                   /product="stage II sporulation protein R"
FT                   /note="Psort-B: Unknown cell location; NOG13215 non
FT                   supervised orthologous group; HMMTigr:IPR014202; K06387
FT                   stage II sporulation protein R"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00161"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71197"
FT                   /db_xref="GOA:C4Z207"
FT                   /db_xref="InterPro:IPR014202"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z207"
FT                   /protein_id="ACR71197.1"
FT                   /translation="MDIIPDMKIYQGGKYHMNIKKKLGILLIVIIAVSGLVGYYRVSYA
FT                   GNLEAVTEGISESIIRFHVRANSDSQEDQEVKLKVKEAVVDYIRPALSESDSLSESRTI
FT                   LEAEGDNIRNVAIKTLRDNGFMEDVSVYFEKSYFPVKSYGDVTFPAGYYEAFRVDIGDA
FT                   EGKNWWCVLYPPLCFVDAVYGVVPEDSKEKLAGVLTDEEYKTVTDRGCKVRFKYLTFIN
FT                   ELLGL"
FT   gene            189352..189885
FT                   /locus_tag="EUBELI_00162"
FT   CDS_pept        189352..189885
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00162"
FT                   /product="Hypothetical protein"
FT                   /note="Psort-B: Cytoplasmic, score:8.87; COG4506
FT                   Uncharacterized protein conserved in bacteria;
FT                   HMMPfam:IPR015231; superfamily:IPR011038"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00162"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71198"
FT                   /db_xref="InterPro:IPR012674"
FT                   /db_xref="InterPro:IPR015231"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z208"
FT                   /protein_id="ACR71198.1"
FT                   /translation="MNCLGYKQSVEESRLNNKDKVFIKIKGLYTGTMDEEASCEGEEVE
FT                   VIESQDDEVEVINVGTYSVVNGKEYIRYEEVYDDSQERSSSIIKIDGDSVEVTKKGVVS
FT                   TKMRFTMGSKNMTYYQTPYGNMSLGIITKSLEIERTEDTISIYLVYGMEVNCEHLSDCD
FT                   MQITITTRELRIDE"
FT   gene            189878..191365
FT                   /locus_tag="EUBELI_00163"
FT   CDS_pept        189878..191365
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00163"
FT                   /product="nicotinate phosphoribosyltransferase"
FT                   /note="Psort-B: Cytoplasmic, score:8.87; COG1488 Nicotinic
FT                   acid phosphoribosyltransferase; HMMPfam:IPR015977;
FT                   HMMPIR:IPR007229; HMMPanther:IPR007229; HMMTigr:IPR006405;
FT                   K00763 nicotinate phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00163"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71199"
FT                   /db_xref="GOA:C4Z209"
FT                   /db_xref="InterPro:IPR006405"
FT                   /db_xref="InterPro:IPR007229"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR036068"
FT                   /db_xref="InterPro:IPR040727"
FT                   /db_xref="InterPro:IPR041525"
FT                   /db_xref="InterPro:IPR041619"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z209"
FT                   /protein_id="ACR71199.1"
FT                   /translation="MNSTFFFEKGVVMKKQFDERNLTMVMDFYELTMANGYFKDEDKER
FT                   KVAFDVFYRKNPDNAGYAIFAGLEQIIEYIENLHFDEDDIEYLRGQGLFGEEFLAYLAD
FT                   FKFRGDIYSFPEGTIMYPNEPVITVVAPLLDAQLVETAILLQVNHQSLIATKTRRIVRS
FT                   AKGRAVSDFGARRAHNMDAAVYGARAAYIGGAVGTATVLAGQMFNIPISGTMAHSWVMF
FT                   YRDEFEAFKHYAENYPDATVLLVDTYDVVKSGIPNAIRCAKEVLEPMGKRLKGIRLDSG
FT                   DLAYLSKKVRKMLDDAGLTDCKIVVSNSLDEWTIMSILEQGGCIDSFGVGERLITAKSD
FT                   PVFGAVYKIAAVEENGVFQPRIKISENVEKITNPGLKKVYRIYDENKKAIADLIAGADE
FT                   VVDLSKPYRYVDPVKPWKNRYFENCTAVELQQLVVKNGKRVMDRVSIDEIKKYVQDQLT
FT                   DNIWEEEQRFENPHNHYLDMSPAYYDMKMSLLHKLTD"
FT   gene            191571..191789
FT                   /locus_tag="EUBELI_00164"
FT   CDS_pept        191571..191789
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00164"
FT                   /product="Hypothetical protein"
FT                   /note="Psort-B: Unknown cell location"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00164"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71200"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z210"
FT                   /protein_id="ACR71200.1"
FT                   /translation="MAEVGLAREISAESDGAKGTKQEFVGRWSECVGICYFQTVGSASA
FT                   LSEHTSRSEAVNLVSATHFHERERVWK"
FT   gene            191897..192337
FT                   /locus_tag="EUBELI_00165"
FT   CDS_pept        191897..192337
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00165"
FT                   /product="Hypothetical protein"
FT                   /note="Psort-B: CytoplasmicMembrane, score:9.75"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00165"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71201"
FT                   /db_xref="GOA:C4Z211"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z211"
FT                   /protein_id="ACR71201.1"
FT                   /translation="MPVWSIVLLIVIAVLIAALVALTIVGRKLQKKQEANNAQLEAAKQ
FT                   VMSMLVIDKKMMKLKDAGLPKMVLDQTPKALRGRKMPIVKAKIGPRVMSLMCDPKVYDQ
FT                   IPIKAEVKAEVSGIYIVGIKSVRGGKIVVPEKKKKGLFKKNK"
FT   gene            complement(192996..193733)
FT                   /locus_tag="EUBELI_00166"
FT   CDS_pept        complement(192996..193733)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00166"
FT                   /product="1-acyl-sn-glycerol-3-phosphate acyltransferase"
FT                   /note="Psort-B: CytoplasmicMembrane, score:9.75; COG0204
FT                   1-acyl-sn-glycerol-3-phosphate acyltransferase;
FT                   HMMPfam:IPR002123; HMMSmart:IPR002123; K00655
FT                   1-acyl-sn-glycerol-3-phosphate acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00166"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71202"
FT                   /db_xref="GOA:C4Z212"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="InterPro:IPR004552"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z212"
FT                   /protein_id="ACR71202.1"
FT                   /translation="MIRLILIVIFAIIIFFASLIMLPIFWLIGKFNQDAKDRGSLRFVQ
FT                   GVFKVVLFLSGVTTTVKGLENLPKDKEAVLFVGNHHGFFDTIISYTYMKPRTGFVAKKE
FT                   IEKVPLLNIWMRYLYCLFLDRKNMKEGLKTILTGIDYLKAGTSIVIFPEGTRNKSIDGV
FT                   LPFHAGSFKLAEKSGCKIIPMVQNNTAAALEDHLPFFKKTHTVLEFGKPIDVASMDREQ
FT                   KKTLAKDVQDLIEKMYEENKALV"
FT   gene            complement(193791..194819)
FT                   /locus_tag="EUBELI_00167"
FT   CDS_pept        complement(193791..194819)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00167"
FT                   /product="thiamine biosynthesis lipoprotein"
FT                   /note="Psort-B: Unknown cell location; COG1477
FT                   Membrane-associated lipoprotein involved in thiamine
FT                   biosynthesis; HMMPfam:IPR003374; K03734 thiamine
FT                   biosynthesis lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00167"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71203"
FT                   /db_xref="GOA:C4Z213"
FT                   /db_xref="InterPro:IPR003374"
FT                   /db_xref="InterPro:IPR024932"
FT                   /db_xref="InterPro:IPR042159"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z213"
FT                   /protein_id="ACR71203.1"
FT                   /translation="MKKLNKITYFSYVILVILILGFLLTACQKPAVTLTTPESVNGFKL
FT                   NTFVQIDSYSGIPKKTLNEALNLCDYYENIFSRTKEDSELSRVNSNQTTDISKELYELI
FT                   SAGLEYAALSNGAFDITIGSVSSLWDFTAESPKVPDSGRIAEALTHVDYTRVSVSDNGD
FT                   GTYSISKPDDVILDLGAVAKGYIADKIKDFLEENGVKHAIINLGGNVLCIGKKTNTDNF
FT                   GIGVRKPFAANNEVLVALSVDDSSVVSSGNYERYFYADDGTFYHHILNPATGYSYDNDL
FT                   SDVTILSKDSLTGDCLSTTCFCLGLEDGMKLIESLDGIEAIFVTNEGEIHYSSGAKAYV
FT                   KS"
FT   gene            194977..196194
FT                   /locus_tag="EUBELI_00168"
FT   CDS_pept        194977..196194
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00168"
FT                   /product="peptidylprolyl isomerase"
FT                   /note="Psort-B: Unknown cell location; COG0544 FKBP-type
FT                   peptidyl-prolyl cis-trans isomerase (trigger factor);
FT                   HMMPfam:IPR001179; ScanRegExp:IPR002160; K01802
FT                   peptidylprolyl isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00168"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71204"
FT                   /db_xref="GOA:C4Z214"
FT                   /db_xref="InterPro:IPR001179"
FT                   /db_xref="InterPro:IPR005215"
FT                   /db_xref="InterPro:IPR008880"
FT                   /db_xref="InterPro:IPR027304"
FT                   /db_xref="InterPro:IPR037041"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z214"
FT                   /protein_id="ACR71204.1"
FT                   /translation="MFMYIETRKYMKKKLFSVLLVGALAASLVACDSKKKEVDKTPSTV
FT                   NTEINADEYAATITDNAGIYKTFVSLSDWKGMSVDLAESDYKVTDSDVEDYIQSLLEAT
FT                   ATTDAQTTGTTKSGDTIKLDYSGKLDGTAFSGGTATDASYTIGSGKFIDDLDKGLVGLT
FT                   VGVETDIPCTFPESYQNSDLAGKQVVFTVTVKEIDVTVVPELNDEWVTANASKLGVSDA
FT                   ELTNVEDLRAYVKNYLETQAASNRSSTVFETAYSQMSDGLDVSEYPSEELADLLKTLNN
FT                   NVDSEYQSYSSSYSSKEDYLKSAYNFDSLDAFNEYADNYAKQYLLQKMIITMIAADNNI
FT                   TVSADDINSTGEELASYYGYNDYQEILDTYGKTMNAEIGYQVLYQKVVEFVCDNVTIND
FT                   TSSTEQ"
FT   gene            196339..198039
FT                   /locus_tag="EUBELI_00169"
FT   CDS_pept        196339..198039
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00169"
FT                   /product="sulfate permease, SulP family"
FT                   /note="Psort-B: CytoplasmicMembrane, score:9.99; COG0659
FT                   Sulfate permease and related transporters (MFS
FT                   superfamily); HMMPfam:IPR002645; HMMPfam:IPR011547;
FT                   Gene3D:IPR002645; superfamily:IPR002645; K03321 sulfate
FT                   permease, SulP family"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00169"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71205"
FT                   /db_xref="GOA:C4Z215"
FT                   /db_xref="InterPro:IPR001902"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR011547"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z215"
FT                   /protein_id="ACR71205.1"
FT                   /translation="MRNVVKPLKGKTMNQFVPKLFDVMKGYSKKQFVNDVIAGIIVAII
FT                   ALPLSIALALASGVGPEQGIYTAIFAGFVISFLGGSRVQIAGPTAAFATIVAGIVAQNG
FT                   MDGLIVATIMAGIILIIMGFLKFGNLIRFIPYTITTGFTFGIAVTILVGQIKDFLGLDT
FT                   SAYTGPTIETLDKLNAVFKCINTFNWQALVVGGVSLAILIIWPRFKKLEKIPASLIAVI
FT                   VSVIMVKLGMQAKTIGDLYTISSKLPGISIPHVNITMVKNLLPDAFTIAVLAGIESLLS
FT                   CVVSDGMIGSRHKPNMELVAQGAGNLVSALFGGIPATGAIARTAANVKNGGRTPIAGMV
FT                   HSVTLLLILVVLMPYAAWIPMPAIAAILFMVAYNMSGWREMISLCKTSPKSDILVLLTT
FT                   AVLTIVFDLVVAIEVGVVLTALLFLKRMADVTEVKSWKYIGDNIDENNDPDNINLKQVP
FT                   KDTLVYEINGPMFFAAADKFLDIQTVSGSKAVIVRMRGVPAMDVTALRSLRNIHAVCKR
FT                   HGAVMILSHVNEQPMSVMEHAGFADEIGRDNFCANIDAALEHAKNIVEG"
FT   gene            198046..199422
FT                   /locus_tag="EUBELI_00170"
FT   CDS_pept        198046..199422
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00170"
FT                   /product="multidrug resistance protein, MATE family"
FT                   /note="Psort-B: CytoplasmicMembrane, score:9.99; COG0534
FT                   Na+-driven multidrug efflux pump; HMMPfam:IPR002528;
FT                   HMMPanther:IPR002528; HMMTigr:IPR002528; K03327 multidrug
FT                   resistance protein, MATE family"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00170"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71206"
FT                   /db_xref="GOA:C4Z216"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z216"
FT                   /protein_id="ACR71206.1"
FT                   /translation="MKEDTLSYIRNNKEITFEQKIRLVIMLSLPTILAQVSSIIMQYID
FT                   ASMVGRLGAGCSASIGLVSTTTWLLGSLASAPSLGFSIQVAQLVGAKKFNRARRVFLQS
FT                   FGIVLLISIIIGAAGAMISWGLPAWLGGEESIQKDAAMYFLITSLSMPALGFNRLGTRM
FT                   LQSCGNTRTPGILNSMNCLLDVIFNFIFIFRWRGFGFGLGVMGAALGTTAAEIVTTIIM
FT                   FYVLMFRTPMLSKGYGTDSDEKAGLATIKKSFVLSLPVTFENVVMFGAMITITRIVAPL
FT                   GVVAVAANSFAITAESLCYMPAYGIEEAATALVGQSIGAGRGKLALSFGRISVAFGMGI
FT                   MAFTGLLMFIFAPFMIGILTPDPAVRELGVTILRIEAFAEPLYGASIVVTGVLRGAGDT
FT                   LVSSLMNFFSLWAIRVVLSFLLVGRYGLVGVWIAMAAELCFRGAIFLVRMERKKWLKKV
FT                   "
FT   gene            complement(199729..200973)
FT                   /locus_tag="EUBELI_00171"
FT   CDS_pept        complement(199729..200973)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00171"
FT                   /product="S-adenosylmethionine synthetase"
FT                   /note="Psort-B: Cytoplasmic, score:9.98; COG0192
FT                   S-adenosylmethionine synthetase; HMMPfam:IPR002133;
FT                   HMMPIR:IPR002133; HMMPanther:IPR002133; HMMTigr:IPR002133;
FT                   ScanRegExp:IPR002133; superfamily:IPR002133; K00789
FT                   S-adenosylmethionine synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00171"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71207"
FT                   /db_xref="GOA:C4Z217"
FT                   /db_xref="InterPro:IPR002133"
FT                   /db_xref="InterPro:IPR022628"
FT                   /db_xref="InterPro:IPR022629"
FT                   /db_xref="InterPro:IPR022630"
FT                   /db_xref="InterPro:IPR022631"
FT                   /db_xref="InterPro:IPR022636"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z217"
FT                   /protein_id="ACR71207.1"
FT                   /translation="MRIDTIRYGIDIFTIKQKGDNMEKRLFTSESVTEGHPDKICDQIS
FT                   DAVLDALYEQDPYSRVACETLTNTGFIMVMGEVTTKANIDIPSIVRKTVTDIGYDSSDK
FT                   GFDGNTCAVMVALDKQSADIAMGVDKALEAKDGEIDDSEGGAGDQGMMFGYATNETPEF
FT                   MPYSSALAQKLSKQLTKVRKDGTLSYLRPDGKTQVTVEYDENKKPIRLDAIVVSSQHAP
FT                   EVSQEQIHEDIKKYVIDAIVDPAMIDADTKIYINPTGRFVIGGPNGDSGLTGRKIIVDT
FT                   YGGAARHGGGAFSGKDCTKVDRSAAYAARYVAKNIVAAGLADRCEIQLSYAIGVARPTS
FT                   IMVDTFGTGKLDEEKIVEIIRENFDLRPNGIIKMLDLRRPIYKQTAAYGHFGRTDLNLP
FT                   WEKLDKVDVLAKYLG"
FT   gene            201317..202417
FT                   /locus_tag="EUBELI_00172"
FT   CDS_pept        201317..202417
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00172"
FT                   /product="putative two-component system response regulator"
FT                   /note="Psort-B: Cytoplasmic, score:8.87; COG2206 HD-GYP
FT                   domain; HMMPfam:IPR006674; HMMSmart:IPR003607;
FT                   HMMTigr:IPR006675; K07814 putative two-component system
FT                   response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00172"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71208"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR006675"
FT                   /db_xref="InterPro:IPR037522"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z218"
FT                   /protein_id="ACR71208.1"
FT                   /translation="MSEKIIFIFDAKEGDQLSEDVNTPDGKILVKKGTILDYDIIANIS
FT                   NHHILEVRIYDNDELEDNQSGIDSKRNTENEKYFDKIRKSRQFKKFKKTYDENIIDIKD
FT                   GLNEVVTNNSPIDTDKLIEGTQQILSENNNSLQLFDMLHSMRQFDDLTYVHCVNVALIS
FT                   SIIGQWLKYSKEDIRILIICGLLHDIGKLMIPNEILTKPGRLTEDEYKIMKQHVNLGYE
FT                   KLKNQNIDMRIKEACLLHHEKCDGTGYPFGLKSESIPVSAKIIAIADVYDAMTAARVYR
FT                   GALCPFEVIETMHCDAFTKFDPKYILPFLKNVASSYIHNDVRLSDGRTGKVILINDNAL
FT                   SQPVVQCGDTFVDLSKEHGLKVSSIL"
FT   gene            complement(202427..202684)
FT                   /locus_tag="EUBELI_00173"
FT   CDS_pept        complement(202427..202684)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00173"
FT                   /product="putative DeoR family transcriptional regulator,
FT                   stage III sporulation protein D"
FT                   /note="Psort-B: Cytoplasmic, score:8.87; NOG13855 non
FT                   supervised orthologous group; HMMTigr:IPR014208;
FT                   ScanRegExp:IPR001034; K06283 putative DeoR family
FT                   transcriptional regulator, stage III sporulation protein D"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00173"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71209"
FT                   /db_xref="GOA:C4Z219"
FT                   /db_xref="InterPro:IPR014208"
FT                   /db_xref="InterPro:IPR018356"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z219"
FT                   /protein_id="ACR71209.1"
FT                   /translation="MRDYIEERATQLAYYIIEHKATVRQTAKVFNVSKSTAHKDVTARL
FT                   MEINPELAKEARKVLDVNKQERHIRGGMATKEKYLHACAR"
FT   gene            complement(202779..203477)
FT                   /locus_tag="EUBELI_00174"
FT   CDS_pept        complement(202779..203477)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00174"
FT                   /product="Hypothetical protein"
FT                   /note="Psort-B: CytoplasmicMembrane, score:9.26; COG3619
FT                   Predicted membrane protein; HMMPfam:IPR010699"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00174"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71210"
FT                   /db_xref="GOA:C4Z220"
FT                   /db_xref="InterPro:IPR010699"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z220"
FT                   /protein_id="ACR71210.1"
FT                   /translation="MASKLHNALAKKLPDIQMSEAFINCVFLAMSGGLQDAYTYFTRNE
FT                   VFSNAQTGNVVLMSTHFMMGEWYQGLKYLLPFLAFGLGVFVTERIQGKYKNATRLHWRQ
FT                   AILLIEIIILIAVGFMPHSMDMFATIIVSFSCAMQVQAFRKVNGYSYASTMCIGNLRSG
FT                   TDALSVFVRTGNKTSLKKAGYYFGIILFFAIGAGIGGNLSMLFGIHTIWISSALLSISV
FT                   LLMFAEKLKI"
FT   gene            complement(203568..205115)
FT                   /locus_tag="EUBELI_00175"
FT   CDS_pept        complement(203568..205115)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00175"
FT                   /product="solute:Na+ symporter, SSS family"
FT                   /note="Psort-B: CytoplasmicMembrane, score:10.00; COG0591
FT                   Na+/proline symporter; HMMPfam:IPR001734;
FT                   HMMPanther:IPR001734; K03307 solute:Na+ symporter, SSS
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00175"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71211"
FT                   /db_xref="GOA:C4Z221"
FT                   /db_xref="InterPro:IPR001734"
FT                   /db_xref="InterPro:IPR038377"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z221"
FT                   /protein_id="ACR71211.1"
FT                   /translation="MGVFMLKLVILIIYFAVLIGIGLYCRKHATDVNGFVLGGRSVGPW
FT                   LTAFAYGTSYFSAVVFVGYAGQFGWKYGIAATWAGIGNAIIGSLLAWVVLGRRTRIMSQ
FT                   HLDSATMPQYFGKRFGSNPLKIGASVIIFIFLIPYTASLYNGLSRLFGMAFNIDYSVCI
FT                   IIMATLTAIYVIAGGYMATAINDFIQGIIMLFGIVAVIAAVIHSKGGFMSALQGLANVS
FT                   DPAVSDTPGIFASFFGPDPFNLLCVVILTSLGTWGLPQMVQKFYAIDNEASIQKGTVIS
FT                   TIFALIVSGGCYFLGGFGRLFSDQIDVKANGFDSIIPTMLSNLSPALIALVVILVLSAS
FT                   MSTLSSLVIASSSTLTIDFLKDNFIKNMSEKKQVLYIRILVVVFIAISAILALIQYKSS
FT                   VTFIAQLMGISWGALAGSFLAPFMFSLYSKKVSKASCWACFLFSSVLMLANIFFRAGFP
FT                   TWLQSPINCGAFAMFAGMIIVPVVSLFTPKPDKELVDSAFACYEKETEVPQKTALGK"
FT   gene            complement(205249..207312)
FT                   /locus_tag="EUBELI_00176"
FT   CDS_pept        complement(205249..207312)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00176"
FT                   /product="Hypothetical protein"
FT                   /note="Psort-B: Cellwall, score:9.18; NOG16847 non
FT                   supervised orthologous group"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00176"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71212"
FT                   /db_xref="InterPro:IPR025584"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z222"
FT                   /protein_id="ACR71212.1"
FT                   /translation="MIKLNKIKRNCVAAVILTMCLMTAGCARNSTSTTTASGGETTITS
FT                   AITKEDTDVTHADDAENYRVSITGDFTVTSDTSDGVTQSGSVYTITKAGEYTVTGLLSE
FT                   GQLIVDAGNENEVTIVLNGTSITCSSGSPIYVKNASEVKIKSEENSFNEVIDNRNEATE
FT                   DSSDDAGNAAIYATCDLKLVGKGALVVTGNYNNGIQSKDDLSIKNVIVKVTAVNNAVKV
FT                   NDAVDIESGNIIAISAKGDGIKTSNSSISNKGNQKGIVTITSGNIDIYAACDGIDASYG
FT                   ADISGDGNLNIYTDTYSEYSEEVTSSGSSSGTSSGRDSSANKSASANTVSYVATSDTIA
FT                   NAPSGFGGGNMGSGNAPDMSNGNAPNMNGSSDRNKTGGNRPGMPGDFNESGNSSGQSYS
FT                   TKGIKAESEINISGFTINICSTDDGIHANSDSGVLETGEDGKGTIVINGGSITISSGDD
FT                   GMHADKQLDVNDGYINVVTSYEGLEAMTINLNGGKIYVYATDDGINACTGDGKTSPIVN
FT                   VTGGYIDVTTTSGDTDGIDSNGNYVQTGGFVLVKGGSSSGNVSGSIDVDGTVTITGGTC
FT                   VALGGVCETPVNSANAYVLGSVSFSSGSYSLKDSSGNEVISFTVDGSFSNGWICSDTLT
FT                   TGSSYTLYRGADSIADWTQESGTMGASGTGGFGGGNMGGMGGQNGGFGGGRR"
FT   gene            complement(207415..208293)
FT                   /locus_tag="EUBELI_00177"
FT   CDS_pept        complement(207415..208293)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00177"
FT                   /product="Hypothetical protein"
FT                   /note="Psort-B: CytoplasmicMembrane, score:9.26; COG1284
FT                   Uncharacterized conserved protein; HMMPfam:IPR003740"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00177"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71213"
FT                   /db_xref="GOA:C4Z223"
FT                   /db_xref="InterPro:IPR003740"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="InterPro:IPR019264"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z223"
FT                   /protein_id="ACR71213.1"
FT                   /translation="MFKSLEVKYPKFYQVFRFIIVIIASVLYAWNLRCFAKVADLLPGG
FT                   FSGVSLLFQAIGLRFFYISIPFTIFNVALNIFPAYIAYRYIGKKFTIYSIVVIILSSVL
FT                   VDILPPYIFTEDILLISVFGGIINGFAISLCLNVGTTTGGTDFISIYFSHVKGIDAWNY
FT                   ILLGNVVILLIAGGLFGWSIALYSIIYQFCSTQVIQFMYKRYQKMTLFIISDKSEEIYH
FT                   AIKNTTNHDATLFKGIGCYEEKERTLIYSVINSEAKRELITLIRSIDKHAFINVVKTEE
FT                   LDGRFNDIPHD"
FT   gene            complement(208340..208777)
FT                   /locus_tag="EUBELI_00178"
FT   CDS_pept        complement(208340..208777)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00178"
FT                   /product="MerR family transcriptional regulator, mercuric
FT                   resistance operon regulatory protein"
FT                   /note="Psort-B: Cytoplasmic, score:8.87; COG0789 Predicted
FT                   transcriptional regulators; HMMPfam:IPR000551;
FT                   HMMSmart:IPR000551; superfamily:IPR009061; K08365 MerR
FT                   family transcriptional regulator, mercuric resistance
FT                   operon regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00178"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71214"
FT                   /db_xref="GOA:C4Z224"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z224"
FT                   /protein_id="ACR71214.1"
FT                   /translation="MYTIGQVSEMFNLPVSTLRYYDKEGLFPFMQRASGIRQFSDTEIA
FT                   ALKLIECLKKSGLEIRDIKQFMEWCQEGSRTYELRKQLFERQKAAVEKEMEKMQETLDM
FT                   LTFKCFYYEQAIKDGNEDGIHSMLPDKLPANIQAAYDNSHK"
FT   gene            209069..209362
FT                   /locus_tag="EUBELI_00179"
FT   CDS_pept        209069..209362
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00179"
FT                   /product="Hypothetical protein"
FT                   /note="Psort-B: Cytoplasmic, score:8.87"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00179"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71215"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z225"
FT                   /protein_id="ACR71215.1"
FT                   /translation="MEDKCMEWRQEKDMPVFMYIFLNKIEDAEEVRWTEKEKNEGYNTY
FT                   KKLLELTEGDSSDVIKKCLRIIKETRHIVEYELWNKIVYFMTDYINGETVWG"
FT   gene            209752..211089
FT                   /locus_tag="EUBELI_00180"
FT   CDS_pept        209752..211089
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00180"
FT                   /product="Hypothetical protein"
FT                   /note="Psort-B: Cytoplasmic, score:9.96; COG1167
FT                   Transcriptional regulators containing a DNA-binding HTH
FT                   domain and an aminotransferase domain (MocR family) and
FT                   their eukaryotic orthologs; HMMPfam:IPR004839;
FT                   Gene3D:IPR015421; superfamily:IPR015424"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00180"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71216"
FT                   /db_xref="GOA:C4Z226"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z226"
FT                   /protein_id="ACR71216.1"
FT                   /translation="MIYDFITNMYFTGMTHGGMIHLSRAKEPEVFRGFWLFFCISKYLK
FT                   EEIYMEYEISNRLSGVHGSMIRELFKLGASKDIISFGGGNPSAETFPCKEIEEIAAKGL
FT                   GENPVSLLQYGLSEGYTPLRDTMKKYLEKKEGFDFENNELFIVSGGQQCADLTTKALVN
FT                   EGDVVLTEEPAFVGCLNTFRSYGAKLVGIPMEQDGMNINALEEALKANPDAKLLYTIPS
FT                   FQNPTGITTSLEKRKKVYELCCKYDIAILEDNPYGELRFAGENVPTIKSMDTEGRVIYA
FT                   GSFSKVMAPAFRLGFLVFNKSLTGPLTVAKQCTDVHSTVLFQYICNEYINNYDFDKHLE
FT                   DSRKVYEHKCNLMMECMKKEFHPSVTFGHPEGGLFVMAFLPEGMDSAPFVREAINRGVL
FT                   SVPGAAFLADESQKSNGFRLNYSTPSDEQIVKGIEILGKLTYEWIK"
FT   gene            211105..212091
FT                   /locus_tag="EUBELI_00181"
FT   CDS_pept        211105..212091
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00181"
FT                   /product="D-lactate dehydrogenase"
FT                   /note="Psort-B: Cytoplasmic, score:9.98; COG1052 Lactate
FT                   dehydrogenase and related dehydrogenases;
FT                   HMMPfam:IPR006139; HMMPfam:IPR006140; ScanRegExp:IPR006140;
FT                   K03778 D-lactate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00181"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71217"
FT                   /db_xref="GOA:C4Z227"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR029752"
FT                   /db_xref="InterPro:IPR029753"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z227"
FT                   /protein_id="ACR71217.1"
FT                   /translation="MKIAAFSVRQDEKQYFDTFANVYKVELQINRSGFTADDIESVKGC
FT                   EAMSVCDGMCDLSAPVLEKLAAEGVKYIGFRTIGYNSVDLEAAKRLGIRVAHSGYSPYS
FT                   VANYTVMLMLMCIRKALYVMMRSHTADYSLGPICGREMQNMTVGIIGTGRIGKAVIKNL
FT                   SGFGCKIIAYDPYPAKDLENVEYVTLDELYARADIISLHTFLSDETYHMINKDSIAKMK
FT                   DGVILINAARGALVDTKDLIEAVESGKIGSVGTDCCEGEDEFIRTDRKYDDLVVNHDYI
FT                   ILKSFQNTIVTPHVAFFTDQAVSDMVESSVKSVVQFAAGEDTPLEVH"
FT   gene            complement(212088..212945)
FT                   /locus_tag="EUBELI_00182"
FT   CDS_pept        complement(212088..212945)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00182"
FT                   /product="LysR family transcriptional regulator,
FT                   transcription activator of glutamate synthase operon"
FT                   /note="Psort-B: Cytoplasmic, score:9.98; COG0583
FT                   Transcriptional regulator; HMMPfam:IPR000847;
FT                   HMMPfam:IPR005119; FPrintScan:IPR000847; Gene3D:IPR011991;
FT                   K09681 LysR family transcriptional regulator, transcription
FT                   activator of glutamate synthase operon"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00182"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71218"
FT                   /db_xref="GOA:C4Z228"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z228"
FT                   /protein_id="ACR71218.1"
FT                   /translation="MELYQLRQFQAAARHKNMTRAASELCIAQPALSKTIHKLEEEFGA
FT                   QLFIRNKKGLECTRQGEILLEYADRILALSEDATRAVSESLGDAGDIRLCLRSSAVLVS
FT                   NVLKDFIHEHPHVSFSISSEPKGCDLLIDSVSSAYDIPDNAHLLMTEEICLAVSSSHPL
FT                   AHTGHISVEQMMNEKFIDLADTPSYAGVFNSIFSKCKKTPQIAYSCNDYILQGKLISLG
FT                   LGVSFVASVTWTSSSLPENISLLHIDDCPHFRSIYYQPLGSFCSENQRIFEHQLEEYFK
FT                   NLNN"
FT   gene            213022..213936
FT                   /locus_tag="EUBELI_00183"
FT   CDS_pept        213022..213936
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00183"
FT                   /product="Hypothetical protein"
FT                   /note="Psort-B: CytoplasmicMembrane, score:9.99; COG0679
FT                   Predicted permeases; HMMPfam:IPR004776"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00183"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71219"
FT                   /db_xref="GOA:C4Z229"
FT                   /db_xref="InterPro:IPR004776"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z229"
FT                   /protein_id="ACR71219.1"
FT                   /translation="MITQILLTQTFIMFILMILGLILSKTGLLTEHGSKDMANILLYAV
FT                   IPCVIIRSYITDFTMEKLYGLLMSAVLAVAAFAVAIAVSYIIYGMRKPIDNFGTAFCNA
FT                   GFIGIPLVTAVFGNEAAFYVASFASILNLLQWTYGIVIITRRKDMINIKKVFVNPVTIS
FT                   LVIGLFLFITGIKLPGVINSTMAGVAALNTPAAMIVLGYYLSCVRIRDLLLNPSLYLAS
FT                   FVRLIIIPLLTLLVLYIIPAGHGQIGMITLIAAATPVGTSTAIFAQKFGQDYERAVCMV
FT                   CLSTLFSIITMPVVMYLAQMWIM"
FT   gene            214123..215493
FT                   /locus_tag="EUBELI_00184"
FT   CDS_pept        214123..215493
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00184"
FT                   /product="neurotransmitter:Na+ symporter, NSS family"
FT                   /note="Psort-B: CytoplasmicMembrane, score:9.99; COG0733
FT                   Na+-dependent transporters of the SNF family;
FT                   HMMPfam:IPR000175; BlastProDom:IPR000175;
FT                   FPrintScan:IPR000175; HMMPanther:IPR000175; K03308
FT                   neurotransmitter:Na+ symporter, NSS family"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00184"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71220"
FT                   /db_xref="GOA:C4Z230"
FT                   /db_xref="InterPro:IPR000175"
FT                   /db_xref="InterPro:IPR037272"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z230"
FT                   /protein_id="ACR71220.1"
FT                   /translation="MRKKGTKAMGNNGIELERDGFKSRTGFILACIGSAVGMGNIWRFP
FT                   YMVSAWGGMTFLIPYVLFVILIGSTGVIEEMALGRATKGGPIKAFGDCMQMRTGKRKAG
FT                   EAIGFIPVLGSLALAMGYTVVVGWIFKYTYLAFSGKLSAMGNDMSAIGGMFGSTASTFG
FT                   NNMWLIIAMVVTAVIMALGIAGGIEKANKVMMPLLFIMFVGLGIYIFTLPGSSAGYKYI
FT                   FTLNPKELLDIKLWIYAFGQAFFSLSIAGNGTVIYGSYLSDKENIVSSARNVAVFDTIA
FT                   ALLAAFVIIPGMAAGGAELSSGGPGLMFIYLVNVFNGMPGGKIVGIVFYVCVLFAGMSS
FT                   LVNLYEAPVATIQEKLKLNRVASVGIIAVAGCVVSLVIQGIVSGWMDAVSIYICPLGAM
FT                   LAAIMFFWVEGKKFAVDAVNAGADKPIGKWFVPLGKYVLVPLALVALIAGALLGGIG"
FT   gene            215480..215626
FT                   /locus_tag="EUBELI_00185"
FT   CDS_pept        215480..215626
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00185"
FT                   /product="Hypothetical protein"
FT                   /note="Psort-B: Cytoplasmic, score:8.87;
FT                   ScanRegExp:IPR002052"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00185"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71221"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z231"
FT                   /protein_id="ACR71221.1"
FT                   /translation="MELADGGLDWLIETGGLLCNPPFLRGGERERGGIDLEAEGRHAEV
FT                   QKE"
FT   gene            215685..215834
FT                   /locus_tag="EUBELI_00186"
FT   CDS_pept        215685..215834
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00186"
FT                   /product="Hypothetical protein"
FT                   /note="Psort-B: Unknown cell location"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00186"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71222"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z232"
FT                   /protein_id="ACR71222.1"
FT                   /translation="MRKSGGLDFEVERQEEVQKEREIAADWTLRQRRGTRKSKKSEKEL
FT                   RIGP"
FT   gene            215824..215958
FT                   /locus_tag="EUBELI_00187"
FT   CDS_pept        215824..215958
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00187"
FT                   /product="Hypothetical protein"
FT                   /note="Psort-B: Extracellular, score:8.82"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00187"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71223"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z233"
FT                   /protein_id="ACR71223.1"
FT                   /translation="MDLEAEERQEKVQKEREGEEDWTLKRRRGTRKSKRSEKGLWIGL"
FT   gene            216213..216779
FT                   /locus_tag="EUBELI_00188"
FT   CDS_pept        216213..216779
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00188"
FT                   /product="Hypothetical protein"
FT                   /note="Psort-B: Cytoplasmic, score:8.87; COG1917
FT                   Uncharacterized conserved protein, contains double-stranded
FT                   beta-helix domain; superfamily:IPR011051"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00188"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71224"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z234"
FT                   /protein_id="ACR71224.1"
FT                   /translation="MTRHHICAKIYIKSHKPLVLKLTSSRIIQVSNNLHFYERRGVIIM
FT                   KFMDKDDFEKQNVFGTGQANTAYAKYFIGDSFLNPLTDPKCGLFLANVTFEPGCRNNWH
FT                   IHHATKGGGQMLICTAGEGWYQEEGKEPVSLVPGTVIAIPPEVKHWHGAKKDSWFSHIA
FT                   AEIPGENTSNEWCEPVTDEEYNRLG"
FT   gene            216863..217273
FT                   /locus_tag="EUBELI_00189"
FT   CDS_pept        216863..217273
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00189"
FT                   /product="Hypothetical protein"
FT                   /note="Psort-B: Cytoplasmic, score:8.87; COG0656 Aldo/keto
FT                   reductases, related to diketogulonate reductase;
FT                   HMMPfam:IPR001395; BlastProDom:IPR001395;
FT                   FPrintScan:IPR001395; Gene3D:IPR001395;
FT                   HMMPanther:IPR001395; ScanRegExp:IPR001395;
FT                   superfamily:IPR001395"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00189"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71225"
FT                   /db_xref="GOA:C4Z235"
FT                   /db_xref="InterPro:IPR018170"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z235"
FT                   /protein_id="ACR71225.1"
FT                   /translation="MSVLSKNYTLNNGVEIPKLGLGTWFIDDADAADAVRAAVATGYRH
FT                   IDTAQAYGNERGVGEGVRTCGVPREQLFVVSKVAAEHKTNESAAKSIDETLEKMGLDYL
FT                   VMMIIHSPQPLFTTKKGQFTTFQIDIARTYPI"
FT   gene            217309..218022
FT                   /locus_tag="EUBELI_00190"
FT   CDS_pept        217309..218022
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00190"
FT                   /product="two-component system, LytT family, response
FT                   regulator"
FT                   /note="Psort-B: Cytoplasmic, score:8.87; COG3279 Response
FT                   regulator of the LytR/AlgR family; HMMPfam:IPR001789;
FT                   HMMPfam:IPR007492; BlastProDom:IPR001789;
FT                   HMMSmart:IPR001789; superfamily:IPR011006; K02477
FT                   two-component system, LytT family, response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00190"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71226"
FT                   /db_xref="GOA:C4Z236"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR007492"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z236"
FT                   /protein_id="ACR71226.1"
FT                   /translation="MQIAICDDEVSMVQILEKKIKKLLPDAVIDKYLSGDELIASGIKP
FT                   DILFLDIQMPGMDGMETAKVLRQDNEDMILVFVTAAEAYVFQAFDVGAFHYLVKPFSDE
FT                   KFKEVVTKAVHNIKRSSRLEKDEKYIMVQTAGSHIKIFLRDIVYAEVYNRKVIIHTRST
FT                   DIEYYGKLQELSDMAGTDFFRTHRAYLVHFKYVEKYDATCVTMKNGTALIAKKNYPEFV
FT                   KQYLKYNQRKGNEVR"
FT   gene            218019..219389
FT                   /locus_tag="EUBELI_00191"
FT   CDS_pept        218019..219389
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00191"
FT                   /product="Hypothetical protein"
FT                   /note="Psort-B: CytoplasmicMembrane, score:9.97; COG2972
FT                   Predicted signal transduction protein with a C-terminal
FT                   ATPase domain; superfamily:IPR003594;
FT                   superfamily:IPR011598"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00191"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71227"
FT                   /db_xref="GOA:C4Z237"
FT                   /db_xref="InterPro:IPR016120"
FT                   /db_xref="InterPro:IPR032834"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR039506"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z237"
FT                   /protein_id="ACR71227.1"
FT                   /translation="MSLVERCWMITSKFSVIAILIITGICFGVFVYPYMKKKREAALVS
FT                   IVYIGIMSVLYLIPQQIGNFSAYMLGVVAAFLVMYVQDRRNIYQKIFLAVTFFSIRWLA
FT                   VAMAGRMDDFITKALVFGNTIAGRQWLQYVLYAGTRILDIVLCIVFLAVAIGLINKAYV
FT                   YKNDEMSVKELVMLIIPSLVGVTGYGILQYYLNIYEKDTGKSLTDTYGFYGALSFVHYF
FT                   ISIIAILVMTTMFQNWKVAQEEQTGQELVLNQVSDMKKHIGEVEKLYQDIRSLRHDMGN
FT                   HIQMLEHLVAENHMDDAAEYMEHLKKEWNEISPEIKTGSPVIDVILMEKLREAKEKQIR
FT                   FISDFHYPGDTKLNAFDLSVILNNALDNCMENVSGENPYICISSFRKNSIFMITIKNRY
FT                   EGELNYKDSDLPETTKSGKEHGIGLHNIRRVARMYMGDISLEQENQEVVLSIMLQVE"
FT   gene            219410..219547
FT                   /locus_tag="EUBELI_00192"
FT   CDS_pept        219410..219547
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00192"
FT                   /product="Hypothetical protein"
FT                   /note="Psort-B: Unknown cell location"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00192"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71228"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z238"
FT                   /protein_id="ACR71228.1"
FT                   /translation="MFFICFTTKKGRFTTSLFIVKKDMPKESVKRNHVVQIFKETDFRI
FT                   "
FT   gene            219507..220367
FT                   /locus_tag="EUBELI_00193"
FT   CDS_pept        219507..220367
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00193"
FT                   /product="Hypothetical protein"
FT                   /note="Psort-B: Extracellular, score:9.55; COG5295
FT                   Autotransporter adhesin"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00193"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71229"
FT                   /db_xref="InterPro:IPR025577"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z239"
FT                   /protein_id="ACR71229.1"
FT                   /translation="MLYRFLRKRISEFKLKEDNTMRINGFSGTNTQTGTMGMTQGNDSV
FT                   SKNIQNQIANAQQKLQDLSSNEEMSLEDKMKKRQEIQQEINNLNQQLRQHQIEQRKEQQ
FT                   SKNSSSMDDMVAGTSSTSKKKDTGLSQASMQAMISADSSMKQAKVQGSMATQIQGRASV
FT                   LESEIKQDAGKGNTEKKEEELAELQAKAQSATAAQMSTLADANKSVEEAAKAENSNTED
FT                   TATKNNTDKSEKTQESAGAAAEETDSVKNTDIKGETQVTVETPTLENAQNATQQAVYTP
FT                   IDIRL"
FT   gene            220368..221144
FT                   /locus_tag="EUBELI_00194"
FT   CDS_pept        220368..221144
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00194"
FT                   /product="Hypothetical protein"
FT                   /note="Psort-B: Unknown cell location"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00194"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71230"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z240"
FT                   /protein_id="ACR71230.1"
FT                   /translation="MVKENGIMSEIKSFSDYTSKYNSNVDYSALFGGTSDSSSVGNTNM
FT                   LSDYAAIKNGSYGKLMKAYYAKQDAEKLSGKGDTSQKLTLMKTSADSLKKSADALNDAS
FT                   LWEKKKIKKKDEKTGEETEVEDYDWDAITKKVKSFIDDYNDVVKEAGESNTKDVLRNAS
FT                   WMTGMTDKTSHLLSKIGITIGKGNKLELDEDELKKADISSLKTIFTGYNSFAGKTAQKA
FT                   AGISNAANRASATYTNNGTYSKTDSSLTSRKIDKEV"
FT   gene            221210..221806
FT                   /locus_tag="EUBELI_00195"
FT   CDS_pept        221210..221806
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00195"
FT                   /product="Hypothetical protein"
FT                   /note="Psort-B: Cytoplasmic, score:8.87; COG1340
FT                   Uncharacterized archaeal coiled-coil protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00195"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71231"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z241"
FT                   /protein_id="ACR71231.1"
FT                   /translation="MSFTVNLSGGGLLINRFNSSNMLKSTQEKLQRQQERDNKVAFFEA
FT                   QKENLKNRKADTLEEISEKLEMFHNYENEIAAANQEYNNSQMFHVMDEAEEHGEKIAEA
FT                   AERNKPKTEEERKEEMVDEALGTEENKGMMSEIMDELSETTEEMTEQMTEKTMENMEEL
FT                   PDEVLQEQLVTDSLEAAEMVQTETIKRYVPIDIRV"
FT   gene            221834..222592
FT                   /locus_tag="EUBELI_00196"
FT   CDS_pept        221834..222592
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00196"
FT                   /product="Hypothetical protein"
FT                   /note="Psort-B: Unknown cell location"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00196"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71232"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z242"
FT                   /protein_id="ACR71232.1"
FT                   /translation="MKIYNNTNITYSAIEHNSRKNTKQNFPADLEKKMTQYTDTVSISK
FT                   TGQERFRYLSSVSSMDYQNRFEREVTDIFVKEDTESVKSDSFEHHVNRMATAYNKMKNS
FT                   IEEKYAEQDYELEYYVTESGKIEELTKEKELDMLNQAYENHSNFMATSTEIWSELQDFT
FT                   PSVVYHKESEQTANEQNIGENQENTAKSKEKGVIKNSAYQAFLSAIQSDNQKLSQQYLG
FT                   DWKDLRLNLNVSDGNRKMLNGIWDYYANKR"
FT   gene            222626..222844
FT                   /locus_tag="EUBELI_00197"
FT   CDS_pept        222626..222844
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00197"
FT                   /product="Hypothetical protein"
FT                   /note="Psort-B: Unknown cell location"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00197"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71233"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z243"
FT                   /protein_id="ACR71233.1"
FT                   /translation="MAVTGVNNYSNIYTNAYTGNIRKNNAKETTEKQVVEQTEDVKTGI
FT                   TRKTAADELSYLSKKFDSDAVWIRYQC"
FT   gene            complement(222920..223075)
FT                   /locus_tag="EUBELI_00198"
FT   CDS_pept        complement(222920..223075)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00198"
FT                   /product="Hypothetical protein"
FT                   /note="Psort-B: Unknown cell location"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00198"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71234"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z244"
FT                   /protein_id="ACR71234.1"
FT                   /translation="MYAAVKSVNPNLKPGQAFDTGILDNVTRESIEATLVQNGNRLVRN
FT                   SIDVSV"
FT   gene            223587..223985
FT                   /locus_tag="EUBELI_00199"
FT   CDS_pept        223587..223985
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00199"
FT                   /product="Hypothetical protein"
FT                   /note="Psort-B: Unknown cell location; COG1733 Predicted
FT                   transcriptional regulators; HMMPfam:IPR002577;
FT                   BlastProDom:IPR002577"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00199"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71235"
FT                   /db_xref="InterPro:IPR002577"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z245"
FT                   /protein_id="ACR71235.1"
FT                   /translation="MPKTKERCMYHKKLESDIRCPLEYGLEVFGGKWKSRVICVLADKK
FT                   ILRYSELRAELVNITDAVLSTTLKALIADDIVSRKSYDEIPPRVEYSLTEKGLSVMPIL
FT                   QSICDWSCAFYKKETDKESSQCMKCDHK"
FT   gene            224119..225966
FT                   /locus_tag="EUBELI_00200"
FT   CDS_pept        224119..225966
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00200"
FT                   /product="glutamate synthase (NADPH) small chain"
FT                   /note="Psort-B: Cytoplasmic, score:9.98; COG0493
FT                   NADPH-dependent glutamate synthase beta chain and related
FT                   oxidoreductases; HMMPfam:IPR013027; BlastProDom:IPR001327;
FT                   FPrintScan:IPR000103; FPrintScan:IPR000759;
FT                   FPrintScan:IPR013027; Gene3D:IPR012285;
FT                   superfamily:IPR009051; K00266 glutamate synthase (NADPH)
FT                   small chain"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00200"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71236"
FT                   /db_xref="GOA:C4Z246"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR019575"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR028261"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR037207"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z246"
FT                   /protein_id="ACR71236.1"
FT                   /translation="MERELSRLTIITKDKAQVTMESLYQDLERRIVASPPGLCTIDLTR
FT                   SFIKMCLAQSCGKCVPCRVGLRQLARLFDDVLDGNATEETLDVIRLTAEGIYYSADCAI
FT                   GYEAAKLVLKCIDGCEDDFRSHMERGFCSCNSNQPVACVKSCPAGVDIPGYIALVHEGR
FT                   YADAVRLIRRDNPMPTTCAYICEHPCENRCKRTLIDAPVNIRGLKKMAVDNAGDVPVPA
FT                   CNEPTGKKVAIIGGGPGGLSAAYYLALMGHKVTIFEQRKQLGGMLRYGIPNYRLPRKKL
FT                   DAEINSILSTGIEVKKNISVGTDITLEDINKEYNAVYISIGAHADKKIGIDGEDAKTGV
FT                   ISAVEMLRAIGDDEMPDYTGKRVVVIGGGNVAMDVARSSVRLGAEKVSIVYRRRKADMT
FT                   ALPEEVEGAEAEGCDVLELMSPVRIEKDENDAAVGLWVQPQMISRIKGGRPSPKTAAKD
FT                   EVLIPCDLIVVAIGQGIETRYFEEHGVTVKRGTIEALDTSEIKERKGIFAGGDCVTGPA
FT                   TVIRAIAAGKVAAANIDEYLGYHHEITSDVEIPYAGYEDKVPCGRVEVALRDAADRKKD
FT                   FEPIEYGFSCEEACQESGRCLRCDHFGFGSFRGGREKQW"
FT   gene            225960..227642
FT                   /locus_tag="EUBELI_00201"
FT   CDS_pept        225960..227642
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00201"
FT                   /product="NADH dehydrogenase I chain G"
FT                   /note="Psort-B: Cytoplasmic, score:8.87; COG4624 Iron only
FT                   hydrogenase large subunit, C-terminal domain;
FT                   HMMPfam:IPR001041; HMMPfam:IPR001450; HMMPfam:IPR003149;
FT                   HMMPfam:IPR004108; Gene3D:IPR003149; HMMTigr:IPR013352;
FT                   ScanRegExp:IPR000283; ScanRegExp:IPR001450;
FT                   superfamily:IPR001041; superfamily:IPR009016; K00336 NADH
FT                   dehydrogenase I chain G"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00201"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71237"
FT                   /db_xref="GOA:C4Z247"
FT                   /db_xref="InterPro:IPR000283"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR003149"
FT                   /db_xref="InterPro:IPR004108"
FT                   /db_xref="InterPro:IPR009016"
FT                   /db_xref="InterPro:IPR013352"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR019574"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR036991"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z247"
FT                   /protein_id="ACR71237.1"
FT                   /translation="MVNLTINGKAVSVKEGTTILEAAKTIGETIPTLCYLKEVNAIGAC
FT                   RVCVVEVEGTDRCVTACNNFVEEGMVVYTNSRKVRTTRKTNVKLILSQHDYKCGTCIRS
FT                   GNCALQSIANELNISEMPYDSILEKDNWDKTFPLIRDAQKCIKCMRCVQVCDNIQGMHI
FT                   WDVVNTGSRTTVNVRANKNIAETACTLCGQCVSNCPVGALTERDDVGIVLDAIENEDII
FT                   TVVQIAPAVRAAWGEDFGMSKEYATAQRLVAGLRRIGFDYIFDTTFAADMTIMEEGSEF
FT                   LERLPEIKESGLPMFTSCCPGWVKFVKSEFPEMAGRLSTAKSPQQMFGAITKSYYAEKL
FT                   GVDPEKIFCVSIMPCLAKKDECTWDGGKDVDAVLTTREVERMFKAFFIKPEELDEDEFD
FT                   NPLGEGTGAGVIFGATGGVMEAALRSAYYLVTGNNPDADAFQSVRGLEGWKEASFDLNG
FT                   TTVNVAVASGLGNTRRLVNAIKKGEVHYDFVEIMSCPGGCINGGGQPYKEDAVMVEERR
FT                   HVLYGLDKRDNLRFSHENPSVKQCYEEYFEKPLSHRAHEILHV"
FT   gene            complement(228095..229318)
FT                   /locus_tag="EUBELI_00202"
FT   CDS_pept        complement(228095..229318)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00202"
FT                   /product="putative transposase"
FT                   /note="Psort-B: Cytoplasmic, score:8.87; COG3328
FT                   Transposase and inactivated derivatives; HMMPfam:IPR001207;
FT                   K07493 putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00202"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71238"
FT                   /db_xref="GOA:C4Z248"
FT                   /db_xref="InterPro:IPR001207"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z248"
FT                   /protein_id="ACR71238.1"
FT                   /translation="MKLMAQLHFTLDSDFFVGLFSETKDEAFGKLMEALLNQVLQAEST
FT                   EQLGASNYERSQERSDYRNGVRTRTLTTRIGKIELQVPRHRNVPFKTSLFENYQRNEQA
FT                   LITTMMEMVVQGVSTRNIKKVTEELCGESFSKSAVSEICKELDVPVKHFKERLLPEHYP
FT                   FIIVDAIYLKAREDHRVKSKALFVAIGINNTGHKEVLGFEVYDSEKVNTWRDFFENLKS
FT                   RGLRGVDIVISDAHAGLVEAIKESFSGSSWQRCQAHFTRNIINKCPKKYSTGLASELRD
FT                   MFNAATIEEARRLKESIYDEYQDVANEAMTVLDEGFEDSITIMALPSKYRIALRTSNII
FT                   ERENREIRRREKVIQIFPNTESIIRLIGAVLQDDHNEWSVGHKIFDMKEYYDKLSSIQS
FT                   NLLKIKVA"
FT   gene            229503..230984
FT                   /locus_tag="EUBELI_00203"
FT   CDS_pept        229503..230984
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00203"
FT                   /product="aminoacylhistidine dipeptidase"
FT                   /note="Psort-B: Cytoplasmic, score:8.87; COG2195 Di- and
FT                   tripeptidases; HMMPfam:IPR002933; HMMPfam:IPR011650;
FT                   FPrintScan:IPR001160; HMMPIR:IPR001160;
FT                   HMMPanther:IPR001160; HMMTigr:IPR001160; K01270
FT                   aminoacylhistidine dipeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00203"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71239"
FT                   /db_xref="GOA:C4Z249"
FT                   /db_xref="InterPro:IPR001160"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z249"
FT                   /protein_id="ACR71239.1"
FT                   /translation="MDINELSPSEVFSYFQEICAIPHGSGNTGMIADYCLEFAKLHGLK
FT                   ARKDTSDNVVIFKAGSSGYEDCEPVILQGHLDMVCEKEPDCDIDMSVQSIKACTDGKMV
FT                   WADGTTLGADDGIAVAFILAVLASDTIAHPPIQAVLTSDEEIGMLGARDLDTSDLTAKR
FT                   LINIDSENEGILYVSCAGGVRAECDIPVAYEDAAGWVADGAIDVQNGSVCFEVKISGLA
FT                   GGHSGVEIHKQHTNAIRLLASLLSHASGAADFRLVSLSGGGKENAIPKEAKAVVSVRSC
FT                   DATTFEQSIKESAAVWMQEISATEPYAKIELEKTDIAADKVLDSKSTANVIYALWLSPD
FT                   GVYKMSQEINGMVQTSLNLGTAYLDADKLVYKYLIRSNTAAGKKLLLERVTTFVKHLSG
FT                   KVVTMSDYPAWEYKSDSQLRKICVDSFTNVYGHEPEVTSIHAGLECGILAGKMPGVDMI
FT                   SFGPTLESVHTPDECMDAASVERTWEYLMEILKEM"
FT   gene            231010..232218
FT                   /locus_tag="EUBELI_00204"
FT   CDS_pept        231010..232218
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00204"
FT                   /product="Hypothetical protein"
FT                   /note="Psort-B: CytoplasmicMembrane, score:9.99; COG5505
FT                   Predicted integral membrane protein; HMMPfam:IPR008537"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00204"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71240"
FT                   /db_xref="GOA:C4Z250"
FT                   /db_xref="InterPro:IPR008537"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z250"
FT                   /protein_id="ACR71240.1"
FT                   /translation="MLYINHKENLYMIKDGFLYLAALIFAAAVLVNLPKIFKGKKAQVF
FT                   FNFAPPIVLIYLGLMLLCTMKVWDLSATSAVYKSVKNPILYAMLFIMLLRCDLKKIIKL
FT                   GPKMLIGFFAATLSIGLGFFVSYAIFHQLLGAGSWKALGALCGSWMGGGGNMLAIQAAL
FT                   DVDEATMAYALVMDSICATLYVMFLLWAIGNHEKFNKWTKADTSIIDGVGAALEEEAKA
FT                   NTKPLVWQNIILLLGSGLLVSAVSMELGSMINAHLSFFDSTTWTVLIVSVLGIVFALTP
FT                   FGKIKGTEEISNVMLYIVIALIASRADLGAVGNAPIWLLAGFVILLIHVAIMIALAKIL
FT                   KLDIFTCCVASLANIGGTATAPVLAGAYSNALVPVGIMMALLGYVVGTGGGLVVANLMS
FT                   IFG"
FT   gene            232529..232921
FT                   /locus_tag="EUBELI_00205"
FT   CDS_pept        232529..232921
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00205"
FT                   /product="Hypothetical protein"
FT                   /note="Psort-B: Cytoplasmic, score:8.87"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00205"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71241"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z251"
FT                   /protein_id="ACR71241.1"
FT                   /translation="MEDRTMMYFEKDLVNKAIELIDGKSKSDELKAFTDVNDINNMIRN
FT                   LQINRDYQCYAIKLNQRLREEYPSIEKLLNLGRSMVNNSVGNNTIYDVVSAIIADLNAD
FT                   KYGIYADVLLKHEVINDMKKFIEKVD"
FT   gene            232989..234311
FT                   /locus_tag="EUBELI_00206"
FT   CDS_pept        232989..234311
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00206"
FT                   /product="Hypothetical protein"
FT                   /note="Psort-B: Cytoplasmic, score:8.87; NOG23391 non
FT                   supervised orthologous group"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00206"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71242"
FT                   /db_xref="InterPro:IPR021352"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z252"
FT                   /protein_id="ACR71242.1"
FT                   /translation="MMRIFISKRKDYMDIFEEKRQLIEKFACQKEYTLESKMELKQLLL
FT                   KDTNGGKLYKYRSFDKDGYSLKNLEEGTLHCSLVEAFNDPFDSKFGYSFEALYKEMSRD
FT                   YEKEISEKMYIFEQAIYVLKRDKEIEDFNKEEQRKINKLLQNRKIIDFWEAFKKENADK
FT                   DKISLEDNKNNIIQLIMIALLDGDSKQYNGVDEGLLKLILINMNEQSMDMLANEDFNMN
FT                   EFAIANGITKDVDEISLISEVWKKLCPQFKNILEKVLEIFGDKCGEIDRYINELYLVGC
FT                   LSSDFKNRLMWSHYADCHKGFCIEYDFSALEKIQNDQYLLPVLYDNKRPLFPWSIAFDQ
FT                   SESSIKEAQKKILLSLLTKDNVWSYEKEWRIFIRKQRSSELIMPPITCIYLGACIDNES
FT                   KNAIINIANKRNIPVKQMQLDRVTYDLHAEDITNKYNTVIF"
FT   gene            234601..235503
FT                   /locus_tag="EUBELI_00207"
FT   CDS_pept        234601..235503
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00207"
FT                   /product="Hypothetical protein"
FT                   /note="Psort-B: Cytoplasmic, score:8.87"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00207"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71243"
FT                   /db_xref="GOA:C4Z253"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z253"
FT                   /protein_id="ACR71243.1"
FT                   /translation="MNRHKHIFSFIFTVVSVPLVLAVQELCSDIQYSLKNYLIILLIIS
FT                   IAGISAWIEYGQYKSEKEIEEKEKVEKQNERAKMVLSQIVQLIDRKAGNIRDNTYELVI
FT                   TTKEWPYFYGAHKYLHEVCENLKFTVAKIIKAENDYVDVSLIYKYYGEEEWKWLAGKSG
FT                   VSGAVNLNEFINDSETLYNYILSHKDESPIFCNDKSKSKIYKWGRRDNLFGGKGSFYVM
FT                   PITFSNNQEALVEAVLLISTYGVNFIALNSTKEEENEFRRILAYEVVPYYVSIIQSELG
FT                   ALYMRHNIDRIKRVLLEDK"
FT   gene            235737..236597
FT                   /locus_tag="EUBELI_00208"
FT   CDS_pept        235737..236597
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00208"
FT                   /product="Hypothetical protein"
FT                   /note="Psort-B: Unknown cell location"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00208"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71244"
FT                   /db_xref="InterPro:IPR014966"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z254"
FT                   /protein_id="ACR71244.1"
FT                   /translation="MLYKIQNFENKTPSDISYEEIELACGKKIKVYDIEMVHDLTQFIG
FT                   FGKYMNNQKCNVYLRGQNDLYNGKLIPSLYRGRTNLESITKKYNKRMNKLKVDIDSFSQ
FT                   YDRCVLEPLLQHYGVKTTYLDLVDNVWVALWFALHQTKSESINSHEYVYYSSNTNKYSY
FT                   IILVATDAINVSDKNGVYEGETTRLVDLRKALPSYFLRPHAQHAYMLKKKGEIESDYSD
FT                   LIIGIAKIPTELGFKWIGTSEFLTVSSLFPAAYFDSGYKILLKKYPEEEQGIINQYGSI
FT                   QILTD"
FT   gene            237142..237450
FT                   /locus_tag="EUBELI_00209"
FT   CDS_pept        237142..237450
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00209"
FT                   /product="Hypothetical protein"
FT                   /note="Psort-B: Unknown cell location"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00209"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71245"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z255"
FT                   /protein_id="ACR71245.1"
FT                   /translation="MQILDHLLEKEGVTLDCVHTLGHFDLHQQTAQENLATCFSLFMYL
FT                   PHLHELNLYNDNKLLVFPIKDLTETNPVYIFMNKDNAYVEGTDGLKNLLKNEVENYV"
FT   gene            237768..238820
FT                   /locus_tag="EUBELI_00210"
FT   CDS_pept        237768..238820
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00210"
FT                   /product="Hypothetical protein"
FT                   /note="Psort-B: Cytoplasmic, score:8.87; COG3093 Plasmid
FT                   maintenance system antidote protein; HMMPfam:IPR001387;
FT                   HMMPfam:IPR010359; HMMSmart:IPR001387;
FT                   ScanRegExp:IPR006025; superfamily:IPR010982"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00210"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71246"
FT                   /db_xref="GOA:C4Z256"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010359"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR013430"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z256"
FT                   /protein_id="ACR71246.1"
FT                   /translation="MVRSRSIIATPPGATIKEQLNDRGMSQKEFAVRIDMTEKHVSKLI
FT                   NGEVQLTPEVAVRLEIVLGVPARFWNNLEAIYREKLIKIAAEKAMDADENLARQFPYSE
FT                   MAKLGWIPQTRNSKEKVINLRKYFEVVSLSLLENTQITRIACRRLAVTDKSDLALLAWT
FT                   QEAKIQARGIETKPINIKGLISVMPDIRKMTLKKPKDFCFELKSLLAENGVALVFLPHL
FT                   KGSFLQGATFIDGNKIVVGLTARGKDADKFWFSLFHELGHIILGHVGKNGGTTEQDEQD
FT                   ADVWSRDELIPLETFKMFKEEQNFSVASVKRFAKENRIAPGIVVGRLQNEGCIEYNMLN
FT                   ELKEHYVITV"
FT   gene            238844..239383
FT                   /locus_tag="EUBELI_00211"
FT   CDS_pept        238844..239383
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00211"
FT                   /product="Hypothetical protein"
FT                   /note="Psort-B: Unknown cell location; COG0655 Multimeric
FT                   flavodoxin WrbA; HMMPfam:IPR005025"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00211"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71247"
FT                   /db_xref="GOA:C4Z257"
FT                   /db_xref="InterPro:IPR005025"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z257"
FT                   /protein_id="ACR71247.1"
FT                   /translation="MSNIIVLSGSPRKGGNTDLLVDAFVKGAEKSNNVEVVSVAYYKVN
FT                   PCIGCNSCFDRAGHECFQQDDMQIVYDKLKCADVIVVASPVYFYGVSAQLKAIIDRLHT
FT                   PMRNDFKVKKLALILVGAAVLPELFDSIKIQYQLVLNFFKLEDAGMVLVRGAKDKGDVR
FT                   NTDGLDEAYRLGLAME"
FT   gene            239765..240061
FT                   /locus_tag="EUBELI_00212"
FT   CDS_pept        239765..240061
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00212"
FT                   /product="Hypothetical protein"
FT                   /note="Psort-B: Cytoplasmic, score:8.87; COG1396 Predicted
FT                   transcriptional regulators; HMMPfam:IPR001387;
FT                   HMMSmart:IPR001387; superfamily:IPR010982"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00212"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71248"
FT                   /db_xref="GOA:C4Z258"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z258"
FT                   /protein_id="ACR71248.1"
FT                   /translation="MRTFDDMLSKQLQDEEFKKEYDAIQPEMDVIRAIVDARTSQNMTQ
FT                   KELAERTGINQADISKLENGTRNPSVNLLKRLADAEMVLVRGSKDNVKPTQND"
FT   gene            240210..241283
FT                   /locus_tag="EUBELI_00213"
FT   CDS_pept        240210..241283
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00213"
FT                   /product="Hypothetical protein"
FT                   /note="Psort-B: Cytoplasmic, score:8.87"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00213"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71249"
FT                   /db_xref="InterPro:IPR041420"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z259"
FT                   /protein_id="ACR71249.1"
FT                   /translation="MIPNANGGLHVGLCIEPTVSYSSEEKAKMLINVFWDFLEDIYFLW
FT                   RENLNIIKDIIVDYEKLIKTSVKIPLNNGDSIKFTFNPQDLPHLLGLQHLVDNPILFEY
FT                   SEKRLSATELYNRMCSDGDDSIDTDEFENSAYFDELYKGRIQYFSSELILDIIRAKQIV
FT                   KFDYSKVKNFSTKLDKIEYMFWKKYKDKNNNYGYFGVGFMASGKDTDVNYPNTFFFRLG
FT                   DDYIKNQEEVLPYSFMKKDKNGKKFFEIYWKQIWKVLEKNKHYKKLKNGYIMEDGSIDE
FT                   NSIKNCVNADILKHYELLQLDALDKIYLPYMKEEFRWTNDEKRYILKKIKISDRDLLPN
FT                   EIKQLLNEYKQSCRMMI"
FT   gene            complement(241408..242220)
FT                   /locus_tag="EUBELI_00214"
FT   CDS_pept        complement(241408..242220)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00214"
FT                   /product="Hypothetical protein"
FT                   /note="Psort-B: Cytoplasmic, score:8.87; HMMPfam:IPR001387;
FT                   HMMSmart:IPR001387; superfamily:IPR010982"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00214"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71250"
FT                   /db_xref="GOA:C4Z260"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z260"
FT                   /protein_id="ACR71250.1"
FT                   /translation="MSCFLYAKHIIIHLKARYNIMKIREFCKMKKITQEKLAEDLNVDV
FT                   RTIRRWESSTPSTRIILKLANYFEVFPYNLLEENEKMPEFPIGQSGSIDFAFIKKEILA
FT                   SINILSSQNVIHDIYRHTFIKYNDNMLEDLLNISLEITNIYSRLVFLLKSKEWLNQLHY
FT                   RINYSCFDYELQLKLLANDLFYPNEGLFNNSEINNLAEKVCNTCNKYKFNPLYSIYLPS
FT                   DIERFLIDAFLSYKSDTTSQLHQTIVCEHILLQLLNYTGDEVHNYYVA"
FT   gene            242460..243146
FT                   /locus_tag="EUBELI_00215"
FT   CDS_pept        242460..243146
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00215"
FT                   /product="integrase/recombinase XerD"
FT                   /note="Psort-B: Cytoplasmic, score:8.87; COG4974
FT                   Site-specific recombinase XerD; HMMPfam:IPR002104;
FT                   Gene3D:IPR013762; superfamily:IPR011010; K04763
FT                   integrase/recombinase XerD"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00215"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71251"
FT                   /db_xref="GOA:C4Z261"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z261"
FT                   /protein_id="ACR71251.1"
FT                   /translation="MRKFLKFIHVDVVYCKYYEEIYIFFHTGMRISEFCGLTMMDIDLE
FT                   KRTINIDHQLQRTSKREYVIEPTKTNAGTRVIPMTNEVTEMFRAIIEDRPDYKVEKVID
FT                   GYTGFLFLDKDGMPLVSMHWEHRFNHMVSRYNEIYKVQMPNITPHVCRHTYCSNMAKSG
FT                   MNPKTLQYLMVHSDIAVTLNVYTHVGLEDAEKELQKMQGLENARKEMGISDTDDKPLKQ
FT                   NMFKVV"
FT   gene            243330..244616
FT                   /locus_tag="EUBELI_00216"
FT   CDS_pept        243330..244616
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00216"
FT                   /product="Hypothetical protein"
FT                   /note="Psort-B: Cytoplasmic, score:8.87"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00216"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71252"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z262"
FT                   /protein_id="ACR71252.1"
FT                   /translation="MIFILDTSVKKIDVKVGMKFGCLQILDDGTEYLQIKETCISDIKE
FT                   EKMGFLQAVKEGKYVRRDWTGWDGGKTIVTPAYIYKPINFNVYRESVTFSDFDKAIEEL
FT                   QKSTGVKHYKCRCRKCGKIRYYSEETLQTEPKVCYKPVYCSSRFTYSIKASNANYNKRK
FT                   KYENNEAVCLVNDKEAVIPSDEYCSAWNDKREKELFKQAEKDAQIIAAIPRKNAINYDK
FT                   DYTGLIYESLEVLECVNDKLESVPIPYYTQRHQKKYQDIIVYKEYKCQCYLCGNKKMVT
FT                   CDKFGIFPPTEYGYRSYNGYWSAVSCECHKISSFQWIVNDILIKNGINYRVEVAVDGVY
FT                   GIDNETPLRYDFAVYKQGKIVAFIECQGEQHYKPVTEFGGERRFAIQQRNDEEKRKYAK
FT                   EHEIKLIEISYKNKKYEIVESILRNNHII"
FT   gene            244653..245468
FT                   /locus_tag="EUBELI_00217"
FT   CDS_pept        244653..245468
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00217"
FT                   /product="Hypothetical protein"
FT                   /note="Psort-B: Cytoplasmic, score:8.87"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00217"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71253"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z263"
FT                   /protein_id="ACR71253.1"
FT                   /translation="MKYIDARTQGSLKQGVMEFLNLSAGGLIRLFVSVYEDTEREPWEC
FT                   VEDFLSEHIVDEKLEYIQMFHLSRRLNGTDLKANNNLEKLLLGSSPLSNFFRKYKVTFE
FT                   SGEGHINLYCNGILQSLDNEFAYNDGNVCYVKSRLGYFKNQDYCVNGFAFRSYLEQNHY
FT                   YSSLASCPELVGNIERLLGIKGMCADYYSNSKYYCIEYLIPMSEVIFDMGNPPETDCEK
FT                   TVEFLKQAILRLYNEWLGSSFICDENLILRLPDDECIESEWFVNAEELA"
FT   gene            245862..247313
FT                   /locus_tag="EUBELI_00218"
FT   CDS_pept        245862..247313
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00218"
FT                   /product="Hypothetical protein"
FT                   /note="Psort-B: Cytoplasmic, score:8.87; KOG1181 FOG:
FT                   Low-complexity"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00218"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71254"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z264"
FT                   /protein_id="ACR71254.1"
FT                   /translation="MLNYINNNLVLINEYQNLYLHEISIDKLIEGFRTEEIIMHNGFDY
FT                   GRFRVFIDSCLLLLNKEKLNNYYKNRYSFKDFIKEVENDINLKDYYELIKQEQLTSDIS
FT                   NICLYHSFENKKKNPWDQVMTIRNAMAHMQYGYFSSQKNGTMIYYYLYNKDHGIRKDSG
FT                   IVFEWVLHELIQRFFSNYSSGLLFKYTFFSRYSFRLRKKSIWKYYFYEITPKICNENLY
FT                   NGYNQGIMSKLAKVSQDNKKLLRFLKENNERINVKELELNRTIKIRNYKKLAKKLKLQT
FT                   RDDYIYGLKAFLDFEGELSNFLIHISQLNNVFYSYCTKRDSENVTQNEIEKYKKQLEKS
FT                   LLELREDKNAKISFKIGFVYLYAMNFALRTEDDDYEELKYQELNVSKFKYQKENWIQYS
FT                   QRNKTQNCLFPRYIVERMRNSLMHGNIEILLNNKGKIEFIFRDKYNKRDEVISIILEDL
FT                   EEFLSQKCLYTGIPKKTLTFLVQKS"
FT   gene            247505..247915
FT                   /locus_tag="EUBELI_00219"
FT   CDS_pept        247505..247915
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00219"
FT                   /product="protein-tyrosine phosphatase"
FT                   /note="Psort-B: Unknown cell location; COG0394
FT                   Protein-tyrosine-phosphatase; HMMPfam:IPR000106;
FT                   HMMPanther:IPR000106; HMMSmart:IPR000106;
FT                   superfamily:IPR000106; K01104 protein-tyrosine phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00219"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71255"
FT                   /db_xref="InterPro:IPR023485"
FT                   /db_xref="InterPro:IPR036196"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z265"
FT                   /protein_id="ACR71255.1"
FT                   /translation="MAESVMTYLVEKEGLADKFYINSAATSREEIGNGVHHGTVAKLKK
FT                   EGIPVIPHRAVQMTLNDYEEYDYLIGMDTENIRNMQRISDGDPDEKIYKLLTFAGSGLD
FT                   VADPWYTGDFEATYRDVLAGCKGLLECLKEEL"
FT   gene            complement(248048..248551)
FT                   /locus_tag="EUBELI_00220"
FT   CDS_pept        complement(248048..248551)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00220"
FT                   /product="Hypothetical protein"
FT                   /note="Psort-B: Unknown cell location; HMMPfam:IPR000182;
FT                   ScanRegExp:IPR008266"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00220"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71256"
FT                   /db_xref="GOA:C4Z266"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z266"
FT                   /protein_id="ACR71256.1"
FT                   /translation="MNIRVLDKNDKAALEQLIFTIENALPVPEWWIPIDDIERSHFFDA
FT                   DWTCFLGAFNDDNELVAASALFFNEHEFAEEAEKLGLDIRSTNVAEVGRCMVHPDFRGH
FT                   NLMCELNKRLCSIARNRGIDTILAVAHPDNVASNSSFRRLGAELKATATVFGSYQRNMY
FT                   ILPW"
FT   gene            248265..248804
FT                   /locus_tag="EUBELI_00221"
FT   CDS_pept        248265..248804
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00221"
FT                   /product="Hypothetical protein"
FT                   /note="Psort-B: Unknown cell location"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00221"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71257"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z267"
FT                   /protein_id="ACR71257.1"
FT                   /translation="MHRPTSATFVERMSRPSFSASSANSCSLKKRALAATSSLSSLNAP
FT                   KKHVQSASKKCERSISSIGIHHSGTGRAFSIVNISCSRAALSFLSNTRIFIAISYTLKF
FT                   RITLTYVSYNPDPPHYNMYVSQNQNIFKFAGRILSRHKLMPIYIYKTYCFLNIYKNIYL
FT                   DRFFLFRAFKFPFLCI"
FT   gene            248917..249915
FT                   /locus_tag="EUBELI_00222"
FT   CDS_pept        248917..249915
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00222"
FT                   /product="rod shape-determining protein MreB-like protein"
FT                   /note="Psort-B: Cytoplasmic, score:9.98; COG1077 Actin-like
FT                   ATPase involved in cell morphogenesis; HMMPfam:IPR004753;
FT                   FPrintScan:IPR001023; FPrintScan:IPR004753;
FT                   HMMPanther:IPR001023; HMMTigr:IPR004753; K03569 rod
FT                   shape-determining protein MreB and related proteins"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00222"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71258"
FT                   /db_xref="GOA:C4Z268"
FT                   /db_xref="InterPro:IPR004753"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z268"
FT                   /protein_id="ACR71258.1"
FT                   /translation="MLSTDIGIDLGTASILVYIRGKGVVLKEPSVVAFDRDTNKIKAIG
FT                   EEARLMLGRTPGNIVAVRPLRQGVISDYTVTEKMLKYFIQKAIGKRMLKKPRISVCVPS
FT                   GVTEVEKKAVEDATLQAGAREVAIIEEPIAAAIGAGIDISRPCGNMIVDIGGGTTDIAV
FT                   ISLGGTVVSTSIKIAGDDFDEAIVRYMRKKHNLLIGERTAEDIKIKVGSAYPKAEVTTM
FT                   NVRGRNLVTGLPKTVEVSSEETEEALREATSQIVEAVHSVLEKTPPELASDIADRGIVL
FT                   TGGGSLLSGLEDLIEAKTGINTMTAEDPMTCVAIGTGKFIEFLAGYRDEVK"
FT   gene            250019..250789
FT                   /locus_tag="EUBELI_00223"
FT   CDS_pept        250019..250789
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00223"
FT                   /product="flagellar basal-body rod protein FlgG"
FT                   /note="Psort-B: Unknown cell location; COG4786 Flagellar
FT                   basal body rod protein; HMMPfam:IPR001444;
FT                   HMMPfam:IPR010930; K02392 flagellar basal-body rod protein
FT                   FlgG"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00223"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71259"
FT                   /db_xref="GOA:C4Z269"
FT                   /db_xref="InterPro:IPR001444"
FT                   /db_xref="InterPro:IPR010930"
FT                   /db_xref="InterPro:IPR012836"
FT                   /db_xref="InterPro:IPR020013"
FT                   /db_xref="InterPro:IPR037925"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z269"
FT                   /protein_id="ACR71259.1"
FT                   /translation="MVKGLYTAYSGLTVQQKRLDVVSNNLANATTTGYKKEGLTTQSFK
FT                   DVYGIKVKDETVGYINQNIGTLNLGAKVGESFRSWDQGSFQNTGNTFDFALSGSGLFSI
FT                   SFTNKAGETSTLYTRDGSFQMNREGYLVTKDGDFVLGENGPIQLPTDFESLTVEESGEI
FT                   YADGQYVDRLALVDFEDYDYVEAYGENLYKAVDGATQTEATAKVNQGYLEASNINVVTE
FT                   MVDMISIARDFESNQKIMNTIDEMLGKMVSISEI"
FT   gene            250829..251662
FT                   /locus_tag="EUBELI_00224"
FT   CDS_pept        250829..251662
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00224"
FT                   /product="flagellar basal-body rod protein FlgG"
FT                   /note="Psort-B: Unknown cell location; COG4786 Flagellar
FT                   basal body rod protein; HMMPfam:IPR001444;
FT                   HMMPfam:IPR010930; ScanRegExp:IPR001444; K02392 flagellar
FT                   basal-body rod protein FlgG"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00224"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71260"
FT                   /db_xref="GOA:C4Z270"
FT                   /db_xref="InterPro:IPR001444"
FT                   /db_xref="InterPro:IPR010930"
FT                   /db_xref="InterPro:IPR019776"
FT                   /db_xref="InterPro:IPR020013"
FT                   /db_xref="InterPro:IPR037925"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z270"
FT                   /protein_id="ACR71260.1"
FT                   /translation="MMRSLWTAASGMMSQQTSVDTIANNLANVNTIGYKQEQTQFKSLL
FT                   YQNLQAKTTSANGDDKPVGAQVGLGSRVSAVTSIYTQGALNATDSLTDFAIDGNGFFAV
FT                   RDTNTGDTVYTRNGHFTWATATEGVMLSTSEGYPVLSADGAEIVLGQDANGEDYKTNLI
FT                   TIDTDGNLLYPDESNNPAPIGIKIGLYQFSNPAGLDKLGSSYLGETEASGVPLNEDYDE
FT                   VGKKSSLRQSYLEASNVQVATEMVNLITAQRAYELCSKAITTSDTMMEQANNLKR"
FT   gene            251677..252111
FT                   /locus_tag="EUBELI_00225"
FT   CDS_pept        251677..252111
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00225"
FT                   /product="Hypothetical protein"
FT                   /note="Psort-B: Unknown cell location"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00225"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71261"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z271"
FT                   /protein_id="ACR71261.1"
FT                   /translation="MSDSITGLSSMNYSDVYDSKAGSLTNKLTGTDYSKASDDELMSVC
FT                   KDFESYFVEQVLKSMEKMAKIDSDDEDSNLFSSMAGIGGTEDTSLNTLGSYFGDEMVSS
FT                   YAKLMTDSNHGKGLGIAQTLYEQMKRNYSTESIPKADEQK"
FT   gene            252152..254074
FT                   /locus_tag="EUBELI_00226"
FT   CDS_pept        252152..254074
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00226"
FT                   /product="exodeoxyribonuclease V"
FT                   /note="Psort-B: Cytoplasmic, score:8.87; COG0507
FT                   ATP-dependent exoDNAse (exonuclease V), alpha subunit -
FT                   helicase superfamily I member; HMMSmart:IPR003593;
FT                   superfamily:IPR010994; K01144 exodeoxyribonuclease V"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00226"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71262"
FT                   /db_xref="GOA:C4Z272"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR006345"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029493"
FT                   /db_xref="InterPro:IPR041451"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z272"
FT                   /protein_id="ACR71262.1"
FT                   /translation="MKYVEGFVENIIFRNEDNGYTVFNIVYDDEEITCVGVLSYINTGE
FT                   FITAQGEFVKHAVYYMQFKVTSYEFRAPDDAASVRRYLSSGAIKGIGEKMAERIVKTFG
FT                   DDTFRIMEEEPERLAEIKGISMSKAMDIANQLIDKKDIRKAMMFLQRYGIQMNLANKIF
FT                   KRYGNDIYNILEQNPYRLADDIEGVGFRTADEIASRAGIKIDSEFRIKSGIFYVLNQAT
FT                   MQGHTYLPYDKLVRQVNELLLIDVQDYDKYLMDLTMDKKIVVKVKDNVKCVYARMYYNM
FT                   EANVAAMLNNLDVQIEEDQKFIDDRIARIEDKEGITLDDIQKEAVAKAVRNGLVIVTGG
FT                   PGTGKTTTINTIIKYFELEGLEIRLAAPTGRAAKRMTEACGYEAQTIHRMLEISGGVPE
FT                   GDRKSAATGLSMFFERNEDNPLEADVIIVDEMSMVDISIMNSLLKAVSIGTKLILVGDV
FT                   DQLPSVGPGNVLKDIIESGCFPVVKLERIFRQAAQSEIIINAHKINRGEEVVLNKYSKD
FT                   FLFVHRNGADNIINAMKTLIKDKLPDYVGADVYDLQILTPSRKSNVGVERLNKIMQDFL
FT                   NPADAIKQERQVGDVTFREGDKVMQIKNDYQLAWEKRSRYGIPTEQGTGAFNGDTGVIR
FT                   ENKHI"
FT   gene            254088..254408
FT                   /locus_tag="EUBELI_00227"
FT   CDS_pept        254088..254408
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00227"
FT                   /product="exodeoxyribonuclease V"
FT                   /note="Psort-B: Cytoplasmic, score:8.87; COG0507
FT                   ATP-dependent exoDNAse (exonuclease V), alpha subunit -
FT                   helicase superfamily I member; K01144 exodeoxyribonuclease
FT                   V"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00227"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71263"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR027785"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z273"
FT                   /protein_id="ACR71263.1"
FT                   /translation="MKFEDGRFVTYEFSQLDELELAYAITVHKSQGSEYPAVIIPMSQG
FT                   PRMLMNRNILYTAVTRARKCVCLVGEEEIFRLMADNVSESKRYSSLTDRIEEIRHIEDF
FT                   GQ"
FT   gene            254455..255186
FT                   /locus_tag="EUBELI_00228"
FT   CDS_pept        254455..255186
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00228"
FT                   /product="competence protein ComFC"
FT                   /note="Psort-B: Cytoplasmic, score:8.87; COG1040 Predicted
FT                   amidophosphoribosyltransferases; K02242 competence protein
FT                   ComFC"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00228"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71264"
FT                   /db_xref="GOA:C4Z274"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z274"
FT                   /protein_id="ACR71264.1"
FT                   /translation="MDYKKVLMEAVNAVLPPACPMCGKPAPFAGGSRVDICPDCMRKVS
FT                   YVSEPVCLKCGKPVENDEVEYCSDCSRKEHVYDQACAVYEYSKCIKDSIYRFKYHNKRE
FT                   YAGIYAKQIADKCGSMIHAWAPDALIPVPIHSSRLKERGFNQAELIAGELEQLIGIPMD
FT                   CEALVRVVKTVPMKELDNAHRVKNLQNAFQAGEKVVRYSKVLIVDDIYTTGATFDACAA
FT                   VLKHAGVQEVYGVSLCIGDGF"
FT   gene            255316..255657
FT                   /locus_tag="EUBELI_00229"
FT   CDS_pept        255316..255657
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00229"
FT                   /product="Hypothetical protein"
FT                   /note="Psort-B: Cytoplasmic, score:8.87; NOG14256 non
FT                   supervised orthologous group"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00229"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71265"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z275"
FT                   /protein_id="ACR71265.1"
FT                   /translation="MKKLEEKFQEVKQYIEDNPRSDMRDISENCDVSTRQIEQWIREER
FT                   LSFSDDSPIGIACEVCGATIKTGRYCERCKYDMANRLGSMYGSATSAVGNVDKERARRE
FT                   KARMRFLDK"
FT   gene            255795..256076
FT                   /locus_tag="EUBELI_00230"
FT   CDS_pept        255795..256076
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00230"
FT                   /product="Hypothetical protein"
FT                   /note="Psort-B: Unknown cell location; HMMPfam:IPR007412"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00230"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71266"
FT                   /db_xref="GOA:C4Z276"
FT                   /db_xref="InterPro:IPR007412"
FT                   /db_xref="InterPro:IPR031316"
FT                   /db_xref="InterPro:IPR035890"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z276"
FT                   /protein_id="ACR71266.1"
FT                   /translation="MRIDAYNAVNQIYQTSQISKAKATAKTSSASDKFEISDTARTYQT
FT                   ARTAVSAASDVREDKIADIKARMAAGTYNISSEAVADKILNNISTLTF"
FT   gene            256091..256603
FT                   /locus_tag="EUBELI_00231"
FT   CDS_pept        256091..256603
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00231"
FT                   /product="Hypothetical protein"
FT                   /note="Psort-B: Cytoplasmic, score:8.87; NOG18796 non
FT                   supervised orthologous group"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00231"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71267"
FT                   /db_xref="GOA:C4Z277"
FT                   /db_xref="InterPro:IPR007809"
FT                   /db_xref="InterPro:IPR036679"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z277"
FT                   /protein_id="ACR71267.1"
FT                   /translation="MASLIDSLINIMDDENRQYTALLDLSNNKTAAIVNGNVEQLQEIF
FT                   GKEQKLIDVITRLETEREACVTDICKILHLSPSEVKVREIVRLLEKKPKEHDALEQSYL
FT                   NLKNTVKQLTEVNDNNKQLLKQSMDMIEFEINLARNASMAPQTANYGKGAYEENSGLGG
FT                   GSFDAKQ"
FT   gene            256798..258738
FT                   /locus_tag="EUBELI_00232"
FT   CDS_pept        256798..258738
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00232"
FT                   /product="flagellar hook-associated protein 1 FlgK"
FT                   /note="Psort-B: Unknown cell location; COG1256 Flagellar
FT                   hook-associated protein; HMMPfam:IPR001444;
FT                   HMMPfam:IPR010930; FPrintScan:IPR002371; HMMTigr:IPR002371;
FT                   K02396 flagellar hook-associated protein 1 FlgK"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00232"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71268"
FT                   /db_xref="GOA:C4Z278"
FT                   /db_xref="InterPro:IPR001444"
FT                   /db_xref="InterPro:IPR002371"
FT                   /db_xref="InterPro:IPR010930"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z278"
FT                   /protein_id="ACR71268.1"
FT                   /translation="MANGMAGLFIGTTGLKTAQTALNTTAHNLSNINTSGYTRQQVTFS
FT                   DTQYVRVNTSDKVSSPDYGLGVAVSEVRRIRDQFIDQAYRNENSRLGFYESQYKAIEEI
FT                   EDQFGEMQGVTYESYLINLYNSVNELAKNPTSTVARSSLIQNATAFIEKSENVYKGLKD
FT                   YQTTLNTQVKNMVDSINKLGDKIYTLNKKISKIESTGIEDANDLRDERDAAIDELSKYI
FT                   DITYYENDSKEVVISAEGIPFITMGELAKMDTRVVEGTNLVIPTWPGYERDVYDLSTEA
FT                   SNVDDTDKGELKGLLIARGNMVVDYTVVPEAPSSSDYDMSTADGRAAYQEAYNKYYKAQ
FT                   EYYNTYIEPSAILSAMAGFDKLVNGIVEKINNILCPEKSEVRNNPYMAPDGTEIQADIY
FT                   TYNSVSQQVLFDRYGREVTGTDNGDGTYSFSSGEKLYMSFGGAEVPVDSYTYSMLDMDK
FT                   TGYGMDDDKTVGTELFSRKGTDRYIKTTDDSGKTIYIRNNLNETDYESLYKLGNLQINP
FT                   EAAQNVGKIPLSTVQGKEDFDRAKELVDAWDEKFASLNPDTYAKSDFMTFYNNFIGEYA
FT                   TLGKALGNYVSNQTTMVDGYDNQRLQSEGVSSDEELEKMIKYQQAYNAASRYVNVVNQM
FT                   LEHLVTSLGNA"
FT   gene            258774..260345
FT                   /locus_tag="EUBELI_00233"
FT   CDS_pept        258774..260345
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00233"
FT                   /product="flagellar hook-associated protein 1 FlgK"
FT                   /note="Psort-B: Unknown cell location; COG1256 Flagellar
FT                   hook-associated protein; HMMPfam:IPR001444;
FT                   HMMPfam:IPR010930; FPrintScan:IPR002371; HMMTigr:IPR002371;
FT                   K02396 flagellar hook-associated protein 1 FlgK"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00233"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71269"
FT                   /db_xref="GOA:C4Z279"
FT                   /db_xref="InterPro:IPR001444"
FT                   /db_xref="InterPro:IPR002371"
FT                   /db_xref="InterPro:IPR010930"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z279"
FT                   /protein_id="ACR71269.1"
FT                   /translation="MASTFFGLTIAYTGLQAAQTSINVTSHNLANINTKGYTRESASTK
FT                   AADALRTYARYGTLGSGVVVDAINQTRDSYYDEKYRNNNTNYGQYNVKNSYMSQIENYL
FT                   NEFTLKGYSTEYENFFSALNQLDRTPADTSAKNQLINNAKSLTDYFNTLSTNLRNVQVD
FT                   ANNEIKDAVQQINSLAQNISSLNKQINQIQANYGNANDLKDQRNALIDDLSQIVNITVS
FT                   ESDMGNNLTNLQITINGNSLVDGYNYHTLQTVARENPRNVSDAAGLYDIQWENGQEFYI
FT                   YSDSLSGELKGLIDIRDGCNGEIEKYASTTDAAGNSTYKTDADGNILTETESQKDKNTQ
FT                   YKGVPYYQSQLNQFIQTFASSVNEILNKGVTSDGSAQGISLFVMKENSQALTASTVTVN
FT                   QALLDNADLLATKYNVSDGEANVDLIVDLINTKDARIYDGGTGSFFLESIVSDMSIDSS
FT                   KAINFTKNYMNLQTTIQNQRLSVMGVDTDEEAMDLVKFQEAYNLSSKMLSVMNELYDRL
FT                   INNTGV"
FT   gene            260361..261917
FT                   /locus_tag="EUBELI_00234"
FT   CDS_pept        260361..261917
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00234"
FT                   /product="flagellar hook-associated protein 3 FlgL"
FT                   /note="Psort-B: Unknown cell location; COG1344 Flagellin
FT                   and related hook-associated proteins; HMMPfam:IPR001492;
FT                   BlastProDom:IPR001029; HMMTigr:IPR013384; K02397 flagellar
FT                   hook-associated protein 3 FlgL"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00234"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71270"
FT                   /db_xref="GOA:C4Z280"
FT                   /db_xref="InterPro:IPR001029"
FT                   /db_xref="InterPro:IPR013384"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z280"
FT                   /protein_id="ACR71270.1"
FT                   /translation="MRITNQMMINSSISNIQVNKNQINTLSTELSTQKKISKPSDDPII
FT                   AIRALRLRSSLDEVTQYLGKNIPDASSWLSVTHDALDESNSIIKDLYKYCVQGSTDSYS
FT                   ESERNTLAESLNKLVEAYYEQGNVDYAGRYVFTGHATDRPLTYQSDADAKNVDYSITQN
FT                   FTREDLSTKTAYTNAYSNDDILNLTVKTDANGNIITPNIQSVNRIQLAYDEINGGTFTL
FT                   GMGNNNSANVTINADGTVTMNGSLTADITQADGSVVQNQVSVVTTSDPDYIPGDNEIAI
FT                   NATTGELLLGQNVYQSVYQNNEFSVTYEKSNFIKGDIDPTMYFDCVDNNTGVVYDKKSE
FT                   DIEYIVNFSQKLKVNTEADEAFNIYLGRNVNDLVNTVQNVLDIDAQISKVESMQKDSQY
FT                   SDDASQEKLKTIMEGLTKQRDFAKSEMKNAFEAGIGQMQGYMDQVSNAKADVGNRQIRL
FT                   DLTKTRLTEQKTNFTDLKSQNEDIDLEEIVVTYTSAELVYQAALSAASKVVQQSLLDFL
FT                   R"
FT   gene            261978..262433
FT                   /locus_tag="EUBELI_00235"
FT   CDS_pept        261978..262433
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00235"
FT                   /product="Hypothetical protein"
FT                   /note="Psort-B: Cytoplasmic, score:8.87; COG1699
FT                   Uncharacterized protein conserved in bacteria;
FT                   HMMPfam:IPR003775"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00235"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71271"
FT                   /db_xref="GOA:C4Z281"
FT                   /db_xref="InterPro:IPR003775"
FT                   /db_xref="InterPro:IPR024046"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4Z281"
FT                   /protein_id="ACR71271.1"
FT                   /translation="MKVQTKWFGEIEVSEDKIITFDKGIIGFEDWKKYTLVYDAEKEEN
FT                   ISIIWLQAIDEPTLALPVMKPEFVFETYDPVVEDELLKALGDDIQDDNIRVYCALTVPR
FT                   DITKMTINLKAPIIVDFDTMKGIQLIADNSEYQVRYPIYDILKKEEN"
FT   gene            262435..262656
FT                   /locus_tag="EUBELI_00236"
FT   CDS_pept        262435..262656
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00236"
FT                   /product="Hypothetical protein"
FT                   /note="Psort-B: Unknown cell location; COG1551 Carbon
FT                   storage regulator (could also regulate swarming and quorum
FT                   sensing); HMMPfam:IPR003751; BlastProDom:IPR003751;
FT                   HMMTigr:IPR003751"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00236"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71272"
FT                   /db_xref="GOA:C4Z282"
FT                   /db_xref="InterPro:IPR003751"
FT                   /db_xref="InterPro:IPR036107"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4Z282"
FT                   /protein_id="ACR71272.1"
FT                   /translation="MLALSRKKDEAIIINDDIEITIIEIKGDQVKLGISAPKSVPIYRK
FT                   EVYAQILDSNKEAASSVDVKTLNQLFKK"
FT   gene            262785..263237
FT                   /locus_tag="EUBELI_00237"
FT   CDS_pept        262785..263237
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00237"
FT                   /product="Hypothetical protein"
FT                   /note="Psort-B: Unknown cell location; COG1334
FT                   Uncharacterized flagellar protein FlaG; HMMPfam:IPR005186"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00237"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71273"
FT                   /db_xref="InterPro:IPR005186"
FT                   /db_xref="InterPro:IPR035924"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z283"
FT                   /protein_id="ACR71273.1"
FT                   /translation="MGMEVNGVAAASSYQSQNLQAAKPVSQVSSVTSATDKSNEVVVDS
FT                   AKSAASNVAVSVGQAADSEKNGNNANDNDKAKKQAESMADVKDIRKVLNNNTIAEFGYN
FT                   EPTNRITIKIKDKDTDEVIKEIPSEKALEMLAKAWELAGIIVDERR"
FT   gene            263241..265355
FT                   /locus_tag="EUBELI_00238"
FT   CDS_pept        263241..265355
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00238"
FT                   /product="flagellar hook-associated protein 2"
FT                   /note="Psort-B: Extracellular, score:9.55; COG1345
FT                   Flagellar capping protein; HMMPfam:IPR003481;
FT                   HMMPfam:IPR010809; K02407 flagellar hook-associated protein
FT                   2"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00238"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71274"
FT                   /db_xref="GOA:C4Z284"
FT                   /db_xref="InterPro:IPR003481"
FT                   /db_xref="InterPro:IPR010809"
FT                   /db_xref="InterPro:IPR040026"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z284"
FT                   /protein_id="ACR71274.1"
FT                   /translation="MAIRLSGMVSGMDTESLVSALVSSYKLKKDNLVKAQTKLSWKQEK
FT                   WKTMNTSIYGFYSGKLSSARFSTSYNLKTSSVSNDKYAKVSASSSAVSGTQRLKVKQLA
FT                   STGYLTGGQIKAADGSKVTGDTKISDIVGTTDGSISFKTASGTKSIDITSDMNVNQFVS
FT                   KLKEAGVNASFDENNARFFISSKESGKDNDFSLVANDSNGLNALQKLGIYTVNDTDSAE
FT                   YKRLAALTEGSDAYNTELEGMYSKITAEDTAKSYADKYNAAKDKLDALAADDTWDHSLT
FT                   LDEYVAKLKTETPDILNAYDKYKKEKVDSEGNTVKDSDGKVVYEYDTEAMEKDGVKDEY
FT                   EAAVKKKASNESLIKVYDDNSKVIEDTKDYVTIGDDGKAVADASNANILQEVNDTNADR
FT                   QAKAKALLDSKIAMASNVAGSASSSGAVRITGQDSEIELNGATFTNNSNNYSINGLTIE
FT                   AMEVTGNDEVTITTNTDVDGIYDMIKGFLKDYNDLVKSVDVAYNAASSKGYEPLTSDEK
FT                   DAMSDDEVKKWEEKIKDSLLRKDSTLGSVLDTMKNDMARSFKVGDKSYSLSSFGIATLG
FT                   YFNSPENETGVYHIDGDKDDSKTSANTDKLREMIASDPDTVISFFSQLSTQLYTDLGKK
FT                   MAASSTSSAYTIYNDKQMNTQYSEYNTKISEAEDKVTTWEDYYYSKFSAMESALAKMNA
FT                   QSSSLTGLFS"
FT   gene            265404..265790
FT                   /locus_tag="EUBELI_00239"
FT   CDS_pept        265404..265790
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00239"
FT                   /product="flagellar protein FliS"
FT                   /note="Psort-B: Unknown cell location; COG1516
FT                   Flagellin-specific chaperone FliS; HMMPfam:IPR003713;
FT                   HMMTigr:IPR003713; K02422 flagellar protein FliS"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00239"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71275"
FT                   /db_xref="GOA:C4Z285"
FT                   /db_xref="InterPro:IPR003713"
FT                   /db_xref="InterPro:IPR036584"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z285"
FT                   /protein_id="ACR71275.1"
FT                   /translation="MAFNQNIAQEYNRNKILTASPAELTLMLYEGAIKFCNIALIAIEK
FT                   QDYEKANINIKKAENIITEFKVTLNHKYPVAKDFENVYNYIYSLLVDANIKKDTEILNR
FT                   ALDEIRGMRDTWKEVMNRTRSMNK"
FT   gene            265800..266273
FT                   /locus_tag="EUBELI_00240"
FT   CDS_pept        265800..266273
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00240"
FT                   /product="Hypothetical protein"
FT                   /note="Psort-B: Cytoplasmic, score:8.87"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00240"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71276"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z286"
FT                   /protein_id="ACR71276.1"
FT                   /translation="MTTNYLQIMIDSLKKKKDILDKIIVLNETQNKILSNTEFDHDVFE
FT                   NNMHEKGECIDELEKLDEGFQSVFDRIKEELSDNKQMYSDEIETMKTLIKAVTELGAKI
FT                   EVQEARNKVKVEAMFRRERQEHKEAKRSASMAKSYYQNMSRVSDEPQFMDTKQ"
FT   gene            266380..267234
FT                   /locus_tag="EUBELI_00241"
FT   CDS_pept        266380..267234
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00241"
FT                   /product="flagellin"
FT                   /note="Psort-B: Extracellular, score:9.55; COG1344
FT                   Flagellin and related hook-associated proteins;
FT                   HMMPfam:IPR001029; HMMPfam:IPR001492;
FT                   BlastProDom:IPR001029; FPrintScan:IPR001492; K02406
FT                   flagellin"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00241"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71277"
FT                   /db_xref="GOA:C4Z287"
FT                   /db_xref="InterPro:IPR001029"
FT                   /db_xref="InterPro:IPR001492"
FT                   /db_xref="InterPro:IPR042187"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z287"
FT                   /protein_id="ACR71277.1"
FT                   /translation="MEAASQYNFKEENIMVVQHNLSAMNTNRQMGVVTSALQKSTEKLS
FT                   SGYKINRAGDDAAGLSISEKMRSQIRGLNKASDNAQDGISLIQVAEGALNETHSILQRM
FT                   NELATQAANDTNTSTDRTAIKAEIDQLTSEINRIQSTTQFNTQNLLDGKFTGKNLQVGS
FT                   LKGQTIKISISNMNAKTLGVSGLTVDKNSTAGVSMSKIQAAIDKVSTQRSNLGALQNRL
FT                   EHTINNLDTTSENTSAAESRIRDTDMADEMVQYSKNNILAQAGNSMLAQANQQTQGVLS
FT                   LLG"
FT   gene            267312..269318
FT                   /locus_tag="EUBELI_00242"
FT   CDS_pept        267312..269318
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00242"
FT                   /product="lipopolysaccharide cholinephosphotransferase"
FT                   /note="Psort-B: Cytoplasmic, score:8.87; COG3475 LPS
FT                   biosynthesis protein; HMMPfam:IPR007074; K07271
FT                   lipopolysaccharide cholinephosphotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00242"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71278"
FT                   /db_xref="GOA:C4Z288"
FT                   /db_xref="InterPro:IPR007074"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z288"
FT                   /protein_id="ACR71278.1"
FT                   /translation="MKFDKSFFEAEVRDGFYVTSEMKQVWAAQLEVLNDVDNACRENGI
FT                   QYFAEWGTLLGAVRHHGFIPWDDDMDICMKRPDYNRFLEIAEKIMPSNYKIYNLKSHNN
FT                   DGNMVSRIINTDQISYDAEKLKKYHGVPYVIGLDIFPLDYISDNKEDDELQSNVIVMIS
FT                   SIMNVIKSIQDNNVQLDEENLTQINMQLSQVENICGVTINREDDIVQQLNILIDRMCGI
FT                   YRENEAEYITIMLLWVGGKNYRFPKKYYDKAIRIPFENTTIPVPYAYDSILKKKYGDYM
FT                   KLVHTWDSHDYPFFESQKKIIENAGVDINKYTDDYRNYNQFKNKIEEIRIDKEKKDYKD
FT                   KKMVVFMPFKAKYWNMMAGLWKEYERSGEYTLIAIPAPYYYKNIDGTIEKFNDDKQYPE
FT                   YVKIVSPENFDFDNEYVEKIIIQNPYDSYNATTTVYPQFYAKKLAMCTKELIYIPYFET
FT                   EEINPSDMRAYVSMDSYVTMPGVVYSDKVIVQSEGIKELYVKKLSEYFGEETRDIWNTK
FT                   IIGNGKHYIEMENSDSKYDDIPEKWKGYIKKSDGSYKKVILYFICTNDVLENGHRVFDK
FT                   IKRSMDTFLEYEDSVVPLMMFESNIDEILQMENPELLEDYNEIKMNFTQYIVNENELDK
FT                   AMNLCDAFYGDAGSEAQLCRNSGKPVMIQNVEI"
FT   gene            269352..271598
FT                   /locus_tag="EUBELI_00243"
FT   CDS_pept        269352..271598
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00243"
FT                   /product="lipopolysaccharide cholinephosphotransferase"
FT                   /note="Psort-B: Cytoplasmic, score:8.87; COG3475 LPS
FT                   biosynthesis protein; HMMPfam:IPR007074; K07271
FT                   lipopolysaccharide cholinephosphotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00243"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71279"
FT                   /db_xref="GOA:C4Z289"
FT                   /db_xref="InterPro:IPR007074"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z289"
FT                   /protein_id="ACR71279.1"
FT                   /translation="MLEKYFEDEVRDGFYVPSMIKRSWAVALDVLSEVDRICRKYDIKY
FT                   YAEWGTLLGAVRHAGFVPWDDDLDIAMPRNDYIKFCQVAKQELKNGYEIFNFKNHDNFH
FT                   HFLARVTCTSRICFEDKYLKEHHGFPYIAGLDIFVHDNVSRDRKNQEHCEKIAEYIITV
FT                   ADNIADGSMNSEQEKDALKRISQLCNCDVSAYQNKEEERIQLYTLAENIFAAFKDDDCD
FT                   EMTQMMPCSMYGNHMRIPKKYYDEIVRIPFENTTIPVPIGFDAMLSKRYGDYMKLVRNT
FT                   GGHNYPFYESQKKQLEVLMDFKLPQYTFDGKKAVRNDDAANTGYKKIITDVMHSVKEEI
FT                   EKIGHHINNGKFWTDNQTEDIIKNVQEKLADIQQALIETGNLIEQIKGENTQSVKCIEK
FT                   FCDTLYMVYQGNTYDITGEFDNLNSVIENEIIMRKEIVIMPYRAADWSYVKNIWEQAEK
FT                   NPETDVIVAVLPYYYKEYDGSVKEYVNELNDFPEEINAIDICSYNLELHHPDMIYIQNP
FT                   FDNENKAVSVYKEYYSDILKKNTDKLVYVQSFHLEEFSSNDERAYKNMSSYCTVPGVVN
FT                   ADEVYVQSDNMREIYIKKLTEFAGDNTEDIWRKKICVKPEWMNDKKETTSHAGGKKRIL
FT                   FYTSISGIMQNQDGAVEKIERVLKTFKQYSEEIEVIWCVQELVDAVLPSLNRKLYECLN
FT                   NIRNNYMLEKIGHVYNDKDKKLLCSCDAYYGDTSPVVQEYRNNGKPVMIMDYMV"
FT   gene            271877..272017
FT                   /locus_tag="EUBELI_00244"
FT   CDS_pept        271877..272017
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00244"
FT                   /product="Hypothetical protein"
FT                   /note="Psort-B: Extracellular, score:8.82"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00244"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71280"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z290"
FT                   /protein_id="ACR71280.1"
FT                   /translation="MGFGSYELKGVWIYNSRPVVLILRWHDFDSYWIKIETYEALKEYT
FT                   A"
FT   gene            272446..273549
FT                   /locus_tag="EUBELI_00245"
FT   CDS_pept        272446..273549
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00245"
FT                   /product="Hypothetical protein"
FT                   /note="Psort-B: Unknown cell location;
FT                   ScanRegExp:IPR001220"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00245"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71281"
FT                   /db_xref="InterPro:IPR011043"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z291"
FT                   /protein_id="ACR71281.1"
FT                   /translation="MYGYTEFFIKVNEMNRQYINFSLNACCICTTSKVVWFVHWGMPAL
FT                   FKYNFEREKIILVREIPNVSYGKAGSGFKTIIEINDKLFLIPCRADNIVVYDIKQDKFT
FT                   EIELKSPAEVMFSKGFLINGKIYCIPYLYDWIVSVDIDTYDIEYLINWKSELNIIGDGL
FT                   NIDAASIAKETIFCIIPMTNVLIKFNYISKKIELARINGLSNIISICCIDQKVYVYDND
FT                   SMEICILDSQLKNVEFKRKINVKNVDLHSVLNTYIVIDCIHESKQFYYDKNLNYVRESI
FT                   HNCTEKKYMKSFYSVSCWSDYNAHNNLQCVLYEDDELQVFNKNASKSYNIRITENEAVC
FT                   IRKELAKELSFYENPLMNLNDWIKQLI"
FT   gene            273562..274842
FT                   /locus_tag="EUBELI_00246"
FT   CDS_pept        273562..274842
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00246"
FT                   /product="Hypothetical protein"
FT                   /note="Psort-B: Cytoplasmic, score:8.87; COG0641
FT                   Arylsulfatase regulator (Fe-S oxidoreductase);
FT                   HMMPfam:IPR007197"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00246"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71282"
FT                   /db_xref="GOA:C4Z292"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z292"
FT                   /protein_id="ACR71282.1"
FT                   /translation="MEDIILTPFCFESIIMYHKLRLQGYNVISFFDRNIYLQGKIYKSI
FT                   DGDCRVEYPWRCFSSKVIICKNEYKDEIMEQMLSFGYSNSNICFVNDFNFEMSNINIWR
FT                   RVNVDSLYDIWGYSDGQKIINLKKHIRLANIIKENRQEQFWGQRREEYYIDNDGIHFIF
FT                   YRLEIDLTSRCTLKCKKCCNMMQYYQNPKDINVETIKNDYSRMMEIIDWTDDIMLIGGE
FT                   PFLYGQLREIVEYIFHEKNTSEKVGVIRIVTNGTIIPSEDIFETFSKCNVHVLISNYGL
FT                   RSRNINKLIDELVKHNINYAVQDTTQWCDVEQYVDGIEEANDINFIKNKIDDCITLCRT
FT                   IDSGKFYMCAHLKSLNDLQALPSEIPKCYIDIYESNVKESLLKYLKRDVHYFKACAWCN
FT                   GCSKDMWDGMKISVAEQTSKPLEYVKY"
FT   gene            274857..275798
FT                   /locus_tag="EUBELI_00247"
FT   CDS_pept        274857..275798
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00247"
FT                   /product="Hypothetical protein"
FT                   /note="Psort-B: Cytoplasmic, score:8.87"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00247"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71283"
FT                   /db_xref="InterPro:IPR007345"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z293"
FT                   /protein_id="ACR71283.1"
FT                   /translation="MYITNNNNCWYTNIGEAFIDIGVKNIFKNISKDNKNIIFNTISPM
FT                   SKFYIGNMYAGKEILKNVMDPADWIKTDLFILPGMFGSIEFVKKSFSINMARKLKENGS
FT                   EIAFLGFGACEYTEQERKIVLEAMQQLKPLFVITRDDKTYQMYKDYVNCIKGLDCAFWV
FT                   NDNFNPAGMSLNKEYIVSTFNRSDEPENVANVTKNLIHPWHMPYYLNKSKTRFLAKENL
FT                   MVSDNPYDYITLYANAKTVYTDLVHATIISLLYNTPVKYYKIDNRRDAFESVKYLKYDK
FT                   DGFMSIDNCKLNEEKKEIEKIINVIIKNKWRK"
FT   gene            275802..277607
FT                   /locus_tag="EUBELI_00248"
FT   CDS_pept        275802..277607
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00248"
FT                   /product="biotin synthesis protein BioC"
FT                   /note="Psort-B: Cytoplasmic, score:8.87; COG0500
FT                   SAM-dependent methyltransferases; HMMPfam:IPR013216;
FT                   superfamily:IPR008930; K02169 biotin synthesis protein
FT                   BioC"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00248"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71284"
FT                   /db_xref="GOA:C4Z294"
FT                   /db_xref="InterPro:IPR008930"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z294"
FT                   /protein_id="ACR71284.1"
FT                   /translation="MNKYILFGAGVYARKAIELIGKDNIKFIVDNNPEKAGSLLDGIKI
FT                   YYYKEKKDCIKDKVIIAVSDKYFDEIKMQLERDGLKDYISISKIEYEITKKNIQSRFDL
FT                   IGVYRKAIEWILKNSIDNNRIICNSQKRKGYPEVTGYYIPSLMRWGYRDLAYNYSLWLL
FT                   DKKKINGSWYDTDDTAPYIFDTAQILKGLLAARKLHSNKSRIDSVIKEGCEWIFSCMTE
FT                   EGQLETPDKQCWGNNENMCSELIHVYCLSPLIEAGRLFKKQEYIEKAKKILDYYKTKYY
FT                   DKIVNFSLLSHFYAYVVEAMLDLGEIDLAKEAMNNIANYQKKSGAVPAYNNVDWVCSTG
FT                   LFQLSLIWFRLGNLERGNKAFEYACRLQNKSGGWFGSYISEENAEERNTYFPSEEISWA
FT                   NKYFLDALYYKNKAEFEATYDCFLSEIDINDERYSVVKNVVSEFNNIRVLDLGCGKGRY
FT                   LKNLLDDLPQNRYFGVDISENVMKGLENLSVYCKVGLLTDIPYDDDEFSVVYTCEALEH
FT                   AVDINSALREMARVTKSGGKIVIIDKNDDCYGELEIGALEQWFNIDDLKHLMDLYCDNV
FT                   EVKKGLKCKGVYNSNLFTAWIGTVR"
FT   gene            277612..278712
FT                   /locus_tag="EUBELI_00249"
FT   CDS_pept        277612..278712
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00249"
FT                   /product="UDP-N-acetylglucosamine 2-epimerase"
FT                   /note="Psort-B: Cytoplasmic, score:8.87; COG0381
FT                   UDP-N-acetylglucosamine 2-epimerase; HMMPfam:IPR003331;
FT                   HMMPanther:IPR003331; HMMTigr:IPR003331; K01791
FT                   UDP-N-acetylglucosamine 2-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00249"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71285"
FT                   /db_xref="GOA:C4Z2N0"
FT                   /db_xref="InterPro:IPR003331"
FT                   /db_xref="InterPro:IPR029767"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z2N0"
FT                   /protein_id="ACR71285.1"
FT                   /translation="MKVMSIFGTRPEAIKMCPVIKELESREKIKSVVCLTGQHKEMLQP
FT                   VMKLFEIKEDYNLRIMTENQSLSSITCKILDMLEELLNKEKPDMILVHGDTTSAYAAAL
FT                   SAFYHNIPVGHVEAGLRTYNMHSPFPEEFNRQSIDLVSDILFAPTQYAKDMLLSEKKGE
FT                   NKIFVTGNTVIDALKTTVCKSYNITECCEDDKLILLTAHRRENIGEPMKNIFSAVNKIT
FT                   EDYPEIKVIYPVHKNPKIREIANQFFANNSRVKMIEPMDVYDFHNVMNKSYLILTDSGG
FT                   IQEEATSLGKPVLILRDTTERPEGVAAGTLKIVGTQTENIYLETKRLLTDKDEYNRMSK
FT                   SVNPYGDGNASKTIVDIIERYFEGKL"
FT   gene            278712..279803
FT                   /locus_tag="EUBELI_00250"
FT   CDS_pept        278712..279803
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00250"
FT                   /product="Hypothetical protein"
FT                   /note="Psort-B: Unknown cell location; COG0463
FT                   Glycosyltransferases involved in cell wall biogenesis;
FT                   HMMPfam:IPR001173"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00250"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71286"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z2N1"
FT                   /protein_id="ACR71286.1"
FT                   /translation="MPKVSVILPTYNGEKYIREAIDSIINQTFTDWELIVVNDCSTDST
FT                   ITIINEYERKDSRIKVINNPYNQKLPKSLNIGFSSAEGEYLTWTSDDNIFLPSALDEMN
FT                   SFLDQNPNKIMVRARYTIIDENGNYLYEPDGYDSETVFVNNCIGACFLYRRDVLSKVGE
FT                   YNAEKYLVEDYDYWLRILFEYKEIGSLDAVIYKYRIHCSSLTATRKKEIHNKLLKLRME
FT                   YINHIIENLENRKDLLCEIYYEFKQANMLSENLNMIFHDIIPELNFDCEVIENRPSIVY
FT                   GAGLYGEKAYKKYAEIISYFADKNKYGSLIHNRAIISLTELQKIYNDYQILVAASPHNV
FT                   YSFLCTLNQINIRKCTVLIFDNE"
FT   gene            279817..281193
FT                   /locus_tag="EUBELI_00251"
FT   CDS_pept        279817..281193
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00251"
FT                   /product="Hypothetical protein"
FT                   /note="Psort-B: CytoplasmicMembrane, score:7.80; COG0438
FT                   Glycosyltransferase; HMMPfam:IPR001296"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00251"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71287"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR041693"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z2N2"
FT                   /protein_id="ACR71287.1"
FT                   /translation="MRILDKKKVVLYGTGNLYNKYYDKFYDLEIVAVLDSDNNKIGKCI
FT                   NGYIVNSPLYLNEIKYDFIILLIVDYNKVMYNLINIGIDRENIKTIDDYRFFEKYREII
FT                   DVRDNTEKKEILMVSHEMNYRGAPLMLLNLADVLVESGFCVDIVCDSKGDLYETLLKKK
FT                   YGLLYFTDFNFGEKEIEKYFGEYKLIIVNTLALWRIITRLECINKKIIWWLHEEESAYA
FT                   ILKPDFSKIKIYNNLKIYGVGAKAIDAFKKFCAKDIKIDSFRWGIENKYSDTKFDYNNG
FT                   KLVFAIIGPDSYIKGQDFLIDTLKNCSRDILNNIEVLLIGDISESKKEIYEKVPAVKCL
FT                   GIMTHTELMEMYERIGVILSVSRNDTFPVVLIEAMMRKRVCMMSDVVGTAEFISNYRNG
FT                   IIFKSENSNDLISSIEWCLNNRRKLNDIAYAGYETYQKYFSKDIFKLNACSIVEKYINK
FT                   "
FT   gene            281171..282133
FT                   /locus_tag="EUBELI_00252"
FT   CDS_pept        281171..282133
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00252"
FT                   /product="Hypothetical protein"
FT                   /note="Psort-B: Cytoplasmic, score:8.87; COG0500
FT                   SAM-dependent methyltransferases; HMMPfam:IPR013216"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00252"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71288"
FT                   /db_xref="GOA:C4Z2N3"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR013691"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z2N3"
FT                   /protein_id="ACR71288.1"
FT                   /translation="MKNILINNGANMDKIVLFGAGQKGRQLLGLYGANVVAIIDNDVNK
FT                   QGTTITEGTNTVPVISIKKYIEEYKDVPVILAVLKCKEIIKELEKEGITNYKVEDSLFK
FT                   TDDVYQDDTISHDNWIEFLSEKFNKKGMRVLEVGSRIVTGACNRSKFDKAEYVGFDYYS
FT                   GPNVDVVGDAHKLSEYFNEKFDLIFCASVFEHLAMPWKVSIEMIKLLKLGGYVFIETHY
FT                   CYASHERPWHFFQFSENALDVLFPEKMGMLCEKKGCSNLIAGRFTEYSSDYLKDTYING
FT                   MYCHSEYYGKKIKEIDKLSWDDILLEDVSKGTKYPCPNR"
FT   gene            282158..284023
FT                   /locus_tag="EUBELI_00253"
FT   CDS_pept        282158..284023
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00253"
FT                   /product="polysaccharide biosynthesis protein"
FT                   /note="Psort-B: Cytoplasmic, score:8.87; COG3754
FT                   Lipopolysaccharide biosynthesis protein; HMMPfam:IPR007739;
FT                   K07272 polysaccharide biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00253"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71289"
FT                   /db_xref="InterPro:IPR007739"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z2N4"
FT                   /protein_id="ACR71289.1"
FT                   /translation="MYRSAIYVVYDKDNIIDRYVGYFLNQLKSCVDEIYVVVNSKEIIR
FT                   GMENFEAATKVYYRENEGYDVGAFKDAIVNFIGIEKIRTYDEVLLINDSFFGPFVSFKD
FT                   IFIMINKTQCDFWGASKHSRYIEKSYEIEEHLQSFFIGIRNRMLNTKEFYQYWLDMPLI
FT                   NNYSDAIRFHELRFTNYFKQRGYTYSCLMDVEANDNVNPMYNYCQYAYIQQELVLKRNF
FT                   PFLKKRPIEIEYKDMQTQENWSKVLDYVDNNTAYDVDMIYENLIRLYNHADLFEKLNLQ
FT                   YVLQTRGEKEISLKNAIVVICGNVKLISNEIDEYIQRIKDEIKVIFITESKEGCEELKN
FT                   QIREYEYVCLINCDIILENNTFSCVNKSALYGVLENLIKSNSYISNVMGIFKRNKKIGA
FT                   LTIPELIHADFLGKAWKRWVQIRQKISYILDSKQIHCIFSMDKMPIVNSDNLWVRRELL
FT                   EQAIEYNDNKIKNVGYLLGYVAQSKGMLSGVCETAEYAGMNQINQQGYLNALVKQMYRQ
FT                   GNNVDSFLDMQKSITRDKIDNFVKKYKKILIYGTGKKAREYEDLLCIDYEYVISDGMTK
FT                   TNKGELYLSQVVPDNDMGIIVCLNESNQRKVIPLLEKRNINYMCI"
FT   gene            284014..285795
FT                   /locus_tag="EUBELI_00254"
FT   CDS_pept        284014..285795
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00254"
FT                   /product="polysaccharide biosynthesis protein"
FT                   /note="Psort-B: CytoplasmicMembrane, score:7.80; COG3754
FT                   Lipopolysaccharide biosynthesis protein; HMMPfam:IPR007739;
FT                   K07272 polysaccharide biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00254"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71290"
FT                   /db_xref="InterPro:IPR007739"
FT                   /db_xref="InterPro:IPR041561"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z2N5"
FT                   /protein_id="ACR71290.1"
FT                   /translation="MYLTKWRPAMNKRLTIYMTYNKNGIIDDYIVYMLKQLVNVSSDII
FT                   VVSNKKLKQREKEKIAFVSEYIERGNEKFDVGAYSQVIKELYDKRQIYEYDELVLINDS
FT                   VFGPFFDLNDMFSAMDRRKGLDFWGITKRGRSDFDGGAGVYPEHIQSYFYAFRKSIISQ
FT                   DAFKEYWQQVVDEISDFRSAILNYEFKLTEHFEKLGFKWDTYCDCNDYIGNNINRNFSP
FT                   YHYSTYELIKDKRCPFLKRKLFTGDFVNKEYTDAVDLKNAYNFIKDNTDYDLNLIWDYV
FT                   LREYELSSIMNAMQMVEIIDKPIQEENESKDKAELFFFIKRDDERLSYIEQKANENVLN
FT                   NINDERYLGSIKSLFNNDSRLGVLIPPMKTFGKVSLSLSHSWINLNVFEKMKDKLEITV
FT                   PYLLDKAPVYQINGLVCRKELLSNDVIKLLELDKTGTILQMIPLIAQEKGYYTKQVITK
FT                   DYVATQIYNLTGMLSVLGEKISDNARNYSVREMTDQLMEEKIKHFLVSAKKVYIYGAGE
FT                   LACRVAEIAKKYCNLRGILVSDKRSNLSNICGIQVMQYSELKYKDIDVIVAVGKKNNRN
FT                   IERILKDDNIKNILYVD"
FT   gene            285817..286449
FT                   /locus_tag="EUBELI_00255"
FT   CDS_pept        285817..286449
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00255"
FT                   /product="Hypothetical protein"
FT                   /note="Psort-B: Cytoplasmic, score:8.87; COG3475 LPS
FT                   biosynthesis protein; HMMPfam:IPR007074"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00255"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71291"
FT                   /db_xref="InterPro:IPR007074"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z2N6"
FT                   /protein_id="ACR71291.1"
FT                   /translation="MSKIIVFGTGKYGKEAYDFFGDDNVLCFADNNAALTGKYLYEKEI
FT                   ILPSDIQSHYKEYLIILAAREELCIEMEYQLMKMGIENSLNFIFIRDYILSGRIDFNEF
FT                   IDRYLDDAYIYKLKYKQELRKEKQCLEKIEFFQQIADIRHLKPARGKLRKRQKESLDLL
FT                   IKVDRYARNIGLNVILEGGNLLGAIRNGGFVPWDDDIDVVMLRNEYN"
FT   gene            286462..287217
FT                   /locus_tag="EUBELI_00256"
FT   CDS_pept        286462..287217
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00256"
FT                   /product="Hypothetical protein"
FT                   /note="Psort-B: Cytoplasmic, score:8.87; HMMPfam:IPR007074"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00256"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71292"
FT                   /db_xref="InterPro:IPR007074"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z2N7"
FT                   /protein_id="ACR71292.1"
FT                   /translation="MYQNGLLLIPDSSPGDYKKINFQIRNLIKANESNIAFLLNGMFLV
FT                   GYSIGTNEELINVDIFPMDYYKEDCSYKELLDYIANIEMEIIKENDIKSYIRFNSKLEK
FT                   NNPYTSKEPTQRIGYGIETFFCLKSCDEFFNYNDIFPLVEIMFENRKFKAPFNSDSYLL
FT                   NLYGDIYQWPYDVAESPHSIGRHFQVFNSEYNAFYISSISDAIEFVNNMGLFYNNKPIV
FT                   EKYKIKVWNEYISIIDYLDENNVDYIVYA"
FT   gene            287232..288359
FT                   /locus_tag="EUBELI_00257"
FT   CDS_pept        287232..288359
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00257"
FT                   /product="Hypothetical protein"
FT                   /note="Psort-B: Unknown cell location; COG3774
FT                   Mannosyltransferase OCH1 and related enzymes;
FT                   HMMPfam:IPR007577"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00257"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71293"
FT                   /db_xref="GOA:C4Z2N8"
FT                   /db_xref="InterPro:IPR007577"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z2N8"
FT                   /protein_id="ACR71293.1"
FT                   /translation="MVLKFDSFDKIREYVNKKETPVVIYGAGMIGQIIMPYIVVEYGIV
FT                   DKLLFYVDGDSKKQNETIHIGNRNIEIKSLDVLPDIPKDAVILITTSNYTGVISMLNTI
FT                   EELRENIVAIIPVILALNAEQMPDSSMITESKKFNIPKKIHYCWFSGNPMPDYLNKCIE
FT                   SWKKFCPDYEIIRWDEDNYNVEKNLYMKQAYEAKKWGFVPDIARLDILYNYGGLYIDTD
FT                   VEVIRNLDDLLKYEAFAGVEKWGNINMGGCSGAVPHHPVIKEMLDFRKNEPFVMQDGSF
FT                   NLTTCGYYETMPLIKKGFKPNNTVQNIAGMTIFSSDYFHPYDYMSGETCITKNTYSIHH
FT                   FNGGWLDEKHRKDREKTKKEYQCIINSIKRLSRNV"
FT   gene            288458..289507
FT                   /locus_tag="EUBELI_00258"
FT   CDS_pept        288458..289507
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00258"
FT                   /product="Hypothetical protein"
FT                   /note="Psort-B: Unknown cell location; NOG13752 non
FT                   supervised orthologous group; HMMSmart:IPR003593"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00258"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71294"
FT                   /db_xref="GOA:C4Z2N9"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011579"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z2N9"
FT                   /protein_id="ACR71294.1"
FT                   /translation="MEVFMDNPYSMVFGKEPELFVSRAAQENKVINDFSGDNPTYQTYL
FT                   LTGVRGSGKTVMMTEIANKLRKSDEWIIVELNPDRDLLNGLAANLSSNNKLAAIFKDAR
FT                   INLSFLGFGVEISGVAPITDIEVALHEMIANLKKHNKKILIAIDEVTNNENIKVFASAF
FT                   QIMVRKDLPVFLLMTGLYENINAIQDEKNLTFLYRAPKLEMKSLNIGAVAQKYADTFDI
FT                   DSDNAVEMAKLTKGYPFAFQVLGYLTWNNNGDYKGVLAEYRQYLEEYVYEKIWSELSAK
FT                   DKEIAFAIAKCDTGKIKDIRELMHIDTNQFNPYRKRLIKKGIVDGSEYGIVRFTLPFFE
FT                   RFVIENYYE"
FT   gene            289534..290190
FT                   /locus_tag="EUBELI_00259"
FT   CDS_pept        289534..290190
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00259"
FT                   /product="ribulose-phosphate 3-epimerase"
FT                   /note="Psort-B: Cytoplasmic, score:8.87; COG0036
FT                   Pentose-5-phosphate-3-epimerase; HMMPfam:IPR000056;
FT                   Gene3D:IPR013785; HMMPanther:IPR000056;
FT                   ScanRegExp:IPR000056; superfamily:IPR011060; K01783
FT                   ribulose-phosphate 3-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00259"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71295"
FT                   /db_xref="GOA:C4Z2P0"
FT                   /db_xref="InterPro:IPR000056"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z2P0"
FT                   /protein_id="ACR71295.1"
FT                   /translation="MYTELTASMMCANFGNLEKEVRELDAAGIDSFHIDIMDGRYVPNF
FT                   AMSLNDMRYIRSATDKPLDVHLMIEHPNTHINLFLNSLKEGDTVYIHPEAEYHPSTTLQ
FT                   KIINAGLIPGIAINPGTSIETVMEMLQIVDKVLVMSVNPGNAGQMYLPYVGKKIERLLK
FT                   IREEMNFEVYWDGACGADKISTFAPMGVKGFVLGTTLLFGKGRPYADILKEIRRL"
FT   gene            290187..291659
FT                   /locus_tag="EUBELI_00260"
FT   CDS_pept        290187..291659
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00260"
FT                   /product="Hypothetical protein"
FT                   /note="Psort-B: Cytoplasmic, score:8.87; NOG19119 non
FT                   supervised orthologous group"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00260"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71296"
FT                   /db_xref="GOA:C4Z2P1"
FT                   /db_xref="InterPro:IPR007554"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z2P1"
FT                   /protein_id="ACR71296.1"
FT                   /translation="MILDNNVYDMSENMIIEYANKLADAIECNQLLEEYNSGQLTYEYL
FT                   IAMFLATQAMENGDKLYNYCYDAVIACGKRNIDFKLKQNKKIKVAFLPISAAEWPAEYI
FT                   YRKLETDTRFEPEVIPVPLIGRPKKERGKVYMQTYDFFANGNYNVKKVYNAETEEIVGW
FT                   EDIGGMPDIVVHVTPWYLNIAKDYQVGQYPLHVLNVYISYGVTLGNSIDGTYAEKCLYN
FT                   KEFVNIMWKVYTETTTNYECYKKYQVLKAKNVINSGYIKMDYFVEKHQYSDDYIRKIWP
FT                   FPSGSDIKGYKRVLITPHFSVGNTNILSFSTFDKNMYFYIYLAKKYRDNVSFIFKPHPN
FT                   LRNGLIENGCMKSVDEYEAYLDEFRKLPNASVCEEGDYLALFDTSDGIINDSISFIGEY
FT                   LYVDKPMLFLERPEQCFDELGRTLIKAHYKACGEDYMGIDNFVNDVVINENDYMKQQRE
FT                   EIFSEELDYYSKNGIKASEYVYKDIVDGVFRL"
FT   gene            291669..292343
FT                   /locus_tag="EUBELI_00261"
FT   CDS_pept        291669..292343
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00261"
FT                   /product="2-C-methyl-D-erythritol 4-phosphate
FT                   cytidylyltransferase"
FT                   /note="Psort-B: Cytoplasmic, score:8.87; COG1211
FT                   4-diphosphocytidyl-2-methyl-D-erithritol synthase;
FT                   HMMPfam:IPR001228; ScanRegExp:IPR001228; K00991
FT                   2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00261"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71297"
FT                   /db_xref="GOA:C4Z2P2"
FT                   /db_xref="InterPro:IPR018294"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR034683"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z2P2"
FT                   /protein_id="ACR71297.1"
FT                   /translation="MNIALVLAGGTGTRLGADIPKQYIEVRGKMIIDYCLETMEHSNDI
FT                   AEVWIVADEMWREHIKKVDKFKGYACPGRNRQLSIYNGLKAIEESLADKEKEVNVLIHD
FT                   AARPFLTEKLIRECVKAVEGHDGVLPVLPMKDTVYYSEDGKVISSLINRDKLYAGQAPE
FT                   LFRLQPYIQANEALLPDKILLVNGSTEPAIMAGMDIVMIPGDENNYKITTKTDMKRFTE
FT                   MM"
FT   gene            292365..293381
FT                   /locus_tag="EUBELI_00262"
FT   CDS_pept        292365..293381
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00262"
FT                   /product="Hypothetical protein"
FT                   /note="Psort-B: Cytoplasmic, score:8.87; COG1063 Threonine
FT                   dehydrogenase and related Zn-dependent dehydrogenases;
FT                   HMMPfam:IPR013149; HMMPfam:IPR013154; HMMPanther:IPR002085;
FT                   superfamily:IPR011032"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00262"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71298"
FT                   /db_xref="GOA:C4Z2P3"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z2P3"
FT                   /protein_id="ACR71298.1"
FT                   /translation="MMKAQVLYGMGDLRYKDIEKPQLKEGWVMVKVMAAGVCGSDIPRI
FT                   YNTGAHVHPIVPGHEFSGEVVETFDKNSRWNGKRVGVFPLIPCGKCSSCKKKMYEMCSN
FT                   YNYLGSRCDGGFAEYAAVPEWNLIELPDNVTYRQAAMMEPMAVAVHAMRRFSISKDSTV
FT                   CVIGLGTIGLLLTMFLKSEGIENVYVFGNKDVQRDYARKLGIDDECYNAKHISADYVFE
FT                   CVGKNETVNQAIELAAPAGHITMVGNPYSDMEISKDLYWKILRKQLKISGTWNSSYTGD
FT                   VNDDWHFVLNKLEKAEIDPERFITHEYSIDGIQTGMKIMRDKSEDYVKVICIDEEDF"
FT   gene            293381..294442
FT                   /locus_tag="EUBELI_00263"
FT   CDS_pept        293381..294442
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00263"
FT                   /product="galactosyltransferase"
FT                   /note="Psort-B: Cytoplasmic, score:8.87; COG0438
FT                   Glycosyltransferase; HMMPfam:IPR001296; K02840
FT                   galactosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00263"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71299"
FT                   /db_xref="GOA:C4Z2P4"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z2P4"
FT                   /protein_id="ACR71299.1"
FT                   /translation="MIRVDILSPVGGKVGGIENVIKLWTKNLSQPDYVVRVIHMSPGTK
FT                   YLDGYEYAYAFCDKEDEDFNEKLKRFVKNYAGFINEYGAPDVCIATNWPVMCVVAETVR
FT                   RILKSDYKIISWVHSSIAEYKKAGLGGIDEMLCADAHLCISRNNERHLLEYVERTKVYY
FT                   VGNPVIMQSFIEKTHGEKQLCYVGRLQEIKRVDIILEALYRAHNKWNLRIIGDGESAQD
FT                   LKEITRYLKLQDRVEYTGWKENPWEYCRDACALVAASEYEGFMLTGAEAMSMGLTVIST
FT                   PVEGLIDYLIPGKNGYLFEKNNAEELAQVLDYLYDGKLPMCDRKACRESVDKYSENNYI
FT                   KKIKKNLEEWLSI"
FT   gene            294550..295362
FT                   /locus_tag="EUBELI_00264"
FT   CDS_pept        294550..295362
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00264"
FT                   /product="flagellin"
FT                   /note="Psort-B: Extracellular, score:9.55; COG1344
FT                   Flagellin and related hook-associated proteins;
FT                   HMMPfam:IPR001029; HMMPfam:IPR001492;
FT                   BlastProDom:IPR001029; FPrintScan:IPR001492; K02406
FT                   flagellin"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00264"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71300"
FT                   /db_xref="GOA:C4Z2P5"
FT                   /db_xref="InterPro:IPR001029"
FT                   /db_xref="InterPro:IPR001492"
FT                   /db_xref="InterPro:IPR042187"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z2P5"
FT                   /protein_id="ACR71300.1"
FT                   /translation="MVVQHNLSAMNTNRQMGIVTDALQKSTEKLSSGYKINRAADDAAG
FT                   LSISEKMRAQIRGLDKASDNAQDGISLIQVAEGALNETHSILQRMNELATQAANDTNTS
FT                   TDRTAIKAEIDQLTSEINRIQSTTQFNTQNLLDGKFTGKNLQIGSLKGQTIKISISNMN
FT                   AKTLGVSGLTVDKNSTAGISMSKIQAAIDKVSTQRSNLGALQNRLEHTINNLDTTSENT
FT                   SAAESRIRDTDMADEMVRYSKNNILSQAGNSMLAQANQQTQGVLSLLQ"
FT   gene            295454..295876
FT                   /locus_tag="EUBELI_00265"
FT   CDS_pept        295454..295876
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00265"
FT                   /product="Hypothetical protein"
FT                   /note="Psort-B: Cytoplasmic, score:8.87;
FT                   ScanRegExp:IPR007087"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00265"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71301"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z2P6"
FT                   /protein_id="ACR71301.1"
FT                   /translation="MKENSYKNVINNLLIENTEESVSKLVGIYKDIDFRKEYMLYDEDL
FT                   LYCYIAVCVYRIEKAHNIFNHILSMGHDLKCITGLICRLKFLIWRIEFGDGACGVNEML
FT                   ECIRRNKLSGVAVEEIINQVSFDKENVYKKIAAYGE"
FT   gene            295879..296544
FT                   /locus_tag="EUBELI_00266"
FT   CDS_pept        295879..296544
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00266"
FT                   /product="Hypothetical protein"
FT                   /note="Psort-B: Unknown cell location; COG1216 Predicted
FT                   glycosyltransferases"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00266"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71302"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z2P7"
FT                   /protein_id="ACR71302.1"
FT                   /translation="MNDKKICFIVCVNNDMYIDECVYYIRNLEIPSEYEIDIITVQDAG
FT                   SMTSGYNAAMQESDAKYKIYIHQDVFLTKRDMIYDILRIFKDSSIGMIGLIGTQKLPDD
FT                   GCMWHGKRVGRIYTNNILSSKEFIASEDNEKPYMQVEAVDGLFMATQYDITWREDLFTG
FT                   WDFYDVSQSQEFLKAGYKIVVPYMDKPWCIHDEGFLNLDRYEEFRKIFLEEYMGGNNH"
FT   gene            296544..297746
FT                   /locus_tag="EUBELI_00267"
FT   CDS_pept        296544..297746
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00267"
FT                   /product="spore maturation protein CgeB"
FT                   /note="Psort-B: Cytoplasmic, score:8.87; COG4641
FT                   Uncharacterized protein conserved in bacteria; K06320 spore
FT                   maturation protein CgeB"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00267"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71303"
FT                   /db_xref="InterPro:IPR024542"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z2P8"
FT                   /protein_id="ACR71303.1"
FT                   /translation="MNILMFGSRNFGIEDVEECFMKKGYKYTYIDDTSYRDRVNRQIDA
FT                   KFADSIEKGIEGEKYDCVFTFNYSPVISNNCKKINIPYISFVYDNPQIQLYSYTVINSC
FT                   NYIFIFDKAQYMELKNGGINTVFYAPLAVNIDRMNRMLGTNGSCNDRYKSDVSFVGSMY
FT                   NEKHNLFQRLEGVSEHTKGYLDAIIQAQRQVYGLFFLEDLLKDRILDDMLKNYPVEVNT
FT                   DGVESVEYIYANYFLARELATEERYDIMKKLGTEFGKDYLINLYTPNGSLKIDGVMNKG
FT                   PIDYYNEMPYVFNNSRINLNITLRSIKSGIPLRAMDICGAGGFLLSNYQADFYDFFTPG
FT                   EDIVLYESIDDMLSKCKYYLTHDSERERIAKNGRARIEEAHTYDIRFEEIFNMVFNTHR
FT                   K"
FT   gene            297755..299695
FT                   /locus_tag="EUBELI_00268"
FT   CDS_pept        297755..299695
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00268"
FT                   /product="Hypothetical protein"
FT                   /note="Psort-B: Unknown cell location; COG0463
FT                   Glycosyltransferases involved in cell wall biogenesis;
FT                   HMMPfam:IPR013217"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00268"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71304"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z2P9"
FT                   /protein_id="ACR71304.1"
FT                   /translation="MIDLGKYGYYGDDPKPVFNTSFYRGEDLYSDGDIENEVIKIIAAN
FT                   PTTDYEEAISRNYSWPVFYHLTRIRQNLLNWYPFKEQSDVLEIGCGMGAITELLCKKCN
FT                   SVTAVELSKRRATATYLRCREYDNLEIIVGNLNDIGFEKKYDYITLIGVLEYQNNFTSS
FT                   SNPFKDFLSKIKQLLKPEGKLIIAIENKYGLKYWCGAPEDHSGIPYDGINNYIYSNIAR
FT                   TFSKKQLERLVKSVGFSNTYFYYPLPDYKMPQVVYSEEYLPKNGSIDNWIPYYEPNGNS
FT                   MISDEEHIYGDLVDNDVFEFFANSFMVECCAGNEDIGEIQYAVSSPFRNKEYNMITVYS
FT                   KNDGFYKIADSDSVNALKSTDNNHKMLDKRGLLVSETNIKGNVMYTKEITGTPLTEILL
FT                   REYADKNENEVYKIFDKIYEEIIRSSEESDKLNPIFNSSDEMHLSVLESNDKILKKIYI
FT                   DMIHKNCFVQENGDYVWIDQEWCLDDIPASFGLYYNIIELYASNMWIDTCIPMKQVLEH
FT                   YALTDKSDCYYNLKQAFLNTVQNRYSTFNYWQLSQLNKDNITTNIKLLYNNMNNCPKQH
FT                   LSETEARINEILKNGTIMDVIEYVGTLTDEIILKDIPQMPQFIVRYLKANDNEKAVMQQ
FT                   SIKRYDDIKNM"
FT   gene            299711..301552
FT                   /locus_tag="EUBELI_00269"
FT   CDS_pept        299711..301552
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00269"
FT                   /product="Hypothetical protein"
FT                   /note="Psort-B: Cytoplasmic, score:8.87; HMMPfam:IPR007554"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00269"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71305"
FT                   /db_xref="GOA:C4Z2Q0"
FT                   /db_xref="InterPro:IPR007554"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z2Q0"
FT                   /protein_id="ACR71305.1"
FT                   /translation="MLNDTAKNMQTIICQAIDSGNYYAAYEALIIYTQTFSVDDFVEEY
FT                   KWLINEYGPQVSVICLDNNESAIDEFIKMQTYKNIELAKLSEEDSNADIIEYIKATSSK
FT                   YICFWEVSCEYDNDKISEMVWKLESSKQFNVVMTPRMYVDAVGNIIGHKDYAYEDIFNN
FT                   VIVKGETLLNYCVSNNINLYGSLSDIMLNKNCAYDMECQHIYKSAAINRLNMLFQILEG
FT                   QKIFYMEQSLVRAKLSAKCDETDEINEYKELEASVNSKQSNAISALSEKSIKKEITFFY
FT                   TDKGEYYNLEPIANEAGKRGYKIRFTKDKKEKAEIGVYCQHVCYPENSKFSLILLHDLA
FT                   QGHNKWPNLWESERWNKFDIGIVPGRTWADRWRQCASFYYANPRSGTYEFGYPKSDYVN
FT                   DESIICRAADVKKKLGIPDKFTVLYAPSWEYDGKEEDFIKAVKDLDVNMVVKQACWSED
FT                   YSIVTNNMRSLHEGIYKNLYYVEPEESIMTALALCDMVVSDESSVMAEALMFGKPSVAV
FT                   TDWMIPDEDPPRPASVPMDYVIKCEKKDLREKVLSIMNHSEEYEDVLQKGRDTFSNQGN
FT                   VCKDIMDAIDYYTQEGTEDGFMSRKLESEYRAFNMWN"
FT   gene            complement(301571..302782)
FT                   /locus_tag="EUBELI_00270"
FT   CDS_pept        complement(301571..302782)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00270"
FT                   /product="spore maturation protein CgeB"
FT                   /note="Psort-B: Cytoplasmic, score:8.87; COG4641
FT                   Uncharacterized protein conserved in bacteria; K06320 spore
FT                   maturation protein CgeB"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00270"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71306"
FT                   /db_xref="InterPro:IPR024542"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z2Q1"
FT                   /protein_id="ACR71306.1"
FT                   /translation="MININIELEVPMKIYFYRYGSICEPDVIDSFKRLGLDVDEETIEI
FT                   SKKNLLPGECVSIVSPKLMNNNYTFVFTINFFPWLSDVCQIVNVVYISLIVDSPVLELY
FT                   SKSLSNSVNRVFLFDKMLFNEFEPYNKEHIFHIPLATNVRRNDEVIKNASAQENRKFTS
FT                   DISFIGSTYQEKCPFNRAILPEYEKGYVDGIINAQLGVYGYNFIEDMLTDDMTERLLNC
FT                   IPQHYEFPEGYRANNKALLAQEYLSVKVAEQERLRLLKMLSDSFNVDIYTGSDTTSLPH
FT                   IHNKGFAKSLSEMPVIFHNSKINLNITAKSIRSGLSLRIFDVLGCGGFLITNYQAELPE
FT                   FFEIGKDLVAYESENHLKELCAYYLTHDDERNEIARHGYETIVNNHTYDIRMLQIIDKS
FT                   FPAR"
FT   gene            302878..304269
FT                   /locus_tag="EUBELI_00271"
FT   CDS_pept        302878..304269
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00271"
FT                   /product="fatty-acyl-CoA synthase"
FT                   /note="Psort-B: Unknown cell location; COG0204
FT                   1-acyl-sn-glycerol-3-phosphate acyltransferase;
FT                   HMMPfam:IPR000873; K00666 fatty-acyl-CoA synthase"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00271"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71307"
FT                   /db_xref="GOA:C4Z2Q2"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z2Q2"
FT                   /protein_id="ACR71307.1"
FT                   /translation="MTDKNTFYNMLKNNAQKHPDAVAVVYDTMKVTYAKLFDDVTKKAL
FT                   HFQKFDGERIAIFGQASYRWIVNMFGTIVAGKDLVLVDFFLPHDSRVDLLKKTEVNYTL
FT                   TSTNQYILSDENSIIISSAEKDDVEGLIYDENTTEGDIIMFTATAGECDKPVVLSVDNI
FT                   LNTATEISNRVECTEDDIVLAQIPLHNEFGLIYSLIWPLCCGAMVCIGRGLRHIDADTY
FT                   YYDPTILIGTPSMIDYLRAVSGFNSELKTIIIGGASCPFRLFENLCDSDLKVYNIYGTT
FT                   ETSGCVGVNELYDGSYTLFDKDAVTIAEDGEILVKGPCVMKGYYKDDEANNKVLKDGVY
FT                   HTGDYGRINNAGRLVLLQRNPDIILLPTGEKISRVRTNEQITAINGVAEGFITFYNNRL
FT                   TAIIVPIDKGATEDIFKRRIDKYNEKKGYRWEIQKIVLRKEPLPRNADGTVDEDAVCEF
FT                   IEKIK"
FT   gene            304272..305264
FT                   /locus_tag="EUBELI_00272"
FT   CDS_pept        304272..305264
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00272"
FT                   /product="lipopolysaccharide cholinephosphotransferase"
FT                   /note="Psort-B: Cytoplasmic, score:8.87; COG3475 LPS
FT                   biosynthesis protein; HMMPfam:IPR007074; K07271
FT                   lipopolysaccharide cholinephosphotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00272"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71308"
FT                   /db_xref="GOA:C4Z2Q3"
FT                   /db_xref="InterPro:IPR007074"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z2Q3"
FT                   /protein_id="ACR71308.1"
FT                   /translation="MEKELEFSADYFKTEVRDGFEIPAMMKRAWAAQMEVLHVVAGVCK
FT                   NNGIRYFADGGTLLGAVRHKGMIPWDDDIDICVVREEYNRLIQVLPKALPHGFVVAGMY
FT                   ADSERLQKAAFVPHLRVIADETLWNFNDYMRYFHGFPYQRVGIDIFPMDYISRDIGITN
FT                   VQKQIIRLGIETLRDWNKLEENGMLDEYVNGFQKLCNVSFDNVNNEKNYMWKIIDKISS
FT                   ISYREEADYITNIFYWLDNDNYKMKKECYDYTIELPFENMNIVAPEMYDEVLRAEYGDY
FT                   IVPVKGAADHDYPFYGHMEPELIKQIRNVGFKGSVDEFCEEVASGRLRV"
FT   gene            305350..305709
FT                   /locus_tag="EUBELI_00273"
FT   CDS_pept        305350..305709
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00273"
FT                   /product="Hypothetical protein"
FT                   /note="Psort-B: Cytoplasmic, score:8.87"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00273"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71309"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z2Q4"
FT                   /protein_id="ACR71309.1"
FT                   /translation="MDDYRQQQIDVLKEAVPYSEKLIGAIEKVSDELAGVPFPETHDAV
FT                   NVIIEGLNWLFEVYNGTKDIIEAGAVDEAEANSGVKELSEAVKADDDVAVSKALVRLST
FT                   FVKQLHDAGSRLINE"
FT   gene            complement(305784..307226)
FT                   /locus_tag="EUBELI_00274"
FT   CDS_pept        complement(305784..307226)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00274"
FT                   /product="Hypothetical protein"
FT                   /note="Psort-B: Unknown cell location; COG1345 Flagellar
FT                   capping protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00274"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71310"
FT                   /db_xref="GOA:C4Z2Q5"
FT                   /db_xref="InterPro:IPR040026"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z2Q5"
FT                   /protein_id="ACR71310.1"
FT                   /translation="MTKNALHIIIFVQINTIYIRKWISFFLEIITDKEVTVMISSVYSY
FT                   YLAQYGHKTNSKYDTHTKAQLKNTYGRVLKSNSQTPTYKTDMSEAAQKYAIDLKENARE
FT                   LSNIANELSGSDGHGMVFKKSAVSSNPQSVTAEYIGDSTSPDSSSFEIDVKQLATSQIN
FT                   TGNFLQPNNRAVEPGDYSFDLNINNLTYEFQFTVDEEESNSDIQNKLARLINRSNIGLA
FT                   ANVNEDSLGNTALSIVSDMTGISGIKPTIFNISPNNDIQTNNPDFVEGFDEPTMKNNTN
FT                   FINAFGLDRVSQYPSNAIFSINGEERSSASNDITINKAFAINFNSTTEEPVTISLREDT
FT                   DSITESIGELVSGYNRLFSIAADKENDKFEGNAKLKKEFSRIMKDYQPQLEKNGLTVDS
FT                   SGTIEVNKAVIQKAASDGTLSDVFNALDSFKKSIQRKADDISINPMNYVNNKIVAYKNP
FT                   HKPVNDPYNLSAYSGMMFNGYI"
FT   gene            complement(307272..307427)
FT                   /locus_tag="EUBELI_00275"
FT   CDS_pept        complement(307272..307427)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00275"
FT                   /product="Hypothetical protein"
FT                   /note="Psort-B: Unknown cell location"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00275"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71311"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z2Q6"
FT                   /protein_id="ACR71311.1"
FT                   /translation="MPMLSLLAQLPPPIIIFVGVKTPIGFFARPLNVGLLNFRHAKKTA
FT                   SIAVLI"
FT   gene            307403..307552
FT                   /locus_tag="EUBELI_00276"
FT   CDS_pept        307403..307552
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00276"
FT                   /product="Hypothetical protein"
FT                   /note="Psort-B: Extracellular, score:8.82; COG0267
FT                   Ribosomal protein L33; HMMPfam:IPR001705;
FT                   BlastProDom:IPR001705; HMMTigr:IPR001705"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00276"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71312"
FT                   /db_xref="GOA:C4Z2Q7"
FT                   /db_xref="InterPro:IPR001705"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="InterPro:IPR038584"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z2Q7"
FT                   /protein_id="ACR71312.1"
FT                   /translation="MRVKITLACTECKQRNYNMTKEKKAHPDRMETKKYCKFCKSHTLH
FT                   KETK"
FT   gene            307575..307778
FT                   /locus_tag="EUBELI_00277"
FT   CDS_pept        307575..307778
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00277"
FT                   /product="Hypothetical protein"
FT                   /note="Psort-B: Unknown cell location; HMMPfam:IPR001901;
FT                   HMMTigr:IPR005807"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00277"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71313"
FT                   /db_xref="GOA:C4Z2Q8"
FT                   /db_xref="InterPro:IPR001901"
FT                   /db_xref="InterPro:IPR005807"
FT                   /db_xref="InterPro:IPR038379"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z2Q8"
FT                   /protein_id="ACR71313.1"
FT                   /translation="MGDTVKAKKQKKNWFKGLKAEFSKIIWPDRQSLTKETVAVLAVSV
FT                   LLGVIIAVVDLIVRFGIEFIVK"
FT   gene            307794..308330
FT                   /locus_tag="EUBELI_00278"
FT   CDS_pept        307794..308330
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00278"
FT                   /product="transcriptional antiterminator NusG"
FT                   /note="Psort-B: Cytoplasmic, score:8.87; COG0250
FT                   Transcription antiterminator; HMMPfam:IPR006645;
FT                   FPrintScan:IPR001062; Gene3D:IPR014722; HMMSmart:IPR006645;
FT                   HMMTigr:IPR001062; ScanRegExp:IPR015869;
FT                   superfamily:IPR008991; K02601 transcriptional
FT                   antiterminator NusG"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00278"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71314"
FT                   /db_xref="GOA:C4Z2Q9"
FT                   /db_xref="InterPro:IPR001062"
FT                   /db_xref="InterPro:IPR006645"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR015869"
FT                   /db_xref="InterPro:IPR036735"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z2Q9"
FT                   /protein_id="ACR71314.1"
FT                   /translation="MDDAKWYVVHTYSGYENKVKANIEKTVENRNLHDQILEVIVPLET
FT                   VVEIKDGSKKAAQKKMFPGYVLVKMVMNDDSWYVVRNTRGVTGFVGPGSKPVPLTPTEI
FT                   KNLGISLEEEQEVKPVIQFAGKVGDKVMILSGAWEDTVGEITNINEGKQCLTINVEMFG
FT                   RETPVEIDFTDVKLL"
FT   gene            308437..308913
FT                   /locus_tag="EUBELI_00279"
FT   CDS_pept        308437..308913
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00279"
FT                   /product="large subunit ribosomal protein L11"
FT                   /note="Psort-B: Unknown cell location; COG0080 Ribosomal
FT                   protein L11; HMMPfam:IPR000911; BlastProDom:IPR000911;
FT                   Gene3D:IPR000911; HMMPanther:IPR000911;
FT                   HMMPanther:IPR006519; HMMSmart:IPR000911;
FT                   HMMTigr:IPR006519; superfamily:IPR000911; K02867 large
FT                   subunit ribosomal protein L11"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00279"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71315"
FT                   /db_xref="GOA:C4Z2R0"
FT                   /db_xref="InterPro:IPR000911"
FT                   /db_xref="InterPro:IPR006519"
FT                   /db_xref="InterPro:IPR020783"
FT                   /db_xref="InterPro:IPR020784"
FT                   /db_xref="InterPro:IPR036769"
FT                   /db_xref="InterPro:IPR036796"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z2R0"
FT                   /protein_id="ACR71315.1"
FT                   /translation="MYYDGRQLPHLFLGGAKMAKKVTGYIKLQIPAGKATPAPPVGPAL
FT                   GQHGVNIVEFTKQFNAKTADQGDLIIPVVITVYADRSFSFITKTPPAAVLLKKACNIKS
FT                   GSGVPNKTKVATIKRAEVQKIAELKMPDLNAASIEAATSMIEGTAKSMGIVVED"
FT   gene            308986..309681
FT                   /locus_tag="EUBELI_00280"
FT   CDS_pept        308986..309681
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00280"
FT                   /product="large subunit ribosomal protein L1"
FT                   /note="Psort-B: Cytoplasmic, score:8.87; COG0081 Ribosomal
FT                   protein L1; HMMPfam:IPR002143; BlastProDom:IPR002143;
FT                   HMMPanther:IPR005878; HMMTigr:IPR005878;
FT                   ScanRegExp:IPR002143; K02863 large subunit ribosomal
FT                   protein L1"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00280"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71316"
FT                   /db_xref="GOA:C4Z2R1"
FT                   /db_xref="InterPro:IPR002143"
FT                   /db_xref="InterPro:IPR005878"
FT                   /db_xref="InterPro:IPR016095"
FT                   /db_xref="InterPro:IPR023673"
FT                   /db_xref="InterPro:IPR023674"
FT                   /db_xref="InterPro:IPR028364"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z2R1"
FT                   /protein_id="ACR71316.1"
FT                   /translation="MKRGKKYVEAAKNIDRQTLYEAADAISLVKKNATAKFDETIEAHI
FT                   RTGCDGRHAEQQIRGAVVLPHGTGKTVRVLVFAKGAKADEALAAGADFVGGEELIPKIQ
FT                   NDNWFEFDVVVATPDMMGVVGRLGRVLGPKGLMPNPKAGTVTMDVTKAVNDIKAGKIEY
FT                   RLDKTNIIHVPIGKASFTEEQLSDNFQAIMDAIVKAKPSSLKGAYLRSVVLTSTMGPGV
FT                   KLSTAKYVG"
FT   gene            309978..310481
FT                   /locus_tag="EUBELI_00281"
FT   CDS_pept        309978..310481
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00281"
FT                   /product="large subunit ribosomal protein L10"
FT                   /note="Psort-B: Cytoplasmic, score:8.87; COG0244 Ribosomal
FT                   protein L10; HMMPfam:IPR001790; ScanRegExp:IPR002363;
FT                   K02864 large subunit ribosomal protein L10"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00281"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71317"
FT                   /db_xref="GOA:C4Z2R2"
FT                   /db_xref="InterPro:IPR001790"
FT                   /db_xref="InterPro:IPR002363"
FT                   /db_xref="InterPro:IPR022973"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z2R2"
FT                   /protein_id="ACR71317.1"
FT                   /translation="MAILKNVGLKTSTIDEIKDNFDGAQGVVVVNYSGLTVEQDTQLRK
FT                   QLREAGVVYKVYKNTLVKRVVAGTEFEPIADTLEGTNAIAFCKTDATAPARILANFAKT
FT                   ADALELKCGVVEGTFYDAAGIATIATIPSREELLSKLLGSIQSPITNFARVIKQIAEKN
FT                   EEVA"
FT   gene            310564..310929
FT                   /locus_tag="EUBELI_00282"
FT   CDS_pept        310564..310929
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00282"
FT                   /product="large subunit ribosomal protein L7/L12"
FT                   /note="Psort-B: Cytoplasmic, score:8.87; COG0222 Ribosomal
FT                   protein L7/L12; HMMPfam:IPR013823; BlastProDom:IPR013823;
FT                   Gene3D:IPR014719; HMMTigr:IPR000206; superfamily:IPR008932;
FT                   K02935 large subunit ribosomal protein L7/L12"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00282"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71318"
FT                   /db_xref="GOA:C4Z2R3"
FT                   /db_xref="InterPro:IPR000206"
FT                   /db_xref="InterPro:IPR008932"
FT                   /db_xref="InterPro:IPR013823"
FT                   /db_xref="InterPro:IPR014719"
FT                   /db_xref="InterPro:IPR036235"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4Z2R3"
FT                   /protein_id="ACR71318.1"
FT                   /translation="MTTQEIIEVIKGLSVLELNDLVKACEEEFGVSAAAGVVVAAAGAG
FT                   AAAAEEKTEFDVELTEAGDQKVKVIKVVREITGLGLKEAKDVVDGAPKVVKEQASKEEA
FT                   EEIKKKLEEVGAKVTLK"
FT   gene            311223..315200
FT                   /locus_tag="EUBELI_00283"
FT   CDS_pept        311223..315200
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00283"
FT                   /product="DNA-directed RNA polymerase"
FT                   /note="Psort-B: Cytoplasmic, score:9.98; COG0085
FT                   DNA-directed RNA polymerase, beta subunit/140 kD subunit;
FT                   HMMPfam:IPR007120; HMMPfam:IPR007641; HMMPfam:IPR007642;
FT                   HMMPfam:IPR007644; HMMPfam:IPR007645; HMMPanther:IPR015712;
FT                   HMMTigr:IPR010243; ScanRegExp:IPR007121; K00960
FT                   DNA-directed RNA polymerase"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00283"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71319"
FT                   /db_xref="GOA:C4Z2R4"
FT                   /db_xref="InterPro:IPR007120"
FT                   /db_xref="InterPro:IPR007121"
FT                   /db_xref="InterPro:IPR007641"
FT                   /db_xref="InterPro:IPR007642"
FT                   /db_xref="InterPro:IPR007644"
FT                   /db_xref="InterPro:IPR007645"
FT                   /db_xref="InterPro:IPR010243"
FT                   /db_xref="InterPro:IPR015712"
FT                   /db_xref="InterPro:IPR019462"
FT                   /db_xref="InterPro:IPR037033"
FT                   /db_xref="InterPro:IPR037034"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z2R4"
FT                   /protein_id="ACR71319.1"
FT                   /translation="MEKNRLRPITSGKAMRMSFSRQKEVLEMPNLIEVQKDSYQWFLNE
FT                   GLKEVFDDISPIADYNGRLSLEFVDFALCEDEVKYSIEECKERDATYAAPLKVTVRLHN
FT                   KETESISEHEIFMGDLPLMTKTGTFVINGAERVIVSQLVRSPGIYYDIQKDKYGKIFLY
FT                   SCQVIPNRGAWLEYETDANDIFYVKVDRNKKVPITVLIRALGFGTNAEILDIFGEEPKL
FT                   LATMEKDTSTNYQEGILELYKKLRPGEPLSVESAEALISGMFFDPRRYDLAHVGRYKFN
FT                   KKLSFKSRITGQVLAEDVVDENGTVIATAGEKLTRESAQAIQDAAVPSVFITVEVKAAD
FT                   GTVSDRVVKILSNRAVDITKWVDISEEEAKELGVTEYVYYPVLAQILAENESLEDIKEA
FT                   ITKNIADLIPKHITVEDILASINYNMHLEYGVGTKDDIDHLGNRRIRAVGELLQNQFRI
FT                   GISRMERVVRERMSTQDLSGISPQSLINIKPVTAAIKEFFGSSQLSQFMDQNNPLSEIT
FT                   HKRRLSALGPGGLSRDRAGFEVRDVHYTHYGRMCPIETPEGPNIGLINSLASYARINEY
FT                   GFVEAPYRIVDKSDPKNPRVTDEVRYFTADEEDDFHVAQANAEIDENGYFVRNTVSGRY
FT                   REETSQFDKSQIDLMDVSPKMVFSVATSMIPFLQNDDCTRALMGSNMQRQAVPLLMTEA
FT                   PVIGTGIENKTAVDSGVCVVAEADGVVLSSESNKIVIREKDGKAREYKLTKFSRSNQSN
FT                   CYNQRPIVFKGDEVKAGDVIADGPSTSNGEIALGKNPLIGFMTWEGYNYEDAVLLSERL
FT                   VRDDVYTSIHIEEYETEARDTKLGPEEITRDLPSTGSDAVKDLDENGIIRVGAEVRAGD
FT                   ILVGKVTPKGETELTAEERLLRAIFGEKAREVRDTSLKVPHGAYGIVVAVKTFTRENGD
FT                   ELSPGVNKSVRIYIAQKRKIGVGDKMAGRHGNKGVVSRVLPVEDMPFLPNGRPLDIVLN
FT                   PLGVPSRMNIGQVLEIHLSLAAKVLGFNISTPVFDGADENDIMDTLDMANAYANHPFDD
FT                   EELAAQKAEAEKNGEEYPEDMVTFTAQYKDVLNKEVFDYLSEHRDHRAEWKGVPIGRDG
FT                   KVRLRDGRTGEYFDSPVTIGFMHYLKLHHLVDDKIHARSTGPYSLVTQQPLGGKAQFGG
FT                   QRFGEMEVWALEAYGAAYTLQEILTVKSDDVVGRVKTYEAIIKGENIPEPGVPESFKVL
FT                   LKELQSLALDVRVLDQDNNEVRLLESSEYEVTDFKKVLDEGNGYRRNSREEEAEYKAGG
FT                   MSTVTLNEDGTEDAVDSDDGADFDMADDFDDDYGDGNSDEY"
FT   gene            315219..318836
FT                   /locus_tag="EUBELI_00284"
FT   CDS_pept        315219..318836
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00284"
FT                   /product="DNA-directed RNA polymerase subunit beta"
FT                   /note="Psort-B: Cytoplasmic, score:9.98; COG0086
FT                   DNA-directed RNA polymerase, beta subunit/160 kD subunit;
FT                   HMMPfam:IPR000722; HMMPfam:IPR007066; HMMPfam:IPR007080;
FT                   HMMPfam:IPR007081; HMMPfam:IPR007083; Gene3D:IPR000722;
FT                   Gene3D:IPR007080; HMMSmart:IPR006592; HMMTigr:IPR012754;
FT                   ScanRegExp:IPR001865; K03046 DNA-directed RNA polymerase
FT                   subunit beta"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00284"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71320"
FT                   /db_xref="GOA:C4Z2R5"
FT                   /db_xref="InterPro:IPR000722"
FT                   /db_xref="InterPro:IPR006592"
FT                   /db_xref="InterPro:IPR007066"
FT                   /db_xref="InterPro:IPR007080"
FT                   /db_xref="InterPro:IPR007081"
FT                   /db_xref="InterPro:IPR007083"
FT                   /db_xref="InterPro:IPR012754"
FT                   /db_xref="InterPro:IPR038120"
FT                   /db_xref="InterPro:IPR042102"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z2R5"
FT                   /protein_id="ACR71320.1"
FT                   /translation="MAEEIKSNKSMKFDKIQIKLASPENILEWSHGEVTKPETINYRTL
FT                   KPEKDGLFCERIFGPSKDWECHCGKYKKIKDKGIVCDKCGVEVTKASVRRDRMGHIHLA
FT                   APVSHIWYFKGIPSRMDLILDIGPKNLEKVLYFASYIVIDPGETDIPFKKILSETEYRE
FT                   LCEQYGSKAFRVGMGAEAILELLQMVNLEEEEVRLKEELANTTSQKAARLIKRIEVVEA
FT                   FKNAGTKPEWMILTEIPVIPPDLRPMVQLDGGRFATSDLNDLYRRIINRNNRLARLLEL
FT                   GAPEIIVRNEKRMLQEAVDALIDNGRRNGRPVTGPGNRALKSLSDLLKGKQGRFRQNLL
FT                   GKRVDYSGRSVIVVGPELKIYQCGLPKEMAIELFKPFVMRELVRRNLADNIKKAKKSVE
FT                   HLEPEVWDVLEDVIKEHPVMLNRAPTLHRLGIQAFEPILVEGKAIKLHPLVCTAFNADF
FT                   DGDQMAVHLPLSVEAQAECRFMLLSPNNLLKPSDGGPVAVPSQDMVLGIYYLTQERPGA
FT                   KGEGKIFKSINEAVLAYENGIITLHAKIMVHVTKNVNGEELSGNIESTLGRLIFNEILP
FT                   QDLGYVDRSKEENLLLPEVDFHVGKKQLKDILQHVINTHGTTTTAEVLDDIKAMGYKYS
FT                   TRAAMTVSISEMTVPPVKKQLLAEAEKKVEQITVKYNRGQATDEERHKNVIRVWQETDD
FT                   KIKDALLQGLDKYNNIFMMADSGARGSNQQIKQLAGMRGLMADTSGNTIELPIKSNFRE
FT                   GLDVLEYFISAHGARKGLSDTALRTADSGYLTRRLVDVSQDLIIRETDCSAGKQIPGMY
FT                   VYSFVNNRATNSSDAKEDILEPLQERITGRYLAEDIVDPATGEIIVEANHLVTPKRAEA
FT                   IIKTGVDKVKIRTILTCRSHIGVCAKCYGTNMATGQTVQVGEAVGIIAAQSIGEPGTQL
FT                   TMRTFHTGGVAGDNITQGLPRVEELFEARKPKMLAVLAEFGGTVSIVKTEKKTEIVITD
FT                   DEGNSKAYPLSKDTREKVVEGQVVAKGEEITEGSENPHDIVRILGVRAVQDYLLREVQK
FT                   VYRIQGVDINDKHIELIVRQMLKKIVVDEAGDSKFLPGSQVDTIEFQEVNERLEEEGKT
FT                   PATGTPIILGITKASLASTSFMSAASFQETTKVLTDAAINGKIDPLIGLKENVIIGKLI
FT                   PAGTGMKRYQDIKISSTDNYIEEDEDESGEDELVFTQED"
FT   gene            319013..319474
FT                   /locus_tag="EUBELI_00285"
FT   CDS_pept        319013..319474
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00285"
FT                   /product="small subunit ribosomal protein S12"
FT                   /note="Psort-B: Cytoplasmic, score:8.87; COG0048 Ribosomal
FT                   protein S12; HMMPfam:IPR006032; FPrintScan:IPR005679;
FT                   Gene3D:IPR012340; HMMPanther:IPR005679;
FT                   HMMPanther:IPR006032; HMMTigr:IPR005679;
FT                   ScanRegExp:IPR006032; K02950 small subunit ribosomal
FT                   protein S12"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00285"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71321"
FT                   /db_xref="GOA:C4Z2R6"
FT                   /db_xref="InterPro:IPR005679"
FT                   /db_xref="InterPro:IPR006032"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z2R6"
FT                   /protein_id="ACR71321.1"
FT                   /translation="MQPFIILISGGENGMPTFNQLVKQGRKTAVKKSTAPALQKGYNSL
FT                   QKKATDISSPQKRGVCTAVKTATPKKPNSALRKIARVRLSNGIEVTSYIPGEGHNLQEH
FT                   SVVLIRGGRVKDLPGTRYHIIRGTLDTAGVAKRRQARSKYGAKRPKDAK"
FT   gene            319694..320164
FT                   /locus_tag="EUBELI_00286"
FT   CDS_pept        319694..320164
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00286"
FT                   /product="small subunit ribosomal protein S7"
FT                   /note="Psort-B: Cytoplasmic, score:8.87; COG0049 Ribosomal
FT                   protein S7; HMMPfam:IPR000235; BlastProDom:IPR000235;
FT                   Gene3D:IPR000235; HMMPanther:IPR000235; HMMTigr:IPR005717;
FT                   ScanRegExp:IPR000235; superfamily:IPR000235; K02992 small
FT                   subunit ribosomal protein S7"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00286"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71322"
FT                   /db_xref="GOA:C4Z2R7"
FT                   /db_xref="InterPro:IPR000235"
FT                   /db_xref="InterPro:IPR005717"
FT                   /db_xref="InterPro:IPR020606"
FT                   /db_xref="InterPro:IPR023798"
FT                   /db_xref="InterPro:IPR036823"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4Z2R7"
FT                   /protein_id="ACR71322.1"
FT                   /translation="MPRKGHTQKRDVLADPIYNNKVVTKLINNIMLDGKRGVAQKIVYG
FT                   AFDRVAAKTERPAIEVFEEAMNNIMPVLEVKARRIGGATYQVPIEVKPDRRQALALRWM
FT                   TTFSRARGEKTMEERLANEILDAANNTGASVKRKEDMHKMAEANKAFAHYRF"
FT   gene            320189..322351
FT                   /locus_tag="EUBELI_00287"
FT   CDS_pept        320189..322351
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00287"
FT                   /product="elongation factor EF-G"
FT                   /note="Psort-B: Cytoplasmic, score:9.98; COG0480
FT                   Translation elongation factors (GTPases);
FT                   HMMPfam:IPR000640; HMMPfam:IPR000795; HMMPfam:IPR004161;
FT                   HMMPfam:IPR005517; FPrintScan:IPR000795; Gene3D:IPR000640;
FT                   Gene3D:IPR014721; HMMTigr:IPR004540; HMMTigr:IPR005225;
FT                   ScanRegExp:IPR000795; superfamily:IPR009000;
FT                   superfamily:IPR009022; K02355 elongation factor EF-G"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00287"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71323"
FT                   /db_xref="GOA:C4Z2R8"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004540"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005517"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009022"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035649"
FT                   /db_xref="InterPro:IPR041095"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z2R8"
FT                   /protein_id="ACR71323.1"
FT                   /translation="MAGREYPLERTRNIGIMAHIDAGKTTLTERILYYTGVNHKIGDTH
FT                   EGTATMDWMAQEQERGITITSAATTCHWTPEKEGKPDKTQPEYRINIIDTPGHVDFTVE
FT                   VERSLRVLDGAVGVFDAQNGVEPQSENVWRQADKYNVPRMAFMNKMDKMGADFFGSCNQ
FT                   LITKLGKNPVLVQIPIGKEDDFKGIIDLFEMKAYVFNGDKGDDIAVGEIPDDLKDQAQE
FT                   YHDKLVEQCAELDEDLMEKFFNDEEISVPELKAALRKGTIEGTAIPCLCGTAYKNKGVQ
FT                   KLLDAVIEYMPAPTDIPDITGVDEDGNEVTRKSSDEEPFAALAFKIMTDPFVGKLAFFR
FT                   VYSGTLNGGSYVLNSNKNKKERVGRILQMHANQRKEIDKVYSGDIAAAVGLKVTVTGDT
FT                   ICDEAHPVILESMEFPEPVIELAIEPKTKNDQGKMGEALAKLAEEDPTFRAHTDQETGQ
FT                   TIIAGMGELHLDIIVDRLLREFKVEANVGAPQVAYRECFTKAVDVDSKYAKQSGGRGQY
FT                   GHCKVRFSPLEANVDKFDVETKNTVLINEPPVLFCESSVVGGAIPKEYIPSVADGIREA
FT                   ANSGILAGFPVLGLRADIYDGSYHEVDSSEMAFHIAGSMAFKDAMAKAAPALLEPIMKV
FT                   EVTMPEEYMGDVIGDINSRRGRIEGMEDISGGKMIKAFVPLAEMFGYATDLRSKTQGRG
FT                   NYSMFFDKYEQAPKSVQDKVISDRNK"
FT   gene            322473..323666
FT                   /locus_tag="EUBELI_00288"
FT   CDS_pept        322473..323666
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00288"
FT                   /product="Hypothetical protein"
FT                   /note="Psort-B: Cytoplasmic, score:9.98; COG0050 GTPases -
FT                   translation elongation factors; HMMPfam:IPR000795;
FT                   HMMPfam:IPR004160; HMMPfam:IPR004161; FPrintScan:IPR000795;
FT                   HMMPanther:IPR004541; HMMTigr:IPR004541; HMMTigr:IPR005225;
FT                   ScanRegExp:IPR000795; superfamily:IPR009000;
FT                   superfamily:IPR009001"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00288"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71324"
FT                   /db_xref="GOA:C4Z2R9"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004160"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004541"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR033720"
FT                   /db_xref="InterPro:IPR041709"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4Z2R9"
FT                   /protein_id="ACR71324.1"
FT                   /translation="MAKAKFERTKPHCNIGTIGHVDHGKTTLTAAITKTLHERLGTGEA
FT                   VAFENIDKAPEERERGITISTAHVEYETEKRHYAHVDCPGHADYVKNMITGAAQMDAGI
FT                   LVVAATDGVMAQTREHILLARQVGVPYIVVFMNKCDMVDDPELLELVDMEIRELLNEYG
FT                   FPGDDTPIIQGSALKALEDPNSEWGDKILELMHTIDEYVPDPERDTDKPFLMPVEDVFS
FT                   ITGRGTVATGRVERGVLHVNEEVEIVGIHEDIRKVVVTGIEMFRKLLDEAQPGDNIGAL
FT                   LRGVQRDEIQRGQVLCKPGSITPHHKFTAQVYVLTKDEGGRHTPFFNNYRPQFYFRTTD
FT                   VTGVCELPAGTEMCMPGDNVEMTVELIHNVAMEQGLRFAIREGGRTVGSGAVATIIE"
FT   gene            323772..324320
FT                   /locus_tag="EUBELI_00289"
FT   CDS_pept        323772..324320
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00289"
FT                   /product="phosphoglycerate mutase"
FT                   /note="Psort-B: Cytoplasmic, score:8.87; COG0406
FT                   Fructose-2,6-bisphosphatase; HMMPfam:IPR013078; K01834
FT                   phosphoglycerate mutase"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00289"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71325"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z2S0"
FT                   /protein_id="ACR71325.1"
FT                   /translation="MLYIMRHGRTDWNVRHKLQGRTDIPLNDEGRMMAAEAGKKYADIH
FT                   FDECYSSPLARAKETAEIFLKGRGVPVYTDDRLVEMGFGIYEGIENSFAIKDCPINSLF
FT                   KNPEDYVTVEGGESFEQLFARTGEFIDNVVMPQVNSGKDILIVGHGAMNCSIIAKFRGT
FT                   PLDKFWDGMTDNCQVVKLM"
FT   gene            324481..325305
FT                   /locus_tag="EUBELI_00290"
FT   CDS_pept        324481..325305
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00290"
FT                   /product="Hypothetical protein"
FT                   /note="Psort-B: Cytoplasmic, score:8.87; COG4990
FT                   Uncharacterized protein conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00290"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71326"
FT                   /db_xref="GOA:C4Z2S1"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="InterPro:IPR039564"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z2S1"
FT                   /protein_id="ACR71326.1"
FT                   /translation="MTKILIAATFVMIILAVVVLFMNYENGYYDEIKSVINLKSSNDEI
FT                   NHNEDTALVDVELVQMEEAGEIAELGTENVQMQTETIENYYKIEDFKWLNQNPELPTGC
FT                   EITSLTSVLNYYGINVKKETMADDYLKKGNGSYYKMFLGNPRDAGSFGCMAQPIVDAAN
FT                   LYFKKNNVSMKASNVSGVSFEKILEYVSQGVPMIVWNTMGMAPAYESKTLTLDGREYTW
FT                   IAPEHCVVVVGYDLDNNEVYVADPMTGMVTRNLKIFEERYVSLKRQAVYVTR"
FT   gene            complement(325365..326705)
FT                   /locus_tag="EUBELI_00291"
FT   CDS_pept        complement(325365..326705)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00291"
FT                   /product="multidrug resistance protein, MATE family"
FT                   /note="Psort-B: CytoplasmicMembrane, score:9.99; COG0534
FT                   Na+-driven multidrug efflux pump; HMMPfam:IPR002528;
FT                   HMMPanther:IPR002528; HMMPanther:IPR015522;
FT                   HMMTigr:IPR002528; K03327 multidrug resistance protein,
FT                   MATE family"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00291"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71327"
FT                   /db_xref="GOA:C4Z2S2"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z2S2"
FT                   /protein_id="ACR71327.1"
FT                   /translation="MVKDMTNGSPSKHILGFAVPMLFGMLFQQFYNLVDTIIVGKTLGV
FT                   EALAGVGATGSINFMIIGFCMGVCNGFVIPVAQCFGAKKPADLRKYVFNGYICSIVFAI
FT                   VLTLASVIFCRRILIIMNTPADIIDHAYNYIVVIFIGIPTVFLYNMVSGVIRSLGDSKT
FT                   PVVFLVLSSIINVVLDFFLILVCKMGVAGAGWATVTSQLISGLTCLIYMYKKYDILKGD
FT                   KSERVLDRRFITNLCMNGVPMGLQYSITAIGSTILQAAVNTLGSTYVAAMTAGSKMFNF
FT                   TCCPFDALGSTMATYAGQNVGAAKIKRLGQGVRSAMIIGSVYSVLSLIALYFTTDYIAL
FT                   LFVNASETTIIALTRQFILASACFYIPLTGVNVVRFCIQGMGFSVFAISAGILEMIGRA
FT                   FAAIILIPSIGFMGACLASPIAWIAADAFLFPAFIHCARKLHARHSK"
FT   gene            326820..327380
FT                   /locus_tag="EUBELI_00292"
FT   CDS_pept        326820..327380
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00292"
FT                   /product="trans-hexaprenyltranstransferase"
FT                   /note="Psort-B: CytoplasmicMembrane, score:9.99; COG4769
FT                   Predicted membrane protein; HMMPfam:IPR010898;
FT                   HMMPIR:IPR014535; K00805 trans-hexaprenyltranstransferase"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00292"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71328"
FT                   /db_xref="GOA:C4Z2S3"
FT                   /db_xref="InterPro:IPR010898"
FT                   /db_xref="InterPro:IPR014535"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z2S3"
FT                   /protein_id="ACR71328.1"
FT                   /translation="MKCLLKCIGNIYAEADMKKTFDVKRLTTLALLTTIALTIFVVESA
FT                   IPTLVPIPGVKLGLANIVTLFVLKRYKFSDAAIVLAMRIILATIFTGQAVSFIYSVSGG
FT                   FLCLIVMAAVNKLLRGQYIFLTGILGAVSHNAGQILAAFFILRLSGIFAYMPFLVISGV
FT                   ITGLFTGLVCFFADRYIPKKYTM"
FT   gene            327384..327788
FT                   /locus_tag="EUBELI_00293"
FT   CDS_pept        327384..327788
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00293"
FT                   /product="Hypothetical protein"
FT                   /note="Psort-B: Unknown cell location; COG5341
FT                   Uncharacterized protein conserved in bacteria;
FT                   HMMPfam:IPR010739"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00293"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71329"
FT                   /db_xref="GOA:C4Z2S4"
FT                   /db_xref="InterPro:IPR024045"
FT                   /db_xref="InterPro:IPR038690"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z2S4"
FT                   /protein_id="ACR71329.1"
FT                   /translation="MEEIVEKRVVAVVAVIVLLVGASVASIIYMKSGKNDGSKTAYIYR
FT                   DNELLRTVSLDDVKNPYTFRIEYGDGEYNDILVENGKIKIADASCPDKLCVNMGYISEP
FT                   LMPIICLPNHLVIRIVNDGEESPSLDGVVY"
FT   gene            complement(327789..328679)
FT                   /locus_tag="EUBELI_00294"
FT   CDS_pept        complement(327789..328679)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00294"
FT                   /product="putative SAM-dependent methyltransferase"
FT                   /note="Psort-B: Cytoplasmic, score:8.87; COG1092 Predicted
FT                   SAM-dependent methyltransferases; K06969 putative
FT                   SAM-dependent methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00294"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71330"
FT                   /db_xref="GOA:C4Z2S5"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR019614"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z2S5"
FT                   /protein_id="ACR71330.1"
FT                   /translation="MFIADNWKDYEVIDTSKGEKLERWGKYILVRPDPQVIWDTPKKER
FT                   GWKNMNGHYHRSSKGGGEWEFFDLPQQWQIHYNSPSFEQELTFNLKPFSFKHTGIFPEQ
FT                   AANWDWFGKIISDARKKRGSEPVKVLNLFAYTGGATLACAAAGANVTHVDASKGIVAWA
FT                   KENAQSSGLIDKPIRWIVDDCVKFVEREIRRGNHYDAIIMDPPSYGRGPKGEIWKIEEA
FT                   IHPLVKLCAQLLSDEPLFFLINSYTTGLQPAVLTYMLSTELKSFGGHCDSQEVGLPVSS
FT                   NGLVLPCGASGRWMK"
FT   gene            328804..331038
FT                   /locus_tag="EUBELI_00295"
FT   CDS_pept        328804..331038
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00295"
FT                   /product="cadherin EGF LAG seven-pass G-type receptor 3
FT                   (flamingo)"
FT                   /note="Psort-B: CytoplasmicMembrane, score:9.97; COG0659
FT                   Sulfate permease and related transporters (MFS
FT                   superfamily); HMMPfam:IPR002645; HMMPfam:IPR011547;
FT                   Gene3D:IPR002645; superfamily:IPR002645; K04602 cadherin
FT                   EGF LAG seven-pass G-type receptor 3 (flamingo)"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00295"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71331"
FT                   /db_xref="GOA:C4Z2S6"
FT                   /db_xref="InterPro:IPR001902"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR011547"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z2S6"
FT                   /protein_id="ACR71331.1"
FT                   /translation="MLIYFYRNLIKGRCILKNVSLKNIQKDIVSGIIVALVSIPISMGY
FT                   AQIAGLPAVYGLYCSILPVLIYGLVTSSPQFVLGVDATPAALVGGTLATLGIVSGSEEA
FT                   KAVVPSITLVAALWLLLFFFIKAGRIVNYISTPVMGGFISGIGVTIILMQTAKLFGGNA
FT                   GTGEAIKLLIHIAGEMKSFNLLSAVLGVGTVVIILVAKKFIPKFPMSVLLMVVGALATA
FT                   IFHIDRFGVKLLPHVDKGLPGFSLPDMSVVFKNPSDIILLGLSVAGVVMAQTLLATNNY
FT                   ANKYGYKVSNNREILSYAAANAASAVIGGCPLNGSVSRTGIADQFGCKSQVMSITASLT
FT                   MLLIVLFGTPVLEYLPVPILTGIVVAALIGITEFGLAVKLWKTDHTEFAIFVGAFLGVL
FT                   LFGTIHGVVIGVILSFIAVIVKAVEPPRAFLGVIPGQEGFYSLNRYRNVKKIKGAVIYR
FT                   FNGALFFANINTFVDDIEKNLDDNTKWVIVDAGGVGSIDVTAVDRLMSLYKALEKKGIR
FT                   FYITEHEHTLNDQLRELGAGEFVEKGVVRRTIPLALRDAGLDRPYPVEEGEEEQAVSGE
FT                   AHEDNERLAEIEWAFGADADEWLEKMAAEMADEIGSVKKDEKNVIVDAEKHAAWGRIGL
FT                   FDENELLERLEMHLFDDKKYPNLDIDDIEKRIDERRVVVEKKLAQINPDAIQMLKEHRK
FT                   QMLDRVKLHNPYAYEHTMEQRRKHYEHLQKKDPELAQKLKNFYNLSDDDK"
FT   gene            331059..332879
FT                   /locus_tag="EUBELI_00296"
FT   CDS_pept        331059..332879
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00296"
FT                   /product="sulfate-transporting ATPase"
FT                   /note="Psort-B: CytoplasmicMembrane, score:9.49; COG0488
FT                   ATPase components of ABC transporters with duplicated
FT                   ATPase domains; HMMPfam:IPR003439; BlastProDom:IPR003439;
FT                   HMMSmart:IPR003593; ScanRegExp:IPR003439; K06020
FT                   sulfate-transporting ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00296"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71332"
FT                   /db_xref="GOA:C4Z2S7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032524"
FT                   /db_xref="InterPro:IPR032781"
FT                   /db_xref="InterPro:IPR037118"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z2S7"
FT                   /protein_id="ACR71332.1"
FT                   /translation="MNILNVEKVSKTYGEKELFNNISLGINSGDKIGLIGVNGTGKSTL
FT                   LKIIAGIEEPDEGQVVKGKGIELAYLAQTPLYYDNENVLEYVMRGKHVDSQPKAKEILN
FT                   KLGITNHAAMMNILSGGQKKRAALARTLVEPARLLILDEPTNHLDNDMVLWLEQFIKNF
FT                   KGELIMVTHDRYFLDNVTNRIVELDKASLYSYDTNYSGFLELKTQREEMERATEAKRQN
FT                   ILRKELAWIRRGCQARSTKQQARIDRFEDMKEASKQARARFDKQLMDMNSVSSRLGRKT
FT                   VELHNICKSFGERTIIDDFTYIFLRDDRIGIVGDNGCGKSTLMKIIAGQLEPDSGSVEV
FT                   GETVRIGYFMQENEPLDDSLTVLEFVRSIGEYVTTADGKATASQMCEKFLFTPKQQWTP
FT                   ISKLSGGEKRRLYLLSVLMSAPNVLILDEPTNDLDIETLEILEEYLDGFAGIVITVSHD
FT                   RYFLDRVVDRIFAFEAGGHLTQYEGGYTDYRDKCVSSIYNMASNGISDTSKSKAAGQLK
FT                   KAYNSHEDKIKFTYMEQKEYETIDDDIEKLETKVSELDDEIVKNATSYSKLAELTKEKE
FT                   DVERKLEEKMERWEYLNDLAEKIEKQKQQG"
FT   gene            332965..334287
FT                   /locus_tag="EUBELI_00297"
FT   CDS_pept        332965..334287
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00297"
FT                   /product="Hypothetical protein"
FT                   /note="Psort-B: Unknown cell location; COG4640 Predicted
FT                   membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00297"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71333"
FT                   /db_xref="GOA:C4Z2S8"
FT                   /db_xref="InterPro:IPR026870"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z2S8"
FT                   /protein_id="ACR71333.1"
FT                   /translation="MFCPNCGTSNDEGALFCANCGTRLEFEPVVTEGSAASDDNAVPQQ
FT                   PEVQTAQVTPMYEQPQNDTMGNSAKKPFKLSKKIVIIGAVVVAVIAAVIVFICVGNSLT
FT                   NYKKTAGSYVKAVEECDWAKAYSLVQIPDSEFLTKNAFITAHSEATGSAVGNMRVIDSF
FT                   SSKGRLPGNKAVSVIYTTATGADSQDLLLTVTDKHYMLFFKKYKVSTEDTVVSDCTINV
FT                   PKGLTLFINDVLVGDQYKSKDSGKNSSYDVYKIPYLFNGTTILKATSEFTEDYTKEIYP
FT                   SYDEYTTSISSYDIKFAEDKINGLKDQAKKDVTEFFDAAQKKSDFSTVSDKFTSDMQSS
FT                   AKSTYNGYVDTFKSTYKQISNFKITTLNPSMSDTTFRVDSNDGCPTIKVGYKISYSYTY
FT                   KYSSDTKSHERNDSKSSAYVYYKYADGQWKISSMGLGVSIY"
FT   gene            334649..334963
FT                   /locus_tag="EUBELI_00298"
FT   CDS_pept        334649..334963
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00298"
FT                   /product="small subunit ribosomal protein S10"
FT                   /note="Psort-B: Cytoplasmic, score:8.87; COG0051 Ribosomal
FT                   protein S10; HMMPfam:IPR001848; BlastProDom:IPR001848;
FT                   FPrintScan:IPR001848; Gene3D:IPR001848;
FT                   HMMPanther:IPR001848; HMMPanther:IPR005731;
FT                   HMMTigr:IPR005731; ScanRegExp:IPR001848;
FT                   superfamily:IPR001848; K02946 small subunit ribosomal
FT                   protein S10"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00298"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71334"
FT                   /db_xref="GOA:C4Z2S9"
FT                   /db_xref="InterPro:IPR001848"
FT                   /db_xref="InterPro:IPR018268"
FT                   /db_xref="InterPro:IPR027486"
FT                   /db_xref="InterPro:IPR036838"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4Z2S9"
FT                   /protein_id="ACR71334.1"
FT                   /translation="MANQVIRITLKAYDHQLIDQSAKKIIETAKKTGAQVSGPVPLPTK
FT                   KEVVTILRAVHKYKDSREQFEQRTHKRLIDVLSPSQKTVDALSKLEMPAGVFINLKVMN
FT                   "
FT   gene            335130..335765
FT                   /locus_tag="EUBELI_00299"
FT   CDS_pept        335130..335765
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00299"
FT                   /product="large subunit ribosomal protein L3"
FT                   /note="Psort-B: Cytoplasmic, score:8.87; COG0087 Ribosomal
FT                   protein L3; HMMPfam:IPR000597; BlastProDom:IPR000597;
FT                   ScanRegExp:IPR000597; superfamily:IPR009000; K02906 large
FT                   subunit ribosomal protein L3"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00299"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71335"
FT                   /db_xref="GOA:C4Z2T0"
FT                   /db_xref="InterPro:IPR000597"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR019926"
FT                   /db_xref="InterPro:IPR019927"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4Z2T0"
FT                   /protein_id="ACR71335.1"
FT                   /translation="MKKAILATKVGMTQIFNEDGVLTPVTVLQAGPCVVTQVKTVENDG
FT                   YDAVQVGFADIREKLVNKPVKGHFDKAEVPYKRFLREFKFENASEYSVKDEIKADIFAA
FT                   GDKVDATAISKGKGFQGAIKRLGQSRGPMAHGSKFHRHQGSNGSATTPGRVFKGKGMPG
FT                   HMGSKRITIQNLEVVRVDVENNVILVKGAVPGPKKSLVTLKETVKAAK"
FT   gene            335794..336414
FT                   /locus_tag="EUBELI_00300"
FT   CDS_pept        335794..336414
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00300"
FT                   /product="large subunit ribosomal protein L4"
FT                   /note="Psort-B: Unknown cell location; COG0088 Ribosomal
FT                   protein L4; HMMPfam:IPR002136; HMMPanther:IPR013005;
FT                   HMMPanther:IPR015498; superfamily:IPR002136; K02926 large
FT                   subunit ribosomal protein L4"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00300"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71336"
FT                   /db_xref="GOA:C4Z2T1"
FT                   /db_xref="InterPro:IPR002136"
FT                   /db_xref="InterPro:IPR013005"
FT                   /db_xref="InterPro:IPR023574"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4Z2T1"
FT                   /protein_id="ACR71336.1"
FT                   /translation="MANVSVYNIEGKEVGSIELNDAVFGVEVNEHLVHMAVVNQLANNR
FT                   QGTQSAKTRSEVSGGGRKPWRQKGTGHARQGSTRSPQWTGGGVVFAPKPRDYSFKMNKK
FT                   EKRIALLSALSSKVADNKIVVLDAFNLDEIKTKKFAEVMSNLKVDKALVVIEGENKNVV
FT                   LSGRNIPTVKVSATNEINTYDVLKYETLVVTKAAVEKLEEVYA"
FT   gene            336414..336713
FT                   /locus_tag="EUBELI_00301"
FT   CDS_pept        336414..336713
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00301"
FT                   /product="large subunit ribosomal protein L23"
FT                   /note="Psort-B: Unknown cell location; COG0089 Ribosomal
FT                   protein L23; HMMPfam:IPR013025; BlastProDom:IPR013025;
FT                   Gene3D:IPR012677; superfamily:IPR012678; K02892 large
FT                   subunit ribosomal protein L23"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00301"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71337"
FT                   /db_xref="GOA:C4Z2T2"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR012678"
FT                   /db_xref="InterPro:IPR013025"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4Z2T2"
FT                   /protein_id="ACR71337.1"
FT                   /translation="MANVQYYDVILKPVITEKSMADMADKKYTFLVHTDANKTMIKDAV
FT                   EKMFEGTKVASVNTMNLDGKKKRRGRTAGTTSKTKKAIVQLTADSKEIEIFEGL"
FT   gene            336815..337612
FT                   /locus_tag="EUBELI_00302"
FT   CDS_pept        336815..337612
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00302"
FT                   /product="large subunit ribosomal protein L2"
FT                   /note="Psort-B: Unknown cell location; COG0090 Ribosomal
FT                   protein L2; HMMPfam:IPR002171; Gene3D:IPR012340;
FT                   Gene3D:IPR014722; HMMPanther:IPR002171;
FT                   HMMPanther:IPR005880; HMMTigr:IPR005880;
FT                   ScanRegExp:IPR002171; superfamily:IPR008991; K02886 large
FT                   subunit ribosomal protein L2"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00302"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71338"
FT                   /db_xref="GOA:C4Z2T3"
FT                   /db_xref="InterPro:IPR002171"
FT                   /db_xref="InterPro:IPR005880"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR014726"
FT                   /db_xref="InterPro:IPR022666"
FT                   /db_xref="InterPro:IPR022669"
FT                   /db_xref="InterPro:IPR022671"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z2T3"
FT                   /protein_id="ACR71338.1"
FT                   /translation="MTGSDFSEITKSTPEKSLLAKKSKNAGRNNQGKITVRHHGGGNRQ
FT                   KYRMIDFKRNKEGVPAQVIGIEYDPNRTANIALICYADGEKAYILAPQGLTDGMTVQNG
FT                   AGAEVRVGNCLPLSEIPVGTQVHNIELYPGKGGQLVRSAGNSAQLMAKEGKYATLRLPS
FT                   GEMRMVPIICRATIGVVGNGDHNLINLGKAGRKRHMGIRPTVRGSVMNPNDHPHGGGEG
FT                   RAPVGRPSPMTPWGKPAMGLKTRKAKKASNKLIVRRRNGKAIK"
FT   gene            337669..337944
FT                   /locus_tag="EUBELI_00303"
FT   CDS_pept        337669..337944
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00303"
FT                   /product="small subunit ribosomal protein S19"
FT                   /note="Psort-B: Unknown cell location; COG0185 Ribosomal
FT                   protein S19; HMMPfam:IPR002222; BlastProDom:IPR002222;
FT                   FPrintScan:IPR002222; Gene3D:IPR002222;
FT                   HMMPanther:IPR002222; HMMTigr:IPR005732;
FT                   ScanRegExp:IPR002222; superfamily:IPR002222; K02965 small
FT                   subunit ribosomal protein S19"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00303"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71339"
FT                   /db_xref="GOA:C4Z2T4"
FT                   /db_xref="InterPro:IPR002222"
FT                   /db_xref="InterPro:IPR005732"
FT                   /db_xref="InterPro:IPR020934"
FT                   /db_xref="InterPro:IPR023575"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4Z2T4"
FT                   /protein_id="ACR71339.1"
FT                   /translation="MARSLKKGAFADESLLKKVDALNAANDKQVIKTWSRRSTIYPQFV
FT                   GHTIAVHDGRKHVPVYVTEDMVGHKLGEFVATRTYRGHGKDEKKSR"
FT   gene            337973..338359
FT                   /locus_tag="EUBELI_00304"
FT   CDS_pept        337973..338359
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00304"
FT                   /product="large subunit ribosomal protein L22"
FT                   /note="Psort-B: Unknown cell location; COG0091 Ribosomal
FT                   protein L22; HMMPfam:IPR001063; BlastProDom:IPR001063;
FT                   Gene3D:IPR001063; HMMPanther:IPR005727; HMMTigr:IPR005727;
FT                   ScanRegExp:IPR001063; superfamily:IPR001063; K02890 large
FT                   subunit ribosomal protein L22"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00304"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71340"
FT                   /db_xref="GOA:C4Z2T5"
FT                   /db_xref="InterPro:IPR001063"
FT                   /db_xref="InterPro:IPR005727"
FT                   /db_xref="InterPro:IPR018260"
FT                   /db_xref="InterPro:IPR036394"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4Z2T5"
FT                   /protein_id="ACR71340.1"
FT                   /translation="MANGHRSQIKRERNAVKDTRPSAKLSYARVSVQKACFVLDAIRGK
FT                   SLDEALAIVMYNPRYASSIIEKLLKSAAANAENNNGMDPSKLYVEECYANKGPTMKRVH
FT                   PRAQGRAYRIEKRMSHITVVLNER"
FT   gene            338390..339067
FT                   /locus_tag="EUBELI_00305"
FT   CDS_pept        338390..339067
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00305"
FT                   /product="small subunit ribosomal protein S3"
FT                   /note="Psort-B: Cytoplasmic, score:8.87; COG0092 Ribosomal
FT                   protein S3; HMMPfam:IPR001351; HMMPfam:IPR004044;
FT                   HMMPfam:IPR008282; Gene3D:IPR001351; Gene3D:IPR015946;
FT                   HMMSmart:IPR004087; HMMTigr:IPR005704;
FT                   ScanRegExp:IPR001351; superfamily:IPR001351;
FT                   superfamily:IPR009019; K02982 small subunit ribosomal
FT                   protein S3"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00305"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71341"
FT                   /db_xref="GOA:C4Z2T6"
FT                   /db_xref="InterPro:IPR001351"
FT                   /db_xref="InterPro:IPR004044"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR005704"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR018280"
FT                   /db_xref="InterPro:IPR036419"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z2T6"
FT                   /protein_id="ACR71341.1"
FT                   /translation="MGQKVNPHGLRVGVIKDWDAKWYAEDDFADNLVEDYNIRKFLKNK
FT                   LYAAGISKIETERASDRLKIVIHTAKPGIVIGKGGAEIENLKKQVEKLTSAKKLSIDIK
FT                   EVKRPDKDAQLVAENIAQQLENRISFRRAMKSCMGRTMKQGAKGIKTSCSGRLGGADMA
FT                   RTEFYSEGTIPLQTLRADIDYGFAEADTTYGKVGVKVWIYEGEVLPTKNNANANVEKEG
FT                   SDK"
FT   gene            339067..339504
FT                   /locus_tag="EUBELI_00306"
FT   CDS_pept        339067..339504
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00306"
FT                   /product="large subunit ribosomal protein L16"
FT                   /note="Psort-B: Cytoplasmic, score:8.87; COG0197 Ribosomal
FT                   protein L16/L10E; HMMPfam:IPR000114; HMMPanther:IPR000114;
FT                   HMMTigr:IPR000114; ScanRegExp:IPR000114; K02878 large
FT                   subunit ribosomal protein L16"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00306"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71342"
FT                   /db_xref="GOA:C4Z2T7"
FT                   /db_xref="InterPro:IPR000114"
FT                   /db_xref="InterPro:IPR016180"
FT                   /db_xref="InterPro:IPR020798"
FT                   /db_xref="InterPro:IPR036920"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4Z2T7"
FT                   /protein_id="ACR71342.1"
FT                   /translation="MLLPKRVKHRRQFRGSMAGKATRGNKITNGEFGIVATEPCWIKSN
FT                   QIEAARVAMTRYIKRGGKVFIKIFPDKPVTGKPIGVRMGKGKGNLECWVAVVKPGRVMF
FT                   EISGVAEETAREALRLATHKLPCKCKIVSRADLEGGDNSEN"
FT   gene            339494..339694
FT                   /locus_tag="EUBELI_00307"
FT   CDS_pept        339494..339694
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00307"
FT                   /product="Hypothetical protein"
FT                   /note="Psort-B: Unknown cell location; COG0255 Ribosomal
FT                   protein L29; HMMPfam:IPR001854; Gene3D:IPR001854;
FT                   HMMTigr:IPR001854; ScanRegExp:IPR001854;
FT                   superfamily:IPR001854"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00307"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71343"
FT                   /db_xref="GOA:C4Z2T8"
FT                   /db_xref="InterPro:IPR001854"
FT                   /db_xref="InterPro:IPR018254"
FT                   /db_xref="InterPro:IPR036049"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4Z2T8"
FT                   /protein_id="ACR71343.1"
FT                   /translation="MKINKYVEDLKAKSAAELNEELVAAKKELFNLRFQNATNQLDNTS
FT                   RIKEVRKNIARIQTVIAQKNA"
FT   gene            339738..339995
FT                   /locus_tag="EUBELI_00308"
FT   CDS_pept        339738..339995
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00308"
FT                   /product="small subunit ribosomal protein S17"
FT                   /note="Psort-B: Cytoplasmic, score:8.87; COG0186 Ribosomal
FT                   protein S17; HMMPfam:IPR000266; BlastProDom:IPR000266;
FT                   Gene3D:IPR012340; HMMPanther:IPR000266;
FT                   ScanRegExp:IPR000266; K02961 small subunit ribosomal
FT                   protein S17"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00308"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71344"
FT                   /db_xref="GOA:C4Z2T9"
FT                   /db_xref="InterPro:IPR000266"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019979"
FT                   /db_xref="InterPro:IPR019984"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4Z2T9"
FT                   /protein_id="ACR71344.1"
FT                   /translation="MEERNLRKTRTGKVISNKMDKTIVVAVQDNVKHPLYNKIVKRTYK
FT                   LKAHDENNECLIGDVVKVMETRPLSKDKRWRLVEIISRAK"
FT   gene            340035..340403
FT                   /locus_tag="EUBELI_00309"
FT   CDS_pept        340035..340403
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00309"
FT                   /product="large subunit ribosomal protein L14"
FT                   /note="Psort-B: Unknown cell location; COG0093 Ribosomal
FT                   protein L14; HMMPfam:IPR000218; BlastProDom:IPR000218;
FT                   Gene3D:IPR000218; HMMPanther:IPR000218;
FT                   HMMPanther:IPR005745; HMMTigr:IPR005745;
FT                   ScanRegExp:IPR000218; superfamily:IPR000218; K02874 large
FT                   subunit ribosomal protein L14"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00309"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71345"
FT                   /db_xref="GOA:C4Z2U0"
FT                   /db_xref="InterPro:IPR000218"
FT                   /db_xref="InterPro:IPR005745"
FT                   /db_xref="InterPro:IPR019972"
FT                   /db_xref="InterPro:IPR036853"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4Z2U0"
FT                   /protein_id="ACR71345.1"
FT                   /translation="MVQQETRLKVADNTGAKEILCIRVMGGSTRRYANIGDVIVATVKE
FT                   ATPGGVVKKGDVVKAVVVRSVKGARRKDGSYIKFDENAAVIIKDDQTPKGTRIFGPVAR
FT                   ELRDKKFMKIVSLAPEVL"
FT   gene            340415..340726
FT                   /locus_tag="EUBELI_00310"
FT   CDS_pept        340415..340726
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00310"
FT                   /product="large subunit ribosomal protein L24"
FT                   /note="Psort-B: Unknown cell location; COG0198 Ribosomal
FT                   protein L24; HMMPfam:IPR005824; BlastProDom:IPR003256;
FT                   Gene3D:IPR014723; HMMPanther:IPR003256; HMMSmart:IPR005824;
FT                   HMMTigr:IPR003256; ScanRegExp:IPR005825;
FT                   superfamily:IPR008991; K02895 large subunit ribosomal
FT                   protein L24"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00310"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71346"
FT                   /db_xref="GOA:C4Z2U1"
FT                   /db_xref="InterPro:IPR003256"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR005825"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR041988"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4Z2U1"
FT                   /protein_id="ACR71346.1"
FT                   /translation="MSAVRIKKGDTVKVIAGKDKGKEGKVLSVNAKNHTALVEGVNMVT
FT                   KHAKPSAANQQGGILHQEAPIDISNIAYSLKGKETKIGYDFKDGKKVRVAKATGEVID"
FT   gene            340793..341287
FT                   /locus_tag="EUBELI_00311"
FT   CDS_pept        340793..341287
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00311"
FT                   /product="large subunit ribosomal protein L5"
FT                   /note="Psort-B: Cytoplasmic, score:8.87; COG0094 Ribosomal
FT                   protein L5; HMMPfam:IPR002132; BlastProDom:IPR002132;
FT                   Gene3D:IPR002132; HMMPanther:IPR002132;
FT                   ScanRegExp:IPR002132; superfamily:IPR002132; K02931 large
FT                   subunit ribosomal protein L5"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00311"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71347"
FT                   /db_xref="GOA:C4Z2U2"
FT                   /db_xref="InterPro:IPR002132"
FT                   /db_xref="InterPro:IPR020929"
FT                   /db_xref="InterPro:IPR020930"
FT                   /db_xref="InterPro:IPR022803"
FT                   /db_xref="InterPro:IPR031309"
FT                   /db_xref="InterPro:IPR031310"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z2U2"
FT                   /protein_id="ACR71347.1"
FT                   /translation="MTEKFGYKNPMMVPKIDKIVINMGVGEAKENSKLLDIAVKEMETI
FT                   AGQKAVLTRAKNSIANFKLREGQAIGCKVTLRGEKMYEFLDRLVNLALPRVRDFRGVSA
FT                   DSFDGRGNYALGIKEQIIFPEIEYDKIDKVRGMDVIITTTAKTDEEARELLRLFNMPFK
FT                   K"
FT   gene            341305..341490
FT                   /locus_tag="EUBELI_00312"
FT   CDS_pept        341305..341490
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00312"
FT                   /product="small subunit ribosomal protein S14"
FT                   /note="Psort-B: Unknown cell location; COG0199 Ribosomal
FT                   protein S14; HMMPfam:IPR001209; HMMPanther:IPR001209;
FT                   K02954 small subunit ribosomal protein S14"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00312"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71348"
FT                   /db_xref="GOA:C4Z2U3"
FT                   /db_xref="InterPro:IPR001209"
FT                   /db_xref="InterPro:IPR023053"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4Z2U3"
FT                   /protein_id="ACR71348.1"
FT                   /translation="MAKTSMKVKQQRAPKFSTRAYTRCTICGRPHSVLRKYGICRICFR
FT                   ELAYKGQIPGVKKASW"
FT   gene            341549..341944
FT                   /locus_tag="EUBELI_00313"
FT   CDS_pept        341549..341944
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00313"
FT                   /product="small subunit ribosomal protein S8"
FT                   /note="Psort-B: Unknown cell location; COG0096 Ribosomal
FT                   protein S8; HMMPfam:IPR000630; BlastProDom:IPR000630;
FT                   HMMPanther:IPR000630; ScanRegExp:IPR000630;
FT                   superfamily:IPR000630; K02994 small subunit ribosomal
FT                   protein S8"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00313"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71349"
FT                   /db_xref="GOA:C4Z2U4"
FT                   /db_xref="InterPro:IPR000630"
FT                   /db_xref="InterPro:IPR035987"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z2U4"
FT                   /protein_id="ACR71349.1"
FT                   /translation="MTDPIADMLTRIRNANTAKHDTVDVPSSKMKLAIAKILLDEGYIK
FT                   SYELVENGKFNDIRITLKYGASKNEKIISGLQRISKPGLRVYANKEELPKVLGGLGVAI
FT                   ISTNKGVITDKEARKLGVGGEVLCFVW"
FT   gene            342059..342583
FT                   /locus_tag="EUBELI_00314"
FT   CDS_pept        342059..342583
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00314"
FT                   /product="large subunit ribosomal protein L6"
FT                   /note="Psort-B: Cytoplasmic, score:8.87; COG0097 Ribosomal
FT                   protein L6P/L9E; HMMPfam:IPR000702; BlastProDom:IPR000702;
FT                   Gene3D:IPR000702; HMMPanther:IPR000702;
FT                   ScanRegExp:IPR002358; K02933 large subunit ribosomal
FT                   protein L6"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00314"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71350"
FT                   /db_xref="GOA:C4Z2U5"
FT                   /db_xref="InterPro:IPR000702"
FT                   /db_xref="InterPro:IPR002358"
FT                   /db_xref="InterPro:IPR019906"
FT                   /db_xref="InterPro:IPR020040"
FT                   /db_xref="InterPro:IPR036789"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z2U5"
FT                   /protein_id="ACR71350.1"
FT                   /translation="MPIAIPAGVTVEIAENNKVTVKGPKGTLERVLPAEMDIKQEGSEI
FT                   VVSRPNDLKKMKSLHGLTRTLIHNMIIGVTEGYEKKLEVNGVGYRAQKQGKKLVLSLGY
FT                   SHPVEMEDPEGIETVLDGTNIIIVKGISKEAVGQYAAEIRAKRAPEPYKGKGIKYADEV
FT                   IRRKVGKTGKK"
FT   gene            342601..342969
FT                   /locus_tag="EUBELI_00315"
FT   CDS_pept        342601..342969
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00315"
FT                   /product="large subunit ribosomal protein L18"
FT                   /note="Psort-B: Cytoplasmic, score:8.87; COG0256 Ribosomal
FT                   protein L18; HMMPfam:IPR005484; BlastProDom:IPR005484;
FT                   HMMTigr:IPR004389; K02881 large subunit ribosomal protein
FT                   L18"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00315"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71351"
FT                   /db_xref="GOA:C4Z2U6"
FT                   /db_xref="InterPro:IPR004389"
FT                   /db_xref="InterPro:IPR005484"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4Z2U6"
FT                   /protein_id="ACR71351.1"
FT                   /translation="MVSKKSRTVVREQKHRRLRNRFSGTAERPRLAVFRSNNHMYAQII
FT                   DDTVGKTLVSASTLDKEVKAELEKTNNVEAAAAVGTVVAKRALEKGIKTVVYDRGGFIY
FT                   AGKIKALAEAAREAGLEF"
FT   gene            342959..343498
FT                   /locus_tag="EUBELI_00316"
FT   CDS_pept        342959..343498
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00316"
FT                   /product="small subunit ribosomal protein S5"
FT                   /note="Psort-B: Unknown cell location; COG0098 Ribosomal
FT                   protein S5; HMMPfam:IPR005324; HMMPfam:IPR013810;
FT                   Gene3D:IPR014720; Gene3D:IPR014721; HMMPanther:IPR000851;
FT                   HMMTigr:IPR005712; ScanRegExp:IPR013810; K02988 small
FT                   subunit ribosomal protein S5"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00316"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71352"
FT                   /db_xref="GOA:C4Z2U7"
FT                   /db_xref="InterPro:IPR000851"
FT                   /db_xref="InterPro:IPR005324"
FT                   /db_xref="InterPro:IPR005712"
FT                   /db_xref="InterPro:IPR013810"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018192"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z2U7"
FT                   /protein_id="ACR71352.1"
FT                   /translation="MNSKRKGDYSMKRTIIDASQLELNDNVVSIKRVTKVVKGGRNMRF
FT                   AALVVVGDGNGHVGAGVGKAAEIPEAIRKGKEDAIKHLVEVPIDENGSVPHDFLGKFGG
FT                   ATVLLKRAPEGTGIIAGGPARSILELAGIKNIRTKSLGSNNKQNVVLATIEGLKSMKTP
FT                   EEVARLRGKSVSEILG"
FT   gene            343506..343721
FT                   /locus_tag="EUBELI_00317"
FT   CDS_pept        343506..343721
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00317"
FT                   /product="Hypothetical protein"
FT                   /note="Psort-B: Cytoplasmic, score:8.87; COG1841 Ribosomal
FT                   protein L30/L7E; HMMPfam:IPR000517; HMMTigr:IPR005996"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00317"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71353"
FT                   /db_xref="GOA:C4Z2U8"
FT                   /db_xref="InterPro:IPR005996"
FT                   /db_xref="InterPro:IPR016082"
FT                   /db_xref="InterPro:IPR036919"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z2U8"
FT                   /protein_id="ACR71353.1"
FT                   /translation="MIPAKQEMEVKMAEKLRITLVKSPIGAVPKHRKTVEAMGLTKMHK
FT                   TVELPDNAATRGQIQQIGYMLKVEEI"
FT   gene            343741..344184
FT                   /locus_tag="EUBELI_00318"
FT   CDS_pept        343741..344184
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00318"
FT                   /product="large subunit ribosomal protein L15"
FT                   /note="Psort-B: Cytoplasmic, score:8.87; COG0200 Ribosomal
FT                   protein L15; HMMPfam:IPR001196; HMMPanther:IPR005749;
FT                   HMMTigr:IPR005749; ScanRegExp:IPR001196; K02876 large
FT                   subunit ribosomal protein L15"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00318"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71354"
FT                   /db_xref="GOA:C4Z2U9"
FT                   /db_xref="InterPro:IPR001196"
FT                   /db_xref="InterPro:IPR005749"
FT                   /db_xref="InterPro:IPR021131"
FT                   /db_xref="InterPro:IPR030878"
FT                   /db_xref="InterPro:IPR036227"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z2U9"
FT                   /protein_id="ACR71354.1"
FT                   /translation="MMDLSNLRPAEGSVLSDNFRRGRGHGSGNGKTAGKGHKGQKARSG
FT                   APRPGFEGGQMPLYRRIPKRGFTNRNRKEFVAINVNVLDRFDNGAEVTVDTLIESGIVK
FT                   DPKDGIKILANGELTKKLTVKANAFSAAAKEKIEALGGTCEVI"
FT   gene            344186..345505
FT                   /locus_tag="EUBELI_00319"
FT   CDS_pept        344186..345505
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00319"
FT                   /product="preprotein translocase SecY subunit"
FT                   /note="Psort-B: CytoplasmicMembrane, score:10.00; COG0201
FT                   Preprotein translocase subunit SecY; HMMPfam:IPR002208;
FT                   HMMPIR:IPR002208; HMMPanther:IPR002208; HMMTigr:IPR002208;
FT                   ScanRegExp:IPR002208; superfamily:IPR002208; K03076
FT                   preprotein translocase SecY subunit"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00319"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71355"
FT                   /db_xref="GOA:C4Z2V0"
FT                   /db_xref="InterPro:IPR002208"
FT                   /db_xref="InterPro:IPR023201"
FT                   /db_xref="InterPro:IPR026593"
FT                   /db_xref="InterPro:IPR030659"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z2V0"
FT                   /protein_id="ACR71355.1"
FT                   /translation="MFKTLVGAFKNKDIRKKIIYTLLILVVVRVGSLLPIPGVDTNYFS
FT                   SLLSGINTGDLSYLSAFTGGSFERMSLFALSITPYITSSIIMQLLTIAIPKLEEMQKEG
FT                   EDGRKKIASITRYVTIGLSLIESIAMAVGFGRTGLIKDSAQLSTLHYVVCIIVVVAALT
FT                   AGSAVLMWLGERITEKGVGNGISIVLLINIISGMPSDFATLYSTFVAPKTPAKGVLAAV
FT                   IILAILIVMVVLVCFLQDGERRIPVQYSQKVSGRRTVGGQSTNIPLKVNTAGVMPIIFA
FT                   SSLMQFPVIIAQLFGKSYEWTRYLSSSYWCRVEAPKYSIGLLVYIVLLIIFAYFYTSIT
FT                   FNPIEVADNLKKAGGVIPGITPGKSTSEYLNKILNYIVFIGAVGLLIIALIPIMCTGFF
FT                   NASVSFGGTSIIIIVGVVLETLKQIESQMCNRYYKGFLSE"
FT   gene            345626..346267
FT                   /locus_tag="EUBELI_00320"
FT   CDS_pept        345626..346267
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00320"
FT                   /product="nucleoside-triphosphate--adenylate kinase"
FT                   /note="Psort-B: Cytoplasmic, score:9.98; COG0563 Adenylate
FT                   kinase and related kinases; HMMPfam:IPR000850;
FT                   HMMPfam:IPR007862; BlastProDom:IPR011769;
FT                   HMMPanther:IPR000850; HMMTigr:IPR006259;
FT                   ScanRegExp:IPR000850; K00944
FT                   nucleoside-triphosphate--adenylate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00320"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71356"
FT                   /db_xref="GOA:C4Z2V1"
FT                   /db_xref="InterPro:IPR000850"
FT                   /db_xref="InterPro:IPR006259"
FT                   /db_xref="InterPro:IPR007862"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033690"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4Z2V1"
FT                   /protein_id="ACR71356.1"
FT                   /translation="MKIIMLGAPGAGKGTQAKKIAAKYAIPHISTGDIFRANIKNNTEL
FT                   GQKAKTYMDKGELVPDELVVDLIMDRFKEADCANGYVLDGFPRTIPQAEALDKALSANG
FT                   ESVDYAINVEVPDENIINRMSGRRACVGCGATYHIQFNPTKVEGICDACGEKLILRDDD
FT                   KPETVKNRLSVYHEQTQPLIEYYSGKGVLKEVDGTQPMDDVFAAIVKILG"
FT   gene            346274..346543
FT                   /locus_tag="EUBELI_00321"
FT   CDS_pept        346274..346543
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00321"
FT                   /product="Hypothetical protein"
FT                   /note="Psort-B: Cytoplasmic, score:8.87; COG2163 Ribosomal
FT                   protein L14E/L6E/L27E"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00321"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71357"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z2V2"
FT                   /protein_id="ACR71357.1"
FT                   /translation="MSDIKGYFASSKAGHDKGTVYMILESDDVYVYLSDGKLRPTDKLK
FT                   KKKLKHVQLIKQKDSDLAEKIEKNLFISNEEIKYAIKQIKTSAK"
FT   gene            346560..346778
FT                   /locus_tag="EUBELI_00322"
FT   CDS_pept        346560..346778
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00322"
FT                   /product="translation initiation factor IF-1"
FT                   /note="Psort-B: Cytoplasmic, score:9.98; COG0361
FT                   Translation initiation factor 1 (IF-1); HMMPfam:IPR006196;
FT                   Gene3D:IPR012340; HMMSmart:IPR003029; HMMTigr:IPR004368;
FT                   K02518 translation initiation factor IF-1"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00322"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71358"
FT                   /db_xref="GOA:C4Z2V3"
FT                   /db_xref="InterPro:IPR004368"
FT                   /db_xref="InterPro:IPR006196"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z2V3"
FT                   /protein_id="ACR71358.1"
FT                   /translation="MSKADVIEIEGKVVEKLPNAFFKVELENGHQILATISGKLRMNFI
FT                   RILPGDKVTIELSPYDLTKGRIIWRDK"
FT   gene            347326..347700
FT                   /locus_tag="EUBELI_00323"
FT   CDS_pept        347326..347700
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00323"
FT                   /product="small subunit ribosomal protein S13"
FT                   /note="Psort-B: Cytoplasmic, score:8.87; COG0099 Ribosomal
FT                   protein S13; HMMPfam:IPR001892; BlastProDom:IPR001892;
FT                   BlastProDom:IPR015886; HMMPanther:IPR001892;
FT                   ScanRegExp:IPR001892; superfamily:IPR010979; K02952 small
FT                   subunit ribosomal protein S13"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00323"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71359"
FT                   /db_xref="GOA:C4Z2V4"
FT                   /db_xref="InterPro:IPR001892"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR018269"
FT                   /db_xref="InterPro:IPR019980"
FT                   /db_xref="InterPro:IPR027437"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4Z2V4"
FT                   /protein_id="ACR71359.1"
FT                   /translation="MARISGVDLPREKRIEIGLTYVYGIGRVRASKILEEAGVNPDTRV
FT                   KDLTDEEVAKIAKVIDADPEHLVEGDLRREVAMNIKRLKEIGCYRGIRHRKGLPCRGQK
FT                   TKTNARTCKGPKKTVANKKK"
FT   gene            347734..348129
FT                   /locus_tag="EUBELI_00324"
FT   CDS_pept        347734..348129
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00324"
FT                   /product="small subunit ribosomal protein S11"
FT                   /note="Psort-B: Unknown cell location; COG0100 Ribosomal
FT                   protein S11; HMMPfam:IPR001971; BlastProDom:IPR001971;
FT                   Gene3D:IPR001971; HMMPanther:IPR001971;
FT                   ScanRegExp:IPR001971; K02948 small subunit ribosomal
FT                   protein S11"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00324"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71360"
FT                   /db_xref="GOA:C4Z2V5"
FT                   /db_xref="InterPro:IPR001971"
FT                   /db_xref="InterPro:IPR018102"
FT                   /db_xref="InterPro:IPR019981"
FT                   /db_xref="InterPro:IPR036967"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z2V5"
FT                   /protein_id="ACR71360.1"
FT                   /translation="MAQKVTKKVTKKRVKKNVERGQAHIQSSFNNTIVTLTDAEGNALS
FT                   WASAGGLGFRGSKKSTPYAAQMAAETATKAALIHGLKSVDVMVKGPGSGREAAIRALSA
FT                   AGLEVTSIKDVTPVPHNGCRPPKRRRV"
FT   gene            348150..348743
FT                   /locus_tag="EUBELI_00325"
FT   CDS_pept        348150..348743
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00325"
FT                   /product="small subunit ribosomal protein S4"
FT                   /note="Psort-B: Cytoplasmic, score:8.87; COG0522 Ribosomal
FT                   protein S4 and related proteins; HMMPfam:IPR001912;
FT                   HMMPfam:IPR002942; HMMPanther:IPR001912;
FT                   HMMSmart:IPR002942; HMMTigr:IPR005709;
FT                   ScanRegExp:IPR001912; K02986 small subunit ribosomal
FT                   protein S4"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00325"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71361"
FT                   /db_xref="GOA:C4Z2V6"
FT                   /db_xref="InterPro:IPR001912"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR005709"
FT                   /db_xref="InterPro:IPR018079"
FT                   /db_xref="InterPro:IPR022801"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4Z2V6"
FT                   /protein_id="ACR71361.1"
FT                   /translation="MAVNRTPVLKRCRSLEMDPVYLGIDKKSRRKAKNAGRKVSEYGMQ
FT                   LREKQKAKFIYGVLEKPFRNYYKKAERQKGMTGENLMIMLELRLDNVLFRLGFARTRKE
FT                   ARQIVDHKHVLVNGKCVNIPSYLVKAGDVIEIREKSKSSARYKEILESTNGRLVPEWLE
FT                   ADADALKGSVKSIPTREVIDVPVNEMLIVELYSK"
FT   gene            348801..349769
FT                   /locus_tag="EUBELI_00326"
FT   CDS_pept        348801..349769
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00326"
FT                   /product="DNA-directed RNA polymerase subunit alpha"
FT                   /note="Psort-B: Cytoplasmic, score:9.98; COG0202
FT                   DNA-directed RNA polymerase, alpha subunit/40 kD subunit;
FT                   HMMPfam:IPR011260; HMMPfam:IPR011261; HMMPfam:IPR011262;
FT                   BlastProDom:IPR011260; Gene3D:IPR011262;
FT                   HMMSmart:IPR011263; HMMTigr:IPR011773;
FT                   superfamily:IPR009025; superfamily:IPR011262; K03040
FT                   DNA-directed RNA polymerase subunit alpha"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00326"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71362"
FT                   /db_xref="GOA:C4Z2V7"
FT                   /db_xref="InterPro:IPR011260"
FT                   /db_xref="InterPro:IPR011262"
FT                   /db_xref="InterPro:IPR011263"
FT                   /db_xref="InterPro:IPR011773"
FT                   /db_xref="InterPro:IPR036603"
FT                   /db_xref="InterPro:IPR036643"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z2V7"
FT                   /protein_id="ACR71362.1"
FT                   /translation="MVDADFNFKMPKIEMTEKSEDGKYGKFVVEPLERGYGLTLGNSLR
FT                   RIMLSSLVGTAVSSIKIEGVLHEFSSIPGVKEDVTEIVMNIKQLSIKNNGNSVEPKEAH
FT                   IDFVGEGVVRASDIQVDPDIEIINPDLVIAHLNGADSKLTMELTITNGRGYVSSEKNKR
FT                   DDQPAGVIAIDSIYTPVERVNMAVQNTRVGQDTDFDKLTLDIFTNGTIEPDEALSLAAK
FT                   VLSEHLKGFINLSENAQKVEIMVEQEEDETTKVLSMSIEDLELSVRSSNCLRRAGINTV
FT                   EELCNKTSDDMMKVRNLGKKSLDEVLLKLKEMGLHLRPNED"
FT   gene            349839..350375
FT                   /locus_tag="EUBELI_00327"
FT   CDS_pept        349839..350375
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00327"
FT                   /product="large subunit ribosomal protein L17"
FT                   /note="Psort-B: Cytoplasmic, score:8.87; COG0203 Ribosomal
FT                   protein L17; HMMPfam:IPR000456; BlastProDom:IPR000456;
FT                   Gene3D:IPR000456; HMMPanther:IPR000456; HMMTigr:IPR000456;
FT                   superfamily:IPR000456; K02879 large subunit ribosomal
FT                   protein L17"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00327"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71363"
FT                   /db_xref="GOA:C4Z2V8"
FT                   /db_xref="InterPro:IPR000456"
FT                   /db_xref="InterPro:IPR036373"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4Z2V8"
FT                   /protein_id="ACR71363.1"
FT                   /translation="MAKYRKLGRTSSQRKALLRSQVTALIENGKIVTTEARAKEVKKMA
FT                   EKLITLAVKEKDNFETVKVSAKVPKKDAEGKRVKEVVDGKKVTVYETVEKEIKKDLPSR
FT                   LHARKQMDKVLYTVTEVPTAAAGKKKNTKTVDLTNKLFDEIAPKYAGRQGGYTRIVKIG
FT                   LRKGDAAMEVLLELV"
FT   gene            350420..351340
FT                   /locus_tag="EUBELI_00328"
FT   CDS_pept        350420..351340
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00328"
FT                   /product="cobalt/nickel transport system ATP-binding
FT                   protein"
FT                   /note="Psort-B: CytoplasmicMembrane, score:9.49; COG1122
FT                   ABC-type cobalt transport system, ATPase component;
FT                   HMMPfam:IPR003439; BlastProDom:IPR003439;
FT                   HMMSmart:IPR003593; ScanRegExp:IPR003439; K02006
FT                   cobalt/nickel transport system ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00328"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71364"
FT                   /db_xref="GOA:C4Z2V9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR015856"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030947"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z2V9"
FT                   /protein_id="ACR71364.1"
FT                   /translation="MESAVRLKRAGGHMGIVKAKNLTFEYIRRDEDGNVEGITKAVDNV
FT                   SIDIKQGDFVAVLGHNGSGKSTFAKHLNALVMPTEGTVWVDGMDTREEENTLKVRQTAG
FT                   MVFQNPDNQIVGTLVDEEVGFGPENIGVPTEEIWERVEKSLKAVGMYAFRNQSPNKLSG
FT                   GQKQRIAIAGIVAMKPKCIVLDEPTAMLDPLGRKDVLNVLHELNRQENVTVILITHYME
FT                   EVIDIDKLYVMDDGKLVMSGTPREIFSQVEKLKELRLDVPHVTELAYELQKEGVPLKNG
FT                   ILTSEEFTEELIRVRNEGFNVNNSR"
FT   gene            351321..352166
FT                   /locus_tag="EUBELI_00329"
FT   CDS_pept        351321..352166
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00329"
FT                   /product="cobalt/nickel transport system ATP-binding
FT                   protein"
FT                   /note="Psort-B: CytoplasmicMembrane, score:9.49; COG1122
FT                   ABC-type cobalt transport system, ATPase component;
FT                   HMMPfam:IPR003439; BlastProDom:IPR003439;
FT                   HMMSmart:IPR003593; ScanRegExp:IPR003439; K02006
FT                   cobalt/nickel transport system ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00329"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71365"
FT                   /db_xref="GOA:C4Z2W0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR015856"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030946"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z2W0"
FT                   /protein_id="ACR71365.1"
FT                   /translation="MSIIVDNISYIYEKGTGFERQALKNVSCAIEDGEFIGLIGHTGSG
FT                   KSTFIQHLNGLVKPTEGHIYYNGRDIYEQGFNMKELRSRVGLVFQYPEHQLFETEIFKD
FT                   VCFGPKNLGLSQKEVEIRAFESLRLVGIDDNMFYQSPFDLSGGQKRRVAIAGVLAMKPD
FT                   VLILDEPTAGLDPKGRDDILNCLKYLREETGMTIILVSHSMDDVANYVSRIMVMNDGVL
FT                   TYDDTPRNVFRHYKELEAIGLAAPQVTYLMNDLKQAGFDVNTDAITIDEAKESILSALG
FT                   "
FT   gene            352129..352986
FT                   /locus_tag="EUBELI_00330"
FT   CDS_pept        352129..352986
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00330"
FT                   /product="cobalt/nickel transport system permease protein"
FT                   /note="Psort-B: CytoplasmicMembrane, score:9.97; COG0619
FT                   ABC-type cobalt transport system, permease component CbiQ
FT                   and related transporters; HMMPfam:IPR003339; K02008
FT                   cobalt/nickel transport system permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00330"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71366"
FT                   /db_xref="GOA:C4Z2W1"
FT                   /db_xref="InterPro:IPR003339"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z2W1"
FT                   /protein_id="ACR71366.1"
FT                   /translation="MKRRKAFCQHWDKGSNMIRDITIGQYYQADSVIHRLDPRVKLMGT
FT                   LIFVISLFLGSNIWLYLVVAAFLAIVIALSKIPLKFILKGLKAIVILIVISAAFNLFLT
FT                   PGTPLIKIWKLTITHEGLNTAVFMVIRLIFLIMGSSLMTLTTTPNNLTDGLEKGLGFLK
FT                   YIKVPVHEIAMMMSIALRFIPILIEETDKIMKAQMARGADFESGNIIKKAKAMIPILVP
FT                   LFISAFRRANELAMAMEARCYHGSEGRTKMKPLKYSRRDINAYLIIALYLACIIVVKVT
FT                   LKLI"
FT   gene            353050..353811
FT                   /locus_tag="EUBELI_00331"
FT   CDS_pept        353050..353811
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00331"
FT                   /product="tRNA-pseudouridine synthase I"
FT                   /note="Psort-B: Cytoplasmic, score:8.87; COG0101
FT                   Pseudouridylate synthase; HMMPfam:IPR001406;
FT                   Gene3D:IPR001406; HMMPanther:IPR001406; HMMTigr:IPR001406;
FT                   K06043 tRNA-pseudouridine synthase I"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00331"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71367"
FT                   /db_xref="GOA:C4Z2W2"
FT                   /db_xref="InterPro:IPR001406"
FT                   /db_xref="InterPro:IPR020095"
FT                   /db_xref="InterPro:IPR020097"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z2W2"
FT                   /protein_id="ACR71367.1"
FT                   /translation="MRRIKLIVAYDGTEYSGWQIQPEAPTIEMCLDKAIRELTGENVHV
FT                   TGASRTDAGVHAYGNVAVFDTESTIPGDRFTFALNRFLPDSIVIQDSWEVSGDFHPRHC
FT                   NTRKTYEYRILNTVVPLPQKRNFTWHVTGSIDIEKMKEAAAYIVGEHDFKSFCCVRTQA
FT                   ESTVRTIYSLEVLQEGSEIIIRIKGNGFLYNMVRIITGTLIQVGKGRFKPEYVKQMLEA
FT                   KDRTVAGQTAPPQGLTLVGIEYVDNDDARVV"
FT   gene            354004..354432
FT                   /locus_tag="EUBELI_00332"
FT   CDS_pept        354004..354432
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00332"
FT                   /product="large subunit ribosomal protein L13"
FT                   /note="Psort-B: Unknown cell location; COG0102 Ribosomal
FT                   protein L13; HMMPfam:IPR005822; BlastProDom:IPR005822;
FT                   Gene3D:IPR005822; HMMPanther:IPR005822;
FT                   HMMPanther:IPR005823; HMMTigr:IPR005823;
FT                   ScanRegExp:IPR005822; superfamily:IPR005822; K02871 large
FT                   subunit ribosomal protein L13"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00332"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71368"
FT                   /db_xref="GOA:C4Z2W3"
FT                   /db_xref="InterPro:IPR005822"
FT                   /db_xref="InterPro:IPR005823"
FT                   /db_xref="InterPro:IPR023563"
FT                   /db_xref="InterPro:IPR036899"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4Z2W3"
FT                   /protein_id="ACR71368.1"
FT                   /translation="MKTYMASASTIERKWYVVDAADYTLGRLASQVAAVLRGKNKPTYT
FT                   PFLDCGDNVIVINADKVKVTGKKLDQKVYYSHSDYVGGLKETTLKEMMEKKPEKVIELA
FT                   VKGMLPKGPLGRQMFTKLHVYAGPDHEQAAQKPEVLKF"
FT   gene            354463..354867
FT                   /locus_tag="EUBELI_00333"
FT   CDS_pept        354463..354867
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00333"
FT                   /product="small subunit ribosomal protein S9"
FT                   /note="Psort-B: Cytoplasmic, score:8.87; COG0103 Ribosomal
FT                   protein S9; HMMPfam:IPR000754; BlastProDom:IPR000754;
FT                   Gene3D:IPR014721; HMMPanther:IPR000754;
FT                   ScanRegExp:IPR000754; K02996 small subunit ribosomal
FT                   protein S9"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00333"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71369"
FT                   /db_xref="GOA:C4Z2W4"
FT                   /db_xref="InterPro:IPR000754"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020574"
FT                   /db_xref="InterPro:IPR023035"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z2W4"
FT                   /protein_id="ACR71369.1"
FT                   /translation="MAKKANGKFYGTGRRKSSIARVYLVPGTGNITINKRSLDEYFGLE
FT                   TLKVVVKQPLALTETADKFDVIVNVHGGGYTGQAGAIRHGISRALLQVDSDEYRPSLKK
FT                   AGFLTRDPRMKERKKYGLKAARRAPQFSKR"
FT   gene            355070..355846
FT                   /locus_tag="EUBELI_00334"
FT   CDS_pept        355070..355846
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00334"
FT                   /product="Hypothetical protein"
FT                   /note="Psort-B: Cytoplasmic, score:8.87; COG0561 Predicted
FT                   hydrolases of the HAD superfamily; HMMPfam:IPR013200;
FT                   HMMTigr:IPR000150; HMMTigr:IPR006379; ScanRegExp:IPR000150"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00334"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71370"
FT                   /db_xref="GOA:C4Z2W5"
FT                   /db_xref="InterPro:IPR000150"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z2W5"
FT                   /protein_id="ACR71370.1"
FT                   /translation="MIKIAFFDIDGTLLKMGCKEPTDKTVKALNSLHQNGILLCMATGR
FT                   GYLSIPEFKDITFDVLLTFNGSYVMAGEKIIFRNPLNNNDKHQIIQNLNKMNRAAAISN
FT                   EHFIVTNGTDEHLEEYFKFGNETLTIADNFDELCKEDIYQIMCACRKEEYAQILQGTEN
FT                   TQITAWWDKAADIIPLNCGKGNAVNAVLNYYGLSKDEAIAFGDGRNDIEMLEAVGTGVA
FT                   MGNAIDEVKARADVICKSVEEDGVYHYCLEKKLIKC"
FT   gene            complement(355920..357950)
FT                   /locus_tag="EUBELI_00335"
FT   CDS_pept        complement(355920..357950)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00335"
FT                   /product="Hypothetical protein"
FT                   /note="Psort-B: Cytoplasmic, score:8.87"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00335"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71371"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z2W6"
FT                   /protein_id="ACR71371.1"
FT                   /translation="MEVIMADFILLDEDFSDFPIGEFPYDKNHSAMGEYHFIHYPGYYG
FT                   KWYDPVCNHVYNGQGASWIISEYNGKHFMEQMRIRNDKPHRTFPMLTSGDRFWRDYTIT
FT                   ASVRMFTTKWGNAGIGFCCQNSANLLVLVFEEHELRLEYRHKEDVTVLDSVPFDYNCDD
FT                   TYVLKAEIKGSHVICSVDDKVYFDLDTEYARQGGKVAITATIPTQFGFVNVTTSESTAA
FT                   SIDAARNAYKAECEDAQAHYPKMKLLKKIDLKGCGTGRQLRFGHLLGNGEYQMVMAQCQ
FT                   KRVNRDAYGTISCLTAFDLDGNILWQHGEPTDNHDIGTISADMPMQIYDIDGDGFDEVI
FT                   TAKNFEVLILDGKTGEVKKRAKTPFSTPEEDGTIIGVPDKIYAFDRINPDGMRICNFRG
FT                   LEKPRDILIKDRYCRVYALNDDLEVMWHFQSDKNTGHFPFAIDINGDGHDELLVGYNML
FT                   DCHGNKMWTMPVNEDHIDEIVPGRFESGPHKGTKFFACVAGKEGFLISDFNGKLLKKDG
FT                   IGHAQRVSLANYLPNRPGYEMVVVNFWGHQGIIYFYDSEGNQLWEMENELNGNLLTPVN
FT                   WTGDGQDFILLNADVERGGMIDGNGIQVVKFPDDGHPTMCAEAVNLYGDARDEIVTWDY
FT                   DSMYIYTQDDAPKDDVYAPFKYPDYNASNYRGEYSYREKWW"
FT   gene            complement(357969..358790)
FT                   /locus_tag="EUBELI_00336"
FT   CDS_pept        complement(357969..358790)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00336"
FT                   /product="xylan 1,4-beta-xylosidase"
FT                   /note="Psort-B: Cytoplasmic, score:9.65; COG2207 AraC-type
FT                   DNA-binding domain-containing proteins; HMMPfam:IPR000005;
FT                   HMMPfam:IPR003313; Gene3D:IPR012287; HMMSmart:IPR000005;
FT                   superfamily:IPR009057; superfamily:IPR011051; K01198 xylan
FT                   1,4-beta-xylosidase"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00336"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71372"
FT                   /db_xref="GOA:C4Z2W7"
FT                   /db_xref="InterPro:IPR003313"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR037923"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z2W7"
FT                   /protein_id="ACR71372.1"
FT                   /translation="MYHFINDNFLTDIATVPPSYKMKHFHEHNKWELMFIYSGSCTLYV
FT                   GDEIYMLNPGGLALISPDTAHMTTYLAGSDHTRYVLYFNNDELKWIADDSSLDIESIFH
FT                   EHPVIHIPERRLDYISSIIQKISYEHNGVDSLSLSFIHSYFHELILFILRCQMYEDNVI
FT                   TKMDTGNELIQKVIEYIIENYHNDITMAATAELFNMSESSLSKKFKAFTGFRFREYLIN
FT                   VRTHAAADLLVNTSLSITEIADKCGFADSNTMGGTFKKIMGEAPGSYRKSH"
FT   gene            359000..361882
FT                   /locus_tag="EUBELI_00337"
FT   CDS_pept        359000..361882
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00337"
FT                   /product="Hypothetical protein"
FT                   /note="Psort-B: Unknown cell location;
FT                   superfamily:IPR011050"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00337"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71373"
FT                   /db_xref="GOA:C4Z2W8"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z2W8"
FT                   /protein_id="ACR71373.1"
FT                   /translation="MIRRNKIIASVAVSVMTGVLVAGNLVPLQGYYAFAQETGVTAMRY
FT                   SAVKDINKTLEGYTPIDSSDPVEFGGTYIKYQGETIQLSETAIYLDGSLSDELAAQYPY
FT                   VYNDITKALSADALKNGTADNPMTVYVAPYVYWIDDPAATDTVQKTEGYSVPYGMVVNS
FT                   DYLTIKGLTGNPDNVVLAGNRGQSHASNGNYTMFRFNCSGALTVKNITIGNYCSVDLDY
FT                   PLMSELNQAKRTDTITQAQLADMSGDKMFADNCNFISRLNLVPISGALRNLYNNCHFES
FT                   TDDALNGNAVYVGCDFDFYGNRPLYSSYNTGSTFLGCTFNCKILNVEAEPTQFFTKEGG
FT                   TITAVDCVYNSNLSVPITMGWTKFPSDSLKCYQSNIIHNGKNITIGGEGAKETVDMTGK
FT                   SVLNAYKVVSGGKTYYNTYNLLKGSDDWDPLGVKDVIAAAGQEAIATQLTIKSDVSEIE
FT                   SGKETASVGGTVNYFYGTNDTTQKITYSVSDEDKAYVKLTDNGDGTCKVEGTNNDDAAK
FT                   KVIINASTESGLEAAVGITVKPSKLDAPEYIKTPVITNDGQGSLKVDYSLDLGSREDMS
FT                   AISWYRCTDAEGSNKVLVAVTRNDSPEYTYKLTAGDVGYYIMAKVESKNIRSDYGTPVN
FT                   TVYDKAIGVKDVRSKNLSTDFSNFPNIKQSEIKAGFWTVDYNRPADTESFGKWQGADTE
FT                   EPWVYGVTGNGCVGAGLYQGTQGSRLMYTPVEGTYGDMSLKLVVDPAKTAGQGFGSAGQ
FT                   YMDVLLKFDTSTLTGYGLRIIRTKASSNAVTFVLVKYDNGAVTEISDEVIASCYVTGCT
FT                   ISLKTEGNKLTAHVETPTEQLADQAAKGYPHVVDLTADIAANSFGGVAIQHTGTTGTGG
FT                   WQNTTMLHNLDITWEGENNQNPEYVEENPSDNENPAETPDDSTGTSTGADTTVNTGDMS
FT                   HAGMYAALTTASLCALLGMAAVYMRRRKDI"
FT   gene            362038..363078
FT                   /locus_tag="EUBELI_00338"
FT   CDS_pept        362038..363078
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00338"
FT                   /product="thiamine biosynthesis lipoprotein"
FT                   /note="Psort-B: Unknown cell location; COG1477
FT                   Membrane-associated lipoprotein involved in thiamine
FT                   biosynthesis; HMMPfam:IPR003374; K03734 thiamine
FT                   biosynthesis lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00338"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71374"
FT                   /db_xref="GOA:C4Z2W9"
FT                   /db_xref="InterPro:IPR003374"
FT                   /db_xref="InterPro:IPR024932"
FT                   /db_xref="InterPro:IPR042159"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z2W9"
FT                   /protein_id="ACR71374.1"
FT                   /translation="MKYNIRKYILAGITAILAAAVLTACGGSKPEKDDTVQSTQEIFAM
FT                   DTYMSLTAYGSNSEEAVSKAVQEINRLDAMFSVGNEDSDVTKINENGSGEVLEETAFIM
FT                   NRAMQVSKETKGAFDITIYQVMELWGFTTKNYRVPESSEIADVLKHVSYTNVEVNGQQV
FT                   TLSDGASIDLGGIAKGYTSSRVIQIMKDCGIEHAIINLGGNVQVLGTKTDGSDWRIAIQ
FT                   NPDSESSYLGVLSTADKAVITSGGYERYFEQDGQVYHHIIDPQTGYPSESDLTSVTIVC
FT                   SDGTTADALSTALFVMGLDGAKELYRSGSLDFEMILYDGSKVYMSEGIADSFSTNMNTE
FT                   IITRQP"
FT   gene            363226..364638
FT                   /locus_tag="EUBELI_00339"
FT   CDS_pept        363226..364638
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00339"
FT                   /product="Hypothetical protein"
FT                   /note="Psort-B: CytoplasmicMembrane, score:9.99; COG2717
FT                   Predicted membrane protein; HMMPfam:IPR007329"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00339"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71375"
FT                   /db_xref="GOA:C4Z2X0"
FT                   /db_xref="InterPro:IPR007329"
FT                   /db_xref="InterPro:IPR013130"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z2X0"
FT                   /protein_id="ACR71375.1"
FT                   /translation="MLLIISLIIVSLFIYFLKGSLKKHAGIYYIGAAVISIAVFLLEFL
FT                   SMPLFVKNNILGIFAKGSLGTAMFVVVMYTGALPKGNKLIAPLMKIRGELSITAAILVL
FT                   CHNFTYGMTYFKMLFIKPEALSATQLTAAIISLVLIIIMIVLTVTSFQAVRKKMKAKKW
FT                   KQLQRTAYVFYGLMYVHIMLINIPYARLGLGTYIANVVIYSIVFLGYAAMRIAKAVSVK
FT                   AARAGKTYGKKPETVLYGLALVICAMMTVSCFAGRQTVSASEDNEEWNDFFNEETVAAM
FT                   VKEIESSTAKTDAEGTTQESLEESVSSDGQSDSQAGGVGNEVSGNSNNSGSDNVSGNSS
FT                   GNSSDSGNQSAQPDNGSDNSGELSGGSGSDAPANTKFKADGTYTGSAVCETYNYNVTVT
FT                   IVISGDTITSVTAESEAGAQDVQYFNMANAKIPAQLLANQSTSGVDAVSGATKSSNAIK
FT                   KAFYYAYKSAKK"
FT   gene            364728..366185
FT                   /locus_tag="EUBELI_00340"
FT   CDS_pept        364728..366185
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00340"
FT                   /product="Hypothetical protein"
FT                   /note="Psort-B: Unknown cell location"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00340"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71376"
FT                   /db_xref="GOA:C4Z2X1"
FT                   /db_xref="InterPro:IPR029218"
FT                   /db_xref="InterPro:IPR029221"
FT                   /db_xref="InterPro:IPR036154"
FT                   /db_xref="InterPro:IPR038031"
FT                   /db_xref="InterPro:IPR038698"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z2X1"
FT                   /protein_id="ACR71376.1"
FT                   /translation="MRKNIFTKIAAVAAATVLAVTALPALVSDTHAADDEYSYVYAGLT
FT                   WQEYWANEGVYNAGDVTSSNEKDTHGEYDKGAFDTVTRATTNHGLHRGSYQCMATIDTE
FT                   DGNKYELAGWSSDGKQMILTDGTQLSYNRGTITNADGSTSKVSSYEVTGIKYVPVKVKT
FT                   SDLADFEQHYRVVKNGEKLYGGFGENKLSSYEYTAAVNADTNGLKTAVKNADGTYSFSA
FT                   RQTGSGKSFAEQDISVAANITSTVKDATGSYGEFLRVDINGDGYGALGAMMQAVKWTYY
FT                   GNDATRTNAVATYGTKFAADNWMHKSMGIQLGLTDSARCQLPAGYDGTGYWSLTVYALG
FT                   YTDTTIDFEATDANIVKIKAPVSDTSKLSAAIAAADALNEADYTAESWAAMKLEYEEAV
FT                   DALAVAEYQADVDEATEHLTAAINALVKVDAGTPSDSEEPDNTDDSSVEDVPTGDANNM
FT                   MAYLAAALLALTAGAAVTCRRKIKNVR"
FT   gene            complement(366279..367028)
FT                   /locus_tag="EUBELI_00341"
FT   CDS_pept        complement(366279..367028)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00341"
FT                   /product="Hypothetical protein"
FT                   /note="Psort-B: Unknown cell location; COG3595
FT                   Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00341"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71377"
FT                   /db_xref="GOA:C4Z2X2"
FT                   /db_xref="InterPro:IPR025164"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z2X2"
FT                   /protein_id="ACR71377.1"
FT                   /translation="MKKRIYLSIIYFITLICIIIGVLGNVFNISPFTRMTMASSGKYIE
FT                   NSSIYDNVSDISVDMNLGSVEIKKGSKLEVIYTGAEKFKPAVSVSGTSLNIEQHVKVHL
FT                   MTNIKNSDCTLTITIPDNICLNSIQADLNMGDMDVNNIHASSADFSVDMGSLKIVDSAV
FT                   KNLTADNNMGDIKLTNCGSDALNLSVDMGSLKISGMDIDKYRANLSVDLGDIKVNDSTY
FT                   SHSYTNNAGSGKSINADVNMGDIKINR"
FT   gene            complement(367031..368011)
FT                   /locus_tag="EUBELI_00342"
FT   CDS_pept        complement(367031..368011)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00342"
FT                   /product="Hypothetical protein"
FT                   /note="Psort-B: CytoplasmicMembrane, score:9.99; NOG21966
FT                   non supervised orthologous group"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00342"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71378"
FT                   /db_xref="GOA:C4Z2X3"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z2X3"
FT                   /protein_id="ACR71378.1"
FT                   /translation="MDTIKSYLETMFANLPATAEVLKAKDELWGMMEDKYNELISEGKS
FT                   ENEAVGTVISEFGNLDELAETLGLNRQSSAPVDNRRTLTQEEARSFVSAGSRHAFLTAL
FT                   GVFLCIFSVVPVAACSAIHNNFIETMGTVALFIIAACGVGIFIITNSLMSKYNYIKKHE
FT                   CIIDYATVGYVQDKKDQLRNISIVCRTLGIIMCIISFVPAAVFDAIPVQGLDDIGGAAM
FT                   ICIVSVGVFLIVFGSMVETSCKTLLALNGDNVAGSYVKKENKEVRYINNTATTIMSVFW
FT                   PTVTCIYLSVSFITFAWALTWVIWPVAAVIHAIFKSILKDDSREV"
FT   gene            complement(368015..368353)
FT                   /locus_tag="EUBELI_00343"
FT   CDS_pept        complement(368015..368353)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00343"
FT                   /product="Hypothetical protein"
FT                   /note="Psort-B: Cytoplasmic, score:8.87; COG1695 Predicted
FT                   transcriptional regulators; HMMPfam:IPR005149;
FT                   Gene3D:IPR011991"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00343"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71379"
FT                   /db_xref="InterPro:IPR005149"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z2X4"
FT                   /protein_id="ACR71379.1"
FT                   /translation="MAGISSDIIRGYNDTIILYLLLDKPSYGYEISKQIKAMTNEKYIV
FT                   KETTLYSAFTRMEKNGYITSFPGVGENGGKKRTYYQITDEGRLYYQSKCEEWALTKEVI
FT                   EKFIVKEN"
FT   gene            complement(368569..369417)
FT                   /locus_tag="EUBELI_00344"
FT   CDS_pept        complement(368569..369417)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00344"
FT                   /product="Hypothetical protein"
FT                   /note="Psort-B: Cytoplasmic, score:8.87; NOG23398 non
FT                   supervised orthologous group; HMMPfam:IPR006992"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00344"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71380"
FT                   /db_xref="GOA:C4Z2X5"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR032465"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z2X5"
FT                   /protein_id="ACR71380.1"
FT                   /translation="MQAIGGGYASYADGTIFQMIPECLGEYDVTPEAVLKVMDEAGVSK
FT                   AVMLQGNFLGPQNLYTYEAAKKYPDRLAAAATYDPFCRNVDSIRKHLFEDLGIKIVKFE
FT                   VSTGSGLMSYHPTIPLDGDVIEEMLSYAEMHNNTVVFDIGRYPAECWQPEALARAIKRH
FT                   PDTQFVVCHLLAPRGLVQENVWLKGMEALTLDNVVFDLASLPSNQGKDATYPYPDAIHY
FT                   IKRAIELVGSDRLMWGSDLPMNLCKDSYRHLIDYIVLSNEISTPDKENIMAATAAKVYF
FT                   K"
FT   gene            complement(369509..370732)
FT                   /locus_tag="EUBELI_00345"
FT   CDS_pept        complement(369509..370732)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00345"
FT                   /product="dicarboxylate/amino acid:cation (Na+ or H+)
FT                   symporter, DAACS family"
FT                   /note="Psort-B: CytoplasmicMembrane, score:10.00; COG3633
FT                   Na+/serine symporter; HMMPfam:IPR001991;
FT                   HMMPanther:IPR001991; ScanRegExp:IPR002155; K03309
FT                   dicarboxylate/amino acid:cation (Na+ or H+) symporter,
FT                   DAACS family"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00345"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71381"
FT                   /db_xref="GOA:C4Z2X6"
FT                   /db_xref="InterPro:IPR001991"
FT                   /db_xref="InterPro:IPR023025"
FT                   /db_xref="InterPro:IPR036458"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z2X6"
FT                   /protein_id="ACR71381.1"
FT                   /translation="MKKLLDKWISISLIKRIIGGLALGIILGLLVPKASGIALFGSVFV
FT                   GALKAIAPLLVFVLVISSLCHSGKSHGGVIKTVIILYMFSTILASVIAVFTSKLFPVTL
FT                   TLTEGFEEMSSPGSIGDVFNSLLMNIVENPITSLTKANYVGILAWAVVIGIACRHAKES
FT                   TKDMLVDISNGLSKVVTWIINFAPFGIMGLVFDTVSNNGMSVFKEYGKLLMLLVGTMLF
FT                   IYFVTNPILVFWCTHKNPYPLVFRCLKKSALTAFFTRSSAANIPINMKECEDMGLDRDT
FT                   YSVTIPLGATINMDGAAITITVMTLAAANTLGITVDIPSAILLSILAALSACGASGVAG
FT                   GSLLLIPMACSLFGIPNDVAMQVVGIGFIIGVIQDSVETALNSSSDLLLSASAEFRQWR
FT                   KEGREITY"
FT   gene            370865..371983
FT                   /locus_tag="EUBELI_00346"
FT   CDS_pept        370865..371983
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00346"
FT                   /product="Hypothetical protein"
FT                   /note="Psort-B: CytoplasmicMembrane, score:9.99; COG0471
FT                   Di- and tricarboxylate transporters; HMMPfam:IPR004680"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00346"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71382"
FT                   /db_xref="GOA:C4Z2X7"
FT                   /db_xref="InterPro:IPR004680"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z2X7"
FT                   /protein_id="ACR71382.1"
FT                   /translation="MERIYNYLKKDAVLTISWVLAIVSMFFIKPDKAYAGYIDWRSLGI
FT                   LWSLMIITKGYMQNGIFEKIGHALLTRTRKMWQLIAVLVGLNFFSSMIITNDVSLITFV
FT                   PFAIMMLKQCGRQELMIPVVVLQTIAANLGSMLTPIGNPQNLYLYGLAGTGIGEFIMWL
FT                   LPYTIVSALLLVISILLIKNKNEIICIEDTDSEAAHNTSVPRVMAYSVLFILALLVVAR
FT                   VLTWYILAAAVLITVLLLEKNVLAKADYALLLTFIGFFIFTGNMGRVEPVAHFLAGIVN
FT                   GRELEAGIITSQCISNVPAALLLSEFTDNIKNLAIGVNIGGLGTLIASMASLISYKLYA
FT                   NEVPEKKGKYFAVFTVYNIIFLVVLYVFTKLI"
FT   gene            372021..373583
FT                   /locus_tag="EUBELI_00347"
FT   CDS_pept        372021..373583
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00347"
FT                   /product="Hypothetical protein"
FT                   /note="Psort-B: CytoplasmicMembrane, score:9.26; NOG06495
FT                   non supervised orthologous group"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00347"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71383"
FT                   /db_xref="GOA:C4Z2X8"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z2X8"
FT                   /protein_id="ACR71383.1"
FT                   /translation="MYGCPGCGAELKYDIKTGKLRCSRCGNKYDVQAIKKDKDAESSLY
FT                   EINEYVCPSCGGRIYTADNTIAGFCSYCGASAILQQRTETIDAPKSIVPFKVEKRVCKT
FT                   KFKNFAKKNMYVPDEYKTADGINEFRGIYLPYHSYDAEVAGVYDAYGSTETTKKKKKKI
FT                   YTTKKYWKIHAPVHGYVKGITHDASGLFRDDLSEAVNDATDSKAVVDFRPGYLCGFYAD
FT                   MSDVPASEYENYAYVNSKEYINNQIKCKVGSNMYINKTEQEPQIKISCKEDILKPVWFM
FT                   SYQNRNRVAYAVINGHTGKMNCDLPVDLKKFFGVSAIISAILFIILMCFQSVMFTAKTM
FT                   IGIAAVFNLIAGLFYDANIRKMYDREIKRTYKLKKSDISKLVAITVGAFMLMYFIISFV
FT                   ITINSEYRESSKWVKAVICAVTFVMQVIMIIKNYHKYEALKKNNTVPSPVFVLSVIINI
FT                   IIMAVAVINPVHDIWYYVATAMALASEVIVVIGIIRDYNYSCTRPLPQFKEYKGGQENI
FT                   EIS"
FT   gene            373570..374382
FT                   /locus_tag="EUBELI_00348"
FT   CDS_pept        373570..374382
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00348"
FT                   /product="Hypothetical protein"
FT                   /note="Psort-B: Unknown cell location; COG1512
FT                   Beta-propeller domains of methanol dehydrogenase type"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00348"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71384"
FT                   /db_xref="GOA:C4Z2X9"
FT                   /db_xref="InterPro:IPR007621"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z2X9"
FT                   /protein_id="ACR71384.1"
FT                   /translation="MRYLKKFLTVIIIFCSFIICGISGTQQVSASESGKTDTSYTIIYD
FT                   DSAYLIKDTDKPQLYDVMESISKDTNVIFYTTDSTEYGRNTADICQNYCAEHFGSSKTA
FT                   PVIMFTIDMYNREIYMYCTGSTRKIIRNAEANSITDNVYKSATAGDYGKCAINAFTQAE
FT                   NCLAGGKVKRPMQIINNVLLAMLLGVTANFTVLKISRASRKSADRCGEMVGIANNSFVS
FT                   VKVSKELIKEHTTVRRESSDYSGGSGDYSGSGGGSSDGGGSSGGGHSF"
FT   gene            374414..375766
FT                   /locus_tag="EUBELI_00349"
FT   CDS_pept        374414..375766
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00349"
FT                   /product="stage V sporulation protein K"
FT                   /note="Psort-B: Cytoplasmic, score:8.87; COG0790 FOG: TPR
FT                   repeat, SEL1 subfamily; HMMPfam:IPR003959;
FT                   HMMSmart:IPR003593; K06413 stage V sporulation protein K"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00349"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71385"
FT                   /db_xref="GOA:C4Z2Y0"
FT                   /db_xref="InterPro:IPR000641"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041627"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z2Y0"
FT                   /protein_id="ACR71385.1"
FT                   /translation="MDSINMCYEMCDYIEQNGIVKLVGNTRLRDNLKKEFLHFLIYISM
FT                   IDERYGEQEKAFIKKKLGFEVSALMAADIKNRNMLGAGYITKMPETFKYFILANAGHKI
FT                   KNDRYDNKEARTLAESYRKLGQEYLAANTESTEVEINVLSSYCVMLDENLKSYGLLRPD
FT                   YKSVTIQAETEDDEKPDADELIAELNSLTGLTAVKEDVNALINLLKVQKMREQMGMKQT
FT                   SVNKHLVFMGNPGTGKTTVARLLARIYKAIGAISKGHLVEVDRSGLVCGYIGQTVTKTA
FT                   EVIESALGGVLFIDEAYTLTNGKGQGDFGQEAVDTLLKGMEDHRDDLVVIVAGYTELME
FT                   EFLDSNPGLRSRFNKFINFEDYTAEEEVEILINNCKKQEYMLSRDALEEARRFFTDRVA
FT                   DKPEGYANARDVRNYLEKAISNQATRIVGLKDVDKNILAMLEKEDLVGIEL"
FT   gene            376127..376663
FT                   /locus_tag="EUBELI_00350"
FT   CDS_pept        376127..376663
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00350"
FT                   /product="phosphoglycerate mutase"
FT                   /note="Psort-B: Cytoplasmic, score:8.87; COG0406
FT                   Fructose-2,6-bisphosphatase; HMMPfam:IPR013078; K01834
FT                   phosphoglycerate mutase"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00350"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71386"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z2Y1"
FT                   /protein_id="ACR71386.1"
FT                   /translation="MGIVYFTRHGQTVWNVENKICGATDSPLTELGHEQAVELGKRILS
FT                   EGIHIDEILYSPLIRAKATALHVSEITGIPAREEIRLKEQNFGKYESTPRDGEEFAKAK
FT                   CNFICSFDGGETMLHLAQRIYNLIDDIKAQPDKTYLLVAHNGIARMVKSYFEDMGNEEF
FT                   SAFKIKNCEILKFEF"
FT   gene            377167..378651
FT                   /locus_tag="EUBELI_00351"
FT   CDS_pept        377167..378651
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00351"
FT                   /product="Hypothetical protein"
FT                   /note="Psort-B: Unknown cell location; COG3210 Large
FT                   exoproteins involved in heme utilization or adhesion"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00351"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71387"
FT                   /db_xref="GOA:C4Z2Y2"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z2Y2"
FT                   /protein_id="ACR71387.1"
FT                   /translation="MRYNQTAKDANISEERGIKMFNKSIIKKAAAIAAVILAVTALPTN
FT                   MTKADTQTSGSTVSQTTSEYTEIRTASELVEAAKSASGNYKLMTDIDMTGVEWTPWDFS
FT                   GTFDGNGHSILNLSVKTVSKKTMKTYDGNRKEYKTYGAGFFGVLTGAKVTGLDIYGARI
FT                   EITTTEPCFAAPIAGLADDSDISDCIIKDTYVSLTDSAKMWGTGGIAGFGSGNLDNITT
FT                   DVTLVCVDTDAAVRDEQFMGGAYAAGFLNIRNCSITIDGYDSDHGYVHDGGLVGMYMVY
FT                   PLELSKTYQGEVLNNKVKGMITFFEDNTDRRAYCQANMGEVMNWTYAYSGFTSDFKRNE
FT                   TYDYSVTLLPEMCSNPSYTDVVTEATASDFGYTTHTCSTCGYTYSDTYTIHEHKVDSYS
FT                   VVKEAASTDKKDGIEAGTCSLCNQTVYREYAANVVTDDNTQATDNKASGTAVKKGMKES
FT                   TAVFAVILVVIVIVIIITVVMMVQNNKRKRRYNRRR"
FT   gene            378664..379995
FT                   /locus_tag="EUBELI_00352"
FT   CDS_pept        378664..379995
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00352"
FT                   /product="aminopeptidase"
FT                   /note="Psort-B: Cytoplasmic, score:8.87; COG1362 Aspartyl
FT                   aminopeptidase; HMMPfam:IPR001948; K01269 aminopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00352"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71388"
FT                   /db_xref="GOA:C4Z2Y3"
FT                   /db_xref="InterPro:IPR001948"
FT                   /db_xref="InterPro:IPR023358"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z2Y3"
FT                   /protein_id="ACR71388.1"
FT                   /translation="MEENTFINVSKDMMSFIEKSPTAFHVTANFMDLLDDAGFVRLNER
FT                   DRWHLISGGKYYATRNDSSIIAFRMPATEGFANYQIAAAHSDSPSFKVKENPELTPDKN
FT                   YVSLNVEKYGGMLMAPWFDRPLSVAGRAIVREGAVLKPVLVNVDRDLCIIPNLAIHMNR
FT                   EANTGLNYNAQKDMIPLIGEAESKGLFDSIIADAAQTDKESVISSDLFLYNRQAGTIWG
FT                   ADNEFISAPRLDDVMCAYSCMNALIDSDESNQESVAVCAVFDNEEVGSSTKQGADSTFL
FT                   SDVLMRIAACAGKDNEDYIRACAGSFMLSADNAHAVHPNYQEKADPTNRPHMNKGIVIK
FT                   YNANQKYTTDAVSAAIFKEICTRAGVPTQEFANRSDIPGGSTLGNIANCHVSMNTVDIG
FT                   LAQLAMHSPYETAGIMDTEYMIKAVKEFFETAIVTNSNGTFTLE"
FT   gene            380030..381031
FT                   /locus_tag="EUBELI_00353"
FT   CDS_pept        380030..381031
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00353"
FT                   /product="tRNA-dihydrouridine synthase C"
FT                   /note="Psort-B: Cytoplasmic, score:8.87; COG0042
FT                   tRNA-dihydrouridine synthase; HMMPfam:IPR001269;
FT                   Gene3D:IPR013785; HMMPIR:IPR001269; HMMPanther:IPR001269;
FT                   ScanRegExp:IPR001269; K05541 tRNA-dihydrouridine synthase
FT                   C"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00353"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71389"
FT                   /db_xref="GOA:C4Z2Y4"
FT                   /db_xref="InterPro:IPR001269"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018517"
FT                   /db_xref="InterPro:IPR035587"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z2Y4"
FT                   /protein_id="ACR71389.1"
FT                   /translation="MAPMEGLTDFTYRNAYEKTFGKGRITKYFTPFISPNKSENFLARE
FT                   IRDIDRGHNKDTYTVVQVMTNEAKDFIWTAKMLYEKYGYSEINLNAGCPSGTVVSKDKG
FT                   SGMLRDTEKLDRFLDEVFEDAFIRENIKVSVKTRIGVEDDDSFPQIMEVYNSYPLEELI
FT                   VHPRVRTDYYRNELHLDAFRYAVDNSRNKLVLNGDIFTRKNFLEMKEMFPEVDTFMLGR
FT                   GLIADPGLINVLTDDNPQAMVRDLNADKKLMKELHDLVYAARTAIMPGDTHAIHRMKEM
FT                   WCYMEYVFDDCKKEIKAIKKSQRMADYKAAVDVFFNKAMLVERKNIIFSKKF"
FT   gene            complement(381054..381818)
FT                   /locus_tag="EUBELI_00354"
FT   CDS_pept        complement(381054..381818)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00354"
FT                   /product="Hypothetical protein"
FT                   /note="Psort-B: Cytoplasmic, score:9.65; COG0300
FT                   Short-chain dehydrogenases of various substrate
FT                   specificities; HMMPfam:IPR002198; HMMPanther:IPR002198"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00354"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71390"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z2Y5"
FT                   /protein_id="ACR71390.1"
FT                   /translation="MKLACITGASSGIGKEFAYLLSDLEYDLILVGRNTDALHEIANNV
FT                   AVRCKCITCDLSDEKSCVKLGRKLRQYPLDIMINNAGFGELGEFTETKLKNDINMINVN
FT                   IKAVHILTKAVLPGFIQRDRGYIMNVASSAGLLPGGPYMSTYYATKAYVTSLTTAIHGE
FT                   LRDLKSNVHISMLCPGPVDTNFNNVANVKFALSGIPADYCAYYALCKMFTGKLTIIPTF
FT                   TMKAGVFGSRFLPRQVLAFMTGHQQKKKTDNI"
FT   gene            382455..383006
FT                   /locus_tag="EUBELI_00355"
FT   CDS_pept        382455..383006
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00355"
FT                   /product="Hypothetical protein"
FT                   /note="Psort-B: Unknown cell location"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00355"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71391"
FT                   /db_xref="GOA:C4Z2Y6"
FT                   /db_xref="InterPro:IPR025588"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z2Y6"
FT                   /protein_id="ACR71391.1"
FT                   /translation="MTIKNETAFTKECMEGAMRASNFDNSRYKTFKLIYNMFGLIFGMM
FT                   MIRELVLKMTGNEQADTFMIVLFGLVAVVFLYIGMVGMDKSNKKKFYNIYGKMVGIKFS
FT                   YEIDAENIIITDEENDSDTFSWNDIVKWNQDPDNIYLFVGDDNCLVVGKKGFTQGSADD
FT                   LRQLADAVIGMRNETENSQQ"
FT   gene            383058..384461
FT                   /locus_tag="EUBELI_00356"
FT   CDS_pept        383058..384461
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00356"
FT                   /product="2-methylcitrate synthase"
FT                   /note="Psort-B: Cytoplasmic, score:9.98; COG0372 Citrate
FT                   synthase; HMMPfam:IPR002020; HMMPanther:IPR002020;
FT                   ScanRegExp:IPR013838; K01659 2-methylcitrate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00356"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71392"
FT                   /db_xref="GOA:C4Z2Y7"
FT                   /db_xref="InterPro:IPR002020"
FT                   /db_xref="InterPro:IPR016142"
FT                   /db_xref="InterPro:IPR016143"
FT                   /db_xref="InterPro:IPR024176"
FT                   /db_xref="InterPro:IPR036969"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z2Y7"
FT                   /protein_id="ACR71392.1"
FT                   /translation="MREIIRRRKAMNNQEMMELSTVDKSDFEELVKECTASGIIDQNLY
FT                   TEYDVKRGLRDSNGNGVLTGLTEISDVLGNQSVHGRKIPVDGELYFQGYNVEELIKRSS
FT                   LDRFRFEEATYLLLFGVLPDKDQLDRFIRILTDLQELSGAFIRDVIMKATSTNLMNSLM
FT                   KSILSLYSYDEKPDDISIPNVLRQSLQLIAKMPLLSVYAYQSYRHFKLDGTLMIKNPKK
FT                   GYSTAENILYMLRDDGDFTELEAKVLDICLVLHAEHGGGNNSTFTTHVVTSSGTDTYSA
FT                   IASSIASLKGPKHGGANLKVQEMFTDIKAHCSDWDNKDEICTYLNKILDKEAFDHAGLI
FT                   YGMGHAVYTNSDPRAVILKKFAKQLSEEKGMQKEFALYELVESEAGQLIMNKRKMFKPV
FT                   CANVDFYSGFVYTMLGIPEEMFTPMFATSRISGWCAHRLEELVNAGKIIRPAYKYVGHH
FT                   RPYVDMDER"
FT   gene            384487..385782
FT                   /locus_tag="EUBELI_00357"
FT   CDS_pept        384487..385782
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00357"
FT                   /product="3-phosphoshikimate 1-carboxyvinyltransferase"
FT                   /note="Psort-B: Unknown cell location; COG0128
FT                   5-enolpyruvylshikimate-3-phosphate synthase;
FT                   HMMPfam:IPR001986; BlastProDom:IPR001986; Gene3D:IPR001986;
FT                   HMMTigr:IPR006264; ScanRegExp:IPR003006;
FT                   superfamily:IPR013792; K00800 3-phosphoshikimate
FT                   1-carboxyvinyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00357"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71393"
FT                   /db_xref="GOA:C4Z2Y8"
FT                   /db_xref="InterPro:IPR001986"
FT                   /db_xref="InterPro:IPR006264"
FT                   /db_xref="InterPro:IPR013792"
FT                   /db_xref="InterPro:IPR036968"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z2Y8"
FT                   /protein_id="ACR71393.1"
FT                   /translation="MSQYKVKKLDHPIHCTVEVPGSKSITNRALLMAALSQGECTLKGV
FT                   LFSDDSRHFLLSLIALGYIIEVNEVERYVIIHGHGRDIPKKRATINVGSAGTAARFLTA
FT                   MLALSDGEYTIEASEQMKKRPMLPLFEALQSMGAEIEFLEKDGHLPVNVKGAAYGGKKP
FT                   QNHVSISISESTQFLSALMMTSPMLEEGIHVHITSNKTEGSYVRITAKMMEQFGCVVDH
FT                   KGAEYVVPAGSGYYPQTYYIEPDVSAACYFYAAAALIGGTAIVKGVHSNSMQGDLKFID
FT                   VLKQMGCAVTEEREGICVSGPKDGEYCGVDVDMNDFSDQSMTLAAIAPFAKTTTVIKNI
FT                   EHIRLQESDRIEAMVNELNNLGVDVKEGRDRIEISPANVKPGVVDTYNDHRMAMSFALI
FT                   GLRVDGIIIDNYECCCKTFENYFEVLEKACAQ"
FT   gene            385779..386960
FT                   /locus_tag="EUBELI_00358"
FT   CDS_pept        385779..386960
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00358"
FT                   /product="spore maturation protein CgeB"
FT                   /note="Psort-B: Cytoplasmic, score:8.87; COG4641
FT                   Uncharacterized protein conserved in bacteria; K06320 spore
FT                   maturation protein CgeB"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00358"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71394"
FT                   /db_xref="InterPro:IPR024542"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z2Y9"
FT                   /protein_id="ACR71394.1"
FT                   /translation="MRILLYRWKVFNQDDVKSAIEYFGHEVHDYTETVIDKDDETGFKL
FT                   RDYEELRQVFSAYDCIFSLNYFPHVSDLCEELGKKYIAWTVDSPLISLYHQSLFNKCNY
FT                   IFIFDRFYCEELKNLGAEHVWYLPLAVNCSRVGKITGSLTADERNKWHSEVSFVGGMYH
FT                   RNSYDEIKDRLPEYLRGYFDAAMAAQMEIYGDSIFDKVLTVDILEKLCELIDFKQDERA
FT                   FSDIALVFSSTFLGFKLANIERVQILNKLAKHFPTDLYTDDPDKELIGVNLKGAVNYMT
FT                   DMPKVFNCSRININPVMRNIRTGIPLRAWDIVGAGGFLMTSFQLEYMDFFENGKDYVYY
FT                   ESHDDLLRKTEYYLNHEDERAQIARNGHEKAEKFHSYEKRMEFILDKCGMLKH"
FT   gene            387098..387991
FT                   /locus_tag="EUBELI_00359"
FT   CDS_pept        387098..387991
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00359"
FT                   /product="Hypothetical protein"
FT                   /note="Psort-B: CytoplasmicMembrane, score:9.99"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00359"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71395"
FT                   /db_xref="GOA:C4Z2Z0"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z2Z0"
FT                   /protein_id="ACR71395.1"
FT                   /translation="MSFCKYCGRQLQDGEVCTCQQAQQPAGAAQPQQEFNQQAAQQPAG
FT                   AAQQTFQQGAGQQTYQQAQQGFNQQQASQQMDAVKKAGANAALDYVNVLKGLFTSPVET
FT                   VSAFVAKANVIMIAILIGGQAIINMLTRLFDMLIANSKAKVTTGSKELDSLLSSYYSSY
FT                   TNTKPYPAGSIFKNMLLEILLVAVAAAVIALVVMLLAKAFNKANVTYMQGLAVYAITAV
FT                   LGIPAELLSWVTGLTSVGFIDRISSCVTVFSNVAGYAFVYIAIRALCKDEKKIPLIMAI
FT                   SYVAVNFLTWVLRLMF"
FT   gene            complement(388072..389505)
FT                   /locus_tag="EUBELI_00360"
FT   CDS_pept        complement(388072..389505)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00360"
FT                   /product="Hypothetical protein"
FT                   /note="Psort-B: Unknown cell location; COG1680
FT                   Beta-lactamase class C and other penicillin binding
FT                   proteins; HMMPfam:IPR001466; superfamily:IPR012338"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00360"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71396"
FT                   /db_xref="InterPro:IPR001466"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z2Z1"
FT                   /protein_id="ACR71396.1"
FT                   /translation="MLDFEKVIPEEVGISSTGLISFARKLECNNLPMHSIIVMRHGKIC
FT                   MESYYAPYTKDTLHRMFSVTKSFVSLAIGLLADEGRISLDDHIADYFPEKQPETGVHPY
FT                   MQMLTIRQMLTMRTCHDVNAYKIGGSPDWVGSFFTVTPDHVPGTNFSYDTASTHTLGAL
FT                   VEKLTGMELLDYLRTKFLDELGFSKEAFILKSPDGKVSMGGSGMCATPQDILKVMYIVS
FT                   QNGKLDGKQLLPSGYLKEATVKHSDPYGKSGSWEEMQGYGYQIWMTTHNGYAFFGMGGQ
FT                   LAVYYPDKDVILVTTADAQGRQGGVQLIYDTFYEEVYSHIDTCTDNSDYEEFQKFENSR
FT                   QLLVQPGEYSSDLVSKINGQNYEFGTNPCGVTDIKLTFNGDEGTFFYTNATGNHELHFG
FT                   LGKNVFQNFPDYNFKCGASAAFRADNNLLIKVQIIDSSVGNMYISLSYIDDYVTVMMRK
FT                   LEESYFNEYDGVFSGKLKN"
FT   gene            389639..390835
FT                   /locus_tag="EUBELI_00361"
FT   CDS_pept        389639..390835
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00361"
FT                   /product="Hypothetical protein"
FT                   /note="Psort-B: CytoplasmicMembrane, score:7.63; COG0053
FT                   Predicted Co/Zn/Cd cation transporters; HMMPfam:IPR002524;
FT                   HMMPanther:IPR002524; HMMTigr:IPR002524"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00361"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71397"
FT                   /db_xref="GOA:C4Z2Z2"
FT                   /db_xref="InterPro:IPR002524"
FT                   /db_xref="InterPro:IPR027469"
FT                   /db_xref="InterPro:IPR027470"
FT                   /db_xref="InterPro:IPR036837"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z2Z2"
FT                   /protein_id="ACR71397.1"
FT                   /translation="MPESMKEKEMIDLLLKRFVKDYDKTKNPEVRTRYGVFAGIVGIIC
FT                   NLILFLAKILAGVLTASVSIMADAVNNLSDAGSSIVTLIGFKLAGKPADYEHPYGHGRI
FT                   EYISGFIVSGAIIIMGFELMTTSFRKILHPTPLEVSVPSIIILVLSILMKMWMAKFNKY
FT                   LGNKVDSAAMKATATDSLSDCVATSVVLIGVLLTLFSDINIDGIAGVVVAVFVILAGFG
FT                   AAKDTLQPLLGQPPTKEFVQELENIVLQDKHIIGVHDLIVHNYGPGRVYASLHAEVPAN
FT                   MDMMEAHDYIDMAERRVEKRMKCFISIHMDPVVTDDEVINHLRKMTIAVVKSVGEELDI
FT                   HDFRTVKGPYITNLIFDVLVPYNYHLSDDEIKKQIQKKITEKQSECHAVINIDKSYTG"
FT   gene            complement(390836..391564)
FT                   /locus_tag="EUBELI_00362"
FT   CDS_pept        complement(390836..391564)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00362"
FT                   /product="3-oxoacyl-[acyl-carrier protein] reductase"
FT                   /note="Psort-B: Cytoplasmic, score:9.98; COG1028
FT                   Dehydrogenases with different specificities (related to
FT                   short-chain alcohol dehydrogenases); HMMPfam:IPR002198;
FT                   HMMPanther:IPR002198; ScanRegExp:IPR002198; K00059
FT                   3-oxoacyl-[acyl-carrier protein] reductase"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00362"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71398"
FT                   /db_xref="GOA:C4Z2Z3"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z2Z3"
FT                   /protein_id="ACR71398.1"
FT                   /translation="MKKTIVITGASRGIGRAIAIELAGKDTNIVINCVNNVDKLNEVKS
FT                   IIEEKGSECETFAGDMGNYSDVQKMFDMCLQRFGQVDVLINNAGISVVGLFQDMSEDEW
FT                   HRICNTNIDSVFNCCHFAVKDMMKRHCGKIINISSVWGLYGASCEVAYSATKGAVNSFT
FT                   RALAKELAPSGIQVNAVACGAIDTEMNGHLSDDDKAELAEEIPAGRFGAPQEVAELVKS
FT                   LSGINNYLTGQIITLDGGWI"
FT   gene            392183..392710
FT                   /locus_tag="EUBELI_00363"
FT   CDS_pept        392183..392710
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00363"
FT                   /product="putative sigma-54 modulation protein"
FT                   /note="Psort-B: Unknown cell location; COG1544
FT                   Ribosome-associated protein Y (PSrp-1); HMMPfam:IPR003489;
FT                   HMMTigr:IPR003489; K05808 putative sigma-54 modulation
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00363"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71399"
FT                   /db_xref="GOA:C4Z2Z4"
FT                   /db_xref="InterPro:IPR003489"
FT                   /db_xref="InterPro:IPR032528"
FT                   /db_xref="InterPro:IPR034694"
FT                   /db_xref="InterPro:IPR036567"
FT                   /db_xref="InterPro:IPR038416"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z2Z4"
FT                   /protein_id="ACR71399.1"
FT                   /translation="MRFIITGRNIDITEGLKSAVEEKLGKLDRFFAPETEVNVTLSVEK
FT                   ERQKIEVTIPVKGNIIRSEQVSSDMYVSIDLVEEVIERQLKKYKNKIVDKQQNAAAFAQ
FT                   EFVEKDYDDDEVKIIRTKRFGIKPMDPEEACVQMELLGHNFYVFFNSETEEVNVVYKRK
FT                   GNTYGLIEPELD"
FT   gene            392836..395472
FT                   /locus_tag="EUBELI_00364"
FT   CDS_pept        392836..395472
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00364"
FT                   /product="preprotein translocase SecA subunit"
FT                   /note="Psort-B: Cytoplasmic, score:8.87; COG0653 Preprotein
FT                   translocase subunit SecA (ATPase, RNA helicase);
FT                   HMMPfam:IPR001650; HMMPfam:IPR004027; HMMPfam:IPR011115;
FT                   HMMPfam:IPR011116; HMMPfam:IPR011130; HMMTigr:IPR000185;
FT                   ScanRegExp:IPR000185; K03070 preprotein translocase SecA
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00364"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71400"
FT                   /db_xref="GOA:C4Z2Z5"
FT                   /db_xref="InterPro:IPR000185"
FT                   /db_xref="InterPro:IPR004027"
FT                   /db_xref="InterPro:IPR011115"
FT                   /db_xref="InterPro:IPR011116"
FT                   /db_xref="InterPro:IPR011130"
FT                   /db_xref="InterPro:IPR014018"
FT                   /db_xref="InterPro:IPR020937"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036266"
FT                   /db_xref="InterPro:IPR036670"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z2Z5"
FT                   /protein_id="ACR71400.1"
FT                   /translation="MIECLNSDTITTQIGFYKEKYKVMGLAQKLFGTHSEHELKRIYPI
FT                   ADKIESYKESYGKLSDEELKAKTKEFKDRLAKGETLDDILPEAFATVREAGKRVLGMEH
FT                   YHVQLIGGIILHQGRIAEMKTGEGKTLVCTLPAYLNALTEEGVIVVTVNDYLAKRDAEQ
FT                   MGMIHEFLGLKVGVVLHDSTREERQAAYACDITYVTNNELGFDYLRDNMAIYKNELVLR
FT                   NLKYCIIDEVDSVLIDEARTPLIISGQSGKSTKLYELCDILARQLQRGEYKGERTKMQA
FT                   IMNEEVEEDGDFIVNEKDKVVNLTEQGIHKVEQFFHIDNYADPENLEIQHNVTLALRAH
FT                   NLMFRDKDYVVKDDEVLIVDEFTGRIMPGRRYSDGLHQAIEAKEHVKVKRESKTLATIT
FT                   FQNFFNKFEKKAGMTGTALTEEKEFREIYNMDVVEVPTNKPVIRVDNNDAVFKTKKGKF
FT                   NAVVQSVIESHEKGQPVLVGTITIETSEMLSEMLRKKGIPHNVLNAKFHELEAQIVSEA
FT                   GRHGAVTIATNMAGRGTDIKLDDEAVAAGGLKIIGTERHESRRIDNQLRGRSGRQGDPG
FT                   ESRFYISLEDDLMRLFAQERLMNIFNSLGVSEDEQIEHKMLSKAIETAQKKIETNNFGI
FT                   RSHLLEYDQVMNEQREIMYAERRRVLDGESMRNSIMKMITDYVENVVNRCVGEDKDANE
FT                   WDYNEINELLLPTIPIEKVVYRENIRNKNELIHDLKEKAVKLYEDKEALFPESEQIREI
FT                   ERVILLKVIDRKWMDHIDDMDQLKQGIGLQALGQRDPVVQYKMMGYDMFDEMTAGIAED
FT                   TIRLLMHIQVEQKIEREQVAKVTGTNKDEGPSVKGPARRTEKKIYPNDPCPCGSGKKYK
FT                   NCCGRQA"
FT   gene            395545..396663
FT                   /locus_tag="EUBELI_00365"
FT   CDS_pept        395545..396663
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00365"
FT                   /product="peptide chain release factor RF-2"
FT                   /note="Psort-B: Cytoplasmic, score:9.98; COG1186 Protein
FT                   chain release factor B; HMMPfam:IPR000352;
FT                   HMMPfam:IPR005139; HMMPanther:IPR004374; HMMTigr:IPR004374;
FT                   ScanRegExp:IPR000352; K02836 peptide chain release factor
FT                   RF-2"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00365"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71401"
FT                   /db_xref="GOA:C4Z2Z6"
FT                   /db_xref="InterPro:IPR000352"
FT                   /db_xref="InterPro:IPR004374"
FT                   /db_xref="InterPro:IPR005139"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z2Z6"
FT                   /protein_id="ACR71401.1"
FT                   /translation="MVELDQFRYRISGYDKPMAQIKKSLDLDNKQKRIEELEADMEAPG
FT                   FWDNPDKSQNAMKELKGLKDAFERYNELETGLDDVKTLIEMAEESNDQSLIPEIEEEIT
FT                   NLEDKMESLRIETLLSGEHDACDAILTLHAGAGGTESCDWCQMLFRMYTRWAESHGYTT
FT                   ETLDYLEGEEAGIKSVTIEIRGENAYGHLKSEHGVHRLVRISPFNAAGKRQTSFVSCDV
FT                   MPDINQDIDIEINDDDLRIDTYRSSGAGGQHINKTSSAIRITHLPTGIVVQCQNERSQH
FT                   QNKDKAMQMLKAKLYLLKEAENAENLSGIRGDVKDINFGSQIRSYVLQPYTMVKDNRTN
FT                   KEVANAGSVLDGNIDPFINAYLTWISTGKTEE"
FT   gene            396713..397213
FT                   /locus_tag="EUBELI_00366"
FT   CDS_pept        396713..397213
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00366"
FT                   /product="purine-binding chemotaxis protein CheW"
FT                   /note="Psort-B: Cytoplasmic, score:9.98; COG0835 Chemotaxis
FT                   signal transduction protein; HMMPfam:IPR002545;
FT                   HMMSmart:IPR002545; superfamily:IPR002545; K03408
FT                   purine-binding chemotaxis protein CheW"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00366"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71402"
FT                   /db_xref="GOA:C4Z2Z7"
FT                   /db_xref="InterPro:IPR002545"
FT                   /db_xref="InterPro:IPR036061"
FT                   /db_xref="InterPro:IPR039315"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z2Z7"
FT                   /protein_id="ACR71402.1"
FT                   /translation="MADYIKPVIFRLGNQQFGVDINLVQSIEREINIVRVPNAMEYISG
FT                   IVNLRGEVIPAFSLRKKFGTDDAVGSIGEDSTIIVNIPGVVKLALEVDDVLEIGDIDAN
FT                   GIVPMPALARTDDTAYLDRVANVNGELVILLDVEKLLTQSEAESVKKFTEEMSNDNGGA
FT                   ANG"
FT   gene            397206..398822
FT                   /locus_tag="EUBELI_00367"
FT   CDS_pept        397206..398822
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00367"
FT                   /product="Glycoside Hydrolase Family 77 candidate
FT                   4-a-glucanotransferase"
FT                   /note="Psort-B: Cytoplasmic, score:9.98; COG1640
FT                   4-alpha-glucanotransferase; HMMPfam:IPR003385;
FT                   Gene3D:IPR013781; HMMTigr:IPR003385; K00705
FT                   4-alpha-glucanotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00367"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71403"
FT                   /db_xref="GOA:C4Z2Z8"
FT                   /db_xref="InterPro:IPR003385"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z2Z8"
FT                   /protein_id="ACR71403.1"
FT                   /translation="MAETKFKRNAGILMPVSSLPSPYGIGTFGKDAYDFVTFVKECNHK
FT                   YWQVLPLGPTTYGDSPYQSYSAFAGNPYFVDLDMLIEEGFLLKSEVISRDWGDGIVPVN
FT                   VSEDDAVNGRFGTYRDGNIGDERYVSYEKIYNNRFDILRIAYDRFRDACAESKKTLAKG
FT                   LPLYKQFDNFVKDNADWLEDYALFMALKSHFNNVSWGEWETDIKFRKPEAMSQYEEQLS
FT                   DDIGYWKFIQFEFYRQWNALKQYANSNGIEIIGDIPIYMGYDSVDVWANQGEFQLDENL
FT                   TPIKVAGVPPDAFSDAGQKWGNPLYDYDKMEANGFSWWRKRMAASAKLYDVIRIDHFIG
FT                   IVKYYTIPSDMPDARQGEYRQGPGQKLLDVINESIGDKKIIAEDLGVEVPEVAKILKEN
FT                   GYPGMKVLEFAFGGDRKNPHLPYNYKQNLVCYGGTHDNETLLGFFEDRGDWELGYAYDY
FT                   LDTRDKGRMVDQVFRAAYSSVAVLTVFAVQDILKLGNWARMNLPSSMGNNWKWRMQKGQ
FT                   LGQHELECMRYLASVFDRERK"
FT   gene            399108..399905
FT                   /locus_tag="EUBELI_00368"
FT   CDS_pept        399108..399905
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00368"
FT                   /product="Hypothetical protein"
FT                   /note="Psort-B: Unknown cell location; COG2340
FT                   Uncharacterized protein with SCP/PR1 domains;
FT                   HMMPfam:IPR014044"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00368"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71404"
FT                   /db_xref="InterPro:IPR014044"
FT                   /db_xref="InterPro:IPR035940"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z2Z9"
FT                   /protein_id="ACR71404.1"
FT                   /translation="MDMKRNNSKKWIKNVTIATAVLVFGIGVGFAAKVAGTPNSDNDGA
FT                   KTIVAAANDATDSVVKETIAQKETETDTETAAIEATTEVTTEEATEAVTEQSSTIAETQ
FT                   PQTETATEAVQVTEHTEAATKAPVPVVQTPSDERVAQVISGINAERAAAGVSAVTYDAI
FT                   LTDMAQVRASENAVNDYFVIENGKHKRPDGRNASSICSDFGQAGYFGEVMGRYQTSPVE
FT                   IVNGWHNSATHYACMTSTKYSRVGVGVAADSEGYLYWVAIFMD"
FT   gene            400314..400763
FT                   /locus_tag="EUBELI_00369"
FT   CDS_pept        400314..400763
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00369"
FT                   /product="chorismate mutase"
FT                   /note="Psort-B: Unknown cell location; COG4492 ACT
FT                   domain-containing protein; HMMPfam:IPR002912;
FT                   HMMPIR:IPR008310; K06209 chorismate mutase"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00369"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71405"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR008310"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z300"
FT                   /protein_id="ACR71405.1"
FT                   /translation="MADNIKYYVVKQKALPEVLLKVAETNRIIETENISVADATEKVGI
FT                   SRSSYYKYKDDIFPFRENVKGKTITFVLSMDDEPGLLSLVLKKVAEFKANILTIHQTIP
FT                   VNGIASLTLSVDILPTTGDSSEMIEQIERLKGVRYLKILSSDASI"
FT   gene            400796..402013
FT                   /locus_tag="EUBELI_00370"
FT   CDS_pept        400796..402013
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00370"
FT                   /product="homoserine dehydrogenase"
FT                   /note="Psort-B: Cytoplasmic, score:8.87; COG0460 Homoserine
FT                   dehydrogenase; HMMPfam:IPR001342; HMMPfam:IPR005106;
FT                   ScanRegExp:IPR001342; K00003 homoserine dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00370"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71406"
FT                   /db_xref="GOA:C4Z301"
FT                   /db_xref="InterPro:IPR001342"
FT                   /db_xref="InterPro:IPR005106"
FT                   /db_xref="InterPro:IPR016204"
FT                   /db_xref="InterPro:IPR019811"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z301"
FT                   /protein_id="ACR71406.1"
FT                   /translation="MAKIAVLGYGTVGSGVVEVLNTNGASIAKRAGDTIEVKSVLDLRD
FT                   FPGDPIQDKIVHDIDLIINDPEIEVVVEVMGGVEPAFTFVKKALEAGKSVCTSNKALVA
FT                   AHGPELLEMAKERKLNFMFEASVGGGIPIIRPLNQSLTADEITKITGILNGTTNYILTK
FT                   MSREGISYQEVLKEAQALGYAERNPEADVEGYDACRKIAILTSLAFGNTVKFEEVYTEG
FT                   ITKISNEDFAYAKELGCVIKLLATSYSKDGKVYAITAPFMIDSTHPLYNVNDVLNGIYV
FT                   HGNVLGDVMFFGAGAGKLPTASAVVSDVVDCVKHKGKNVMTIWSSVKQELGDTFDETRR
FT                   FFVRIKGDDVQAAKAAFGEGQVVKVDGINGEFGFVTEPMTERAFEDAKDKVSVISRIRI
FT                   DDTKLQ"
FT   gene            402035..403351
FT                   /locus_tag="EUBELI_00371"
FT   CDS_pept        402035..403351
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00371"
FT                   /product="aspartate kinase"
FT                   /note="Psort-B: Unknown cell location; COG0527
FT                   Aspartokinases; HMMPfam:IPR001048; HMMPfam:IPR002912;
FT                   Gene3D:IPR001048; HMMTigr:IPR001341; ScanRegExp:IPR001341;
FT                   superfamily:IPR001048; K00928 aspartate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00371"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71407"
FT                   /db_xref="GOA:C4Z302"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001341"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR005260"
FT                   /db_xref="InterPro:IPR018042"
FT                   /db_xref="InterPro:IPR027795"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z302"
FT                   /protein_id="ACR71407.1"
FT                   /translation="MVKVVKFGGSSLASAEQFKKVGNIIRADEDRKYVVPSAPGKRFPE
FT                   DTKVTDMLYKCYAEAEAGKNIEKSLKAIEERYNEIIKGLGLKLSLKEQFETIKKNFEAL
FT                   AGKDYAASRGEYLNGIIMANYLGYEFIDAATVICFDKDGEFDSEKTNEVCEAKFANIVR
FT                   AVVPGFYGAMPNGKVKTFSRGGSDVTGSIVARALKADMYENWTDVSGFLAADPRIVNNA
FT                   KPINVITYKELRELSYMGASVLHESAIFPVRKGGIPINIKNTNAPEDKGTMIVETTCNM
FT                   PEYTITGIAGKKGFVAISIDKDMMNSEIGFCRKVLSVFEDNGISIEHMPSGIDTMTVFV
FT                   HQDEFVEKEQKVLAQIHKAVNPDSVELEANLALIAVVGRGMKNSTGIAGNIFSALAKAK
FT                   INVKMIDQGSSELNIIIGVRNRYFEDAIKTIYGVFVPEE"
FT   gene            403355..403846
FT                   /locus_tag="EUBELI_00372"
FT   CDS_pept        403355..403846
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00372"
FT                   /product="Hypothetical protein"
FT                   /note="Psort-B: CytoplasmicMembrane, score:9.99; NOG11098
FT                   non supervised orthologous group; ScanRegExp:IPR006052"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00372"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71408"
FT                   /db_xref="GOA:C4Z303"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z303"
FT                   /protein_id="ACR71408.1"
FT                   /translation="MNRGIWDMKEAKNELLQFVGGVIMLVVGLYILSQKVMVSSSYGFF
FT                   SLWGGRFSSGLIMVPLIIGVVWMFASGGSFVSKVFTVLSVILIIAAIVASTRIWLVTIT
FT                   MYEWVLILVLIFGGTGLVAKVLFANNKSEKSKKDKSEQTGGSYTSSVDDELDKMKKNMK
FT                   "
FT   gene            403962..406253
FT                   /locus_tag="EUBELI_00373"
FT   CDS_pept        403962..406253
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00373"
FT                   /product="Hypothetical protein"
FT                   /note="Psort-B: Cytoplasmic, score:8.87; COG2183
FT                   Transcriptional accessory protein; HMMPfam:IPR003029;
FT                   Gene3D:IPR012340; HMMSmart:IPR003029; HMMSmart:IPR006641"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00373"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71409"
FT                   /db_xref="GOA:C4Z304"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR006641"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018974"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR023319"
FT                   /db_xref="InterPro:IPR023323"
FT                   /db_xref="InterPro:IPR032639"
FT                   /db_xref="InterPro:IPR037027"
FT                   /db_xref="InterPro:IPR041692"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z304"
FT                   /protein_id="ACR71409.1"
FT                   /translation="MDIAKKIAEELEIKVTQVEAAVKLIDEGCTIPFIARYRKEVTGAL
FT                   NDEQLRNLDERLKYLRNLEDRKTQVLASIEEQGKLTEELKAAITAAETMVLVEDLYRPY
FT                   KQKRRTRATIAKEKGLEPLAQFIYAQEATEDVEVKAAEFISDEEGKEVATAQDAIAGAL
FT                   DIIAEQISDVADYRTYIRDITMKEGKLVVTAKDEKAESVYENYYDYSEALSTIPGHRIL
FT                   AINRGEDEKFLTVKVEAPEERILRYLEKNILKDNAFTEEYLKNCIADAYGRLIAPAIER
FT                   EIRSSLTETAEDGAIKVFGKNLEQLLLQPPIAGKVVLGWDPAFRTGCKLAVVDPTGKVL
FT                   ATKVIYPTEPHNKVAESKAEVKKLIDKYHVNLISCGNGTASRESEKIISDMIHEMNLPV
FT                   DYVITNEAGASVYSASKLATEEFPDFDVAQRSAVSIARRVQDPLAELVKIDPKSIGVGQ
FT                   YQHDMNQKKLENTLTGVVEDSVNKVGVDLNTASASLLEYISGISKAVAKNIVEYRETNG
FT                   RFTNRKQLLKVAKLGPKAFEQCAGFMRISGGDNPLDATSVHPESYEAATKLLALLGYDI
FT                   NSITSGELIGLKSKVEDFAKMADELGIGTMTLEDIVKELEKPGRDPRDEMPKPILRKDV
FT                   LDMKDLTPGMILKGTVRNVIDFGAFVDIGVHQDGLVHISQMSSTKRVEHPLDVVSVGDI
FT                   VDVRVIDVDIPKARISLSMILDEKEAANRKYTKDNSNNKNNRNNGKGNRQDRKPKKEGL
FT                   NLSGLAKFMH"
FT   gene            406266..406799
FT                   /locus_tag="EUBELI_00374"
FT   CDS_pept        406266..406799
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00374"
FT                   /product="Hypothetical protein"
FT                   /note="Psort-B: Unknown cell location"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00374"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71410"
FT                   /db_xref="GOA:C4Z305"
FT                   /db_xref="InterPro:IPR025588"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z305"
FT                   /protein_id="ACR71410.1"
FT                   /translation="MEDRIEFDSVITEKALNDFKMYHIFHNVGGVFGYVFAAFAIVMCV
FT                   LGVIFKMSPKYIVMMGLFGVFFFFYPIVNMRLGTKKQMKTVAAFKEPMHYSAGEDKIIV
FT                   SQGDMSEELAWEQIYKIRFTGSNLILYLSSVRANVLTVNSMGEAAVPFVKMCQKKLKSF
FT                   QVKVNMDKLAKAVA"
FT   gene            406819..407250
FT                   /locus_tag="EUBELI_00375"
FT   CDS_pept        406819..407250
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00375"
FT                   /product="Hypothetical protein"
FT                   /note="Psort-B: Cytoplasmic, score:8.87; COG0802 Predicted
FT                   ATPase or kinase; HMMPfam:IPR003442; HMMTigr:IPR003442"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00375"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71411"
FT                   /db_xref="GOA:C4Z306"
FT                   /db_xref="InterPro:IPR003442"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z306"
FT                   /protein_id="ACR71411.1"
FT                   /translation="MVKETFNAKETFEAGYEMGKKALPGQIYCLNGDLGVGKTVFTQGF
FT                   AKGLGIEEPVNSPTFTIIQEYHEGRLPLYHFDVYRIGDVEEMDELGYEEYFYSDGVCLI
FT                   EWSTLIQEIIPDNAIEIVIEKDLEKGFDYRKITIGQEAV"
FT   gene            407247..407948
FT                   /locus_tag="EUBELI_00376"
FT   CDS_pept        407247..407948
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00376"
FT                   /product="O-sialoglycoprotein endopeptidase"
FT                   /note="Psort-B: Cytoplasmic, score:8.87; COG1214 Inactive
FT                   homolog of metal-dependent proteases, putative molecular
FT                   chaperone; HMMPfam:IPR000905; K01409 O-sialoglycoprotein
FT                   endopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00376"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71412"
FT                   /db_xref="GOA:C4Z307"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR022496"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z307"
FT                   /protein_id="ACR71412.1"
FT                   /translation="MRILAIESSAVTASVAILEDDTLVVEYTINHKMTHSQTLLPMIDD
FT                   IFSMVQLKPDDVDVIAVSKGPGSFTGLRIGAATGKGIALALDKKMVAVPTLAAMAYNLY
FT                   GDSRYICPVMDARRKHLYSGIYTFDGDRLITVRDVNLESYDELAEELAGLDRQVVLVGD
FT                   GVDVAGDVLKEQLGDKCVLAPAHIKTQRAGSVALLAKQMADNGEYTDADELKPDYLRPS
FT                   QAEREKAQHES"
FT   gene            407938..408387
FT                   /locus_tag="EUBELI_00377"
FT   CDS_pept        407938..408387
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00377"
FT                   /product="ribosomal-protein-alanine N-acetyltransferase"
FT                   /note="Psort-B: Cytoplasmic, score:9.65; COG0456
FT                   Acetyltransferases; HMMPfam:IPR000182; HMMTigr:IPR006464;
FT                   K03789 ribosomal-protein-alanine N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00377"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71413"
FT                   /db_xref="GOA:C4Z308"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR006464"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z308"
FT                   /protein_id="ACR71413.1"
FT                   /translation="MSLKYVIRPMTEDDTFAVELIEQVIFSLPWSQKSFADACRNQDNV
FT                   YLVCEADGVIAGYCGMWTVLGEGNITNMAVSPDYRRCGIAQMLMQSMEKYGNDKNVTSY
FT                   FLEVRQSNLPAIALYEKMGYKNIGIRKRFYEKPVEDAVIMSKNIG"
FT   gene            408443..409357
FT                   /locus_tag="EUBELI_00378"
FT   CDS_pept        408443..409357
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00378"
FT                   /product="ribonuclease Z"
FT                   /note="Psort-B: Cytoplasmic, score:8.87; COG1234
FT                   Metal-dependent hydrolases of the beta-lactamase
FT                   superfamily III; HMMPfam:IPR001279; HMMTigr:IPR013471;
FT                   K00784 ribonuclease Z"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00378"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71414"
FT                   /db_xref="GOA:C4Z309"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR013471"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4Z309"
FT                   /protein_id="ACR71414.1"
FT                   /translation="MLDVCLLGTSGMLPLPGRWLTSLMTRYNGSSLMIDCGEGTQIAVK
FT                   QKGWSFNPIDVICFTHYHADHISGLPGLLLTIGNSDRKKPLTLVGPKGLGRVVSSLRVI
FT                   APELPFELKFIELTNQQEHLSICGYEIDAFRVNHAVICYGYSISIPRIGKFDVEKAKEL
FT                   GIPCSMWNKLQHGTAVTIDDKEYTPDMVMGAARKGLKVTYCTDSRPVQIISDNAKESDL
FT                   FICEGMYGEDGKEAKAKEYKHMTFTEAAQLAKNADVREMWLTHYSPSLVRPQDYVDKAR
FT                   KIFPATIAANDGRTVELKFDDEG"
FT   gene            409361..409948
FT                   /locus_tag="EUBELI_00379"
FT   CDS_pept        409361..409948
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00379"
FT                   /product="Hypothetical protein"
FT                   /note="Psort-B: Unknown cell location"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00379"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71415"
FT                   /db_xref="GOA:C4Z310"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z310"
FT                   /protein_id="ACR71415.1"
FT                   /translation="MKKYGRTIIVIAVLVALGLVYYYYLANKDTGKDATDIAADTSEVS
FT                   VLISKDIMANYPESPKDVVNLYARITKAYYDTSLTDEQIEALGKQARLMFDDELKNTQT
FT                   DADFYEKLKEDIGNYNSTKTRISSYAIQSAAKTKYSTFKDRQYASIALVYYLRQGDKLI
FT                   DSPTKFTLRKDDDGHWKILFWELTEISSDSEQ"
FT   gene            409932..410990
FT                   /locus_tag="EUBELI_00380"
FT   CDS_pept        409932..410990
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00380"
FT                   /product="O-sialoglycoprotein endopeptidase"
FT                   /note="Psort-B: Extracellular, score:8.10; COG0533
FT                   Metal-dependent proteases with possible chaperone activity;
FT                   HMMPfam:IPR000905; BlastProDom:IPR000905;
FT                   HMMPanther:IPR009180; HMMTigr:IPR000905; K01409
FT                   O-sialoglycoprotein endopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00380"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71416"
FT                   /db_xref="GOA:C4Z311"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR017861"
FT                   /db_xref="InterPro:IPR022450"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z311"
FT                   /protein_id="ACR71416.1"
FT                   /translation="MIQNNRRYKMSEKDDVLILAIESSCDETAAAVVKNGREVLSNVIN
FT                   TQIAIHTEYGGVVPEIASRKHIENINPVIRKALEDAGVTLDDIDAIGVTYGPGLVGALL
FT                   VGVAEAKAIAFAKNKPLVGVHHIEGHISANYVENKELEPPFVALVVSGGHTHLVKVNDY
FT                   GEYEIVGRTRDDAAGEAFDKVARAIGLGYPGGPKIDKLAKEGNPDAIEFPRAHVDDAPY
FT                   DFSFSGIKSAVLNYINSANMQGKEINRADVAASFQKAVVDALVSRAVRLAKECGMDKLA
FT                   IAGGVASNSALRAAIQEACAKNNIGFYSPSPILCTDNAAMIGAAAYYEYIKGVRHGYDL
FT                   NAVPNLKLGERI"
FT   gene            410990..411673
FT                   /locus_tag="EUBELI_00381"
FT   CDS_pept        410990..411673
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00381"
FT                   /product="2-C-methyl-D-erythritol 4-phosphate
FT                   cytidylyltransferase"
FT                   /note="Psort-B: Cytoplasmic, score:8.87; COG1211
FT                   4-diphosphocytidyl-2-methyl-D-erithritol synthase;
FT                   HMMPfam:IPR001228; HMMTigr:IPR001228; K00991
FT                   2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00381"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71417"
FT                   /db_xref="GOA:C4Z312"
FT                   /db_xref="InterPro:IPR001228"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR034683"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4Z312"
FT                   /protein_id="ACR71417.1"
FT                   /translation="MNTAIVLAGGSGKRMHSEIPKQYMQLNGKPVIYYSLKAFEESEHV
FT                   DEIILVTAKEYIEYVRNEIAGSQFAKLTKIIEGGKERFDSVWAGLQQISEKGYVYIHDG
FT                   ARPCINQNIINACWETVVQTDACVAAAPVKDTIKVADADEYAINTPDRKTLWQIQTPQV
FT                   FSADVIKEAYSRLYEQNCFDGVTDDAMVVERYGNSKIKLVNCGYCNIKITTPEDMEIAG
FT                   IFLKG"
FT   gene            411731..412435
FT                   /locus_tag="EUBELI_00382"
FT   CDS_pept        411731..412435
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00382"
FT                   /product="Hypothetical protein"
FT                   /note="Psort-B: CytoplasmicMembrane, score:9.26"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00382"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71418"
FT                   /db_xref="GOA:C4Z313"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z313"
FT                   /protein_id="ACR71418.1"
FT                   /translation="MKNFSVKNINFVGAGAALLAFIFTFIPFYKLQPTTYFLQNESTAA
FT                   LYTITKNLVTYNFFGVLCLILALAAIILYVWNGSEKITMAAIVVSVVDLISLFLALIVG
FT                   NSDIKDVKSLINALVQYSGTSANANLFLKSSVAAGFVLELLMILVMIGSYWINELVIKP
FT                   YVFGDKSGAKLNPFEGVTGTAKARAQAAPQGFIQQPVQGQAFGQAPQQPVQGQTFGQAP
FT                   QQPAQNQNNNAQ"
FT   gene            412675..412760
FT                   /locus_tag="EUBELI_00383"
FT   tRNA            412675..412760
FT                   /locus_tag="EUBELI_00383"
FT                   /product="tRNA-Ser"
FT   gene            412784..412981
FT                   /locus_tag="EUBELI_00384"
FT   CDS_pept        412784..412981
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00384"
FT                   /product="Hypothetical protein"
FT                   /note="Psort-B: Unknown cell location"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00384"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71419"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z314"
FT                   /protein_id="ACR71419.1"
FT                   /translation="MAFYLPEVFMSILHKKLMQVVLVKELDIQDIVILKKYDKKVKKFL
FT                   TNKNGNDILIKLSARKADNT"
FT   gene            413153..414672
FT                   /locus_tag="EUBELI_00385"
FT   rRNA            413153..414672
FT                   /locus_tag="EUBELI_00385"
FT                   /product="16S ribosomal RNA"
FT   gene            414841..414957
FT                   /locus_tag="EUBELI_00386"
FT   rRNA            414841..414957
FT                   /locus_tag="EUBELI_00386"
FT                   /product="5S ribosomal RNA"
FT   gene            414964..415037
FT                   /locus_tag="EUBELI_00387"
FT   tRNA            414964..415037
FT                   /locus_tag="EUBELI_00387"
FT                   /product="tRNA-Ile"
FT   gene            415131..415203
FT                   /locus_tag="EUBELI_00388"
FT   tRNA            415131..415203
FT                   /locus_tag="EUBELI_00388"
FT                   /product="tRNA-Ala"
FT   gene            415440..418324
FT                   /locus_tag="EUBELI_00389"
FT   rRNA            415440..418324
FT                   /locus_tag="EUBELI_00389"
FT                   /product="23S ribosomal RNA"
FT   gene            418435..418506
FT                   /locus_tag="EUBELI_00390"
FT   tRNA            418435..418506
FT                   /locus_tag="EUBELI_00390"
FT                   /product="tRNA-Asn"
FT   gene            418570..418641
FT                   /locus_tag="EUBELI_00391"
FT   tRNA            418570..418641
FT                   /locus_tag="EUBELI_00391"
FT                   /product="tRNA-Glu"
FT   gene            418672..418743
FT                   /locus_tag="EUBELI_00392"
FT   tRNA            418672..418743
FT                   /locus_tag="EUBELI_00392"
FT                   /product="tRNA-Thr"
FT   gene            418748..418821
FT                   /locus_tag="EUBELI_00393"
FT   tRNA            418748..418821
FT                   /locus_tag="EUBELI_00393"
FT                   /product="tRNA-Met"
FT   gene            418839..418912
FT                   /locus_tag="EUBELI_00394"
FT   tRNA            418839..418912
FT                   /locus_tag="EUBELI_00394"
FT                   /product="tRNA-Asp"
FT   gene            418952..419038
FT                   /locus_tag="EUBELI_00395"
FT   tRNA            418952..419038
FT                   /locus_tag="EUBELI_00395"
FT                   /product="tRNA-Leu"
FT   gene            419062..419135
FT                   /locus_tag="EUBELI_00396"
FT   tRNA            419062..419135
FT                   /locus_tag="EUBELI_00396"
FT                   /product="tRNA-Arg"
FT   gene            419280..419453
FT                   /locus_tag="EUBELI_00397"
FT   CDS_pept        419280..419453
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00397"
FT                   /product="Hypothetical protein"
FT                   /note="Psort-B: Extracellular, score:8.82; KOG1839
FT                   Uncharacterized protein CLU1/cluA/TIF31 involved in
FT                   mitochondrial morphology/distribution, also found
FT                   associated with eIF-3"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00397"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71420"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z3F1"
FT                   /protein_id="ACR71420.1"
FT                   /translation="MSKNTSKNSTNSKNSTNSSNSTNSRNSYNETDSTNSKNQSSKNSK
FT                   NKTSGSDESDCY"
FT   gene            419566..419904
FT                   /locus_tag="EUBELI_00398"
FT   CDS_pept        419566..419904
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00398"
FT                   /product="Hypothetical protein"
FT                   /note="Psort-B: Unknown cell location; HMMSmart:IPR001763"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00398"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71421"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z3F2"
FT                   /protein_id="ACR71421.1"
FT                   /translation="MISSRKIDYYVNDPYVTIIDIRLKEKFLHSRIKGAIHYEYNRLID
FT                   DINNIYKRGKISCEFRKIFGNKEKIYIFYCDKGAMSLVICEKMSGLGYICKTVVGGFEA
FT                   YKGMCVIN"
FT   gene            419965..421125
FT                   /locus_tag="EUBELI_00399"
FT   CDS_pept        419965..421125
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00399"
FT                   /product="putative N6-adenine-specific DNA methylase"
FT                   /note="Psort-B: Cytoplasmic, score:8.87; COG0116 Predicted
FT                   N6-adenine-specific DNA methylase; HMMPfam:IPR000241;
FT                   ScanRegExp:IPR000241; ScanRegExp:IPR002052; K07444 putative
FT                   N6-adenine-specific DNA methylase"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00399"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71422"
FT                   /db_xref="GOA:C4Z3F3"
FT                   /db_xref="InterPro:IPR000241"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR004114"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z3F3"
FT                   /protein_id="ACR71422.1"
FT                   /translation="MNTYELIAPCHFGLESVLKREIYDLGYDISSVEDGKVTFVGDSEA
FT                   ICRANINLRTTERILIKVGQFKAETFTELFDNTKALEWENYIPKNGKFWVTKANSVNSK
FT                   LFSSSDIQSIVKKAIVERLKEHYRIGWFEEDGDSYPIRVTIMKDIVTIALDTSGDSLHK
FT                   RGYRPAAGKAPISETLAAALIMLTPWRGDRILVDPFCGSGTFPIEAAMIAANIAPGMNR
FT                   KFTAQKWTNIIDKQLWYDAVDEAEDMINLDIETDIQGFDIDADVIRKARSNAENAGVEK
FT                   LIHFQERSVADLSHHKKYGFIITNPPYGERLEDKETLPGIYSAFGRQFAKLDSWSAYMI
FT                   TSYEDAVKYFGRKPDKNRKIYNGMLKTYFYSFQGPKPPKKEKGQER"
FT   gene            421128..421715
FT                   /locus_tag="EUBELI_00400"
FT   CDS_pept        421128..421715
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00400"
FT                   /product="nucleoside-triphosphatase"
FT                   /note="Psort-B: Cytoplasmic, score:8.87; COG0127 Xanthosine
FT                   triphosphate pyrophosphatase; HMMPfam:IPR002637;
FT                   HMMPanther:IPR002637; HMMTigr:IPR002637; K01516
FT                   nucleoside-triphosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00400"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71423"
FT                   /db_xref="GOA:C4Z3F4"
FT                   /db_xref="InterPro:IPR002637"
FT                   /db_xref="InterPro:IPR020922"
FT                   /db_xref="InterPro:IPR029001"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z3F4"
FT                   /protein_id="ACR71423.1"
FT                   /translation="MTTIILASNNKDKVKEVKEILKGYNVISLKDAGIDLDVEENGTTF
FT                   EENALIKARAVCKLTGQLTMADDSGLEIDYLNKEPGVYSARYMGHDTSYDIKNASLIKR
FT                   LEGVEGQDRSGRFVCAIAVCFPDGKEIVKRGTMEGLISKEIVGDNGFGYDPIVYLPEYG
FT                   KTSAQLDPEEKNKISHRGKALELIKKELDECL"
FT   gene            421716..422219
FT                   /locus_tag="EUBELI_00401"
FT   CDS_pept        421716..422219
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00401"
FT                   /product="Hypothetical protein"
FT                   /note="Psort-B: Cytoplasmic, score:8.87; COG0622 Predicted
FT                   phosphoesterase; HMMPfam:IPR004843; HMMTigr:IPR000979"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00401"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71424"
FT                   /db_xref="GOA:C4Z3F5"
FT                   /db_xref="InterPro:IPR000979"
FT                   /db_xref="InterPro:IPR024654"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z3F5"
FT                   /protein_id="ACR71424.1"
FT                   /translation="MAHSGGFMQRIMIVSDSHRRHGNLAEAIYNEQPFDLLIHLGDIEG
FT                   EEDIIQELAGGETIMVPGNNDFFSPLPREREIELAGKKVLLTHGHYYYVSLDLQTLREE
FT                   CIARGIDIVMFGHTHRPLIQIEDELTFINPGSISYPRQADKRCTYIMLEIDDNGEMSFN
FT                   LKYV"
FT   gene            422365..422439
FT                   /locus_tag="EUBELI_00402"
FT   tRNA            422365..422439
FT                   /locus_tag="EUBELI_00402"
FT                   /product="tRNA-Pro"
FT   gene            422460..422530
FT                   /locus_tag="EUBELI_00403"
FT   tRNA            422460..422530
FT                   /locus_tag="EUBELI_00403"
FT                   /product="tRNA-Gly"
FT   gene            422535..422608
FT                   /locus_tag="EUBELI_00404"
FT   tRNA            422535..422608
FT                   /locus_tag="EUBELI_00404"
FT                   /product="tRNA-Arg"
FT   gene            422656..422729
FT                   /locus_tag="EUBELI_00405"
FT   tRNA            422656..422729
FT                   /locus_tag="EUBELI_00405"
FT                   /product="tRNA-His"
FT   gene            422744..422816
FT                   /locus_tag="EUBELI_00406"
FT   tRNA            422744..422816
FT                   /locus_tag="EUBELI_00406"
FT                   /product="tRNA-Gln"
FT   gene            422882..422954
FT                   /locus_tag="EUBELI_00407"
FT   tRNA            422882..422954
FT                   /locus_tag="EUBELI_00407"
FT                   /product="tRNA-Lys"
FT   gene            423104..423580
FT                   /locus_tag="EUBELI_00408"
FT   CDS_pept        423104..423580
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00408"
FT                   /product="Hypothetical protein"
FT                   /note="Psort-B: Unknown cell location"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00408"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71425"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z3F6"
FT                   /protein_id="ACR71425.1"
FT                   /translation="MFVSKLGTFVALGVRGSRMIDNCSFNLGEFYVKMGKTNRNFWRYM
FT                   EMNKEQLYAAQTAMIEWLSDPHELGKKPFKIECAGEFDFNEMHYYIFKFKASLLGKWLV
FT                   GVCGGFEDDDLEPCGHIFSNMQEYNETTAKNECITMVENIMAYWKEQAAKYNNQ"
FT   gene            423610..424035
FT                   /locus_tag="EUBELI_00409"
FT   CDS_pept        423610..424035
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00409"
FT                   /product="Hypothetical protein"
FT                   /note="Psort-B: CytoplasmicMembrane, score:9.99"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00409"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71426"
FT                   /db_xref="GOA:C4Z3F7"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z3F7"
FT                   /protein_id="ACR71426.1"
FT                   /translation="MKKGIRILYFITVVISALVGLWHFFVPWMFQWYDYLPMQYENLIV
FT                   GIDYTNYCFSLLLFGLSVLLIMLGKRALAMNREVIYFYFFLTVVWVFRACLASFVEPWP
FT                   LQPIPVAAIGQLIASDVQAVLMLIVSGLFFKSLKRKA"
FT   gene            424154..424807
FT                   /locus_tag="EUBELI_00410"
FT   CDS_pept        424154..424807
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00410"
FT                   /product="Hypothetical protein"
FT                   /note="Psort-B: CytoplasmicMembrane, score:9.99; COG1396
FT                   Predicted transcriptional regulators; HMMPfam:IPR001387;
FT                   HMMSmart:IPR001387; superfamily:IPR010982"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00410"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71427"
FT                   /db_xref="GOA:C4Z3F8"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z3F8"
FT                   /protein_id="ACR71427.1"
FT                   /translation="MEHDIGCKIKAARIEKKLTQEQVAELLGVSRQTISNWENEKSYPD
FT                   IISVIKMSECYDVSLDYLLKGEQKMKSYYDYLEESTNVVKSNANRNKIITILSYLLIWA
FT                   FAMIVFWFFTSGSDAMGYSLMFLWFILPISTFIVSIVIGKNNFWGKGKWAFTLFFGVMY
FT                   MLAEYGTFKMANNIAFNKLNAPDLGMIVAGAIIAAIGMLVGSLWNKKRHNQKNK"
FT   gene            424866..425468
FT                   /locus_tag="EUBELI_00411"
FT   CDS_pept        424866..425468
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00411"
FT                   /product="dipeptidase E"
FT                   /note="Psort-B: Cytoplasmic, score:9.65; COG3340 Peptidase
FT                   E; HMMPfam:IPR005320; K05995 dipeptidase E"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00411"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71428"
FT                   /db_xref="GOA:C4Z3F9"
FT                   /db_xref="InterPro:IPR005320"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z3F9"
FT                   /protein_id="ACR71428.1"
FT                   /translation="MKLFLCSHFSSVGSLIKEEIENKKVAFIPTASLREGYTGYVGSAR
FT                   KLFKKLGAIVTEIDISTEAYSTIQSVFEEADVIYFTGGNSFFLMDQLRKTGTDGLLKKE
FT                   LANGKLMIGESAGAIICAPSIQYIEQMDEKPEDYSQEDDAGIDLIDFYVLPHYLTAPFK
FT                   KVTEKIMTEFSDLNLCPINNRQGIVIDGEDSKVICKD"
FT   gene            425625..426476
FT                   /locus_tag="EUBELI_00412"
FT   CDS_pept        425625..426476
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00412"
FT                   /product="Hypothetical protein"
FT                   /note="Psort-B: Cytoplasmic, score:8.87"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00412"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71429"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z3G0"
FT                   /protein_id="ACR71429.1"
FT                   /translation="MDDKMNDVINEVQKKLGEEYEVKRVEVMKNNDTKLKGIQVRRKDM
FT                   NVAKICYWTSESVDEIVAVINRSLFPKFDCEINLEKLKDRIVYTLVNADSNKSRLKTIP
FT                   YRLLKGTDLAITYKLIIDIDFNATASSDVTNALIEHLGVTENDLYTFATKNTQKLYAPS
FT                   IMSLTDIVSKIDNQSQEDVSNTPETIFVLTNFKKHFGASCILYPDVLKNFCIEKNMDGV
FT                   YMIPSSVHEFLLLVMDKEYVNCGYVKQMIKEANRESLEKEDVLSDNLYYYNAVNDAVSI
FT                   VE"
FT   gene            426486..426839
FT                   /locus_tag="EUBELI_00413"
FT   CDS_pept        426486..426839
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00413"
FT                   /product="Hypothetical protein"
FT                   /note="Psort-B: Cytoplasmic, score:8.87"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00413"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71430"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z3G1"
FT                   /protein_id="ACR71430.1"
FT                   /translation="MKYTFRSEKELQEVIQACAGIPQKVIDNAKYHIGLVEECFEDGAC
FT                   GNFYILTDDDGIDSDTYKDCLREYNLIEGDYEFDDLICEENGSEWHIRAFIGTDAYWGF
FT                   FYKCKTKEVFYGK"
FT   gene            426829..427293
FT                   /locus_tag="EUBELI_00414"
FT   CDS_pept        426829..427293
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00414"
FT                   /product="Hypothetical protein"
FT                   /note="Psort-B: Unknown cell location"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00414"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71431"
FT                   /db_xref="InterPro:IPR012441"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z3G2"
FT                   /protein_id="ACR71431.1"
FT                   /translation="MESKKEQLITEVVYQGNHTYEIKKTIDGFKGDKAILIGLYPTVDG
FT                   DNITKIDSTQLHLINHMKELGLNEVRIMNLYSEVFDRKPTTSQLTYDKENFEYITQAVN
FT                   TAGEYKLIIAYGSSHSSNKTTNTLKKNLLEAISNSKAKDRVYQISSVAKF"
FT   gene            427338..427517
FT                   /locus_tag="EUBELI_00415"
FT   CDS_pept        427338..427517
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00415"
FT                   /product="Hypothetical protein"
FT                   /note="Psort-B: Unknown cell location; COG1943 Transposase
FT                   and inactivated derivatives; HMMPfam:IPR002686"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00415"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71432"
FT                   /db_xref="GOA:C4Z3G3"
FT                   /db_xref="InterPro:IPR036515"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z3G3"
FT                   /protein_id="ACR71432.1"
FT                   /translation="MMFWTILLMSAKSWKLVQHTKNGYANLKYKYGDRHFWCRGYYVDT
FT                   VGKNAKKNEEYEKN"
FT   gene            427504..427722
FT                   /locus_tag="EUBELI_00416"
FT   CDS_pept        427504..427722
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00416"
FT                   /product="Hypothetical protein"
FT                   /note="Psort-B: Unknown cell location"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00416"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71433"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z3G4"
FT                   /protein_id="ACR71433.1"
FT                   /translation="MKKIRCRKIWNMIRFPCINYCDFENLHKHWECFWTGWALLCRLVS
FT                   WKSRMIVNGSSNLVEFCVKMGKMNCNL"
FT   gene            428087..428785
FT                   /locus_tag="EUBELI_00417"
FT   CDS_pept        428087..428785
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00417"
FT                   /product="Hypothetical protein"
FT                   /note="Psort-B: Cytoplasmic, score:8.87; COG0500
FT                   SAM-dependent methyltransferases; HMMPfam:IPR013216"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00417"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71434"
FT                   /db_xref="InterPro:IPR025714"
FT                   /db_xref="InterPro:IPR026669"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z3G5"
FT                   /protein_id="ACR71434.1"
FT                   /translation="MRIKGDGSIMNKAYERETEMWNQVFKECTPVDLRTLDLQVETMFD
FT                   EALKLFAQKTTNVLDFGCGTGDISFQYLQYQPTHKVLGIDASKTGIEFATETARLSDYK
FT                   TATFLEGTDHTVKQLEENSFDGVILSNVLDVMPKDVSKEVVEDLERVLKPGGYWFIKMN
FT                   PYYSKEELESFGYENMGNNIYEENHIMRLRQATTNYWKERFARFGKEIIYLEFEYPWQE
FT                   GMNRLFVYQS"
FT   gene            428900..431170
FT                   /locus_tag="EUBELI_00418"
FT   CDS_pept        428900..431170
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00418"
FT                   /product="Hypothetical protein"
FT                   /note="Psort-B: CytoplasmicMembrane, score:7.63; COG5001
FT                   Predicted signal transduction protein containing a membrane
FT                   domain, an EAL and a GGDEF domain; HMMPfam:IPR000160;
FT                   HMMPfam:IPR001633; BlastProDom:IPR011591;
FT                   HMMSmart:IPR000160; HMMSmart:IPR001633; HMMTigr:IPR000160"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00418"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71435"
FT                   /db_xref="GOA:C4Z3G6"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z3G6"
FT                   /protein_id="ACR71435.1"
FT                   /translation="MRVFYGLIITAVILMIGACALKAYKKEGALARVVFLYELGAFICG
FT                   IIFLVYTYVPGTTITVLCKGLIMASFDWLLILLMYYTQYYTGMFKGIVGVKVFMIAYSL
FT                   LETVAFLINTWTRWIFDITYISDDQIIVQFAKGNVLGRLHYVFAYGIMLLLILSYIVMV
FT                   ERMSRFYRFRYFAILILLLAASLLDIMTTWSDSIYDMSMAAFGIMSILIYYLTYRYVPN
FT                   ELIENTFSLIIRDMNSGIICFDNAGRCIYCNGIVKEMYSITDNINEVEHNYASWLHTQT
FT                   EHDNKKFRQTISVGDERRSIDISYNRVYDDKHNFICDYFIFNDRTEAVELLEYEKFRAT
FT                   HDNLTGLLNKEQFYEETANVVRNDRNHTYCLVCSNIKDFKLVNELFGIEKGDEIIKMQA
FT                   GLIKASSESGYICGRIQNDRFAVCMPKDSFKNEIMQNSIVSMQDRFNNASFKIRVVVGV
FT                   YDIEDVDEPVSNMCDKAFIASETIKNNYETNIAYYDDKLLKRTLEERRVISEFEGAIEK
FT                   KEFKMFLQPQVNTHGKAYGAEALVRWQHPERGLLSPFFFIDILETTGLIYKLDMYMWEC
FT                   AAAKLSEWKKKGDTVHYISVNISTKDFYLIDVYEVITSIVKKYDIEPKMLKLEITETAL
FT                   MSDLKKNMEVIKSLRDYGFKIEIDDFGSGYSSLNMLKDISADVLKIDMAFLRATENEVK
FT                   GQDILETIISLGGKLGMEVITEGVETDKQLIMLTEMGCHIFQGYYFSKPIPVEEFEQKY
FT                   MNE"
FT   gene            431183..432007
FT                   /locus_tag="EUBELI_00419"
FT   CDS_pept        431183..432007
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00419"
FT                   /product="hydrogenase 1 maturation protease"
FT                   /note="Psort-B: Unknown cell location; COG0489 ATPases
FT                   involved in chromosome partitioning; ScanRegExp:IPR000577;
FT                   K03605 hydrogenase 1 maturation protease"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00419"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71436"
FT                   /db_xref="GOA:C4Z3G7"
FT                   /db_xref="InterPro:IPR019591"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033756"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z3G7"
FT                   /protein_id="ACR71436.1"
FT                   /translation="MSENCSGSCSSCSSDCESRKGPQILRNANNGKVKKVIAVVSGKGG
FT                   VGKSLVTSMLAVKANKDGKKSAILDADITGPSIPKSFGLTERVTCNEDGTVMYPETSKN
FT                   GIKVMSLNLLMEKETDPVIWRGPVIAGVVKQFWEDVDWDETDCMFVDCPPGTGDVPLTV
FT                   FQSMPIDGIIIVTSPQDLVSMIVEKAINMAKLMNIPVIGIVENMSYFKCPDCGNIHYIY
FT                   GKSKIDEVAAANDIKTVAKLPMDAKVAGLVDSGKAEELDVSALDGIFDAIMA"
FT   gene            432020..433255
FT                   /locus_tag="EUBELI_00420"
FT   CDS_pept        432020..433255
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00420"
FT                   /product="Hypothetical protein"
FT                   /note="Psort-B: Cytoplasmic, score:8.87; NOG34977 non
FT                   supervised orthologous group"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00420"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71437"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z3G8"
FT                   /protein_id="ACR71437.1"
FT                   /translation="MKRLILFKGGVETLEFFTEQMAAVWEKMGCSVFWYNLMLQQASSS
FT                   ALVEFFKAHSSDEWYMFTFNFEGIAGEAGLYRDDGWNFWDWAGVKVVNVVVDHPLYYNK
FT                   YIRKHPEKYIQLDIDEMHVAYMNRFFPEVHTEYMLTAGTELNYNRCIMPDKNYLSMKER
FT                   PIDIIFTGNYTPKRILRKHLDNMDDEYIDFYEGVLSYLIDNPSETIDAAAENALRREFP
FT                   DITDEQLVDCMPNMMYADLAVRFHYRELAIRALADSGLKIHTYGEGYNYIECNHHENII
FT                   EHGGVDSKVCLDMISQAKISLNVMPWFKMGAHDRVFNTMLNGGVALTDTSLFYENTFAD
FT                   GENVLFYSLEDLRDYEKSGYDACIAARITDKVKCALADTKHLQEIADSGYECCKGRHSW
FT                   IERAVVIEKYFR"
FT   gene            433396..434763
FT                   /locus_tag="EUBELI_00421"
FT   CDS_pept        433396..434763
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00421"
FT                   /product="multidrug resistance protein, MATE family"
FT                   /note="Psort-B: CytoplasmicMembrane, score:9.99; COG0534
FT                   Na+-driven multidrug efflux pump; HMMPfam:IPR002528;
FT                   HMMPanther:IPR002528; HMMPanther:IPR015522;
FT                   HMMTigr:IPR002528; K03327 multidrug resistance protein,
FT                   MATE family"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00421"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71438"
FT                   /db_xref="GOA:C4Z3G9"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z3G9"
FT                   /protein_id="ACR71438.1"
FT                   /translation="MANSQKGKIDMTTGHIMRNIILFAIPIIIGNVLQQLYTTVDALVI
FT                   GKYCGDTSLAAVGTSSQPVEVLLCVFLGIGTGVSILISQYTGARESRKVVSVCGTSITF
FT                   IYIIGIPIGILGWFAAPYILEFMKVPQDVWNAALIYTRVVFLGTLGNLGYNMNAGILRG
FT                   LGDSKASLWFLVVSCVSNIVFDLLFVAGFGMDVAGAALSTSIAMFISWIVSIVYIRKKF
FT                   PEIQFTFLPRRFSGTMMKDILAIGLPVGLNNSLYSLGHVALQTFNNSQGAIFMAGGAVA
FT                   GRITGCSNIAITGLSSAATTFSGQNYGAKKYSRIKEGHWRIPLCSGLITLSCGLFFIMI
FT                   HKPIIRFFSSDEMVLMYASRHVVVMLLSQWFFAIFNCIISIVNGTGKVRYTTIVNILML
FT                   WAVRIPSAYIINRYFDGTWVMLCFPISFSFGMFAMIGYYLFSPAWKEVMRMAEKNS"
FT   gene            complement(434851..436344)
FT                   /locus_tag="EUBELI_00422"
FT   CDS_pept        complement(434851..436344)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00422"
FT                   /product="flagellin"
FT                   /note="Psort-B: Extracellular, score:9.55; COG1344
FT                   Flagellin and related hook-associated proteins;
FT                   HMMPfam:IPR001029; HMMPfam:IPR001492;
FT                   BlastProDom:IPR001029; K02406 flagellin"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00422"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71439"
FT                   /db_xref="GOA:C4Z3H0"
FT                   /db_xref="InterPro:IPR001029"
FT                   /db_xref="InterPro:IPR001492"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z3H0"
FT                   /protein_id="ACR71439.1"
FT                   /translation="MVVQHNMAAMNANRMLSGVSSAQSKSTEKLSSGYRINRAADDAAG
FT                   LSISEKMRSQIRGLNKASDNAQDGISLIQTAEGALNESHSILQRMRELSVQAANGTETD
FT                   DDREAVQNEIEQLQSELTRISDTTEFNTMKLLDGSQSGSKVQASVSKSADAMLTTEPAT
FT                   TGKSVSAALTNTADGTESTYAVTVMDKDGNASTTTVKFTAGADEEADANAIIKALKDTD
FT                   LADKFDMTYATGDKTITFTSKEEGVSSNVVLTQLGTAKAAAATVTPGTDAYSKLSKDYA
FT                   AYDGSGNIEDAIFTVNGQKFAYVTDATKLGDDYKDVNYIETAAATIDPAEAAKMAKLIN
FT                   SKTGISAEADKNGNISLKAGSSNTGKGIELQIGANEGQTMSFTLDDMSADALGVGVGKV
FT                   DLSKQETAKTATTTIDAAIKKISKARGQMGAVQNRLEHTINNLDTASENMQTAESRIRD
FT                   TDMAEEMVNYSKNNILAQAGQSMLAQANQSNQGVLTLLQ"
FT   gene            complement(436474..436800)
FT                   /locus_tag="EUBELI_00423"
FT   CDS_pept        complement(436474..436800)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00423"
FT                   /product="Hypothetical protein"
FT                   /note="Psort-B: Unknown cell location;
FT                   BlastProDom:IPR003751"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00423"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71440"
FT                   /db_xref="GOA:C4Z3H1"
FT                   /db_xref="InterPro:IPR003751"
FT                   /db_xref="InterPro:IPR036107"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z3H1"
FT                   /protein_id="ACR71440.1"
FT                   /translation="MHGHGKQGGFEMLKLTIKPGEFINIGNDIRVVYSGGTDGNIHLLI
FT                   DAPRELNIVRSKVLSRKKDSSENNYPHSAPSYYAEPKLSQETVSKIRHLIKEDKNTKKN
FT                   NTQD"
FT   gene            436836..437414
FT                   /locus_tag="EUBELI_00424"
FT   CDS_pept        436836..437414
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00424"
FT                   /product="Hypothetical protein"
FT                   /note="Psort-B: Unknown cell location; COG0582 Integrase;
FT                   HMMPfam:IPR002104; Gene3D:IPR013762; superfamily:IPR011010"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00424"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71441"
FT                   /db_xref="GOA:C4Z3H2"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z3H2"
FT                   /protein_id="ACR71441.1"
FT                   /translation="MEVNNMGTSQPIRSLDELTAFRSYYLNKEVNLRNYMLICMGLNTA
FT                   LRISDMLQLKWGNVYDFDRKHYVKHIVVCEGKTGKETRIAINNNLIEAFEMYMGSLKSV
FT                   SGNDYIFTGKTKGTHLSRSQAFRIITHVAEALNMENGISCHSLRKTFGYYAWKYGTPPA
FT                   MLMEIYNHSSYEITKRYLGIKQDDRDNVF"
FT   gene            437665..437746
FT                   /locus_tag="EUBELI_00425"
FT   tRNA            437665..437746
FT                   /locus_tag="EUBELI_00425"
FT                   /product="tRNA-Leu"
FT   gene            437813..438721
FT                   /locus_tag="EUBELI_00426"
FT   CDS_pept        437813..438721
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00426"
FT                   /product="aldose 1-epimerase"
FT                   /note="Psort-B: Cytoplasmic, score:8.87; COG2017 Galactose
FT                   mutarotase and related enzymes; HMMPfam:IPR008183;
FT                   Gene3D:IPR014718; superfamily:IPR011013; K01785 aldose
FT                   1-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00426"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71442"
FT                   /db_xref="GOA:C4Z3H3"
FT                   /db_xref="InterPro:IPR008183"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR014718"
FT                   /db_xref="InterPro:IPR037481"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z3H3"
FT                   /protein_id="ACR71442.1"
FT                   /translation="MYNKENMSGKEANMAEYVLENNILKVTVDSKGCEIRDVLCKTDNT
FT                   HRMWNANPEGWKRVAPVLFPLIGKYKDNQSIYNGKVYEMGQHGFARDMEFTLVKHNDDM
FT                   LVMRLESDENTKEKYPFDFALELEYHLIDNEIKEVYRVINKDNEMMHFSIGGHPAFVTP
FT                   ENDASMAGCKIRFDADRITYHLIGDYQLMARDEYELPLINHEYTIQEDSFEKDAFIIEG
FT                   SQAGTVSLVKNEKPFVTVKFDTPVFGLWSCKSKNVPFVCIEPWYGRTDAIDFTGELKDR
FT                   EYSNHLDAGEVFEKSFSILFY"
FT   gene            complement(438794..440185)
FT                   /locus_tag="EUBELI_00427"
FT   CDS_pept        complement(438794..440185)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00427"
FT                   /product="aldehyde dehydrogenase (NAD+)"
FT                   /note="Psort-B: Cytoplasmic, score:9.98; COG1012
FT                   NAD-dependent aldehyde dehydrogenases; HMMPfam:IPR015590;
FT                   HMMPIR:IPR012394; HMMPanther:IPR012394;
FT                   HMMPanther:IPR015590; ScanRegExp:IPR015590; K00128 aldehyde
FT                   dehydrogenase (NAD+)"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00427"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71443"
FT                   /db_xref="GOA:C4Z3H4"
FT                   /db_xref="InterPro:IPR012394"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z3H4"
FT                   /protein_id="ACR71443.1"
FT                   /translation="MRYDMEATQINKLVQSQRHFFLTGTTLDVNVRIDALKKLYSAIKK
FT                   HENEIFDALYKDLGKSQFESYMCEVGLTLSEISYMIKHIRTFSREKNVPTPLAQFHSRS
FT                   FKKPSPRGVVLIMSPWNYPFLLTMEPLVDAIAAGNTAILKPSAYSPYVSDVICLIIKEI
FT                   FDPAYVSVVTGGRAENNCLLNEHFDYIFFTGSQAVGKEVMRKAAEYLTPVTLELGGKSP
FT                   CIVTESADLKLAARRIVFGKFLNCGQTCVAPDYIYVQDSIKDHLVKELINETKRQFTDS
FT                   PLNNNDYGKIVNEKHFNRISGLIDNSKVVLGGASDADSLRIEPTIMDNVTFDDAVMQEE
FT                   IFGPLMPILTFHSVEEAVNTVNAHMHPLALYIFTKNKKETRYVTSRCNYGGGCINDTII
FT                   HLATSKMGFGGFGESGMGSYHGKAGFDTFSHYKSIVDKKCWLDLPMRYQPYTKTNNSLI
FT                   HMFLK"
FT   gene            complement(440175..441398)
FT                   /locus_tag="EUBELI_00428"
FT   CDS_pept        complement(440175..441398)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00428"
FT                   /product="alcohol dehydrogenase"
FT                   /note="Psort-B: Cytoplasmic, score:9.65; COG1454 Alcohol
FT                   dehydrogenase, class IV; HMMPfam:IPR001670;
FT                   ScanRegExp:IPR001670; ScanRegExp:IPR013032; K00001 alcohol
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00428"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71444"
FT                   /db_xref="GOA:C4Z3H5"
FT                   /db_xref="InterPro:IPR001670"
FT                   /db_xref="InterPro:IPR018211"
FT                   /db_xref="InterPro:IPR039697"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z3H5"
FT                   /protein_id="ACR71444.1"
FT                   /translation="MNIFKKIYCRSFQTVFKIALPFLPYRKPKIVSALSDIPSVLNKKK
FT                   KSCPVIITDPGIAKLGILSMLTDVFDNAGIEYHVYDKTVANPTTDTVEEALAIYKDNKC
FT                   DCIIGFGGGSSMDCAKAVGVRIARPKTHLSKLGGILKVHSKLPLLVAIPTTAGTGSETT
FT                   LAAVIVDATTRHKYAINDFPLIPRYAVLDPKVTLTLPASITATTGMDALTHAVEAYIGN
FT                   STTPGTRKDALMATELIFNNLDRAYTNGSDTTARKNMLKAAYYAGCAFTKSYVGYVHAI
FT                   AHSLGGEYNVPHGLANAVILPMVLESYGESIYTKLHDLAIAAGVADKDMPDETAAKAFI
FT                   QAVRDMKARFNIGDTIPEIKEADIPKLAGYADKEANPLYPVPVLMDAKTLEQFYYKLMK
FT                   DNTCENEV"
FT   gene            complement(441471..442163)
FT                   /locus_tag="EUBELI_00429"
FT   CDS_pept        complement(441471..442163)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00429"
FT                   /product="Hypothetical protein"
FT                   /note="Psort-B: Cytoplasmic, score:9.65; COG0726 Predicted
FT                   xylanase/chitin deacetylase; HMMPfam:IPR002509;
FT                   superfamily:IPR011330"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00429"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71445"
FT                   /db_xref="GOA:C4Z3H6"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z3H6"
FT                   /protein_id="ACR71445.1"
FT                   /translation="MGNCSIGSRKLPIYCVDLSKKTNLDTSKKYVSISFDAAWGDEDTI
FT                   KILDILDKYNIKTTFFMTGGWVDSYPDKVLEIYNRGHDLGNHSQNHKEMSKLSVNEQKD
FT                   EIMSVANKIKEITGYTSFLFRPPYGDYNSTLIDTVYGCNFYPIEWDVDSLDWKDYGTDN
FT                   IIKTVTTHKALKNGSIILMHNGAKYTAEALESVITGLQSQGYEIVPVSQLINTENFHMD
FT                   GTGLQIPD"
FT   gene            complement(442548..443885)
FT                   /locus_tag="EUBELI_00430"
FT   CDS_pept        complement(442548..443885)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00430"
FT                   /product="poly-gamma-glutamate synthesis protein (capsule
FT                   biosynthesis protein)"
FT                   /note="Psort-B: CytoplasmicMembrane, score:9.87; COG2843
FT                   Putative enzyme of poly-gamma-glutamate biosynthesis
FT                   (capsule formation); K07282 poly-gamma-glutamate synthesis
FT                   protein (capsule biosynthesis protein)"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00430"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71446"
FT                   /db_xref="GOA:C4Z3H7"
FT                   /db_xref="InterPro:IPR019079"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z3H7"
FT                   /protein_id="ACR71446.1"
FT                   /translation="MAKKTNVPLKRRRRSELNVKLIAIIAAVLFVVTISIVFAVIGSHK
FT                   KENNPSVADNQNNETTAEPTTEEETTTKVPTVEVDLMMIGDMLMHEGVVKSGLMDDETY
FT                   NFDHLYTNIAKDISSADIKIVNQETILGGSDFAYTGYPTFNSPWALGDAEVKAGFNIIL
FT                   HATNHTLDKGLKGVENCLSFWKTYHPDTTVLGINETEEDYENIYVYEKEGFKIAFLNYT
FT                   YGTNGIPIPDSKPYIVNMLDKDKITADVTKAKQLADMVIVLPHWGTEYVYTPDSNQNYW
FT                   TQLFLSLGVDVVIGTHPHVLEPVEVVSDTKGHEMLVYYSLGNFVSNQDQKPRMIGGMAK
FT                   MTLVKDETGCYVKNYNLTPVITQKLFGKKAITTYKLSDYTESLASGNAIRNDSGCSDFS
FT                   LSYCQTLVKQILGDDYDESTSELNVSLHPDGLVKDTSATESSSSAK"
FT   gene            444076..445410
FT                   /locus_tag="EUBELI_00431"
FT   CDS_pept        444076..445410
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00431"
FT                   /product="glutamine synthetase"
FT                   /note="Psort-B: Cytoplasmic, score:9.98; COG0174 Glutamine
FT                   synthetase; HMMPfam:IPR008146; HMMPfam:IPR008147;
FT                   BlastProDom:IPR008146; Gene3D:IPR014746; HMMTigr:IPR004809;
FT                   ScanRegExp:IPR008147; superfamily:IPR008147; K01915
FT                   glutamine synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00431"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71447"
FT                   /db_xref="GOA:C4Z3H8"
FT                   /db_xref="InterPro:IPR004809"
FT                   /db_xref="InterPro:IPR008146"
FT                   /db_xref="InterPro:IPR008147"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR027302"
FT                   /db_xref="InterPro:IPR036651"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z3H8"
FT                   /protein_id="ACR71447.1"
FT                   /translation="MSRYTKDDIFRMVEEEDVEFIRLQFTDIFGTLKNIAITSSQLEKA
FT                   LDNKCMFDGSSVEGFVRIEESDMYLYPDYDTFEIFPWRPQQGKVARLICDVYTPDGKPF
FT                   EGDPRWILKKTIKEANEMGYRFDVGPECEFFLFHTDDNGLPTTLSHEKAGYFDLGPNDL
FT                   GENIRRDMVLTLEDMGFEIEASHHEVAPAQHEIDFKYDEALKTADNIQTFKMTVKTIAK
FT                   RHGLYATFMPKPKFGISGSGMHINMSLATEEGKNIFADENGKIGLSDDAYHFIAGIMKH
FT                   ARGMSAITNPLVNSYKRLVPGYEAPVYIAWSAKNRSPLIRIPASRGNGTRVELRNPDPT
FT                   ANPYLVLALCLAAGLDGIKNKIEVPESVDCNIYEMTPGERRAAGIENMPADLKEAVDCL
FT                   VTDEFLCSVLGEHITTKYVEAKMKEWENYTTRVSQWEIDEYLYKY"
FT   gene            445455..446009
FT                   /locus_tag="EUBELI_00432"
FT   CDS_pept        445455..446009
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00432"
FT                   /product="Hypothetical protein"
FT                   /note="Psort-B: Cytoplasmic, score:8.87; COG3707 Response
FT                   regulator with putative antiterminator output domain;
FT                   HMMPfam:IPR005561; Gene3D:IPR011991; superfamily:IPR011006"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00432"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71448"
FT                   /db_xref="GOA:C4Z3H9"
FT                   /db_xref="InterPro:IPR005561"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z3H9"
FT                   /protein_id="ACR71448.1"
FT                   /translation="MSTLIVAFPKLEEAKTVRNLLIHRGFDVAVPCTSGAQAINQADTL
FT                   SDGIIICGYKLSDNMVYTELYEYKPKSFEMLLVASQNRWEDCQDNGIVCAAMPIKVNDL
FT                   VSTIEMMLQAQIRRRRKLRSQPRKRSPEEQKIIDDAKHLLMERNNMSEQEAFRYIQKCS
FT                   MDSGNTMVESATMVMGIYQDV"
FT   gene            446039..446956
FT                   /locus_tag="EUBELI_00433"
FT   CDS_pept        446039..446956
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00433"
FT                   /product="diaminopimelate epimerase"
FT                   /note="Psort-B: Cytoplasmic, score:9.98; COG0253
FT                   Diaminopimelate epimerase; HMMPfam:IPR001653;
FT                   HMMTigr:IPR001653; ScanRegExp:IPR001653; K01778
FT                   diaminopimelate epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00433"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71449"
FT                   /db_xref="GOA:C4Z3I0"
FT                   /db_xref="InterPro:IPR001653"
FT                   /db_xref="InterPro:IPR018510"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z3I0"
FT                   /protein_id="ACR71449.1"
FT                   /translation="MKRRPGMKFTKMHGAGNDYIYVDCTQSVIDNPSQVAIDLSDRHFG
FT                   IGSDGLILIKNSDKADFFMEMYNADGSQGQMCGNGIRCVGKFVYDNGLTDKTTVTIDTL
FT                   AGVKILELKTGADGKVETARVNMGAPILEAAQIPVDTKGLKEYKGCEIETIAGKVVKTP
FT                   VVDETIVVEGKEYKVTAVSMGNPHAIVYLDKDIDIKKFEIEKIGPFFENHKAFPERINT
FT                   EFIQVVDKNNLNMRVWERGSGETLACGTGACASLVATVLNGMCDTTATLHLLGGDLKIT
FT                   WDKDENTVYLEGPAKTVFTGEVDI"
FT   gene            446958..447587
FT                   /locus_tag="EUBELI_00434"
FT   CDS_pept        446958..447587
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00434"
FT                   /product="methenyltetrahydrofolate cyclohydrolase"
FT                   /note="Psort-B: Unknown cell location; COG3404 Methenyl
FT                   tetrahydrofolate cyclohydrolase; HMMPfam:IPR007044;
FT                   superfamily:IPR007044; K01491 methenyltetrahydrofolate
FT                   cyclohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00434"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71450"
FT                   /db_xref="GOA:C4Z3I1"
FT                   /db_xref="InterPro:IPR007044"
FT                   /db_xref="InterPro:IPR036178"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z3I1"
FT                   /protein_id="ACR71450.1"
FT                   /translation="MMTDMTMDNFLAVLSSSEPVPGGGGACGYVAAVGMSLGNMVLALT
FT                   TGKKKYAEYQEEIEELIVKATDLTKRLAECMDKDAESFKPLAAAYGLPKDTEEQIKERE
FT                   AIMAKALVTASEAPLSMMELILEAMKLINRISVIGSRIAISDAGVGITMCEAAMKGASL
FT                   NVFINTKLMKDRELAEDMNFKADKMLAEAAQIEEETFGRVMDAVRP"
FT   gene            447688..448530
FT                   /locus_tag="EUBELI_00435"
FT   CDS_pept        447688..448530
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00435"
FT                   /product="methylenetetrahydrofolate dehydrogenase (NADP+) /
FT                   methenyltetrahydrofolate cyclohydrolase"
FT                   /note="Psort-B: Cytoplasmic, score:8.87; COG0190
FT                   5,10-methylene-tetrahydrofolate dehydrogenase/Methenyl
FT                   tetrahydrofolate cyclohydrolase; HMMPfam:IPR000672;
FT                   BlastProDom:IPR000672; K00288 methylenetetrahydrofolate
FT                   dehydrogenase (NADP+) K01491 methenyltetrahydrofolate
FT                   cyclohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00435"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71451"
FT                   /db_xref="GOA:C4Z3I2"
FT                   /db_xref="InterPro:IPR000672"
FT                   /db_xref="InterPro:IPR020630"
FT                   /db_xref="InterPro:IPR020631"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z3I2"
FT                   /protein_id="ACR71451.1"
FT                   /translation="METLKGLPVANAINEKIIEEMKDWKGAIPHLAIVRVGERPDDMSY
FT                   ERGATKKMEKVGFRCTSYTFPADIDNDTFQKEFDKINEDEDIDGILLLRPLPKHLDEKA
FT                   IENRIASVKDLDGISPMNLAKVYAGDPTGYGPCTAEAVIEMLDYAGVDLKGKRAVVIGR
FT                   SLVIGKPVAMMLMKKNATVTVCHTKTVDMPGVCKGAEVLVAAAGVAKMVDKSFVADGAV
FT                   VIDVGINVDEDGNLCGDVDFEDVAENASVCTPVPGGVGSVTTSVLAKHLLKAAKARRA"
FT   gene            448630..449025
FT                   /locus_tag="EUBELI_00436"
FT   CDS_pept        448630..449025
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00436"
FT                   /product="holin-like protein"
FT                   /note="Psort-B: CytoplasmicMembrane, score:9.99; COG1380
FT                   Putative effector of murein hydrolase LrgA;
FT                   HMMPfam:IPR005538; BlastProDom:IPR005538; K05338 holin-like
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00436"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71452"
FT                   /db_xref="GOA:C4Z3I3"
FT                   /db_xref="InterPro:IPR005538"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z3I3"
FT                   /protein_id="ACR71452.1"
FT                   /translation="MKLLRQFLIILAISFVGEALKYLLPLPVPASIYGMVILFVGLLTG
FT                   LIKLSWVKDAGKFLIAVMPVMFIPAGVGLMSSWGVLKPMLVPVLVVTVVAIITVMAVTG
FT                   QASQIIIRADRKRELRKAQRNEVNTNE"
FT   gene            449018..449710
FT                   /locus_tag="EUBELI_00437"
FT   CDS_pept        449018..449710
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00437"
FT                   /product="holin-like protein LrgB"
FT                   /note="Psort-B: CytoplasmicMembrane, score:9.99; COG1346
FT                   Putative effector of murein hydrolase; HMMPfam:IPR007300;
FT                   K05339 holin-like protein LrgB"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00437"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71453"
FT                   /db_xref="GOA:C4Z3I4"
FT                   /db_xref="InterPro:IPR007300"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z3I4"
FT                   /protein_id="ACR71453.1"
FT                   /translation="MNDFFRESLFAGVTLSLLSYFIGSVLKKKFKLGIFNPLLISIIIT
FT                   IIVLAVSGVDYDVYNQGARYLSWFLTPATVCLAIPLYEQWSLLKKNYKAVVVGIASGVL
FT                   TSLTTVLVLSKIMNLSHAEYVTLLPKSITTAIGMGVSEELGGYVTITVAVIVVTGVLGN
FT                   IFGELICKIFRIKEPIAKGLALGSAAHAIGTAKAMEMGEVEGAMSSLSIAVAGILTVVL
FT                   SSVFAGFM"
FT   gene            449729..450304
FT                   /locus_tag="EUBELI_00438"
FT   CDS_pept        449729..450304
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00438"
FT                   /product="cytidylate kinase"
FT                   /note="Psort-B: Cytoplasmic, score:8.87; NOG14451 non
FT                   supervised orthologous group; K00945 cytidylate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00438"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71454"
FT                   /db_xref="GOA:C4Z3I5"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z3I5"
FT                   /protein_id="ACR71454.1"
FT                   /translation="MIITIARQCGCMGDQIGKALAEKYFIPFYDKDAVCRLAKEKGLYE
FT                   KYPYFYGEMPLDMLLYADTMAGDDTTDNGKTPRKAMADIIGNENCVVVGRCGNNAFRHR
FT                   EDVISVFLTGNKEKRVELIEKKHNVSPKKAAKIVEDTDLRRRSYHNYYTGEEWGNAEYY
FT                   DICIDVSKVGEDGALRLIEAYINETGVL"
FT   gene            450285..451001
FT                   /locus_tag="EUBELI_00439"
FT   CDS_pept        450285..451001
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00439"
FT                   /product="GntR family transcriptional regulator,
FT                   transcriptional repressor for pyruvate dehydrogenase
FT                   complex"
FT                   /note="Psort-B: Cytoplasmic, score:8.87; COG2186
FT                   Transcriptional regulators; HMMPfam:IPR000524;
FT                   HMMPfam:IPR011711; Gene3D:IPR011991; HMMSmart:IPR000524;
FT                   K05799 GntR family transcriptional regulator,
FT                   transcriptional repressor for pyruvate dehydrogenase
FT                   complex"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00439"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71455"
FT                   /db_xref="GOA:C4Z3I6"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z3I6"
FT                   /protein_id="ACR71455.1"
FT                   /translation="MRQGCYKLKQDNMNQKKISQEYEKAIQYIYELMKSGELTIGSRLP
FT                   TERALAETLGIGRNSTREALSIMHGMGLIERRQGSGNYISENVGQSIKQTILMMIALKT
FT                   ITKREVCEFRRMMEKSVCNAVIHTGLTKEQQERLESMVNHMSMVTGENLVDTDKAFHEE
FT                   LIADTGNNLWITLMEAVVEVYREWIDYVIKHADGIKKKKLLKTHEMIYDSLIKKDIETL
FT                   NAAIDEHYDIIEELLG"
FT   gene            451025..451675
FT                   /locus_tag="EUBELI_00440"
FT   CDS_pept        451025..451675
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00440"
FT                   /product="phosphoglycolate phosphatase"
FT                   /note="Psort-B: Cytoplasmic, score:8.87; COG0546 Predicted
FT                   phosphatases; HMMPfam:IPR005834; HMMTigr:IPR006402;
FT                   HMMTigr:IPR006439; ScanRegExp:IPR000150; K01091
FT                   phosphoglycolate phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00440"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71456"
FT                   /db_xref="GOA:C4Z3I7"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z3I7"
FT                   /protein_id="ACR71456.1"
FT                   /translation="MKYKIVVFDLDGTILNTLEDLADSTNYALSVFDMPERTIEEIRHF
FT                   VGNGIRKLMERAVPQGTPESMIVKVHETFTEHYKKHCADKTRPYDGIKELIENIRNAGV
FT                   YTAVVSNKADYGVQILCKDYFPGLFDYAVGEREGIRRKPYPDSVNEVLRQFDVDRTQAV
FT                   YVGDSEVDVQTAANAGMDVCMVGWGFRDEEFLKENGAEFVVHSPEEAWEFINK"
FT   gene            complement(451681..452634)
FT                   /locus_tag="EUBELI_00441"
FT   CDS_pept        complement(451681..452634)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00441"
FT                   /product="Carbohydrate Esterase Family 12 protein"
FT                   /note="distantly related to pectin acetylesterases;
FT                   Psort-B: Cytoplasmic, score:8.87; COG2755 Lysophospholipase
FT                   L1 and related esterases; HMMPfam:IPR001087;
FT                   Gene3D:IPR013831; superfamily:IPR013830"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00441"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71457"
FT                   /db_xref="GOA:C4Z3I8"
FT                   /db_xref="InterPro:IPR013830"
FT                   /db_xref="InterPro:IPR037459"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z3I8"
FT                   /protein_id="ACR71457.1"
FT                   /translation="MNIYLAGDSIVQNYTEEEFIAGWGQFLPRFFKPDVNVFNYAKGGR
FT                   SSRLFINEGRFEEIDRHIQSGDYLFIEFCHNDDDSKDYKSMFNRQTPLGVPDESGRFPV
FT                   IAGVKMPKNYIPPEYIEALNNDDSITDKQAVLNSVLAINQSYPYDTYYPYSKDASMGSY
FT                   KWFIKQFIDMARKHDAVPVLVTAPARTFFNDDGTIMDAPGCHGGNNFSYIRAMRQIGEE
FT                   TGTPVLDLFSYSVELFEKIGHDNIHRYTSIKKGINKGKWPDDFLKELAKPETVSENTHF
FT                   NKDGAMLITEGLVELIRESKNPQLCELQSSLLHNVV"
FT   gene            452887..453729
FT                   /locus_tag="EUBELI_00442"
FT   CDS_pept        452887..453729
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00442"
FT                   /product="hemerythrin"
FT                   /note="Psort-B: Cytoplasmic, score:8.87; COG2703
FT                   Hemerythrin; HMMPfam:IPR012312; BlastProDom:IPR002063;
FT                   Gene3D:IPR012827; HMMTigr:IPR012827; K07216 hemerythrin"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00442"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71458"
FT                   /db_xref="GOA:C4Z3I9"
FT                   /db_xref="InterPro:IPR012312"
FT                   /db_xref="InterPro:IPR012827"
FT                   /db_xref="InterPro:IPR035938"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z3I9"
FT                   /protein_id="ACR71458.1"
FT                   /translation="MYEFTEDCMIHIDNIDEEHRKLFQMLNEAFALVKETDNAASIAKN
FT                   LIDNLKDYAITHFAHEEEYMKSIHDPELPIQQREHKAFAEKINTFKLDESSPEAATNSL
FT                   NELLLYLTRWLYSHILSSDMMIGKMAPETNVDDAFAFTDKYITGIELVDEEHKHLFDII
FT                   RDTNDVIHAELLHDKYDEIIRLLSELREYTETHFSDEEELMKKIGYPEIEAQKRAHSAF
FT                   VEKLVNIDFRELEAMDDNQEEYLMDLIGFLLGWLSNHILGSDKKIGKYIKEHNIVLEK"
FT   gene            453719..453847
FT                   /locus_tag="EUBELI_00443"
FT   CDS_pept        453719..453847
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00443"
FT                   /product="Hypothetical protein"
FT                   /note="Psort-B: Unknown cell location"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00443"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71459"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z3J0"
FT                   /protein_id="ACR71459.1"
FT                   /translation="MKSNILYDIIYVYEYLKDYERDFFSWNLTGKRCHRLKAYAGN"
FT   gene            454129..455874
FT                   /locus_tag="EUBELI_00444"
FT   CDS_pept        454129..455874
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00444"
FT                   /product="aspartyl-tRNA synthetase"
FT                   /note="Psort-B: Cytoplasmic, score:10.00; COG0173
FT                   Aspartyl-tRNA synthetase; HMMPfam:IPR004115;
FT                   HMMPfam:IPR004364; HMMPfam:IPR004365; Gene3D:IPR012340;
FT                   HMMPanther:IPR004364; HMMPanther:IPR004524;
FT                   HMMTigr:IPR004524; K01876 aspartyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00444"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71460"
FT                   /db_xref="GOA:C4Z3J1"
FT                   /db_xref="InterPro:IPR002312"
FT                   /db_xref="InterPro:IPR004115"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR004524"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR029351"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z3J1"
FT                   /protein_id="ACR71460.1"
FT                   /translation="MANMYRDVNLSEVNESYIGKELKVAGWVENIRDHGGVSFIDLRDM
FT                   YGVLQVVLRDTTLLDGIHKEECIAIEGIMEQRDEETYNPKIPSGTIELEAKKITILGQV
FT                   YQQLPFEVQTSKEVREDVRLKYRYLDLRNQKVKDNMIFRSKVIAFLRQKMTDMGFLEIQ
FT                   TPILCASSPEGARDYIVPSRKYKGKFYALPQAPQQYKQLLMVSGFDKYFQIAPCFRDED
FT                   ARADRSPGEFYQLDFEMSFATQEDVFRIGEEVLTETFAKFAPEGYEVTQAPYPIISYKQ
FT                   AMLEFGSDKPDLRNPLRIIDLSEFFNKCTFKPFQNKTVRAINVHAKLSKGQHEKLLKFA
FT                   TGIGMGGLGYLEVLEDGSYKGPIDKFIPEELKGEIKDLAGLQPGDTIFFIADKEDRAAY
FT                   FAGQIRNELGERLDLIEKNAYRFCYVNDFPMFERDPETKKIGFTHNPFSMPQGGLEALN
FT                   TKDPLDILAYQYDIVCNGVELSSGAVRNHDMQIMVKAFEIAGYDEEVLKAKFGALYNAF
FT                   QFGAPPHAGMAPGVDRMIMLLRNEENIREIIPFPMSGTAQDLMCGAPNEVTEQQLREVH
FT                   IKVRD"
FT   gene            complement(456000..456128)
FT                   /locus_tag="EUBELI_00445"
FT   CDS_pept        complement(456000..456128)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00445"
FT                   /product="Hypothetical protein"
FT                   /note="Psort-B: Unknown cell location"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00445"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71461"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z3J2"
FT                   /protein_id="ACR71461.1"
FT                   /translation="MAGISTFFPSEEFIFRQVLVVEGQAAGFFINSQARCFGAAGT"
FT   gene            456422..456718
FT                   /locus_tag="EUBELI_00446"
FT   CDS_pept        456422..456718
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00446"
FT                   /product="aspartyl-tRNA(Asn)/glutamyl-tRNA (Gln)
FT                   amidotransferase subunit C"
FT                   /note="Psort-B: Cytoplasmic, score:8.87; COG0721
FT                   Asp-tRNAAsn/Glu-tRNAGln amidotransferase C subunit;
FT                   HMMPfam:IPR003837; HMMTigr:IPR003837; K02435
FT                   aspartyl-tRNA(Asn)/glutamyl-tRNA (Gln) amidotransferase
FT                   subunit C"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00446"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71462"
FT                   /db_xref="GOA:C4Z3J3"
FT                   /db_xref="InterPro:IPR003837"
FT                   /db_xref="InterPro:IPR036113"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z3J3"
FT                   /protein_id="ACR71462.1"
FT                   /translation="MANVISDETIEYVGILAKLELSDEEKEAAKKDMASMLDYIDKLGE
FT                   LDTTGVEPMSHVFPVNNVMREDVVTNGDGSEATLANAPECNESGFIVPKTVES"
FT   gene            456730..458175
FT                   /locus_tag="EUBELI_00447"
FT   CDS_pept        456730..458175
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00447"
FT                   /product="amidase"
FT                   /note="Psort-B: Cytoplasmic, score:8.87; COG0154
FT                   Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit and
FT                   related amidases; HMMPfam:IPR000120; Gene3D:IPR000120;
FT                   HMMPanther:IPR000120; HMMTigr:IPR004412;
FT                   ScanRegExp:IPR000120; superfamily:IPR000120; K01426
FT                   amidase"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00447"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71463"
FT                   /db_xref="GOA:C4Z3J4"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="InterPro:IPR004412"
FT                   /db_xref="InterPro:IPR020556"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4Z3J4"
FT                   /protein_id="ACR71463.1"
FT                   /translation="MSLLDYTAVELAAKIKAGETTATEAMEAVIAQIEKSEDELNCYVT
FT                   FDKEKALAAAKKADEDIKAGKLTGPLAGVPFAIKDNMCTEGMLTTCSSKILGNFVPTYT
FT                   ADAVERLQNAGAVIIGKTNMDEFAMGSTTETSAFGATKNPRNPEHVPGGSSGGSAAAVA
FT                   ANECFAALGSDTGGSIRQPASYCGVVGLKPTYGTVSRYGLIAYGSSLDQIGPLCKDVTD
FT                   CATIMEAIAGKDDKDSTSIGRDDYSFTNALVDDVKGMKIGIPRDYFGEGLDPEVKEAVL
FT                   NAAKVLESKGAIVEEFDLSLVEYAIPTYYTIAAAEASSNLERFDGVKYGYRTKEYEGLH
FT                   NMYKKTRSEGFGPEVKRRIMLGSFVLSSGYYDAYYLKALRVKALIKKAFDEAFAKYDVI
FT                   LGPVAPTTAPKLGSSLSDPIKMYLGDIYTISVNLAGLPGLSVPCGKDKNGLPIGLQLIG
FT                   DCFKENNIIRAGYAYEQARGRFE"
FT   gene            458191..459642
FT                   /locus_tag="EUBELI_00448"
FT   CDS_pept        458191..459642
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00448"
FT                   /product="aspartyl-tRNA(Asn)/glutamyl-tRNA (Gln)
FT                   amidotransferase subunit B"
FT                   /note="Psort-B: Cytoplasmic, score:8.87; COG0064
FT                   Asp-tRNAAsn/Glu-tRNAGln amidotransferase B subunit (PET112
FT                   homolog); HMMPfam:IPR003789; HMMPfam:IPR006075;
FT                   HMMPfam:IPR006107; HMMPanther:IPR004413; HMMTigr:IPR004413;
FT                   ScanRegExp:IPR004413; superfamily:IPR003789; K02434
FT                   aspartyl-tRNA(Asn)/glutamyl-tRNA (Gln) amidotransferase
FT                   subunit B"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00448"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71464"
FT                   /db_xref="GOA:C4Z3J5"
FT                   /db_xref="InterPro:IPR003789"
FT                   /db_xref="InterPro:IPR004413"
FT                   /db_xref="InterPro:IPR006075"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR017958"
FT                   /db_xref="InterPro:IPR017959"
FT                   /db_xref="InterPro:IPR018027"
FT                   /db_xref="InterPro:IPR023168"
FT                   /db_xref="InterPro:IPR042114"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4Z3J5"
FT                   /protein_id="ACR71464.1"
FT                   /translation="MKDYEVVIGLEVHVELATKTKIFCGCSTEFGGAPNSHTCPVCTGM
FT                   PGSLPVLNKKVVEYAAAVGLATNCTITQDCKFDRKNYFYPDNPQNYQISQLYLPICRNG
FT                   HVDVTLSDGTEKTIRIHEIHMEEDAGKLVHDEWEGVSYVDYNRSGVPLIEIVSEPDMRS
FT                   AEEVIAYLTKLRTTIQYLGASDCKLQEGSMRADVNLSVRERGSNEFGTRTETKNLNSFA
FT                   AIERAIKAETARQIDLIEAGEKVVQETRRWNDDKEYSYAMRSKEDAQDYRYFPDPDLVP
FT                   IHISDEYLAELKAKQPEFKDEKKARYIEEFGLPEYDAEILTDSKKFTEIFEEATAICNQ
FT                   PKKVSNWIMGETMRLMKEESAKTGREFRAEELTFSPESLAKIITLVEKKEINNAAAKEI
FT                   FEHVFAENVDVDAYVEEHGLKQVNDEGALRATVEKVIADNPQSVADYKGGKKQAIGYLV
FT                   GQTMKAMQGKANPGMVNALLQELLK"
FT   gene            459675..461051
FT                   /locus_tag="EUBELI_00449"
FT   CDS_pept        459675..461051
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00449"
FT                   /product="Glycoside Hydrolase Family 28-like
FT                   polygalacturonase"
FT                   /note="Psort-B: Extracellular, score:8.10; COG5434
FT                   Endopolygalacturonase; HMMPfam:IPR000743; Gene3D:IPR012334;
FT                   ScanRegExp:IPR000743; superfamily:IPR011050"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00449"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71465"
FT                   /db_xref="GOA:C4Z3J6"
FT                   /db_xref="InterPro:IPR000743"
FT                   /db_xref="InterPro:IPR006626"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z3J6"
FT                   /protein_id="ACR71465.1"
FT                   /translation="MKKVNFDVKLPAFVERIVYVDNYGARPYCYTIEDASRNADAINRA
FT                   INYISEKGGGTVVIPDGIWFTAPIEIKSDVELRIEKNAILKFSKDIDQYPLIITNYEGQ
FT                   ECIRAKSPITAENAINIGITGGGVIDGSGDMWRPIKQFKITDRQWEALMKKSQYIIDTK
FT                   GGGIWMPTESSFKGNEHNIQLDAENALEKASEYYDFYRPVMVSLRHCKRILLDGVTFKN
FT                   SPAWNIHPFFCKNLTVRNVTVSNPYYAQNGDGIDVESCKKVHIHNCTFETGDDAICLKS
FT                   GKNAVARQIEGPCEDVYIHDCLVNEGHGGFVIGSEMSRGIKNVLVENCTFLGTDVGVRI
FT                   KSALGRGGVIENINIKNINMVDIKEQAIILTMSYVLNSLNRDEEINGIDKDDIPYFKNI
FT                   NFEGINCLGAKEAVVIEPIKDMPETITDIHIKASSFVTSGENRVGCDCLTSEQTTYEIL
FT                   "
FT   gene            complement(461104..461487)
FT                   /locus_tag="EUBELI_00450"
FT   CDS_pept        complement(461104..461487)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00450"
FT                   /product="Hypothetical protein"
FT                   /note="Psort-B: Unknown cell location; HMMPfam:IPR009875"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00450"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71466"
FT                   /db_xref="GOA:C4Z3J7"
FT                   /db_xref="InterPro:IPR009875"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z3J7"
FT                   /protein_id="ACR71466.1"
FT                   /translation="MGDFIMANGIEKRRFKRMKADLRLNVSSLFNQDNKEIKNLDSPIT
FT                   VTNISEGGIAFESKSMLPINFYFNAALNLGSETDTLYSVVKIIRSQPIEGTDNYLYGCE
FT                   FVGMAPILGYIFDEYEAKIEKKN"
FT   gene            461711..462601
FT                   /locus_tag="EUBELI_00451"
FT   CDS_pept        461711..462601
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00451"
FT                   /product="phosphoribosylaminoimidazole-succinocarboxamide
FT                   synthase"
FT                   /note="Psort-B: Cytoplasmic, score:8.87; COG0152
FT                   Phosphoribosylaminoimidazolesuccinocarboxamide (SAICAR)
FT                   synthase; HMMPfam:IPR001636; BlastProDom:IPR001636;
FT                   Gene3D:IPR013816; HMMPanther:IPR001636; HMMTigr:IPR001636;
FT                   ScanRegExp:IPR001636; K01923
FT                   phosphoribosylaminoimidazole-succinocarboxamide synthase"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00451"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71467"
FT                   /db_xref="GOA:C4Z3J8"
FT                   /db_xref="InterPro:IPR001636"
FT                   /db_xref="InterPro:IPR018236"
FT                   /db_xref="InterPro:IPR028923"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4Z3J8"
FT                   /protein_id="ACR71467.1"
FT                   /translation="MDELMGKCELLYEGKVREVYDCDDKLVMVATDRISAFDHILKNKV
FT                   TEKGAILTQMSKFWFDYTKDVVANHMVSVDVNDMPEFFHKDEYIGRSMLCKKLTMLPVE
FT                   CIVRGYITGSGWASYKENGTVCGIKLPEGLKESEKLPEPIYTPSTKAEIGDHDENISFE
FT                   KSIEVLEKQFPGKGLEYATKIKDATITLYKKCAEYALSKGIIIADTKFEFGLDENGEVV
FT                   IGDEMLTPDSSRFWPLEGYEAGKSQPSYDKQFVRDWLKANPDSDYLLPDDVIEKTVEKY
FT                   KEAYKLLTGKDFSRK"
FT   gene            462628..464070
FT                   /locus_tag="EUBELI_00452"
FT   CDS_pept        462628..464070
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00452"
FT                   /product="amidophosphoribosyltransferase"
FT                   /note="Psort-B: Cytoplasmic, score:8.87; COG0034 Glutamine
FT                   phosphoribosylpyrophosphate amidotransferase;
FT                   HMMPfam:IPR000583; HMMPfam:IPR000836; HMMPanther:IPR005854;
FT                   HMMTigr:IPR005854; ScanRegExp:IPR000634;
FT                   ScanRegExp:IPR002160; ScanRegExp:IPR002375; K00764
FT                   amidophosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00452"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71468"
FT                   /db_xref="GOA:C4Z3J9"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005854"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR035584"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z3J9"
FT                   /protein_id="ACR71468.1"
FT                   /translation="MNQIDINDSHYAEDELHEECGVFGVYDFDGNDVSSTIYYGLFALQ
FT                   HRGQESCGIAVSDTEGPKGKVLSYKDMGLVNEVFNPEKLEKLNGNIGVGHVRYSTAGSS
FT                   SRENAQPLVLNYVKGTLGMAHNGNLLNAVELREELSYTGAIFQTTIDSEVIAYLIARER
FT                   LNVPTVEGAVLNAMKKIKGAYSLIVMSPRKLIGARDPFGFKPLCIGKRDNAYFLSSETC
FT                   ALDTVGAEFVRDVEPGEVVTITKDGIKSDKSLCQKNTARCIFEYIYFARPDSKIDGMGV
FT                   YESRINAGRILAKTHPVEADIVVGVPESGNPAALGFSMESGIPYGNAFIKNNYVGRTFI
FT                   KPKQEQRESSVKVKLNVLKEAVAGKRVVMIDDSIVRGTTSARIVSLLKAAGAKEVHVRI
FT                   SSPAFLHPCYFGTDIPSEDQLIASGHSVDEICEIIGADSLGYLEVDKLSEMICGQTGYC
FT                   DACFTGNYPIEPPKIDIRGEMG"
FT   gene            464274..465650
FT                   /locus_tag="EUBELI_00453"
FT   CDS_pept        464274..465650
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00453"
FT                   /product="uroporphyrin-III C-methyltransferase /
FT                   precorrin-2 dehydrogenase / sirohydrochlorin
FT                   ferrochelatase"
FT                   /note="Psort-B: Cytoplasmic, score:8.87; COG1648 Siroheme
FT                   synthase (precorrin-2 oxidase/ferrochelatase domain);
FT                   HMMPfam:IPR000878; Gene3D:IPR014776; Gene3D:IPR014777;
FT                   HMMTigr:IPR006366; HMMTigr:IPR006367;
FT                   superfamily:IPR000878; K02302 uroporphyrin-III
FT                   C-methyltransferase K02303 precorrin-2 dehydrogenase K02304
FT                   sirohydrochlorin ferrochelatase"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00453"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71469"
FT                   /db_xref="GOA:C4Z3K0"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR006366"
FT                   /db_xref="InterPro:IPR006367"
FT                   /db_xref="InterPro:IPR012409"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z3K0"
FT                   /protein_id="ACR71469.1"
FT                   /translation="MSYFPFFREIEGEKCLVIGGGKVAARKISRLKGFGVKIKVVAPSI
FT                   VSDIEAVAQACDNISVERRIFTPQDIENVDFVIAAAGEEVDKEATRLCKEKAIPVNVVD
FT                   NQELCDFIFPSIVQKGDMVAGFVTGGKSPHVAAKLRRDFEANVSDNIESILDYLSEVRT
FT                   LAKEKIDDDRKRAAFIREVSEFCMKADRVCSNKEENAFLQKYLDNRSETVLPGAALVGA
FT                   GCGSYELITIKGLNEIRRAEVIVYDDLIDEHLLEFAPESCELIYAGKRSGRHSKAQEEI
FT                   NELLVEKALEGRYVVRLKGGDPYVFGRGGEEALALKEHGIPVHEVPGVTSGIGLCGMAG
FT                   IPVTHRGASRGFHVITGHTADNLSPEVEEIRWKSYAKLDETFVFLMGLKSIDMITEKLM
FT                   RYGKLSDTPVAVIHGENTDGTYVKLVGTLSDIAAKVKEVDFPSPAIIVVGEVASLELTD
FT                   "
FT   gene            465698..466294
FT                   /locus_tag="EUBELI_00454"
FT   CDS_pept        465698..466294
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00454"
FT                   /product="putative hydrolases of HD superfamily"
FT                   /note="Psort-B: Cytoplasmic, score:8.87; COG1896 Predicted
FT                   hydrolases of HD superfamily; HMMPfam:IPR006674; K07023
FT                   putative hydrolases of HD superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00454"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71470"
FT                   /db_xref="GOA:C4Z3K1"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR039356"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z3K1"
FT                   /protein_id="ACR71470.1"
FT                   /translation="MDKDRLDRQIEFIREIDKEKSIGRQTYLADASRKEDDAEHAWHMA
FT                   IMTVLLSEYANEKIDVLRTMTMLLIHDLVEIDAGDTYAYDENAKKTQRERELKCADRIF
FT                   SILPEDQGKYMRELWEEFEAQETPEAKFARTMDNFQPVILNDASKGKSWAEKGVHLSQI
FT                   LKRNARTGEGSEELWKYSYEKFIMPNVKKGNIKED"
FT   gene            466533..467090
FT                   /locus_tag="EUBELI_00455"
FT   CDS_pept        466533..467090
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00455"
FT                   /product="Hypothetical protein"
FT                   /note="Psort-B: Unknown cell location; COG1373 Predicted
FT                   ATPase (AAA+ superfamily)"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00455"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71471"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z3K2"
FT                   /protein_id="ACR71471.1"
FT                   /translation="MQTYLINNFGSTTSLKSILKELHKSGMDIKRETLNRYINILMDAK
FT                   IIYECKRFDLKSINGEQKYYLSDMGFYFATNTDNRINYGPALENVVFNYAKSKGYDISI
FT                   GRIGKLECDFIMRDNMNNYGYVQVTMTTMLNRETEDREYAPLEMIKDNYPKYVLTRNDM
FT                   IQKRNGIIHENIPQFMASGKLF"
FT   gene            complement(467087..468268)
FT                   /locus_tag="EUBELI_00456"
FT   CDS_pept        complement(467087..468268)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00456"
FT                   /product="Hypothetical protein"
FT                   /note="Psort-B: CytoplasmicMembrane, score:9.26; COG2972
FT                   Predicted signal transduction protein with a C-terminal
FT                   ATPase domain; HMMPfam:IPR003594; superfamily:IPR003594"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00456"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71472"
FT                   /db_xref="GOA:C4Z3K3"
FT                   /db_xref="InterPro:IPR032834"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z3K3"
FT                   /protein_id="ACR71472.1"
FT                   /translation="MFSLLIPVAILTNAALNAFCSFIVYLCCIVLNYDSKPVWALFHAL
FT                   ALTILMALSEGLIAAAIPDITIYAFRDGNIHSSAFTFVILSKSVYLCISQLVTRIFSKN
FT                   TVNNASIRKSTLMLYLIPVMSSIITVSLGYICLNGKLSGSDSVIVFICLVLLLSINILT
FT                   FYLQQDISQKNVEYARLQIELQKETDTEHYYNYVQEVNEKQHILIHDIKNHLNTISQLN
FT                   DGKHIDEITGYINNILGSDALRKSKRYCKIDILNVIISRYAEQCSNSGISFEADIRANT
FT                   LEYLPAQDFTSIFCNLLDNAIDASLSCDEPYIDCNVSLIRGGNADLISIANSCKSSPLG
FT                   HDGKLHSRKQDTGFHGYGLKSVKRIADKYNGLLNYVYSEEKQEFRVVVMLEHP"
FT   gene            complement(468414..469211)
FT                   /locus_tag="EUBELI_00457"
FT   CDS_pept        complement(468414..469211)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00457"
FT                   /product="two-component system, LytT family, response
FT                   regulator"
FT                   /note="Psort-B: Cytoplasmic, score:8.87; COG3279 Response
FT                   regulator of the LytR/AlgR family; HMMPfam:IPR001789;
FT                   HMMPfam:IPR007492; BlastProDom:IPR001789;
FT                   HMMSmart:IPR001789; superfamily:IPR011006; K02477
FT                   two-component system, LytT family, response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00457"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71473"
FT                   /db_xref="GOA:C4Z3K4"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR007492"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z3K4"
FT                   /protein_id="ACR71473.1"
FT                   /translation="MTLFVFKITFILIFSSVIITIVLFYGDWIMNIFICDDDNLICEQI
FT                   KTLCESYYIEHKLKRPDIYIFHSGEDILASDIKPDIVYLDIQMSGIDGIAVGNSLVKSY
FT                   PAAIIIIITSFPEYLDEAMRFHVFRYISKPVESKRFMRNLEDAISEFNSIGGRIIVKCK
FT                   GKTYVLSAKDIIMVEVNPHCRNLTIHTVSDTYTTTQTLASIKSMLPSGSFYQSHRCYIV
FT                   NMNYIMSYNNSRIYMENHLYADIALRKYNDFFNTYSAFLTTLR"
FT   gene            469402..470589
FT                   /locus_tag="EUBELI_00458"
FT   CDS_pept        469402..470589
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00458"
FT                   /product="Hypothetical protein"
FT                   /note="Psort-B: Unknown cell location"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00458"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71474"
FT                   /db_xref="GOA:C4Z3K5"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z3K5"
FT                   /protein_id="ACR71474.1"
FT                   /translation="MKRRGIRYVIPIIFIAVLVGAMVTYVLLHKNTEAEKGLDYASLIG
FT                   VTGDSDFQNYWDTDGWYDLAAVEDGYYYMNFEQKLLFLNLETNDVIPVCAKPECDHKSS
FT                   SCNAFFGNGAALRSIYYYRGYIYYFGLSNGMAQLCRMDKSGTTREVIGELIPNDGVDSI
FT                   RAVFQGEYAFIYDGSGLADEQETTKSIIEVSLTSGDKKIVYEVTGKGISITNVKCFGDK
FT                   IFFTVRKADSISDKAISVHSRGLFSYSCSNDEIEEVSGQNINDYYVVDGTMYYFVTGEG
FT                   LYKIDIGSDISQKIWESTEQCDMCSVSSDGEYIYLNNHKYCYYMWELYGFSENRYIVID
FT                   KGGNVINEILCPDALALYFGDDRYLFYKSMNDAEGLMYMKKDDIETGGDWKQVFE"
FT   gene            470586..471314
FT                   /locus_tag="EUBELI_00459"
FT   CDS_pept        470586..471314
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00459"
FT                   /product="Hypothetical protein"
FT                   /note="Psort-B: Unknown cell location"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00459"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71475"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z3K6"
FT                   /protein_id="ACR71475.1"
FT                   /translation="MTKYIRLFKKGMYRFCMMFLLILISSGCNVKEIETQTQTETNNQY
FT                   AVQEPEMTVIDGINYITEQGIKLKVTYPIISKDIADGNLVGTYMVNPVKLGNGLGEKDE
FT                   MAYIVAGIIEWPSLYNDENIEKLEYTAYNASCIFDYSDMSENKYTKKQMDIKGETKTIY
FT                   GNDENKLKLIIINELPTSDKAAYSYMQPEYVEIKSVIDDINKMIVGVHVYYMDGSEDSD
FT                   YYRVESISKSDISRIQIYRL"
FT   gene            471334..473292
FT                   /locus_tag="EUBELI_00460"
FT   CDS_pept        471334..473292
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00460"
FT                   /product="Hypothetical protein"
FT                   /note="Psort-B: CytoplasmicMembrane, score:9.99"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00460"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71476"
FT                   /db_xref="GOA:C4Z3K7"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z3K7"
FT                   /protein_id="ACR71476.1"
FT                   /translation="MQELKRIINYKRIILLLIAATVNVVFFLYDNKPVMDEDIINKENV
FT                   AHETYIKNYHEEVNAIIDNADKLKKYSIFNKAGSFSYANILQTARDFERVKNVILPEDE
FT                   YKGVQAYTTYYYQYFFTMLVMMFVIYDMFAQRDNGMWSITYSCANGRIMYAIKQTGVIV
FT                   VTGAFTHTLIYWSTFIAAMLQRGGVRDLVNPVQTIETFDKFTYPWSKIKYVTVLYLISM
FT                   VCIVALCITIWGVFVMFRNRVYALVTMLIFAAVEQFIYSHIDIHSVWNGLHYINIINII
FT                   NINATFSSYRNWGVGTYVFPVFSVVLFVHIICAGVIGYIAINVSASMKPYKNTTFIKRF
FT                   TDCVSAGCQKILARIPFLFKEIHKFIFTSHCGWVVVVMLTVTAYVCQTGQYHYTDDNKY
FT                   MDSEYMLHGGKDYTYFQDYLDNLYQQRDELQADIDDYGDILTRDESVDIGSYVNLKTKQ
FT                   QQILKLIESRREYADKIEYIGHMDETFNIRAWMISDRGYEVILGKKGLYRRIMVNLALI
FT                   CGFILMSADAGRLERVSGMILFEHSTALGRNKMRCNKYLSCITITIIMTVIICGMEFLW
FT                   MRHIYGIPYMNAPVVSLTFMGNKLGMGLYASGILKWMLLHMTIWQYMLMQFIMRLVICL
FT                   ILSVGIMKITRSIKNIK"
FT   gene            473378..474826
FT                   /locus_tag="EUBELI_00461"
FT   CDS_pept        473378..474826
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00461"
FT                   /product="adenylosuccinate lyase"
FT                   /note="Psort-B: Cytoplasmic, score:8.87; COG0015
FT                   Adenylosuccinate lyase; HMMPfam:IPR000362;
FT                   HMMTigr:IPR004769; ScanRegExp:IPR000362;
FT                   superfamily:IPR008948; K01756 adenylosuccinate lyase"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00461"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71477"
FT                   /db_xref="GOA:C4Z3K8"
FT                   /db_xref="InterPro:IPR004769"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR019468"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z3K8"
FT                   /protein_id="ACR71477.1"
FT                   /translation="MKGGYEMNDRYQTPLAERYASKEMQYIFSPDMKFKTWRRLWIALA
FT                   ETEHELGLPITQEQIDELKAHKDDINYEDAKRREKEVRHDVMSHVYAYGLQCPKAKGII
FT                   HLGATSCYVGDNTDIIIMTEGLKLVRKKLVNVIDELSKFADKYKAQPTLAFTHFQPAQP
FT                   TTVGKRATLWLNELVMDLEDLDYVLSTMKLLGCKGTTGTQASFLELFNGDQDKIRQIDG
FT                   KIAEKMGFDACVPVSGQTYSRKVDTRVLNVLAGIAASAHKFSNDIRLLQHLKEVEEPFE
FT                   KSQIGSSAMAYKRNPMRSERMASLADFVISDALNPAIVSSTQWFERTLDDSANKRMSVP
FT                   EGFLAVDGILDLYLNVVDGLVVYDKVIIKHMMAELPFMATENIMMDAVKAGGDRQELHE
FT                   KIRELSMIAGKRVKQEGLDNNLLELIAAEPMFGVTLEELQSKLDPMKYVGRSKEQVDEY
FT                   LADVIKPILDANKEELGMKAEINV"
FT   gene            474851..475432
FT                   /locus_tag="EUBELI_00462"
FT   CDS_pept        474851..475432
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00462"
FT                   /product="Hypothetical protein"
FT                   /note="Psort-B: Unknown cell location; COG0655 Multimeric
FT                   flavodoxin WrbA; HMMPfam:IPR005025"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00462"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71478"
FT                   /db_xref="GOA:C4Z3K9"
FT                   /db_xref="InterPro:IPR005025"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z3K9"
FT                   /protein_id="ACR71478.1"
FT                   /translation="MKVVLVNGSRRDAGCTYTALSVVAKELEAQGIDTEIVAVGSRVVK
FT                   GELDAVVKEVGAKITDADGLIVGSPVYYASPTGEILMFLDRLFGAYGNELRYKCGSSIA
FT                   SARRGGTTSTVDVLNKYFQINQMPVVSSNYWNIVHGNTPDEVVKDEEGMQTMRLLGQNF
FT                   AWLVKSIDAAKKAGIELPQGENKIKTNYIR"
FT   gene            475488..477002
FT                   /locus_tag="EUBELI_00463"
FT   CDS_pept        475488..477002
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00463"
FT                   /product="Hypothetical protein"
FT                   /note="Psort-B: Unknown cell location; COG1502
FT                   Phosphatidylserine/phosphatidylglycerophosphate/cardiolipi
FT                   n synthases and related enzymes; HMMPfam:IPR001736;
FT                   HMMSmart:IPR001736"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00463"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71479"
FT                   /db_xref="GOA:C4Z3L0"
FT                   /db_xref="InterPro:IPR001736"
FT                   /db_xref="InterPro:IPR025202"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z3L0"
FT                   /protein_id="ACR71479.1"
FT                   /translation="MYIQHAFTARAVMRIDRYLRSIVVKSYKRRKLMKRIILGAVILLV
FT                   VLIAAIVACALISYHKQPELTADEINQLDEQGIWKERTSAERARIIEDNDEALKERIRM
FT                   ISNAKSEIILSTFDFRSDDSGKLMLGALIDAADRGVSVNVIVDGVSGFTKMKGNPDFKA
FT                   LASSDNVNVKIYNKVNPFKPWQSMGRLHDKYVIADRTNYILGGRNTFNYFLGAYPGHKN
FT                   YDRDVLVYCESPDETSSVNDVLAYYESVWNYKESKAFLKNNKCAGNKKVKAARKELLDN
FT                   YNIYYADNKDYLTDTDYTDETVEVNNIALLSNPIECGAKKPVVWYQLTKLMEQADSQVK
FT                   IHTPYIICNEYMYDGLKKVCDSVENVSLMTNSVGNNGNPFGSADYYAHKDKVLGTGLEV
FT                   WEYEGGYSYHGKSVLIDDDISVVGSFNIDMRSVYLDTELMLVIDSKEINEQLGGAMQTY
FT                   EHSARKANADGTYDNPYNVQPVALTPKRERRMKLIKNFLLWTRYLF"
FT   gene            477122..477194
FT                   /locus_tag="EUBELI_00464"
FT   tRNA            477122..477194
FT                   /locus_tag="EUBELI_00464"
FT                   /product="tRNA-Val"
FT   gene            477225..477298
FT                   /locus_tag="EUBELI_00465"
FT   tRNA            477225..477298
FT                   /locus_tag="EUBELI_00465"
FT                   /product="tRNA-Met"
FT   gene            477510..478184
FT                   /locus_tag="EUBELI_00466"
FT   CDS_pept        477510..478184
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00466"
FT                   /product="Hypothetical protein"
FT                   /note="Psort-B: Cytoplasmic, score:8.87; COG4912 Predicted
FT                   DNA alkylation repair enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00466"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71480"
FT                   /db_xref="InterPro:IPR014825"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z3L1"
FT                   /protein_id="ACR71480.1"
FT                   /translation="MTHLQEELFKLQDTAYRDFHSSLMPGVDKEAVIGVRTPVLRAFAK
FT                   KFSKTEEAEQFMTELPHKYYEENNLHMMLIAQIKDYNMCVSETEKFLPYIDNWATCDSP
FT                   LPKCFDKNKEDIIVRAKNWIATDDTYVKRYGMGVMMRLFLDEDFKEEYIQLVAGVKSEE
FT                   YYVNMMIAWYMATALAKQWDAAIPYIQEHRLSEWVHRKSIQKAVESYRITPEQKDYLKG
FT                   LR"
FT   gene            478189..479526
FT                   /locus_tag="EUBELI_00467"
FT   CDS_pept        478189..479526
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00467"
FT                   /product="multidrug resistance protein, MATE family"
FT                   /note="Psort-B: CytoplasmicMembrane, score:9.99; COG0534
FT                   Na+-driven multidrug efflux pump; HMMPfam:IPR002528;
FT                   HMMPanther:IPR002528; HMMPanther:IPR015522;
FT                   HMMTigr:IPR002528; ScanRegExp:IPR001241; K03327 multidrug
FT                   resistance protein, MATE family"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00467"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71481"
FT                   /db_xref="GOA:C4Z3L2"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z3L2"
FT                   /protein_id="ACR71481.1"
FT                   /translation="MKSNEIDMTTGSLPKKILMYSVPLMLSNVLQVMFNLCDVAVVGKF
FT                   VGPLALGAVGSTSIIITLTTGILLGLAGGVNAVVALFVGAKNSANVKKAVHTSIVICMI
FT                   AGLLLLLSGLFLSRPVLNLIGTKKELIDGAVIYLTIYLLGSPALAMYNYGNAVLSAVGD
FT                   TKRPLMYLITAGIINVVLNLFFVIVCRLGVVGVALASIISQYISAFLILKFLFGCGKDY
FT                   GLYITNIGMDSHIAARVLRIGLPAAVQYSLFAVANLYIQSAVNSFDHVVVEGNSAAANA
FT                   DNIVYDMMAAFYTACTSFIAQNLGARKRDRIKKAYLVTQMYSFIIGAVLGALLVVFRTQ
FT                   FLSIFTSDPDVMHYGSIRLGIMGCSYFISAFMDNAAAGARGLGRSVIPTIIVIMGSVVF
FT                   RIVWVCTIFASIHTLMSLYLVYASAWAFTSIIGTVYFIIIFRKTLR"
FT   gene            479729..480598
FT                   /locus_tag="EUBELI_00468"
FT   CDS_pept        479729..480598
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00468"
FT                   /product="phosphate transport system substrate-binding
FT                   protein"
FT                   /note="Psort-B: Unknown cell location; COG0226 ABC-type
FT                   phosphate transport system, periplasmic component;
FT                   HMMPfam:IPR006059; HMMTigr:IPR011862; K02040 phosphate
FT                   transport system substrate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00468"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71482"
FT                   /db_xref="GOA:C4Z3L3"
FT                   /db_xref="InterPro:IPR011862"
FT                   /db_xref="InterPro:IPR024370"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z3L3"
FT                   /protein_id="ACR71482.1"
FT                   /translation="MRKGIKKLLTVALTATLGLAALAGCGTGTSSNGDGSANGGTTKEL
FT                   SGKIQLAGSTSMEKMCGALMEAFMEEYPNVTVTTEYTGSGAGIESVTSGAVDIGNASRA
FT                   LSDKEKSAGIEENIVAIDGIAMITDKNNKVTNVTKQQLTDIYTGKITNWKDLGGSDEAI
FT                   VVIGREAASGTRGAFEELLEVKNKCAYAQELDSTGAVLAKVAATPGAIGYVSLDVVDKT
FT                   VAALKLDGVDATEDNIKAGKYTLSRPFVMATKGSVSSQSELVQTWFNFVKSEAGKKVIK
FT                   GVGLILPE"
FT   gene            480634..481626
FT                   /locus_tag="EUBELI_00469"
FT   CDS_pept        480634..481626
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00469"
FT                   /product="phosphate transport system permease protein"
FT                   /note="Psort-B: CytoplasmicMembrane, score:10.00; COG0573
FT                   ABC-type phosphate transport system, permease component;
FT                   HMMPfam:IPR000515; HMMTigr:IPR011864; K02037 phosphate
FT                   transport system permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00469"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71483"
FT                   /db_xref="GOA:C4Z3L4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR011864"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z3L4"
FT                   /protein_id="ACR71483.1"
FT                   /translation="MEEVINVGMNRINKTPAAVKVTANGSLKGNKKSKHASESVARFIF
FT                   LICAVVAILAVCSITIYMFIKGTESLKSVGIADLLFKTVWAPTATPPAYGIVYIILSSI
FT                   AGTTLAILIGVPIGLLTAVFLTEIAGKKLAAVVQPAVELLAAIPSVIYGLLGLMLLNPL
FT                   LYKLEKHVFANSTTHQYTGGANLLAAVLVLAIMILPTVINMSASAIRAVPMNLRATSLA
FT                   LGATKIQTIFKVVVPAAKSGIITGIVLGIGRALGEAMAINLVAGGSVNLPLPFNSVRFL
FT                   TTQIVSEMSYADGVHRQVLFTVGLVLYIFIMIINLIITFMQKKGEKANG"
FT   gene            481619..482479
FT                   /locus_tag="EUBELI_00470"
FT   CDS_pept        481619..482479
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00470"
FT                   /product="phosphate transport system permease protein"
FT                   /note="Psort-B: CytoplasmicMembrane, score:10.00; COG0581
FT                   ABC-type phosphate transport system, permease component;
FT                   HMMPfam:IPR000515; HMMTigr:IPR005672; K02038 phosphate
FT                   transport system permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00470"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71484"
FT                   /db_xref="GOA:C4Z3L5"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR005672"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z3L5"
FT                   /protein_id="ACR71484.1"
FT                   /translation="MDNLKAKKRHPEEIAVYSAIYVCAAFSVLLLLGIIVYVFAKGARR
FT                   VNWAFLTGVTSILHGTVGIAGNILNTLIIILLTMIITTPIGVGAAIYLNEYAKPGKLVT
FT                   VIIFATETLAGIPSIIFGLFGMLFFGQLCHMGYSLLTGSLTLTLMVLPLVTRNTQEALK
FT                   TVPDSFRTGAVGLGAGKWYTIRTILLPSAMPGIVTGVILAIGRIIGESAALLFTAGSAH
FT                   LLPKTFDAFLEKIFHSGGTLTIQLYLSASKGEFEVAFGIAVVLLVIVLLINFGTKRLAK
FT                   KLEKH"
FT   gene            482493..483254
FT                   /locus_tag="EUBELI_00471"
FT   CDS_pept        482493..483254
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00471"
FT                   /product="phosphate transport system ATP-binding protein"
FT                   /note="Psort-B: CytoplasmicMembrane, score:9.49; COG1117
FT                   ABC-type phosphate transport system, ATPase component;
FT                   HMMPfam:IPR003439; BlastProDom:IPR003439;
FT                   HMMPanther:IPR005670; HMMSmart:IPR003593;
FT                   HMMTigr:IPR005670; ScanRegExp:IPR003439; K02036 phosphate
FT                   transport system ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00471"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71485"
FT                   /db_xref="GOA:C4Z3L6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005670"
FT                   /db_xref="InterPro:IPR015850"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z3L6"
FT                   /protein_id="ACR71485.1"
FT                   /translation="MSNKIKVKVENLNLYYGENHALKDVNMDIQENAVTAFIGPSGCGK
FT                   STFLKTLNRMNDLVDGVRIDGKVLLDGEDIYEPGVDTTILRKKVGMVFQQPNPFPMSIY
FT                   DNIAYGPRVHGIRDKKRLDQIVEESLRGAAIFDEVKDRLKKSAMGLSGGQQQRICIARA
FT                   LAVQPEVLLMDEPTSALDPISTSKIEDLMEDLKKKYTVIVVTHNMQQATRVSDQTAFFL
FT                   VGEMVEFGDTKQIFSYPQDKRTEDYITGRFG"
FT   gene            483251..483922
FT                   /locus_tag="EUBELI_00472"
FT   CDS_pept        483251..483922
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00472"
FT                   /product="phosphate transport system protein"
FT                   /note="Psort-B: Cytoplasmic, score:9.98; COG0704 Phosphate
FT                   uptake regulator; HMMPfam:IPR008170; HMMTigr:IPR008170;
FT                   K02039 phosphate transport system protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00472"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71486"
FT                   /db_xref="GOA:C4Z3L7"
FT                   /db_xref="InterPro:IPR026022"
FT                   /db_xref="InterPro:IPR028366"
FT                   /db_xref="InterPro:IPR038078"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z3L7"
FT                   /protein_id="ACR71486.1"
FT                   /translation="MMRSKFDEQLDRLNKEMMKMGSAIEDSIRKAVDALVRQDAELAKK
FT                   VMLQDEEIDREQKTIESICFNLLIQQQPVAKDLRTITAALKMVTDMERIGDQAADIGEI
FT                   TIKLANQPYIKKLEHINQMASETMLMLIRSIEAYVEKDMDKARKVIAYDDVVDDLFEKV
FT                   RDDLIAMIQADSANGEQAADLLMVAKYFERIGDHATNIAEWVIFALDTKGGFDENASEH
FT                   L"
FT   gene            483897..484130
FT                   /locus_tag="EUBELI_00473"
FT   CDS_pept        483897..484130
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00473"
FT                   /product="Hypothetical protein"
FT                   /note="Psort-B: Unknown cell location"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00473"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71487"
FT                   /db_xref="GOA:C4Z3L8"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z3L8"
FT                   /protein_id="ACR71487.1"
FT                   /translation="MKMLLNICKNTHLTEKKYEYLFLLLNTLAWCVIGFVVWAIVSIFA
FT                   FRGMEWMFTFVGYFGLIPGFIGGVVEAWRNEN"
FT   gene            484239..484709
FT                   /locus_tag="EUBELI_00474"
FT   CDS_pept        484239..484709
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00474"
FT                   /product="Hypothetical protein"
FT                   /note="Psort-B: Cytoplasmic, score:8.87"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00474"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71488"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z3L9"
FT                   /protein_id="ACR71488.1"
FT                   /translation="MALVLSACYVRNDKQTGVDDRMSDESEPVTAKAVHIERGTSGSEN
FT                   EVTAPLESEKATRKGYNPEMAFNYDEHEDIEVDDNYVASLCTEAVRELEAMFGPAEFYI
FT                   KAENSGEDSYTLNIMYNGKAAEFDDDELQQIYAYIGQEYKEVKLTDINMQSW"
FT   gene            485095..485358
FT                   /locus_tag="EUBELI_00475"
FT   CDS_pept        485095..485358
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00475"
FT                   /product="thiamine biosynthesis ThiG"
FT                   /note="Psort-B: Cytoplasmic, score:8.87; NOG36389 non
FT                   supervised orthologous group; HMMPfam:IPR003749;
FT                   Gene3D:IPR012675; HMMTigr:IPR010035; K03149 thiamine
FT                   biosynthesis ThiG"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00475"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71489"
FT                   /db_xref="InterPro:IPR003749"
FT                   /db_xref="InterPro:IPR010035"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR016155"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z3M0"
FT                   /protein_id="ACR71489.1"
FT                   /translation="MLAQIQTQRMAERRKGGTMVQINGEQQDVALVAGKTLLAYVTEAG
FT                   YDPVGIVIEKNMEIIHREDFDKVSIEDGDVIEILHFVGGGQF"
FT   gene            485448..485582
FT                   /locus_tag="EUBELI_00476"
FT   CDS_pept        485448..485582
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00476"
FT                   /product="Hypothetical protein"
FT                   /note="Psort-B: Unknown cell location"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00476"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71490"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z3M1"
FT                   /protein_id="ACR71490.1"
FT                   /translation="MDFKAVGKHDEVQKGSQSAEDWTLKRWEGTMKSKRYDKSREIGH"
FT   gene            485719..486507
FT                   /locus_tag="EUBELI_00477"
FT   CDS_pept        485719..486507
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00477"
FT                   /product="thiamine biosynthesis ThiG"
FT                   /note="Psort-B: Cytoplasmic, score:8.87; COG2022
FT                   Uncharacterized enzyme of thiazole biosynthesis;
FT                   HMMPfam:IPR008867; Gene3D:IPR013785; superfamily:IPR008867;
FT                   K03149 thiamine biosynthesis ThiG"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00477"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71491"
FT                   /db_xref="GOA:C4Z3M2"
FT                   /db_xref="InterPro:IPR008867"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR033983"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z3M2"
FT                   /protein_id="ACR71491.1"
FT                   /translation="MENKAQDKKEDKLILGGHEFNSRFILGSGKYNVNLIKAAVEQGGA
FT                   EIITLALRRANTENKENILDFIPKGVTLLPNTSGARNAEEAVRIARLSREMGCGDFVKI
FT                   EIMHDAKYLLPDNYETVKATEILAKEGFVVMPYMYPDLNVARDLQNAGAACVMPLASPI
FT                   GSNNGLSTKAFIQILIDEIDLPIIVDAGIGKPSQACEAMEMGAAAVMANTAIATAGNVP
FT                   AMAEAFKKAIEAGRSAYLTGMGRVLARGGSASDPLTGFLR"
FT   gene            486633..487892
FT                   /locus_tag="EUBELI_00478"
FT   CDS_pept        486633..487892
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00478"
FT                   /product="thiamine biosynthesis ThiH"
FT                   /note="Psort-B: Cytoplasmic, score:8.87; COG1060 Thiamine
FT                   biosynthesis enzyme ThiH and related uncharacterized
FT                   enzymes; HMMPfam:IPR007197; HMMPfam:IPR010722;
FT                   Gene3D:IPR013785; HMMTigr:IPR012726; K03150 thiamine
FT                   biosynthesis ThiH"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00478"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71492"
FT                   /db_xref="GOA:C4Z3M3"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010722"
FT                   /db_xref="InterPro:IPR012726"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR034428"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z3M3"
FT                   /protein_id="ACR71492.1"
FT                   /translation="MNEENQVYFIDSDQLPPAALERKHKLEQDPSFRTDYMKYLDDMEI
FT                   IDSDIKDKVLKAMDEFDYDSYTAADVERALSKDTCNIEDFKALLSPAAAPYLEQMARKA
FT                   ENETKKHFGNTVYIFTPIYIANYCQNYCIYCGFNCYNNIHRKKLSFEEIEHEMKVIADT
FT                   GMEEILILTGESRKYSDVEYIGESVKIARKYFKNIGIEIYPVNVDEYRYLHECGVDYVT
FT                   VFQETYNPVKYETLHLLGHKRVWPYRFDAQERALIAGMRGAGFSALLGLDDFRKDALAT
FT                   ALHVYYLNRKYPHAELSLSCPRLRPIINNDKINPRDVGEKQLCQVLCAYRLFLPFVGIT
FT                   VSSRESAQFRNGITKICATKVSAGVSTGIGDHESKYTGKKDGDAGDEQFEINDNRSFDR
FT                   MYKDMEDGGLQPVVNEYIYV"
FT   gene            487873..488499
FT                   /locus_tag="EUBELI_00479"
FT   CDS_pept        487873..488499
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00479"
FT                   /product="thiamine-phosphate pyrophosphorylase"
FT                   /note="Psort-B: Cytoplasmic, score:8.87; COG0352 Thiamine
FT                   monophosphate synthase; HMMPfam:IPR003733;
FT                   BlastProDom:IPR003733; Gene3D:IPR013785; K00788
FT                   thiamine-phosphate pyrophosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00479"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71493"
FT                   /db_xref="GOA:C4Z3M4"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022998"
FT                   /db_xref="InterPro:IPR036206"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z3M4"
FT                   /protein_id="ACR71493.1"
FT                   /translation="MNTFMYRKYICITNKHLVSGSGGAECTMNEYIMQLEKCVALHPYA
FT                   MILREKDMDRQNYRKLARRIQVMCKKASVKMFVHSDISAAEYAGCGNVHFSMEHFKQMC
FT                   DEQADVIKGLDCMSVSCHSMEEAVIAVRAGADQIVLGTIFETQCKPGKMGAGLSFLEEV
FT                   CRAVHTVNPTVKVFAIGGIKPDNIEEVLEAGADGGCMMSWFMQQD"
FT   gene            488618..490141
FT                   /locus_tag="EUBELI_00480"
FT   CDS_pept        488618..490141
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00480"
FT                   /product="Hypothetical protein"
FT                   /note="Psort-B: Unknown cell location; KOG1181 FOG:
FT                   Low-complexity; superfamily:IPR013830"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00480"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71494"
FT                   /db_xref="GOA:C4Z3M5"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z3M5"
FT                   /protein_id="ACR71494.1"
FT                   /translation="MKDMLRIGTKDRRKYIIICLAAVLVIALITVSVIAVQVKHSKNKK
FT                   KNIVENTTAETKTIQETTVQETTEEETTEEDTTQEESAEVVEQEVVEEFFENEISTENQ
FT                   KAFELPPRQLTDEFISYDGQKREITCYGDSMMAGAGSATEGKVNGIDIYGWTTPVTIEN
FT                   LTKITTHNLGVSGENSSQITFRAGGTKVYIDRDITISETDSAIAQIIDENGNVFETDNY
FT                   SGYGFDYDPYPGDMYINGYLCDVKNTGDGQVEIKLTKGYAAYDNSTDNSVVIYESETAE
FT                   YSRQRADIKAESEKGTESSTVIKETESQTSGQKPMEKPTENVTEKPTEKPTETSGMEKV
FT                   TISARTQAMTRASQERSAKDILILEMGSNGGWENDYQQLILQYDNIILNSGCKYYIIVG
FT                   DTDDPADSADGYQGAYDSDGNYVGIGDTSWEAALRLAYGDHFFNTRTYMIQNGLSDCGL
FT                   DVTTDDLENFKMGNISKQLRYDWTHFNCYGYYSKGIGIYKKGVELGYWS"
FT   gene            490278..490523
FT                   /locus_tag="EUBELI_00481"
FT   CDS_pept        490278..490523
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00481"
FT                   /product="Hypothetical protein"
FT                   /note="Psort-B: Cytoplasmic, score:8.87;
FT                   superfamily:IPR000032"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00481"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71495"
FT                   /db_xref="InterPro:IPR000032"
FT                   /db_xref="InterPro:IPR035895"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z3M6"
FT                   /protein_id="ACR71495.1"
FT                   /translation="MKKGGNHMEVAINNIDKVRKFVDIVSRFDCDIDLVSGHTMVDAKS
FT                   ILGIFSLNIMKPMMMIIHDDEDKAQIIRNSLKAFAA"
FT   gene            490573..492813
FT                   /locus_tag="EUBELI_00482"
FT   CDS_pept        490573..492813
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00482"
FT                   /product="polyphosphate kinase"
FT                   /note="Psort-B: Cytoplasmic, score:8.87; COG0855
FT                   Polyphosphate kinase; HMMPfam:IPR003414; K00937
FT                   polyphosphate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00482"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71496"
FT                   /db_xref="GOA:C4Z3M7"
FT                   /db_xref="InterPro:IPR003414"
FT                   /db_xref="InterPro:IPR024953"
FT                   /db_xref="InterPro:IPR025198"
FT                   /db_xref="InterPro:IPR025200"
FT                   /db_xref="InterPro:IPR036830"
FT                   /db_xref="InterPro:IPR036832"
FT                   /db_xref="InterPro:IPR041108"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z3M7"
FT                   /protein_id="ACR71496.1"
FT                   /translation="MFYITPIVDFTYQCDNKIIAKEKMWLKEKMRNDMKFTEIKKKFFD
FT                   YFREKENGAMSINTKETTQRACYTNRELSWLAFNERVLNEAANPKVPLAERLTFASIYQ
FT                   TNLDEFFMVRVGTLMMQMQLQEKERDNKTGMTSEEQVKAILDKVSELEKKKGRVYEQLM
FT                   GELETAGIRIINFNKLSNDEGAMLEEYFDMHIAPFLSPMIIGQQQPFPFLANKQLYAIV
FT                   LMKTKKGKNKIGIVPCSNSVFKRLIEIPTRPGTFMLSEELILHFVSKLYEKYEILEKSV
FT                   MRVIRNADIDAGSFDDEDLDYRNMMEHMVKQRNRLNPVCVQLNRKINDKAKKKLTDYLE
FT                   IGAKHLIEERTPLDMSFVFQLQNVLKNKPELFYKKRVPQPSKEISMNEKIIPQIEKKDV
FT                   VLSYPFESMRPFISMLEEAASDPTVVSIKMTLYRVADRSKIVETLIEAAENGKEVIVLV
FT                   ELRARFDEANNIEMSKRLEEAGCQLLYGLGDYKVHSKLCLITRSVNNTFSYITQIGTGN
FT                   YNEKTSRLYTDLSLVTANEEIGADAAAVFAALQKGETVDSSNQLLVAPNCLQNRILSMI
FT                   DEQIDKVKNGKDGYVGVKINSLTDKLIIEKLIEASQAGVKIDLEVRGICCIKPGVKGYT
FT                   DNIRVVSVVGRFLEHSRIYRFGRGDDQKIYIASADFMTRNTTRRVEVAAPVLDKHCQER
FT                   IIHIFNLIMQDDEKGKEQNSDGVYCDRHINNPKIDSQETLYEESYEAAASAE"
FT   gene            492838..493914
FT                   /locus_tag="EUBELI_00483"
FT   CDS_pept        492838..493914
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00483"
FT                   /product="6-phosphofructokinase"
FT                   /note="Psort-B: Cytoplasmic, score:8.87; COG0205
FT                   6-phosphofructokinase; HMMPfam:IPR000023;
FT                   BlastProDom:IPR015913; HMMPIR:IPR012003;
FT                   HMMPanther:IPR000023; ScanRegExp:IPR015912; K00850
FT                   6-phosphofructokinase"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00483"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71497"
FT                   /db_xref="GOA:C4Z3M8"
FT                   /db_xref="InterPro:IPR000023"
FT                   /db_xref="InterPro:IPR012003"
FT                   /db_xref="InterPro:IPR012829"
FT                   /db_xref="InterPro:IPR015912"
FT                   /db_xref="InterPro:IPR022953"
FT                   /db_xref="InterPro:IPR035966"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z3M8"
FT                   /protein_id="ACR71497.1"
FT                   /translation="MKIGMLTSGGDCQSLNAAMRGVAKTLYNNTNDVEIYGFLDGYKGM
FT                   ITKNYKLMKEEDFSGILTEGGTILGTSRTPFKYINEPDKEGRDKVAGMIKTYKDLKLDC
FT                   LVMLGGNGSHKTAALLSQKGLNVVTLPKTIDNDIEGTEMSFGFQSAIDVATRTIDEIHT
FT                   TAASHSRVFIVEIMGHKTGWLTLHSGIAGGADIILIPEIPYNVDEVLNTIRKREKQGKK
FT                   FTIIAMAEGAISDEDAKLSKKELKEKRKTYTFPSVAYQLSDELQKKAGQEVRVTIPGHV
FT                   QRGGIPSASDRTLATRIGVEAAGLILRKDYGNMVCIKEGKFSKIPLEEVAGKTKMVNVD
FT                   NELIRQAESLGISLGRKA"
FT   gene            493898..494263
FT                   /locus_tag="EUBELI_00484"
FT   CDS_pept        493898..494263
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00484"
FT                   /product="Hypothetical protein"
FT                   /note="Psort-B: CytoplasmicMembrane, score:9.75"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00484"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71498"
FT                   /db_xref="GOA:C4Z3M9"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z3M9"
FT                   /protein_id="ACR71498.1"
FT                   /translation="MAERHKWYIIQSKCFGKKGNALKKSDRLKIVILGITGLLILIGTG
FT                   IFIFIGQSICTMAGVGLFVIVCLGMVVVAGKKDDQTETIEQLNQTISEQSRRIMNTEGQ
FT                   LARYKRELAEATGKNEA"
FT   gene            494288..495136
FT                   /locus_tag="EUBELI_00485"
FT   CDS_pept        494288..495136
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00485"
FT                   /product="undecaprenyl-diphosphatase"
FT                   /note="Psort-B: CytoplasmicMembrane, score:9.99; COG1968
FT                   Uncharacterized bacitracin resistance protein;
FT                   HMMPfam:IPR003824; HMMTigr:IPR003824; K06153
FT                   undecaprenyl-diphosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00485"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71499"
FT                   /db_xref="GOA:C4Z3N0"
FT                   /db_xref="InterPro:IPR003824"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z3N0"
FT                   /protein_id="ACR71499.1"
FT                   /translation="MLLEILKAILFGIVEGITEWLPISSTGHMILLDQVVKLNVSADFY
FT                   KMFQVVIQLGAIMAVVILFWNKLWPFYMKKTGDSKKAAWKDGALAMWIKIIIACIPAAI
FT                   VGLIFDDKIDELFYHPIPVAIALIVVGIVFIVVENAKKGSKPAIRSIGEITYKAAIIIG
FT                   LFQLIAAVFPGTSRSGATIIGALIIGVSRSVAAEFTFFLAVPVMFGASLLKIAKYAAVG
FT                   MAMTGTEWIVLIVGCLVAFFVSVFVIKFLMGYIKKHDFKVFGVYRIILGIAVIALSFVL
FT                   F"
FT   gene            complement(495139..495741)
FT                   /locus_tag="EUBELI_00486"
FT   CDS_pept        complement(495139..495741)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00486"
FT                   /product="Hypothetical protein"
FT                   /note="Psort-B: Unknown cell location; KOG1181 FOG:
FT                   Low-complexity"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00486"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71500"
FT                   /db_xref="GOA:C4Z3N1"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z3N1"
FT                   /protein_id="ACR71500.1"
FT                   /translation="MKLNNLIVKIFLGIYLVIIIAGVVVFENIGFAGGGLEKSIHTASN
FT                   SETQPVTVKDINPETISKTTPAATVKETASSQDVTKHETTIVTETQTVTVASETSCESS
FT                   EPETVQTEVQNTQPATTAQTSYTFANGRITNTSALKSYHVTGASYVNMHKDKNGSHSFA
FT                   VVPGGTTGFILSVGAYYTLIDYNGTSGYVYNSYLEVY"
FT   gene            495793..496536
FT                   /locus_tag="EUBELI_00487"
FT   CDS_pept        495793..496536
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00487"
FT                   /product="Na+-transporting two-sector ATPase"
FT                   /note="Psort-B: Cytoplasmic, score:8.87; COG1720
FT                   Uncharacterized conserved protein; HMMPfam:IPR001378;
FT                   BlastProDom:IPR001378; HMMTigr:IPR001378;
FT                   ScanRegExp:IPR001378; K01550 Na+-transporting two-sector
FT                   ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00487"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71501"
FT                   /db_xref="InterPro:IPR023368"
FT                   /db_xref="InterPro:IPR023370"
FT                   /db_xref="InterPro:IPR036413"
FT                   /db_xref="InterPro:IPR036414"
FT                   /db_xref="InterPro:IPR040372"
FT                   /db_xref="InterPro:IPR041369"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z3N2"
FT                   /protein_id="ACR71501.1"
FT                   /translation="MGQVNKKVVIRRCKMNIIGHISTDFPTKFGIPRQSGLIEELKGVI
FT                   TFEPEYRQPEAFRGLEDFSHIWVLWQFSKSQKKTIAATVTPPRLGGKVRMGVFATRSPF
FT                   RPNDIGLSCVKLEHIEYTADKGPVLFVSGVDMVDGTPIYDIKPYVKFTDSHPEAKEGFT
FT                   AATYNRNLKVIFPSDLLAIMPENKQTAAVKILEQDPRPAYDTDEAMAYGVTFSGFDIRF
FT                   KVHGDMLTVFEVVDIEAAGGYKKVK"
FT   gene            496636..497187
FT                   /locus_tag="EUBELI_00488"
FT   CDS_pept        496636..497187
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00488"
FT                   /product="2-C-methyl-D-erythritol 2,4-cyclodiphosphate
FT                   synthase"
FT                   /note="Psort-B: Cytoplasmic, score:8.87; COG0245
FT                   2C-methyl-D-erythritol 2,4-cyclodiphosphate synthase;
FT                   HMMPfam:IPR003526; Gene3D:IPR003526; HMMTigr:IPR003526;
FT                   ScanRegExp:IPR003526; superfamily:IPR003526; K01770
FT                   2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00488"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71502"
FT                   /db_xref="GOA:C4Z3N3"
FT                   /db_xref="InterPro:IPR003526"
FT                   /db_xref="InterPro:IPR020555"
FT                   /db_xref="InterPro:IPR036571"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4Z3N3"
FT                   /protein_id="ACR71502.1"
FT                   /translation="MRVGMGYDVHKLVKDRKLIMGGVEIPYELGLLGHSDADVLLHAIM
FT                   DALLGAAALGDIGKHFPDTDDRYKGISSIKLLEEVGKKIDEANYIIENIDATIIAQKPK
FT                   MRPYIDDMRKNIADALKIDVDRVNVKATTEEGLGFTGSGEGISSQAICSLNSVSNYIYG
FT                   AADMTNCRSDCGGCMGCQNK"
FT   gene            497259..497933
FT                   /locus_tag="EUBELI_00489"
FT   CDS_pept        497259..497933
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00489"
FT                   /product="serine O-acetyltransferase"
FT                   /note="Psort-B: Cytoplasmic, score:9.98; COG1045 Serine
FT                   acetyltransferase; HMMTigr:IPR005881;
FT                   superfamily:IPR011004; K00640 serine O-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00489"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71503"
FT                   /db_xref="GOA:C4Z3N4"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005881"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR042122"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z3N4"
FT                   /protein_id="ACR71503.1"
FT                   /translation="MKYRDYVKQEIAVIKDRDPAIKSDKEVYLYPSFKAILKYRKAHKL
FT                   YLKGEYYKARKISQKTARQTGIEIHPGAQIGEGLFIDHGHGVVIGETAIIGNNVTLYQG
FT                   VTLGGTGKEQGKRHPTLGNNIMVGAGAKILGSVTIGDNCKIGAGSVVLKDVPANSTVVG
FT                   VPGRVVIQDSVRLFDDLDQIHLPDPVMQDIENLKQENARLKKRLAHLENSVNESRSSYD
FT                   DN"
FT   gene            497960..499378
FT                   /locus_tag="EUBELI_00490"
FT   CDS_pept        497960..499378
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00490"
FT                   /product="cysteinyl-tRNA synthetase"
FT                   /note="Psort-B: Cytoplasmic, score:9.98; COG0215
FT                   Cysteinyl-tRNA synthetase; HMMPfam:IPR015273;
FT                   HMMPfam:IPR015803; Gene3D:IPR014729; HMMPanther:IPR015804;
FT                   HMMTigr:IPR002308; superfamily:IPR009080; K01883
FT                   cysteinyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00490"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71504"
FT                   /db_xref="GOA:C4Z3N5"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015273"
FT                   /db_xref="InterPro:IPR015803"
FT                   /db_xref="InterPro:IPR024909"
FT                   /db_xref="InterPro:IPR032678"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4Z3N5"
FT                   /protein_id="ACR71504.1"
FT                   /translation="MRIYNTLSRRKEEFKPLEEGKVKMYVCGPTVYNLIHIGNARPMIV
FT                   FDTVRRYLEYKGYDVNYVSNFTDVDDKIIKKANEEGVSAEEISTRYIAECKKDMEGMNI
FT                   KPATTHPLATQEIGGMIDMIQTLIDKGYAYEVNGTVYYRTRKFAEYGKLSKKNIDDLEA
FT                   GHRDEAHSLKVTGEDEKEDPLDFVLWKPKKEGEPSWPSPWSDGRPGWHIECSVMSKKYL
FT                   ADEIDIHAGGEDLIFPHHENEIAQSEAANGVPFSKYWMHNAFLNIDNKKMSKSLGNFFT
FT                   VRDISREYDLEVLRFFMLSAHYRNPVNFSHDLMESAKNGLDRILTAVDNLRHLSENAKD
FT                   VIMTEDEKKIIASIDDIYKKFEDSMDDDFNTADAISAIFELVKLANSNSSSDNSKEYID
FT                   TLMKKITTLTDILGLKTDKKEEMLDEDIEALIAERQQARKDKNFARADEIRDELLAKGI
FT                   VLKDTREGVRWSRA"
FT   gene            499363..499806
FT                   /locus_tag="EUBELI_00491"
FT   CDS_pept        499363..499806
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00491"
FT                   /product="ribonuclease III"
FT                   /note="Psort-B: Cytoplasmic, score:8.87; COG1939
FT                   Uncharacterized protein conserved in bacteria;
FT                   HMMPfam:IPR000999; HMMPIR:IPR008226; HMMSmart:IPR000999;
FT                   superfamily:IPR000999; K01162 ribonuclease III"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00491"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71505"
FT                   /db_xref="GOA:C4Z3N6"
FT                   /db_xref="InterPro:IPR000999"
FT                   /db_xref="InterPro:IPR008226"
FT                   /db_xref="InterPro:IPR036389"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z3N6"
FT                   /protein_id="ACR71505.1"
FT                   /translation="MEQSLDNDLVKCIYEGLDMKHTEPSQLSPLVLAYIGDSIYDLVIK
FT                   TWVIEQGNMQVNKLNKKTSSIVKAESQSAMIGVIEPMLSEHEEAVYKRGRNAKSYTSAK
FT                   NASIGDYRRATGFEALMGYLYLSGQYERMMELVKAGLESLELK"
FT   gene            499878..500618
FT                   /locus_tag="EUBELI_00492"
FT   CDS_pept        499878..500618
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00492"
FT                   /product="RNA methyltransferase, TrmH family"
FT                   /note="Psort-B: Cytoplasmic, score:8.87; COG0566 rRNA
FT                   methylases; HMMPfam:IPR001537; HMMPfam:IPR013123;
FT                   BlastProDom:IPR001537; HMMTigr:IPR004441; K03218 RNA
FT                   methyltransferase, TrmH family"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00492"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71506"
FT                   /db_xref="GOA:C4Z3N7"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR004441"
FT                   /db_xref="InterPro:IPR013123"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z3N7"
FT                   /protein_id="ACR71506.1"
FT                   /translation="MRYNELTFQGRNAVLEAFRSGKTIDKLFILDGCQDGPIKSIVREA
FT                   KKTDAIINYVDKERLDRLAGTGHHQGVVAIGAAYEYAEVDDILASAKEKGEDPFIFILD
FT                   EIEDPHNLGAIIRTANLAGAHGVIIPKRRAVGLTATVAKTSAGAINYTPVAKVTNISQT
FT                   IEELKKQGLWFVCADMGGETMYNLNLKGPIGLVIGNEGNGVSRLVKDKCDFIASIPMKG
FT                   DIDSLNASVAAGVLAYEIVRQRLN"
FT   gene            500629..501240
FT                   /locus_tag="EUBELI_00493"
FT   CDS_pept        500629..501240
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00493"
FT                   /product="RNA polymerase sporulation-specific sigma factor"
FT                   /note="Psort-B: Cytoplasmic, score:8.87; COG1595
FT                   DNA-directed RNA polymerase specialized sigma subunit,
FT                   sigma24 homolog; HMMPfam:IPR007627; HMMTigr:IPR014284;
FT                   ScanRegExp:IPR000943; superfamily:IPR013324;
FT                   superfamily:IPR013325; K03091 RNA polymerase
FT                   sporulation-specific sigma factor"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00493"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71507"
FT                   /db_xref="GOA:C4Z3N8"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR016371"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z3N8"
FT                   /protein_id="ACR71507.1"
FT                   /translation="MKHMEEYPDEELIDMYRAGNEQAIEYIFERYKYIVRKKAKAMFLA
FT                   GGDSDDLIQEGMIGLYKAVRDYDKQKDASFMTFAGMCINRQILNAVTASNRKKNTPLNT
FT                   YVSFDEPVNPEDDSQVKLVDVLKSDKEQNPERLFIDQENAESLEDKLYSVLSGFEKNVL
FT                   ELYMSGKDYIAIAQTLDKPPKSIDNAIQRIRNKVDKITNL"
FT   gene            501269..501340
FT                   /locus_tag="EUBELI_00494"
FT   tRNA            501269..501340
FT                   /locus_tag="EUBELI_00494"
FT                   /product="tRNA-Thr"
FT   gene            501383..502678
FT                   /locus_tag="EUBELI_00495"
FT   CDS_pept        501383..502678
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00495"
FT                   /product="adenylosuccinate synthase"
FT                   /note="Psort-B: Cytoplasmic, score:8.87; COG0104
FT                   Adenylosuccinate synthase; HMMPfam:IPR001114;
FT                   BlastProDom:IPR001114; HMMPanther:IPR001114;
FT                   HMMSmart:IPR001114; HMMTigr:IPR001114; K01939
FT                   adenylosuccinate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00495"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71508"
FT                   /db_xref="GOA:C4Z3N9"
FT                   /db_xref="InterPro:IPR001114"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042109"
FT                   /db_xref="InterPro:IPR042110"
FT                   /db_xref="InterPro:IPR042111"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z3N9"
FT                   /protein_id="ACR71508.1"
FT                   /translation="MVKAIVGANWGDEGKGKITDMLAEESDIIVRFQGGANAGHTIIND
FT                   YGKFALHLLPSGVFYNHTTSVIGNGVALNIPYLVKELKSLTDRNVPMPKILVSDRAQIL
FT                   MPYHVAFDTYEEARLAGKSFGSTKSGIAPFYSDKYAKIGFQVNELFGDEQELKEKIANV
FT                   CTLKNVMLEHLYHQPLLNEEEIFNTLMEYKEMVEPYVCDTSAFLHQALKDGKKILLEGQ
FT                   LGSLKDTDHGIYPMVTSSSTLAPYGAIGAGIPAASITDVVTVVKAYSSAVGAGAFVSEI
FT                   FGDEADELRRRGGDGGEFGATTGRPRRMGWFDAVATRYGVRMQGTTEVALTVLDVLGYL
FT                   DEIPMCVGYEIDGKITKDFPTTPQLEKAKPVLKTMPGWKSDIRGITNYEELPVECRNYI
FT                   ETIEQEIEAPITMVSNGPGRHEIIHRKSNFSK"
FT   gene            502755..503402
FT                   /locus_tag="EUBELI_00496"
FT   CDS_pept        502755..503402
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00496"
FT                   /product="deoxyribose-phosphate aldolase"
FT                   /note="Psort-B: Cytoplasmic, score:9.98; COG0274
FT                   Deoxyribose-phosphate aldolase; HMMPfam:IPR002915;
FT                   Gene3D:IPR013785; HMMPIR:IPR011343; HMMPanther:IPR011343;
FT                   HMMTigr:IPR011343; K01619 deoxyribose-phosphate aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00496"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71509"
FT                   /db_xref="GOA:C4Z3P0"
FT                   /db_xref="InterPro:IPR002915"
FT                   /db_xref="InterPro:IPR011343"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR028581"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4Z3P0"
FT                   /protein_id="ACR71509.1"
FT                   /translation="MKFNKYFDHTNLKPDATKDDIRTLCEEAKKYDFASVCVNGIYTAF
FT                   AKQCLSGSDVKTCVVVGFPLGAMSTDVKAYETKKAVEDGADEIDMVIPVGLLKAGEYDA
FT                   VYEDIKAVRDACAGKVLKVIFENCLLTDEEKIKACELSVKAGADYVKTSTGFSTGGATI
FT                   SDVALMKAHVEGKCKVKAAGGIRDYNTAAAMIDAGADRLGTSATIKIMEGRQ"
FT   gene            complement(503405..503650)
FT                   /locus_tag="EUBELI_00497"
FT   CDS_pept        complement(503405..503650)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00497"
FT                   /product="Hypothetical protein"
FT                   /note="Psort-B: CytoplasmicMembrane, score:9.75"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00497"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71510"
FT                   /db_xref="GOA:C4Z3P1"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z3P1"
FT                   /protein_id="ACR71510.1"
FT                   /translation="MYIIKYLTLEVLFMKRLKRFAALTAVILWGIMIIATLILAFIDNE
FT                   ACHKVFTGLLFTDIVFPVVIYAMTLVYKILSGRNKQ"
FT   gene            503774..504544
FT                   /locus_tag="EUBELI_00498"
FT   CDS_pept        503774..504544
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00498"
FT                   /product="Hypothetical protein"
FT                   /note="Psort-B: Unknown cell location; COG5651 PPE-repeat
FT                   proteins"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00498"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71511"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z3P2"
FT                   /protein_id="ACR71511.1"
FT                   /translation="MHMSINAYNASTISALFAGLNNSSSGTSLSYGIDFTTYNSIKNGS
FT                   YSKLMRKYYSNQASESTNGATANKNTGKVHSIDKQKNNATVNRDNAASLVDSASELKKY
FT                   SLWSKVDKTDKDGNTTKEYDTDKIAKAVSSFVKDYNSLVSSTADSSSRYVLNSASNMVN
FT                   YTRANADLLKKIGISVGSDNKLTVDEDKLKTSDMAVIKSVFKDSGSFGQTISAKASTIY
FT                   GNAVSQLSELSTKNSYTSNGLYSYSSGYTYNQYT"
FT   gene            504577..505083
FT                   /locus_tag="EUBELI_00499"
FT   CDS_pept        504577..505083
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00499"
FT                   /product="preprotein translocase SecA subunit"
FT                   /note="Psort-B: Unknown cell location; COG0653 Preprotein
FT                   translocase subunit SecA (ATPase, RNA helicase);
FT                   HMMPfam:IPR004027; K03070 preprotein translocase SecA
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00499"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71512"
FT                   /db_xref="InterPro:IPR004027"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z3P3"
FT                   /protein_id="ACR71512.1"
FT                   /translation="MALLETWRKLAYETEMDQKNASEFWGSYFNQEKAIYEQILANPDT
FT                   VVKGTVKELAEKFGVEVLLMTGFLDGINDSLKTPNPIETMDENTEVSLDYDKEKLYYNM
FT                   VGCKADWLYELPQWDNLLDEQTRKDLYKKQKLSGTVVKGKKIGRNDPCPCGSGKKYKQC
FT                   CGKNA"
FT   gene            505161..505907
FT                   /locus_tag="EUBELI_00500"
FT   CDS_pept        505161..505907
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00500"
FT                   /product="Hypothetical protein"
FT                   /note="Psort-B: Unknown cell location; COG0500
FT                   SAM-dependent methyltransferases; HMMPfam:IPR013216"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00500"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71513"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z3P4"
FT                   /protein_id="ACR71513.1"
FT                   /translation="MDAYTGFAYVYDEYMDNIPYEEWGQYMIALLKGNGVSGDSSVLEL
FT                   GCGTGTVTRMLAKEGYDCVGLDMSEDMLSIASEKTFEEGSQVIYTCQDMRDFEVPYEVD
FT                   GMISIGDSMNYITSVPDLESVFACVSENLKKGGVFIFDLKTIHFFRDILAENTYAENRE
FT                   DSAFIWDNYYDEEERNNEYELAVFVKNEDGTFDRFEEQHYQHGFTIDEVTGAANKAGLT
FT                   VKNVYNAFTKDMPDDKSERLYFVIEK"
FT   gene            505897..506799
FT                   /locus_tag="EUBELI_00501"
FT   CDS_pept        505897..506799
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00501"
FT                   /product="molecular chaperone Hsp33"
FT                   /note="Psort-B: Cytoplasmic, score:8.87; COG1281 Disulfide
FT                   bond chaperones of the HSP33 family; HMMPfam:IPR000397;
FT                   BlastProDom:IPR000397; K04083 molecular chaperone Hsp33"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00501"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71514"
FT                   /db_xref="GOA:C4Z3P5"
FT                   /db_xref="InterPro:IPR000397"
FT                   /db_xref="InterPro:IPR016153"
FT                   /db_xref="InterPro:IPR016154"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z3P5"
FT                   /protein_id="ACR71514.1"
FT                   /translation="MRNNKEIIMGDYIVRATAAGGQVRAFAATTKGLVEEAKERHNMSP
FT                   IATVALGRLLTGGAMMGTMMKNDADILTVQIKGNGPIGSMTVTANPKGEVKGFVGNPQV
FT                   MLPLKDGKLDIADAVGIGVLSVIKDIGLKEPYVGDTILITSEIADDLTYYFANSEQVPS
FT                   SVGLGVLMNKDNTVEQAGGFIIQLMPGATDEFIDKLEARIKEIKSVTAMLEEGMTPEQI
FT                   LEHILGDMELEILDTIPTKFYCNCSKDRVSKAVISVGKEEIQKMIDDGEPIEVNCHFCN
FT                   SHYTFTVDELKEMYDCCTR"
FT   gene            506811..507335
FT                   /locus_tag="EUBELI_00502"
FT   CDS_pept        506811..507335
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00502"
FT                   /product="shikimate kinase"
FT                   /note="Psort-B: Cytoplasmic, score:8.87; COG0703 Shikimate
FT                   kinase; HMMPfam:IPR000623; K00891 shikimate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00502"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71515"
FT                   /db_xref="GOA:C4Z3P6"
FT                   /db_xref="InterPro:IPR000623"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031322"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z3P6"
FT                   /protein_id="ACR71515.1"
FT                   /translation="MEVHMNNIILIGMPGSGKSSLGVVLAKKIGFGFIDSDLVIQQREG
FT                   MTLERIIEKHGDAGFIQIENEVNCSISPHHTVIATGGSAVYGKEAMEHFKDIGTVVYLE
FT                   LPPESLEERLGSLKERGVVSNGKTTVEDIYADRVALYKKYADITLNEQGKQIRETVEML
FT                   YDIIMNKDQYN"
FT   gene            507486..509162
FT                   /locus_tag="EUBELI_00503"
FT   CDS_pept        507486..509162
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00503"
FT                   /product="glutaminyl-tRNA synthetase"
FT                   /note="Psort-B: Cytoplasmic, score:9.98; COG0008 Glutamyl-
FT                   and glutaminyl-tRNA synthetases; HMMPfam:IPR000924;
FT                   HMMPanther:IPR000924; HMMPanther:IPR004514;
FT                   HMMTigr:IPR004514; ScanRegExp:IPR001412;
FT                   superfamily:IPR011035; K01886 glutaminyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00503"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71516"
FT                   /db_xref="GOA:C4Z3P7"
FT                   /db_xref="InterPro:IPR000924"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR004514"
FT                   /db_xref="InterPro:IPR011035"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020056"
FT                   /db_xref="InterPro:IPR020058"
FT                   /db_xref="InterPro:IPR020059"
FT                   /db_xref="InterPro:IPR020061"
FT                   /db_xref="InterPro:IPR022861"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z3P7"
FT                   /protein_id="ACR71516.1"
FT                   /translation="MENEALSKNFIEQIIDKDIESGHCKKVITRFPPEPNGYLHIGHAK
FT                   SILLNYGLAKEYGGQFNMRFDDTNPTKEKVEFVDSIKADVEWLGAEWNGDVLFASDYFP
FT                   QMYEAAVKLIKKGKAYVDDLSAEEIRQYRGTLTEPGKESPYRNRSVEENLQLFEEMKEG
FT                   KYADGTKVLRAKIDMASPNINMRDPIIYRVAHMTHHRTGDQWCIYPMYDFAHPIEDAVE
FT                   GITHSICTLEFEDHRPLYDWVVIETGYKTSPEENPKQIEFAKLYLTNVVTGKRYIKKLV
FT                   EDGIVDGWDDPRLVSIAALRRRGFTPEAIKMFVELVGVTKAQGSVEYPMLEYCIREDLK
FT                   LKVKRMMAVLDPVKLVIDNYPEGQVEYMEVANNQENPEMGTRKVPFTKELYIEREDFME
FT                   EPPKKYFRLFPGNEVRLMNAYFVTCTDYVKDENGKVIEVHCTYDPETKGGNFTGRKVKG
FT                   TIHWVSATEGCKAEVRLYENIVDEEKGVYNEEDGSMNINPNSKTVLTECYLEPELMKAV
FT                   SEDKFQFVRNGYFCVDNKDSEPGKPIFNRIVSLKSSFKLQK"
FT   gene            509176..509907
FT                   /locus_tag="EUBELI_00504"
FT   CDS_pept        509176..509907
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00504"
FT                   /product="hypothetical protein"
FT                   /note="Psort-B: Cytoplasmic, score:8.87; COG1655
FT                   Uncharacterized protein conserved in bacteria; K09766
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00504"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71517"
FT                   /db_xref="InterPro:IPR018708"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z3P8"
FT                   /protein_id="ACR71517.1"
FT                   /translation="MEGIGQKKETDYIFDKTIKCDVCGKEFKTKQVRTGKARFVGTDAV
FT                   LKPLYEGIDTCKYDIILCPHCGYAAAQRNYGHLTPKQRKAIRENVEPRFKAKENETETY
FT                   SYERAVRRCKMAMLTEMVTGGKISESAYLCLKLAWLYRGEIEETKTNGGSQADIDKYYK
FT                   YEHEYLEDAYKGFKQALETEYPPIAGMDEMTIYYLLTSLAVECGNMAEAKQYGSSILLS
FT                   KTASAKLKNKTRDVLEAIKNN"
FT   gene            509931..511928
FT                   /locus_tag="EUBELI_00505"
FT   CDS_pept        509931..511928
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00505"
FT                   /product="Hypothetical protein"
FT                   /note="Psort-B: CytoplasmicMembrane, score:9.99; COG1368
FT                   Phosphoglycerol transferase and related proteins, alkaline
FT                   phosphatase superfamily; HMMPfam:IPR000917;
FT                   Gene3D:IPR001952"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00505"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71518"
FT                   /db_xref="GOA:C4Z3P9"
FT                   /db_xref="InterPro:IPR000917"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z3P9"
FT                   /protein_id="ACR71518.1"
FT                   /translation="MNKVKTFLQKIWTYDLVHTAVYSLILELVVECFNRRGIMGLAFPF
FT                   MHPVIFIYNTLIIMTTMTIALFFTRRIFAYCVISVAWIGLSLTNFIILSSRKTPFTAMD
FT                   FYLIKDAIKVAGLYVSIVQIILIALLVIAVITGLVFLWRKAPKIEVTIKKTKFYAYAGV
FT                   QLVLVFLAAYGIGITLLFTGAVEGHFGNLAQAYKKYGFSHCFVSSVLDRGIKKSGEYSE
FT                   EYMESLKKDLDDVEPEADDKTPNIIFVQLESFFDPTHVKGITLSENPLPNYQKLISEYS
FT                   SGYLSVPCFGAGTCNTEFEVQTGINIDDFGPGEYPYRTIMKSKVCESMAYDLKKLGYST
FT                   HAIHNNDGTFYDRNLVFSHLGYDTFTSIEYMDGFEKTPMGWAKDYVLTDEIDKALNSTS
FT                   GTDYVFTISVQGHGDYPSTPMEGYTPEIKVTNFPVAEQQASFEYYVNQIHEMDNFIGEL
FT                   VDKLSERDEETILVLYGDHLPTFDFTDEMLTNGDKFQTQYVIWSNFQMDKQNKDIQAYQ
FT                   LSAYVMERLGMSEGYIMKYHQSKKNLPEDEYLKNLKILEYDILYGKKEIYGGDTPYVAT
FT                   ELKMGIDDIEITDVYNYGDTVFIEGNHFNDYSCALINGKEYATEKISDRLLRVKGAKVK
FT                   KDDLVTVAQKGDDKVELSRTTFAVKQQAKQ"
FT   gene            511978..512232
FT                   /locus_tag="EUBELI_00506"
FT   CDS_pept        511978..512232
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00506"
FT                   /product="cold shock protein (beta-ribbon, CspA family)"
FT                   /note="Psort-B: Cytoplasmic, score:9.98; COG1278 Cold shock
FT                   proteins; HMMPfam:IPR002059; BlastProDom:IPR002059;
FT                   Gene3D:IPR012340; HMMSmart:IPR011129; ScanRegExp:IPR002059;
FT                   K03704 cold shock protein (beta-ribbon, CspA family)"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00506"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71519"
FT                   /db_xref="GOA:C4Z3Q0"
FT                   /db_xref="InterPro:IPR002059"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012156"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019844"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z3Q0"
FT                   /protein_id="ACR71519.1"
FT                   /translation="MVILVRCFKHQDFFLEVLEMKGTVKWFNNQKGYGFISDESGKDVF
FT                   VHYSGLNMEGFKSLEEGAQVEFDVTEGAKGPQATNVTKL"
FT   gene            512370..513245
FT                   /locus_tag="EUBELI_00507"
FT   CDS_pept        512370..513245
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00507"
FT                   /product="Hypothetical protein"
FT                   /note="Psort-B: CytoplasmicMembrane, score:9.99; COG4377
FT                   Predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00507"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71520"
FT                   /db_xref="GOA:C4Z3Q1"
FT                   /db_xref="InterPro:IPR011397"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z3Q1"
FT                   /protein_id="ACR71520.1"
FT                   /translation="MFKNLIGGFMENIDIDFGQTVSSGAVSMLVAGAILVLSVLIVAII
FT                   ITAKRWKGRAIPLLLGLLSYVIFGFMFSQMFMSIIRLIPSVDMSFTYNSSSYIVVYNIV
FT                   FAVGLAIARWFTVKLMADKYNRAGDVILAGTGIALGDAVMMYGLSVLSYYVYAQAISAS
FT                   GLQKVVEDMLSSGLSAEEVMTEYTANMAQLFNAPEPLWFIMGLATVLDIVLNIILCIVV
FT                   YGSVKKQINYMLPYYAIIIQFVSNILFQVYNPYSLANTIILFTIKLVVVIGTILYTKQF
FT                   IMKEIKYSDD"
FT   gene            513238..515619
FT                   /locus_tag="EUBELI_00508"
FT   CDS_pept        513238..515619
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00508"
FT                   /product="Hypothetical protein"
FT                   /note="Psort-B: CytoplasmicMembrane, score:10.00; COG0474
FT                   Cation transport ATPase; HMMPfam:IPR005834;
FT                   HMMPfam:IPR008250; HMMPanther:IPR001757; HMMTigr:IPR001757;
FT                   ScanRegExp:IPR001757"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00508"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71521"
FT                   /db_xref="GOA:C4Z3Q2"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z3Q2"
FT                   /protein_id="ACR71521.1"
FT                   /translation="MTDVKKGLSTKQVEKLTLEGKVNVSVGKQSKTIGQIIAGNVFTYF
FT                   NLIFAVFAVLLALVRSYNNMTFVPVIIFNMLIGIIQEIRAKKVLDKLTVVNAPKTSVIR
FT                   DGQLHIIDSETLVKGDLCVFSAGNQLSADAILVEGFVRVNESLVTGESDEVVKNAGDIL
FT                   LSGSFIVSGECKAVLTNVGLDAYAAKLAIEAKAGRKKQKTDMMESLDKLVKTIGVLIIP
FT                   IGIGLFLQSRFAVGSTIKGSIDSMVASLVGMIPEGLYLLASVALVVSVMRLGKKNVLVH
FT                   EMNCVETLARVNVLCVDKTGTITKPEMSVTHVEILDYTYDSGEAVDSHGVERIIKNVAA
FT                   AISTDNATMEAIHRYYGIDKEKECDEVFPFSSQNKYSGARYGRDVYLFGAPEYLLLDSY
FT                   DNYKKVIDKYSGNGERIVVFGKANEEITGEAVTMAITPIAFIILENEIRETAKDTFEYF
FT                   KQQGVAIKVISGDNPVTASKVAIRAGIENATHYIDATTLKTDDDIEKAVEEYTVFGRVI
FT                   PEQKKKIIEAFKAAGNVVAMTGDGVNDVLALKCADCSVAMASGSEAASNAAQIVLLDSD
FT                   FSKMPDVVGEGRRVVNNIKRSASLFLAKNIFSMMLTIFTLISVNLYPLYPTQLSFLGIF
FT                   TIGIPAFFLALQPNKSLIKGDFLLNVVLKALPTGITDFIVVTIVTIYGNCTGLVHEQTA
FT                   TAATLVLLTVGMAALIRVCMPFDMIRVIVCIAMAGGIVFSMIFLRPLFAMVVLKGLTRN
FT                   LTIIMMILSIPLYRYVCRMTAWLIDFLENHNRHFRHLLKG"
FT   gene            complement(515635..516618)
FT                   /locus_tag="EUBELI_00509"
FT   CDS_pept        complement(515635..516618)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00509"
FT                   /product="sulfonate/nitrate/taurine transport system
FT                   substrate-binding protein"
FT                   /note="Psort-B: Unknown cell location; COG0715 ABC-type
FT                   nitrate/sulfonate/bicarbonate transport systems,
FT                   periplasmic components; HMMPfam:IPR015168; K02051
FT                   sulfonate/nitrate/taurine transport system
FT                   substrate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00509"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71522"
FT                   /db_xref="InterPro:IPR015168"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z3Q3"
FT                   /protein_id="ACR71522.1"
FT                   /translation="MTIILVTTFPMTACNKENADNSVKKITLCEVTHSIFYAPQYVAIE
FT                   NGYFADEGLELTVTNGFGADKVMTALISGDADIGFMGSESSIYVYAEGSDDYAVNFAGL
FT                   TQRAGNFLVGRESNDNFDWSELKGKTVIGGRAGGMPQMLFEYILKKNNINPETDLEILQ
FT                   NVDFGSTSAAFTSGIGDYTVEFEPSATLLEQQGEGHVIASLGVESGYVPYTAYCAKKSY
FT                   IKKNPDVIQKFTNATQKGLDYVNTHSSAEIAAIIAPQFKETDIATITAIVERYKSQDTW
FT                   KTSTVFTEDSFNLLQDILTQAGELKSPVPYSSLVTTEFSEKALNKQ"
FT   gene            516818..518245
FT                   /locus_tag="EUBELI_00510"
FT   CDS_pept        516818..518245
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00510"
FT                   /product="methyl-accepting chemotaxis protein"
FT                   /note="Psort-B: Cytoplasmic, score:9.98; COG0840
FT                   Methyl-accepting chemotaxis protein; HMMPfam:IPR004089;
FT                   HMMSmart:IPR004089; K03406 methyl-accepting chemotaxis
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00510"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71523"
FT                   /db_xref="GOA:C4Z3Q4"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR025991"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z3Q4"
FT                   /protein_id="ACR71523.1"
FT                   /translation="MFRKNKTTAKAASGNDLNTLLDVFDKIISGEISHTGESPADITLF
FT                   ENPEVANKFNEVVETYKRFNNNFVMRLNEAMESIGDNSYVKNMMDEVQSQAQAIGAMGE
FT                   SGHNLEESINHINVAMADIKDNTHEMLAATQNSTANMNESIKVVNESSEKISDINRQVQ
FT                   EFQDKIHKIGEIVDIVKKVASQSNLLALNASIEAARAGEAGKGFAVVADQVRQLSSSTS
FT                   ESADDIVNYVRELNDDIGRLAVSMDDTTVKLSEGNSKVEESLSDIERMNNQMVAINDAV
FT                   NGIFADIDTQSSITTEFAKQVDSIAASYDKLSDNCMATGTHIYKIGRYIDTARSDMFRS
FT                   FSNVTTQDMIRIFQIDHFILMWRVYNNAVGFETLKVTQLNNPDSCKLGKWMKAQTDTRI
FT                   TGSRQFKDLDAAHRQIHKYAVDSWNAKESGNVELALEYFQKCYDAFGVYSNKIEEFKSY
FT                   MRTIGYTDETEKVTFRK"
FT   gene            518346..520007
FT                   /locus_tag="EUBELI_00511"
FT   CDS_pept        518346..520007
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00511"
FT                   /product="inorganic pyrophosphatase"
FT                   /note="Psort-B: Cytoplasmic, score:8.87; COG1227 Inorganic
FT                   pyrophosphatase/exopolyphosphatase; HMMPfam:IPR000644;
FT                   HMMPfam:IPR004097; HMMPfam:IPR010766; HMMSmart:IPR000644;
FT                   K01507 inorganic pyrophosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00511"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71524"
FT                   /db_xref="GOA:C4Z3Q5"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR001667"
FT                   /db_xref="InterPro:IPR004097"
FT                   /db_xref="InterPro:IPR010766"
FT                   /db_xref="InterPro:IPR028979"
FT                   /db_xref="InterPro:IPR038222"
FT                   /db_xref="InterPro:IPR038763"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z3Q5"
FT                   /protein_id="ACR71524.1"
FT                   /translation="MEEYKEKAKEIMVIGHKNPDTDSICSAICYADLKNKITGTDNYVP
FT                   KRAGHLNEETHFVLNRFGVEAPEYIKDVRPQVMNIEIRHTEGINSEISVRNAWKLMDSL
FT                   NVVTLPITEGRKLTGLVSIDDIAKSYFETFDNRVLSNAKTSFANIVETLGGRVITGDES
FT                   EIFDKGKMLIAAANPDMMESMIDEGDIVILGNRYESQLCAIEMEAKCLIICEGAKVSNT
FT                   IAKVAKSHNCIIIETDYDTYTVARLMNQAIPVGFFMTPRDRIVCFKTTDYVEDIQEIMT
FT                   KKRFRDFPIEDENGNYVGTISRRNLLRSGRKKVILVDHNEKNQAVNGIEDTEILEIIDH
FT                   HRLGPIQTITPVFFRNQPLGCTGTIIYKMYQEAGINIEPVIAGLMCSAIISDTLIFKSP
FT                   TCTPDDIEAAMELADIAGIDPEVYGRQMFGAGSNLDEKTDREIFYQDFKKFAINDVTVG
FT                   VGQVNAMGPEDIEKIKAKEVPFIDTVTGDGGLDVVYFLMTDISTECSYVLCSGKNADTI
FT                   MSQAFGVDKQQDTYILKNVVSRKKQFLPAIMEAMEQ"
FT   gene            520026..520898
FT                   /locus_tag="EUBELI_00512"
FT   CDS_pept        520026..520898
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00512"
FT                   /product="methionyl aminopeptidase"
FT                   /note="Psort-B: Cytoplasmic, score:8.87; COG0024 Methionine
FT                   aminopeptidase; HMMPfam:IPR000994; HMMPfam:IPR004027;
FT                   Gene3D:IPR000994; HMMPanther:IPR000994;
FT                   HMMPanther:IPR002467; HMMTigr:IPR002467; K01265 methionyl
FT                   aminopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00512"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71525"
FT                   /db_xref="GOA:C4Z3Q6"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001714"
FT                   /db_xref="InterPro:IPR002467"
FT                   /db_xref="InterPro:IPR004027"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z3Q6"
FT                   /protein_id="ACR71525.1"
FT                   /translation="MKALRKDDPCWCNSGKKYCDCHMEFDRKLDNFKRKFHKVPPRNII
FT                   KNEEQLAGMRESSKINIAVLDYVAENIHAGMTTQDIDDLVYKKTTEMGGIPAPLNYEGF
FT                   PKSVCTSINEQVCHGIPSKNIQLLDGDIINVDCSTILNGYFSDSSRMFCIGNVAPEHKK
FT                   LVDVAKECVELGLAQVKPWGHLGDVAAAINEHAKANGYSVVREVGGHGIGLEFHETPFV
FT                   SYVIKKGTGMVMAPGMVFTIEPMINAGLPDIYIDEGNNWTIYTDDDSYSAQWEIMVHVT
FT                   EDGYEVMSY"
FT   gene            521042..521182
FT                   /locus_tag="EUBELI_00513"
FT   CDS_pept        521042..521182
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00513"
FT                   /product="Hypothetical protein"
FT                   /note="Psort-B: Extracellular, score:8.82"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00513"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71526"
FT                   /db_xref="InterPro:IPR020256"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z3Q7"
FT                   /protein_id="ACR71526.1"
FT                   /translation="MMMTQQVPAMCYVPWQRWDELYEPSRAIMRGTMFPVLDKPFTGGR
FT                   S"
FT   gene            521179..521457
FT                   /locus_tag="EUBELI_00514"
FT   CDS_pept        521179..521457
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00514"
FT                   /product="Hypothetical protein"
FT                   /note="Psort-B: Unknown cell location; NOG18028 non
FT                   supervised orthologous group"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00514"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71527"
FT                   /db_xref="InterPro:IPR024207"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z3Q8"
FT                   /protein_id="ACR71527.1"
FT                   /translation="MNCCNNIRNEKAMIMKNIYELGFALVETMLYLDTHPDDAAAIEYY
FT                   AEIKDKYVQFMKKYSDYYGPLSMEYMVNDNYWMWVATPMPWEYKGGM"
FT   gene            521459..522058
FT                   /locus_tag="EUBELI_00515"
FT   CDS_pept        521459..522058
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00515"
FT                   /product="spore coat protein JC"
FT                   /note="Psort-B: Cytoplasmic, score:8.87; COG3546
FT                   Mn-containing catalase; HMMPfam:IPR007760;
FT                   Gene3D:IPR012347; superfamily:IPR009078; K06334 spore coat
FT                   protein JC"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00515"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71528"
FT                   /db_xref="InterPro:IPR007760"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="InterPro:IPR039377"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z3Q9"
FT                   /protein_id="ACR71528.1"
FT                   /translation="MWNYEKRLQYPINIKNCNPTLAAMIISQYGGPDGELGASMRYLSQ
FT                   RYSMPYREVAGLLTDIGTEELGHLEMVSTMVHQLTRNLTMEQIKGTPFEAYYVDHTVGV
FT                   WPQAAGGVPFCALEFQSKGDAITDIVEDMAAEQKARSTYDNLLRLCRDDPDVYEPLKFL
FT                   REREVVHFQRFGEAMSIIQSKLDSKNFYAYNPEFKK"
FT   gene            522086..522865
FT                   /locus_tag="EUBELI_00516"
FT   CDS_pept        522086..522865
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00516"
FT                   /product="Hypothetical protein"
FT                   /note="Psort-B: Cytoplasmic, score:8.87"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00516"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71529"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z3R0"
FT                   /protein_id="ACR71529.1"
FT                   /translation="MIEYIYKRLIKGVPMKEKIYTIPVNDAFSSDCECPICSMYKALED
FT                   DAVSYTMGPSYMEDDIRAVTDKKGFCQKHLKKVYDCENRLGFALVMKTHLDRVINDIEG
FT                   LQDGKVAGKSMFKKADKPSVTAYTEQLEGTCFVCERIDNTFQRYLDTIFHMYKHDSDFR
FT                   EKYKTCKGFCTKHYGILLEQAANSLKGDMLDEFIKITNSLYIENMKRVRDDVEWFINKF
FT                   DHKYIDEPWKNAKDSLVRAMIKDGSYIADEPGKKNNR"
FT   gene            complement(522923..524005)
FT                   /locus_tag="EUBELI_00517"
FT   CDS_pept        complement(522923..524005)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00517"
FT                   /product="Hypothetical protein"
FT                   /note="Psort-B: Unknown cell location; COG5279
FT                   Uncharacterized protein involved in cytokinesis, contains
FT                   TGc (transglutaminase/protease-like) domain"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00517"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71530"
FT                   /db_xref="InterPro:IPR002931"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z3R1"
FT                   /protein_id="ACR71530.1"
FT                   /translation="MKFRKYWASLLAGAILTASLYGCSIPFTNNNTSDTSSEISYIPFD
FT                   NKAATTEDIIQFIIQSMENNNNECDIFVADDKLIDANEWLTRISGIEQIKCEYRRIKDG
FT                   YNMVITYDCWDNYAIMKAYNSDNTSQLNERQLELYNKYIEILSEVTSPHKSDYENELAI
FT                   HDYLVSHITYIDNGGSTFNAYDALINGEAVCSGYTESFKTFMDMLGIENYTLSGTAGSQ
FT                   QHIWNVVKLGNDWYQVDVTWDDPVGSTSEYIDHGYFNITDADMAIDHTWNSAVNAANPA
FT                   NGYIYTYPVQSKLQVINTQNEFDNYILRCIRNRTRHIEFTTTADLDIKSAVSNAGIQLS
FT                   YAYKTTNRTNYTLYTVTFTF"
FT   gene            524097..524960
FT                   /locus_tag="EUBELI_00518"
FT   CDS_pept        524097..524960
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00518"
FT                   /product="N-glycosylase/DNA lyase"
FT                   /note="Psort-B: Cytoplasmic, score:8.87; COG0122
FT                   3-methyladenine DNA glycosylase/8-oxoguanine DNA
FT                   glycosylase; HMMPfam:IPR003265; HMMPfam:IPR012904;
FT                   HMMSmart:IPR003265; superfamily:IPR011257;
FT                   superfamily:IPR012294; K03660 N-glycosylase/DNA lyase"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00518"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71531"
FT                   /db_xref="GOA:C4Z3R2"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="InterPro:IPR012904"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z3R2"
FT                   /protein_id="ACR71531.1"
FT                   /translation="MADYKLKNVCDFDLAQTLECGQCFHFVKLDEEDYVLTAKGYVLHV
FT                   SQEADTVTFYDTDKDEYVNVWKDYFDMDRDYSAIKKKLLEKDDKLKDAIESMWGVRILN
FT                   QDFFETLISFIISQNKQIPHIKKIVADISAKFGTYKGTYGGADMYTFPTLEQLANASEE
FT                   DFKELKTGFRAPYIMDAIRRNMAGQFDINELKSMDYDSCIKELMTIKGVGEKVANCVSL
FT                   FGLGKKEAFPVDVWIKRIMETMYFDGVDTPKDKIAAFAKEQFGELGGFAQQYLFYYGKS
FT                   IKMGVK"
FT   gene            525064..525429
FT                   /locus_tag="EUBELI_00519"
FT   CDS_pept        525064..525429
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00519"
FT                   /product="chaperonin GroES"
FT                   /note="Psort-B: Cytoplasmic, score:9.98; COG0234
FT                   Co-chaperonin GroES (HSP10); HMMPfam:IPR001476;
FT                   BlastProDom:IPR001476; Gene3D:IPR001476;
FT                   HMMPanther:IPR001476; ScanRegExp:IPR001476;
FT                   superfamily:IPR011032; K04078 chaperonin GroES"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00519"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71532"
FT                   /db_xref="GOA:C4Z3R3"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR018369"
FT                   /db_xref="InterPro:IPR020818"
FT                   /db_xref="InterPro:IPR037124"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z3R3"
FT                   /protein_id="ACR71532.1"
FT                   /translation="MSANRNMNAAMKGSLLCGDSGMEEYIMKLVPLGDRVVIKALVAEE
FT                   TTKSGIVLPGQAKEKPQQAEVIAVGPGGVVDGKEVVMQVKPGDKVIYSKYSGTEVKLDE
FT                   DENLIIVKQSDILAIIE"
FT   gene            525501..527126
FT                   /locus_tag="EUBELI_00520"
FT   CDS_pept        525501..527126
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00520"
FT                   /product="chaperonin GroEL"
FT                   /note="Psort-B: Cytoplasmic, score:9.98; COG0459 Chaperonin
FT                   GroEL (HSP60 family); HMMPfam:IPR002423;
FT                   HMMPanther:IPR002423; HMMTigr:IPR012723;
FT                   ScanRegExp:IPR001844; superfamily:IPR008950; K04077
FT                   chaperonin GroEL"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00520"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71533"
FT                   /db_xref="GOA:C4Z3R4"
FT                   /db_xref="InterPro:IPR001844"
FT                   /db_xref="InterPro:IPR002423"
FT                   /db_xref="InterPro:IPR018370"
FT                   /db_xref="InterPro:IPR027409"
FT                   /db_xref="InterPro:IPR027410"
FT                   /db_xref="InterPro:IPR027413"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4Z3R4"
FT                   /protein_id="ACR71533.1"
FT                   /translation="MAKEIKYGIEARKALEEGVNKLANTVRVTIGPKGRNVVLDKSYGA
FT                   PLITNDGVTIAKDIELEDAFENMGAQLVKEVAAKTNDVAGDGTTTATVLAQAMINEGMK
FT                   NLAAGANPIVLRKGMKKATDCAVEAIAGMSEKVTGKDQIAKVAAISAGDEEVGQMVADA
FT                   MEKVSNDGVITIEESKTMKTELDLVEGMQFDRGYISAYMATDMDKMEAVLDNPYILITD
FT                   KKISNIQEILPVLEQIVQSGAKLLIIAEDVEGEALTTLIVNKLRGTFNVVAVKAPGYGD
FT                   RRKEMLKDIAILTGGQVISEELGLELKDTTMDMLGRAKSVKVQKENTVIVDGEGAKEDI
FT                   DARVAQIKAQLEETTSEFDKEKLQERLAKLAGGVAVIRVGAATETEMKEAKLRMEDALN
FT                   ATRAAVEEGVVSGGGSAYIHASKKVAELVKTLSGDEKIGAQIILKALEAPLFHIAYNAG
FT                   LEGAVIINKVRESEVGTGFDAYKEEYVNMIDAGILDPAKVTRSALQNATSVASTLLTTE
FT                   SVVANIKEDAPAMPAGGAGMGGMM"
FT   gene            527207..527713
FT                   /locus_tag="EUBELI_00521"
FT   CDS_pept        527207..527713
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00521"
FT                   /product="Hypothetical protein"
FT                   /note="Psort-B: Cytoplasmic, score:8.87"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00521"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71534"
FT                   /db_xref="GOA:C4Z3R5"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z3R5"
FT                   /protein_id="ACR71534.1"
FT                   /translation="MIEGTVEQIVKVTAPKISIFYRIILVIACLLAATTIVQTGWLGVI
FT                   VLVIFIFFTVFVFEYYNAEYEYSYVDGSLTIDKIMAKSVRKNVGSFDLTRAVLVAKVNS
FT                   QEALGKARQQLRTYNCSSGVDDPEDIVIYTYDNDSNEMIRLFMLPDDSMKEAIVSAVGN
FT                   GVAHL"
FT   gene            527873..529333
FT                   /locus_tag="EUBELI_00522"
FT   CDS_pept        527873..529333
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00522"
FT                   /product="malate dehydrogenase"
FT                   /note="Psort-B: Cytoplasmic, score:8.87; COG0516 IMP
FT                   dehydrogenase/GMP reductase; HMMPfam:IPR000644;
FT                   HMMPfam:IPR001093; Gene3D:IPR013785; HMMPanther:IPR001093;
FT                   HMMSmart:IPR000644; HMMTigr:IPR005990;
FT                   ScanRegExp:IPR015875; K00024 malate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00522"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71535"
FT                   /db_xref="GOA:C4Z451"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR001093"
FT                   /db_xref="InterPro:IPR005990"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR015875"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z451"
FT                   /protein_id="ACR71535.1"
FT                   /translation="MGKIIGEGITFDDVLLVPQYSEVTPNMIDLSTQLTKNIKLNIPLM
FT                   SAGMDTVTEHRMAIAMARQGGIGIIHKNMSVEAQAEEVDKVKRSENGVITDPFFLHPDN
FT                   TLQEANDLMGKFRISGVPITDDNGKLVGIITNRDLKFEEHFERPIKECMTSENLITAPV
FT                   GTTLEEAKKILGKARKEKLPIVDDDYKLRGLITIKDIEKSVKYPSSAHDSQGRLLAGAA
FT                   VGITANVMERVQALVNANVDCIVIDSAHGHSKNIITTLKEIKSAFPDLQVIAGNIATGA
FT                   AAKALCEAGVDAVKVGIGPGSICTTRVVAGIGVPQVTAVMDAYAEAKKYGIPVIADGGI
FT                   KYSGDIVKAIAAGGNVCMLGSLLAGCDEAPGTFELFQGRKYKVYRGMGSIAAMENGSKD
FT                   RYFQTGAKKLVPEGVEGRVAYKGLVEDTIFQLMGGLRSGMGYCGAPTIPVLQETAQFIK
FT                   MSSAALRESHPHDIHITKEAPNYSVEDK"
FT   gene            529527..530111
FT                   /locus_tag="EUBELI_00523"
FT   CDS_pept        529527..530111
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00523"
FT                   /product="Hypothetical protein"
FT                   /note="Psort-B: Unknown cell location"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00523"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71536"
FT                   /db_xref="InterPro:IPR028051"
FT                   /db_xref="InterPro:IPR028976"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z452"
FT                   /protein_id="ACR71536.1"
FT                   /translation="MKDRILGKYIAKNHTGNVFTDNELQVIRQGNTDKMVETFLHMGND
FT                   YYNTQMQCTINSLGMFMDGDIELDHIDFERTYRGEFIGCQIMDGDIDVFLGIAGNDKEL
FT                   LKVASTFAQEDIKEFDADAYDALCEFINVINGAYATKLGENDVEVTLHPPVFYKNTEVT
FT                   AEDGFYVVTFNMENNLFKILMAADNKIQLSA"
FT   gene            530126..530491
FT                   /locus_tag="EUBELI_00524"
FT   CDS_pept        530126..530491
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00524"
FT                   /product="two-component system, chemotaxis family, response
FT                   regulator CheY"
FT                   /note="Psort-B: Cytoplasmic, score:9.98; COG0784 FOG:
FT                   CheY-like receiver; HMMPfam:IPR001789;
FT                   BlastProDom:IPR001789; HMMSmart:IPR001789;
FT                   superfamily:IPR011006; K03413 two-component system,
FT                   chemotaxis family, response regulator CheY"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00524"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71537"
FT                   /db_xref="GOA:C4Z453"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z453"
FT                   /protein_id="ACR71537.1"
FT                   /translation="MAKILIVDDSKTSRKFLRNMLEDAGHEIVSEAVNGAEGVEKYKMY
FT                   KPDVVTMDITMPVMDGIEAVKEIMEIDPGAKVIMVTAAGQKTNMVEALKRGAADFIQKP
FT                   FDSAVIINTIEKVLEDE"
FT   gene            530491..531228
FT                   /locus_tag="EUBELI_00525"
FT   CDS_pept        530491..531228
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00525"
FT                   /product="tRNA-pseudouridine synthase I"
FT                   /note="Psort-B: Cytoplasmic, score:8.87; COG0101
FT                   Pseudouridylate synthase; HMMPfam:IPR001406;
FT                   Gene3D:IPR001406; HMMPanther:IPR001406; HMMTigr:IPR001406;
FT                   K06043 tRNA-pseudouridine synthase I"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00525"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71538"
FT                   /db_xref="GOA:C4Z454"
FT                   /db_xref="InterPro:IPR001406"
FT                   /db_xref="InterPro:IPR020095"
FT                   /db_xref="InterPro:IPR020097"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z454"
FT                   /protein_id="ACR71538.1"
FT                   /translation="MYNYRIEIEYDGGRYDGWQRLGKDASTNTIESRLCEIIARMTGET
FT                   VDMYAGSRTEKGVHALCQTANFKLEKEVKAIEIKNYLNRYLPRDIAVMSVTEADERFHS
FT                   QLNAKSKIYEYRLDTGNVANVFRRKYAYHTFDKPDFDAMRKAAGYFEGKHDFKAFTTAK
FT                   KSKSTEKTIKKISVEYEGARAYIRIEADDFLHNMARYIIGMMLDVGNGIKKPEDVKRCL
FT                   DGENIQMSLPAESYGLFLVKVVY"
FT   gene            531250..533016
FT                   /locus_tag="EUBELI_00526"
FT   CDS_pept        531250..533016
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00526"
FT                   /product="arginyl-tRNA synthetase"
FT                   /note="Psort-B: Cytoplasmic, score:9.98; COG0018
FT                   Arginyl-tRNA synthetase; HMMPfam:IPR005148;
FT                   HMMPfam:IPR008909; HMMPfam:IPR015945; Gene3D:IPR014729;
FT                   HMMPanther:IPR001278; HMMTigr:IPR001278;
FT                   superfamily:IPR009080; K01887 arginyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00526"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71539"
FT                   /db_xref="GOA:C4Z455"
FT                   /db_xref="InterPro:IPR001278"
FT                   /db_xref="InterPro:IPR005148"
FT                   /db_xref="InterPro:IPR008909"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR035684"
FT                   /db_xref="InterPro:IPR036695"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z455"
FT                   /protein_id="ACR71539.1"
FT                   /translation="MKTIIELITDEIKNVFAECGYDEAYAKVTVSNRPDLCEFQCNGAM
FT                   AAAKAYKKAPFMIADEVVAKLADNKMFSKIESVKPGFININICEDYLAGYLNEMSETEK
FT                   FGYVNSESNKTVIVDYGGANAAKPLHVGHLRSAVIGESVKRINTFVGNKTIGDVHLGDW
FT                   GLQMGLIIEELRDRKPELPYFDDSFTGEYPEEAPFTISELEEIYPAASAKSKEDIAFAE
FT                   RAHEATLKLQSGDKACRAIWHHIMNVSKADLKKNYDNLNVHFDLWKGESDAQPYIDDMV
FT                   NKMIADGIAYESQGATVVDIQQEGDTKELPPCIVRKSDGAALYATSDLATIVEREKLYH
FT                   PDTYIYLADKRQELHFTQVFRTAKKAGIVAPDADMRFVGFGTMNGKDGKPFKTRSGGVM
FT                   RLEHLIADIDEAVYEKIMSNRTVEETEARDTAKIVGLAALKYGDLSNQASKDYVFDIER
FT                   FSSFEGNTGPYILYTIVRIKSILNKYTENGGSTNNLKIMAATEESEKNLSLSLIKFADI
FT                   IDGAYRDNAPHKICQFIYEVSNAFNGFYHNNKILSEPDEAKKASYIALISLTKSILEQC
FT                   IDLLAIECPDRM"
FT   gene            533029..534054
FT                   /locus_tag="EUBELI_00527"
FT   CDS_pept        533029..534054
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00527"
FT                   /product="Hypothetical protein"
FT                   /note="Psort-B: Cytoplasmic, score:8.87; COG0463
FT                   Glycosyltransferases involved in cell wall biogenesis;
FT                   HMMPfam:IPR001173"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00527"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71540"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z456"
FT                   /protein_id="ACR71540.1"
FT                   /translation="MGKLLSFAIPCYNSAEYMEHCINTVLAGGDEVEVIIVDDGSTKDN
FT                   TYEIAKRYEKEYPDIVKAVHQENGGHGEAVNTGLKHATGRFFKVVDSDDWVDGKSYKRM
FT                   LATLRSFEEGSEPDMVIANYVYEKVGAKRKKVIHYENVFPVEQMFTWDDINIGDFKVDQ
FT                   YILMHTVVYRTQLLKDCGLELPKHTFYVDNIFVFEPLPYVKNMYYINTNFYRYFIGRED
FT                   QSVNESVMISRIDQQLSVNKRMIDSFLSENPKNINCRKYMINYLRIMMEVSSIFLIVSG
FT                   TKEHLAKKKALWQYAKDKDEVLYKKLRHSLLGWSVNIPTSAGRWISKQGYKVANNIIGF
FT                   N"
FT   gene            534079..534843
FT                   /locus_tag="EUBELI_00528"
FT   CDS_pept        534079..534843
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00528"
FT                   /product="2-deoxy-D-gluconate 3-dehydrogenase"
FT                   /note="Psort-B: Cytoplasmic, score:9.65; COG1028
FT                   Dehydrogenases with different specificities (related to
FT                   short-chain alcohol dehydrogenases); HMMPfam:IPR002198;
FT                   HMMPanther:IPR002198; HMMTigr:IPR011286;
FT                   ScanRegExp:IPR002198; K00065 2-deoxy-D-gluconate
FT                   3-dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00528"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71541"
FT                   /db_xref="GOA:C4Z457"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR011286"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z457"
FT                   /protein_id="ACR71541.1"
FT                   /translation="MSIIDAFRLDGKVAVVTGANTGLGQGMSVALAQAGAKVVGVARRS
FT                   CEDTKKLVEADGGEFAEVIADLSDMSAIDVIVNGALAAFGKVDILVNNAGLIKRNDAID
FT                   FTEDEWDSVIQVNQKMVFFLSQAFAKQYIKQGHGGKIININSMLSYQGGIRVPSYTASK
FT                   SAGMGLTKAMCNEWACHNINVNAIAPGYMATNNTAQLRSDSDRSEAIIDRIPAGRWGTP
FT                   DDMKGAVVFLASAASDYVNGFTLAVDGGWLAR"
FT   gene            complement(534915..535448)
FT                   /locus_tag="EUBELI_00529"
FT   CDS_pept        complement(534915..535448)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00529"
FT                   /product="Hypothetical protein"
FT                   /note="Psort-B: Unknown cell location"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00529"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71542"
FT                   /db_xref="GOA:C4Z458"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z458"
FT                   /protein_id="ACR71542.1"
FT                   /translation="MRIIMDIIKFNTTLKASGKDYTKIVFWNRFIRNPIELILSWTPAI
FT                   ISLVLLSLHYYSSFLLILYAVCWFYPIYIFAYQFRSSVNYHLKHRDPSEEAPCTITLMD
FT                   NAIMADIPEHDLVYTYEWNQFTNVYNKFGYYMLFNKGRMIVMLNQNDMPEDVKSAVPAY
FT                   IKSHVDRNICKINF"
FT   gene            535572..537743
FT                   /locus_tag="EUBELI_00530"
FT   CDS_pept        535572..537743
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00530"
FT                   /product="histidine ammonia-lyase"
FT                   /note="Psort-B: Cytoplasmic, score:8.87; COG2199 FOG: GGDEF
FT                   domain; HMMPfam:IPR000160; HMMPfam:IPR001633;
FT                   HMMSmart:IPR000160; HMMSmart:IPR001633; HMMTigr:IPR000160;
FT                   K01745 histidine ammonia-lyase"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00530"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71543"
FT                   /db_xref="GOA:C4Z459"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z459"
FT                   /protein_id="ACR71543.1"
FT                   /translation="MIGYNIIRFMYYRRVILSGNKTVNLELSQIIHMLEDNGTFVEVSK
FT                   NIIEKITDNLHAQDAVIMQISADGKSMHAIAEAKDVIGSKLDVEDISQCCLCSDELKRT
FT                   AMSTASDEEKERLALCNAKICISVPITINNVKAMYLLVMGDTDDFAGEDKVIEYIKDVA
FT                   MIIHSIAQSKVINNSLISSYDVLQKILDNIGSGIIVCSKNSGNILFENDMASHVTEVRE
FT                   TIRECLEEVFQNKDISGHIGTPMERYNTESGLWFEVRFSELKWIDGSDVVVATAADITQ
FT                   KKKNQQKIEYQAHNDFLTGLYNRMKCEVDLRKVIRRTEKAGLKGAVLFLDLDDFKHIND
FT                   GLGHQYGDILLQQIAAGLTGIPGLRGHCYRMGGDEFVIIIEPEIYNELSKIVTNIKTLF
FT                   NKPWYLMETEYFCTMSMGIALFPDNSVDVHEITRMADVAMYEAKRSGKNGYAYYSSEVE
FT                   NSTAKRLDIENNMRQAISNEINEFVVFYQPVVNVNTQMCTSCEALVRWDSKALGFMGPG
FT                   EFIPLAEYLGLITSIGDYVLEEACRRCKIWNDNGHPDFYINVNLSVVQLLQKDVVENIK
FT                   RILDKTGVNPKNIVLEITESFAINDMQRVMEIITGLKKLGPRIALDDFGTGYSSLNYIK
FT                   QLPLDIIKVDKTFIDDIVEDDYAQAFVKLIVDLSKTIGTKIVVEGVEHKEQFELLKSLG
FT                   VDYIQGYYFGKPVPANIFEEKNLEGRLGK"
FT   gene            537740..539062
FT                   /locus_tag="EUBELI_00531"
FT   CDS_pept        537740..539062
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00531"
FT                   /product="dihydroorotase"
FT                   /note="Psort-B: Cytoplasmic, score:8.87; COG0044
FT                   Dihydroorotase and related cyclic amidohydrolases;
FT                   HMMPfam:IPR006680; BlastProDom:IPR005847;
FT                   HMMTigr:IPR004722; ScanRegExp:IPR002195;
FT                   superfamily:IPR011059; K01465 dihydroorotase"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00531"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71544"
FT                   /db_xref="GOA:C4Z460"
FT                   /db_xref="InterPro:IPR002195"
FT                   /db_xref="InterPro:IPR004722"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z460"
FT                   /protein_id="ACR71544.1"
FT                   /translation="MNILIKEGRVLDPASKTDKVMDVLIKDGFIAAMEENIDESQADDV
FT                   IDASGCMVMPGLIDLNAHFREPGLEHKETIRTGSRAAARGGYTTVCMMPNTKPVIDNVE
FT                   MLQYVTDKAEEVTDINLYTIAAMTAGQEGEYLTDFEALKDAGAVAVSDNGGTIMNARTA
FT                   RQAMRQAAEVDIPVFAHCEDTNLAARGVMNAGERAKELGLFGIMDAVEDVIVARDILLA
FT                   KNTGAKLHISHVSNKESAFIIKIAKEQGIPVTAEVAPHHFTLTEDAVNGDDANFKINPP
FT                   LRKADDVKALKEALASGVIDVIATDHAPHHPTEKERPFDEAPFGVVGLETAVPVTITVL
FT                   VRTGVLTPLQMVEKMSYNPAKILGIDRGVLAPGKVADITVVNPTEEYDIDSNRFASKGK
FT                   NTPFEGKHVYGKVLYTLVNGRVVYSDHNGTEILIEREVPKL"
FT   gene            539108..540031
FT                   /locus_tag="EUBELI_00532"
FT   CDS_pept        539108..540031
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00532"
FT                   /product="orotidine-5-phosphate decarboxylase"
FT                   /note="Psort-B: Cytoplasmic, score:8.87; COG0284
FT                   Orotidine-5-phosphate decarboxylase; HMMPfam:IPR001754;
FT                   Gene3D:IPR013785; HMMTigr:IPR011995; superfamily:IPR011060;
FT                   K01591 orotidine-5-phosphate decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00532"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71545"
FT                   /db_xref="GOA:C4Z461"
FT                   /db_xref="InterPro:IPR001754"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR011995"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z461"
FT                   /protein_id="ACR71545.1"
FT                   /translation="MIKKLVDKIVETNAPIVVGLDPMMKYLPKHLADVAFEQYGETLEG
FT                   AAEAIWQYNKGIIDNIYDIVPAVKPQIAMYEQFGIEGLKAFKKTVDYCHEKGMIVIGDV
FT                   KRGDIGSTSEAYAVAHLGKVNVGSKAITPFDEDFATVNPYLGSDGINPFIKVCNEQDRG
FT                   IFILVKTSNPSSGEFQDQLINGRPLYELVGEKVNEWGASSMDGDYSNVGAVVGATYPEM
FT                   GRVLRKVMPKAYILVPGYGAQGGQGKDLVDFFNPDGLGAIVNSSRGIIAAYTKEQYAKF
FT                   GEKNFGEASRQAALDMIADINGALGK"
FT   gene            540059..540871
FT                   /locus_tag="EUBELI_00533"
FT   CDS_pept        540059..540871
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00533"
FT                   /product="dihydroorotate dehydrogenase electron transfer
FT                   subunit"
FT                   /note="Psort-B: Cytoplasmic, score:8.87; COG0543
FT                   2-polyprenylphenol hydroxylase and related flavodoxin
FT                   oxidoreductases; HMMPfam:IPR001433; HMMPIR:IPR012165;
FT                   K02823 dihydroorotate dehydrogenase electron transfer
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00533"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71546"
FT                   /db_xref="GOA:C4Z462"
FT                   /db_xref="InterPro:IPR000951"
FT                   /db_xref="InterPro:IPR012165"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR019480"
FT                   /db_xref="InterPro:IPR023455"
FT                   /db_xref="InterPro:IPR037117"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z462"
FT                   /protein_id="ACR71546.1"
FT                   /translation="MEIIMAYRENAKILKADCLADGVYEIWFETKDIAKTAKAGQFISV
FT                   YSNDGSRMLPRPISICKVENNNLRIVFRVAGKGTEEFSKMKAGEYLDIQGPLGNGYNLG
FT                   KIAAEIKAEGRSFDKAILFGGGIGIPPMLELARRLDCHKNVVVGYRNSQTFLKEDFEAV
FT                   ADTDVYIATEDGSVGTKGNVLDAVKQEKVEADVIFACGPTPMLRAIKAYALENDIPCYV
FT                   SLEEKMACGIGACLACVCKSTGIDDHSQVKNKRVCKEGPVFNVKEVEL"
FT   gene            540871..541782
FT                   /locus_tag="EUBELI_00534"
FT   CDS_pept        540871..541782
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00534"
FT                   /product="dihydroorotate oxidase"
FT                   /note="Psort-B: Unknown cell location; COG0167
FT                   Dihydroorotate dehydrogenase; HMMPfam:IPR001295;
FT                   Gene3D:IPR013785; HMMPIR:IPR012135; HMMTigr:IPR005720;
FT                   ScanRegExp:IPR001295; K00226 dihydroorotate oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00534"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71547"
FT                   /db_xref="GOA:C4Z463"
FT                   /db_xref="InterPro:IPR001295"
FT                   /db_xref="InterPro:IPR005720"
FT                   /db_xref="InterPro:IPR012135"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR024920"
FT                   /db_xref="InterPro:IPR033888"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z463"
FT                   /protein_id="ACR71547.1"
FT                   /translation="MSDINMSVNIAGVELKNPVTVASGTFGSGMEYGEYVDLNRLGAVT
FT                   TKGVANIPWPGNPTPRIAETYGGMMNAIGLQNPGLDTFVKRDIPFLKQYDTKIIVNVCG
FT                   KSEADYVDAVEKLGEQPVDLLEINISCPNVKEGGIAFGQVPSSAEAITKAVKKVAKQPV
FT                   IMKLSPNVTDITEMAKAVEAGGADAVSLINTLTGMKIDVNRRTFAVANKTAGVSGPAIH
FT                   PIAVRMVYQVANAINLPIIGMGGIRTAEDALEMIMVGASAVAVGTANFNDPYTTIKVID
FT                   GIREYMEKNNVADIKELIGCVR"
FT   gene            541865..542971
FT                   /locus_tag="EUBELI_00535"
FT   CDS_pept        541865..542971
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00535"
FT                   /product="Hypothetical protein"
FT                   /note="Psort-B: Unknown cell location; NOG34977 non
FT                   supervised orthologous group"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00535"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71548"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z464"
FT                   /protein_id="ACR71548.1"
FT                   /translation="MGWEVMHIRLDKATQKDKLCVLADEYDSQPFDYVFDINTKLDAVC
FT                   DDSGRYCFDRLGKAVWHYILDHPFYHHDSLKVPLKNMNVICLDEMHKKFIDETYPHINS
FT                   CIVLPLAAKQAESGLKPYDMRENDLIFTASYTDPDMVYFKAKKQDSENVVFFNTFTQIL
FT                   FDNPELTQEEAIRKIYPGISGTQTAEKLQQNFMADVYIQAAIRQEIVVQLIRNHVPVKL
FT                   YGHNWDTFLTKAEVLMKEDLTFIKEHVEDCGEVTYGELPAIYNNARLSINQLPWFKAGI
FT                   HDRTPLALMNGCVSITDGSTYMRREIPMDSGVEYYSLDELDNVGEKIKSLVADAASMTD
FT                   KAARGVQYAEDMWSWKHWAEEFEEAAKE"
FT   gene            complement(543408..545162)
FT                   /locus_tag="EUBELI_00536"
FT   CDS_pept        complement(543408..545162)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00536"
FT                   /product="1-deoxy-D-xylulose-5-phosphate synthase"
FT                   /note="Psort-B: Unknown cell location; COG1154
FT                   Deoxyxylulose-5-phosphate synthase; HMMPfam:IPR005475;
FT                   HMMPfam:IPR005476; superfamily:IPR009014; K01662
FT                   1-deoxy-D-xylulose-5-phosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00536"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71549"
FT                   /db_xref="GOA:C4Z465"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR005477"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z465"
FT                   /protein_id="ACR71549.1"
FT                   /translation="MYIENINSPADVKKLNIMQLNVLAEEMRHALLTRASRHGGHFGPN
FT                   FGMVEAIIAMHYVFDSPKDKIVFDVSHQCYPHKMLTGRKDAYLYEEHYDDVSGYTNPNE
FT                   SEHDFFTVGHTSTSISLACGLAKARDLNGEDGNVIAVIGDGSLSGGEALEGLDFASELN
FT                   SNMIIVANDNDMSIAENHGGLYANLKLLRETNGQAECNLFKAMNLDYIYVDKGNDIASL
FT                   IEAFEKVKDTKKAVVVHINTLKGKGYAPAEQNKEKWHWHMPFDIATGESLFKDEEPDFS
FT                   DASLEYLLKKMDEDKSVVAITAGTPTVMGFTADMRAKAGKQFVDVGIAEETAVALASGI
FT                   AANGGKPVFGVYSSFIQRAYDQITQDVCINGNAVTFAVFAGSVYGMNDVTHLGLQDIPM
FT                   LNSIPGLIYLAPVTKEDYIAMLDWSLTQNEYPVAIKVPGGRMVSTGTPVTKDFGKLDTY
FT                   EITKKGSKVAILGLGTFYENAVKAADILKASHGIDATVINPYYISGIDADTLNELKKDH
FT                   AVVATLEDGYLEGGFGAKIAAFYGSSDMKVLNFGIKKEFIDRYDVAEVLKDNHLTPEQI
FT                   AEDIAATL"
FT   gene            545813..546604
FT                   /locus_tag="EUBELI_00537"
FT   CDS_pept        545813..546604
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00537"
FT                   /product="Hypothetical protein"
FT                   /note="Psort-B: Unknown cell location"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00537"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71550"
FT                   /db_xref="InterPro:IPR018958"
FT                   /db_xref="InterPro:IPR037883"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z466"
FT                   /protein_id="ACR71550.1"
FT                   /translation="MNEQVKNAYEKIKMLCEKLDNADYSEFSNAATMEELDLWQKENGV
FT                   VLPENYKEWLLLSKYSYIAGGVLELFMPSKNGYYGQLVPEEFIVVGNVIGDGERLCFDV
FT                   NMGEFVRYDHGYIREVGDFTNILNWAIEYLKIMLEAVNDKIRFVSRNDLLRRKAIQGFW
FT                   IHERELLNNGRCTRQWNGDEIEAIYNINLDTGNKRIYAGKPVQYKNGEKLTDENGTPVR
FT                   YEGHHMMSYQEHPEYIGEWKNIQALTPEEHILGAHGQGKRG"
FT   gene            546610..547140
FT                   /locus_tag="EUBELI_00538"
FT   CDS_pept        546610..547140
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00538"
FT                   /product="Hypothetical protein"
FT                   /note="Psort-B: Cytoplasmic, score:8.87"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00538"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71551"
FT                   /db_xref="InterPro:IPR018958"
FT                   /db_xref="InterPro:IPR037883"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z467"
FT                   /protein_id="ACR71551.1"
FT                   /translation="MYTKIEIPENNSLKSKIEELYEWCDKRDNDDELGKTYFNEPIDED
FT                   KLNKWEEANGVKIPETYKEWLRFTEKCLIDGTSAMFWGTDDFHHNFMPDNLTVIGEMSG
FT                   DGEVVCFSNDNGEFMGYYEGDITYRTNDFSQVIDQIFERNSAWGGLSKEDIELFMEFCE
FT                   RNKREKAEMEHDD"
FT   gene            547232..547447
FT                   /locus_tag="EUBELI_00539"
FT   CDS_pept        547232..547447
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00539"
FT                   /product="Hypothetical protein"
FT                   /note="Psort-B: Unknown cell location"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00539"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71552"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z468"
FT                   /protein_id="ACR71552.1"
FT                   /translation="MCFNKEMRGKIMNYIYDYISEERKKEIAYMNIVDTYNRTGYLDIP
FT                   GDKVVKSKDEYFLFWYNSPDTLCLRQ"
FT   gene            547490..547756
FT                   /locus_tag="EUBELI_00540"
FT   CDS_pept        547490..547756
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00540"
FT                   /product="Hypothetical protein"
FT                   /note="Psort-B: Unknown cell location"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00540"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71553"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z469"
FT                   /protein_id="ACR71553.1"
FT                   /translation="MLIYGDKYMDIEIPNENWKEKVEFPDDAHPENFNMNTDKLKIYNT
FT                   IDMSFLRDCEYKIDICKMLSEYIHGDALWFKIKKIKFLLMMKL"
FT   gene            547815..548126
FT                   /locus_tag="EUBELI_00541"
FT   CDS_pept        547815..548126
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00541"
FT                   /product="Hypothetical protein"
FT                   /note="Psort-B: CytoplasmicMembrane, score:9.99"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00541"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71554"
FT                   /db_xref="GOA:C4Z470"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z470"
FT                   /protein_id="ACR71554.1"
FT                   /translation="MAAIIAVALIVAWLFIGNYLPKIIRYIISAILDVVAIVLFIMTPM
FT                   SLIIRIIIIVLLAFMAIIWLAKFNRFNGNKKIEWEQSRVDGIMFTVGVIIITLIIDLF"
FT   gene            548113..548652
FT                   /locus_tag="EUBELI_00542"
FT   CDS_pept        548113..548652
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00542"
FT                   /product="Hypothetical protein"
FT                   /note="Psort-B: Cytoplasmic, score:8.87"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00542"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71555"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z471"
FT                   /protein_id="ACR71555.1"
FT                   /translation="MICFNRNKKRGKIMDYIYDYISEERKKEIADMNIVDTYNRTGYLD
FT                   IPGDKVVKSKDEYFLFWHNLEDTLCLRQQIEETGSSSIGKKRYMLIYGDKYMNIDIPDE
FT                   NWMEKDEYPNNDPTFNINTEKMKQYNTIDLSFLKNCDYKTDICKMLSEYIHGDAIWFKI
FT                   MKNRIFIDDEMIVEEF"
FT   gene            549234..549965
FT                   /locus_tag="EUBELI_00543"
FT   CDS_pept        549234..549965
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00543"
FT                   /product="orotate phosphoribosyltransferase"
FT                   /note="Psort-B: Cytoplasmic, score:8.87; COG0461 Orotate
FT                   phosphoribosyltransferase; HMMPfam:IPR000836;
FT                   HMMTigr:IPR004467; K00762 orotate
FT                   phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00543"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71556"
FT                   /db_xref="GOA:C4Z472"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR004467"
FT                   /db_xref="InterPro:IPR023031"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z472"
FT                   /protein_id="ACR71556.1"
FT                   /translation="MKQCRRTAGLNKEDIMEQYKQEFIDFMVESDVLKFGDFTLKSGRK
FT                   SPFFMNAGAYVTGTQLARLGEYYAKAIHETYGDDFDVLFGPAYKGIPISVVTAVAYAKL
FT                   YGKEVRYCSDRKEEKDHGADKGGFLGSKLKDGDRVIMIEDVTTSGKSMEETVPKVRGAA
FT                   DVTIVGLMVSLNRMEVGLGGKVSALEEIKERYGFPTSAIVSMADVVEHLYNKECEGKVV
FT                   IDDALKAAIDKYYAEYGVKNA"
FT   gene            549946..550143
FT                   /locus_tag="EUBELI_00544"
FT   CDS_pept        549946..550143
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00544"
FT                   /product="Hypothetical protein"
FT                   /note="Psort-B: Unknown cell location"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00544"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71557"
FT                   /db_xref="GOA:C4Z473"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z473"
FT                   /protein_id="ACR71557.1"
FT                   /translation="MVLRTHKTDVNGGLTMEENLYKKLKSVGASNLVFGILIILFGIGA
FT                   GVMMIINGARLLAHRSDSLF"
FT   gene            550194..550664
FT                   /locus_tag="EUBELI_00545"
FT   CDS_pept        550194..550664
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00545"
FT                   /product="ABC-2 type transport system permease protein"
FT                   /note="Psort-B: CytoplasmicMembrane, score:9.99; COG4767
FT                   Glycopeptide antibiotics resistance protein;
FT                   HMMPfam:IPR006976; K01992 ABC-2 type transport system
FT                   permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00545"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71558"
FT                   /db_xref="GOA:C4Z474"
FT                   /db_xref="InterPro:IPR006976"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z474"
FT                   /protein_id="ACR71558.1"
FT                   /translation="MKKKHYVTLIKWALFVIYMILLFYVVFFAEGMGRAEIASGYKYNL
FT                   TLFTEIRRYWRYLGHFDSLGWIAFLNIIGNVLAFIPFGIFVPWLSNGRINVFATFAYGF
FT                   ALSLTIETVQLICKVGCFDVDDLVLNVLGALCGYAIYAIAYRIVKMFSKKDR"
FT   gene            550669..550983
FT                   /locus_tag="EUBELI_00546"
FT   CDS_pept        550669..550983
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00546"
FT                   /product="Hypothetical protein"
FT                   /note="Psort-B: CytoplasmicMembrane, score:9.26"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00546"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71559"
FT                   /db_xref="GOA:C4Z475"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z475"
FT                   /protein_id="ACR71559.1"
FT                   /translation="MKLFNKYKFSDKSQALGGLISTAMGILSLLSFGYGVYLSFKAAGE
FT                   GGLRVGSLGILSLILAVIGTVIGLISFKEDNKFYGTSRFGSMLCGVIAVFMIAVFLMGI
FT                   "
FT   gene            551012..553084
FT                   /locus_tag="EUBELI_00547"
FT   CDS_pept        551012..553084
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00547"
FT                   /product="Hypothetical protein"
FT                   /note="Psort-B: Cytoplasmic, score:8.87; COG2309 Leucyl
FT                   aminopeptidase (aminopeptidase T)"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00547"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71560"
FT                   /db_xref="GOA:C4Z476"
FT                   /db_xref="InterPro:IPR000787"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z476"
FT                   /protein_id="ACR71560.1"
FT                   /translation="MFNDNVEERYALAIERIKEIAEEPGLKNDGYADYFKCIATFILKM
FT                   DKLAADLKADVFRDYSLEEYKNLNTGLYEDVIGKAYETSYANPAYAASKLGLSEGRLLS
FT                   FLYVEIRGMIVYAYEGRMAEMTALMELFVEVYCMCASTEEDCGKPDYKQMKESVYWYVS
FT                   DYSDDLMEYRVRELLDPELDFATKIIMESDLTDVRYLYRFGEYVTDNEIKTAEYLSSLS
FT                   EEEIQKMADTFTEGYRIGFELTGKDLSKKKTVNIRYCLGFERLVRAEIKNFEKLGLKPT
FT                   IYRAAVNTINKRLNIKVGYYGANPNKQMDFDHRFDNALYMDGEFVERKTGALKLAYEKN
FT                   KELAAVHGGPAVMEVFGEVPFEPQIKSEALTLDTKQQKLSVKYSNDAGSIVNEYIKGEE
FT                   RSFTIIAYPIPEIGENFEEIFEGTVKINTLDYNKYKAIQQALIDVLDTAQYVEVKGANG
FT                   NCTDMKVSIMKITDHKTQTVFENCLADVNIPLGEVFTSPVLKKTTGVLNVSSVYLNDIK
FT                   FNNLTVWFEDGFVKDYTCTNFDDEAKNRELFKANVLYDHETLPLGEFAIGTNTTAYVFA
FT                   NKHDIVYKLPILIVEKMGPHFAVGDTCYSRAEDVYVTNPDGKEIISRDNEVSLLRKTEP
FT                   DKAYYNCHTDITIPYDEIGNITVVAENGTRTDLIKNGRFVLDGTLALNDAFLTEL"
FT   gene            553204..553704
FT                   /locus_tag="EUBELI_00548"
FT   CDS_pept        553204..553704
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00548"
FT                   /product="phosphoribosylaminoimidazole carboxylase"
FT                   /note="Psort-B: Cytoplasmic, score:8.87; COG0041
FT                   Phosphoribosylcarboxyaminoimidazole (NCAIR) mutase;
FT                   HMMPfam:IPR000031; BlastProDom:IPR000031; Gene3D:IPR000031;
FT                   HMMPanther:IPR000031; HMMTigr:IPR000031;
FT                   superfamily:IPR000031; K01587 phosphoribosylaminoimidazole
FT                   carboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00548"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71561"
FT                   /db_xref="GOA:C4Z477"
FT                   /db_xref="InterPro:IPR000031"
FT                   /db_xref="InterPro:IPR024694"
FT                   /db_xref="InterPro:IPR033747"
FT                   /db_xref="InterPro:IPR035893"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z477"
FT                   /protein_id="ACR71561.1"
FT                   /translation="MALVGIVMGSDSDMPVMAKAADILEQLGISYEMTIISAHREPDVF
FT                   FEYAKSAEEKGFKVIIAGAGMAAHLPGMCAAIFPMPVIGIPMHTTSLGGRDSLYSIVQM
FT                   PTGIPVATVAINGGANAGILAAKILATSDAALLERLKDYTKNLKESVQKKDARLQEVGY
FT                   KNY"
FT   gene            553764..554789
FT                   /locus_tag="EUBELI_00549"
FT   CDS_pept        553764..554789
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00549"
FT                   /product="phosphoribosylformylglycinamidine cyclo-ligase"
FT                   /note="Psort-B: Unknown cell location; COG0150
FT                   Phosphoribosylaminoimidazole (AIR) synthetase;
FT                   HMMPfam:IPR000728; HMMPfam:IPR010918; HMMTigr:IPR004733;
FT                   K01933 phosphoribosylformylglycinamidine cyclo-ligase"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00549"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71562"
FT                   /db_xref="GOA:C4Z478"
FT                   /db_xref="InterPro:IPR004733"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4Z478"
FT                   /protein_id="ACR71562.1"
FT                   /translation="MDYKKSGVDIEAGYKSVELMKEAVKSTMREEVLGGIGGFSGAFSL
FT                   AKIKEMEEPVLLSGTDGCGTKVKLAFIMDKHDTIGIDAVAMCVNDVVCAGGEPLFFLDY
FT                   IACGKNYPEKIATIVGGVAEGCRQSECALIGGETAEHPGLMPQDEYDLAGFAVGVVDKK
FT                   DLITGENIKPGDTLIGIASSGVHSNGFSLVRSVFTMTEESLNTYYDSLGKTLGEALLAP
FT                   TKIYVKTMKEIKKAGVKVKGCSHITGGGFYENVPRMLPDGVKAVIKKDSYEVPPIFKML
FT                   AEDGNIEEHMMYNTFNMGIGLVLAVDPADVDTVMEAVKAAGETPYVIGSIEAGEKGVTL
FT                   C"
FT   gene            554783..555379
FT                   /locus_tag="EUBELI_00550"
FT   CDS_pept        554783..555379
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00550"
FT                   /product="phosphoribosylglycinamide formyltransferase"
FT                   /note="Psort-B: Cytoplasmic, score:8.87; COG0299
FT                   Folate-dependent phosphoribosylglycinamide
FT                   formyltransferase PurN; HMMPfam:IPR002376;
FT                   Gene3D:IPR002376; HMMTigr:IPR004607; ScanRegExp:IPR001555;
FT                   superfamily:IPR002376; K00601 phosphoribosylglycinamide
FT                   formyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00550"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71563"
FT                   /db_xref="GOA:C4Z479"
FT                   /db_xref="InterPro:IPR001555"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR004607"
FT                   /db_xref="InterPro:IPR036477"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z479"
FT                   /protein_id="ACR71563.1"
FT                   /translation="MLRVAVMVSGGGTNLQAIIDAVKDGTITNTELVAVISNNAGAYAL
FT                   TRAKDNNIPAYCISPKDYESRDAFNDALLDKVNELNVDLIVLAGFLVRIPEKMVHQYSH
FT                   RIINIHPSLIPSFCGVGFYGLKVHEAALAKGVKVSGATVHYVDEGMDTGEIIFQKAVDV
FT                   LDGDTPETLQRRIMEQAEWKLLPKAINKIANEHVN"
FT   gene            555405..556700
FT                   /locus_tag="EUBELI_00551"
FT   CDS_pept        555405..556700
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00551"
FT                   /product="phosphoribosylamine--glycine ligase"
FT                   /note="Psort-B: Cytoplasmic, score:8.87; COG0151
FT                   Phosphoribosylamine-glycine ligase; HMMPfam:IPR000115;
FT                   Gene3D:IPR000115; Gene3D:IPR013815; Gene3D:IPR013816;
FT                   Gene3D:IPR013817; HMMTigr:IPR000115; ScanRegExp:IPR000115;
FT                   superfamily:IPR011054; K01945 phosphoribosylamine--glycine
FT                   ligase"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00551"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71564"
FT                   /db_xref="GOA:C4Z480"
FT                   /db_xref="InterPro:IPR000115"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR020559"
FT                   /db_xref="InterPro:IPR020560"
FT                   /db_xref="InterPro:IPR020561"
FT                   /db_xref="InterPro:IPR020562"
FT                   /db_xref="InterPro:IPR037123"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z480"
FT                   /protein_id="ACR71564.1"
FT                   /translation="MICGGIKMKVLVVGSGGREHAICWKLSKSPKVDKIYCAPGNAGIA
FT                   ELAECVDIKAMEFEKLVAFAKENSIDLTVIGMDDPLVGGVVDVFEAEGLRVFGPRKNAA
FT                   ILEGSKAFSKDLMKKYNIPTAAYETFTSAEEAKKYLETAEYPIVLKADGLALGKGVLIC
FT                   ENKEDALAGVDELMLDKKFGTAGDTIVIEEFMTGREVSVLSFVDGDTIKIMSSAQDHKR
FT                   AKDGDQGLNTGGMGNFSPSPFYTKEVDEFCKKYIYQATVDAMKSEGRPFKGVIFFGLML
FT                   TPKGPKVLEYNARFGDPEAQVVLPRMKNDIVDVFEACIDGTLDKVDLQFEDNACVCVIL
FT                   ASDGYPLAYEKGFEIKGMENFKGKDDYFLFHAGSKFNEEGKVVTNGGRVLGVTALGKDL
FT                   KEARAKAYEATEWVDFDNKYMRHDIGKAIDEA"
FT   gene            556837..558111
FT                   /locus_tag="EUBELI_00552"
FT   CDS_pept        556837..558111
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00552"
FT                   /product="histidyl-tRNA synthetase"
FT                   /note="Psort-B: Cytoplasmic, score:10.00; COG0124
FT                   Histidyl-tRNA synthetase; HMMPfam:IPR002314;
FT                   HMMPIR:IPR004516; HMMPanther:IPR015805; K01891
FT                   histidyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00552"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71565"
FT                   /db_xref="GOA:C4Z481"
FT                   /db_xref="InterPro:IPR004516"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR015807"
FT                   /db_xref="InterPro:IPR041715"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z481"
FT                   /protein_id="ACR71565.1"
FT                   /translation="MKITPVKGTNDYLPNEVEIRDYLQNEILKVYVANGFEHITTPIIE
FT                   DIENLDKSDGGENLNLIFKIMKRGDKLEKAVSSLQENPKTGTACENEIADMGLRYDLTL
FT                   PLSRYFANNKDKLTLPMKCIQMDRVYRAERPQKGRLREFVQCDIDIIGSDSTDSEVELI
FT                   LTTTKALKAIGMKNFKVKINDRRLLRSFLQNCGFAEEQLDSVCITFDKMDKVGLDGVKA
FT                   ELTDKGFDAAAIEKFIGFFGSVSSAQEISLESVEAILEDKAPAESVRGIINTVNELSDG
FT                   QFDVVFDLSLVRGQGYYTGTVFEVESIDFKGAIAGGGRYDNLIGKFIGQQVSAVGFSIG
FT                   FERIFSILMQNGVETKASADKIAVMYDEGQVKEAYAIAEKYRAEGKVCSLYVKPKKMGK
FT                   FLGKLEERGYKGFVNVSNGDEISLF"
FT   gene            complement(558118..558615)
FT                   /locus_tag="EUBELI_00553"
FT   CDS_pept        complement(558118..558615)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00553"
FT                   /product="Hypothetical protein"
FT                   /note="Psort-B: Unknown cell location;
FT                   ScanRegExp:IPR006162"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00553"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71566"
FT                   /db_xref="GOA:C4Z482"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z482"
FT                   /protein_id="ACR71566.1"
FT                   /translation="MRQTKIVVIPFKKLLIGVVIAAIVIAFVIFAVIRLGSNGSDDSRN
FT                   TTKPKSSTVNASASSNIETPLDNADAPKFCPGVYTASILLDGNPVDIQVTVDSSNINSI
FT                   ELVNLSESITTMYPKLATSFDEVAAKVMEAGTTNITYDSANRYTYSVFIEAISAALKKA
FT                   AP"
FT   gene            558733..562062
FT                   /locus_tag="EUBELI_00554"
FT   CDS_pept        558733..562062
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00554"
FT                   /product="Hypothetical protein"
FT                   /note="Psort-B: Cytoplasmic, score:8.87; COG3857
FT                   ATP-dependent nuclease, subunit B"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00554"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71567"
FT                   /db_xref="GOA:C4Z483"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038726"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z483"
FT                   /protein_id="ACR71567.1"
FT                   /translation="MSLQLILGSSGVGKSHYLYTHIIDESMKNPDRNYIVVVPEQYTMA
FT                   IQKRLVSMHPRKGILNIDVVSFERLAYKVFEEVGEDNLEVLDDTGKNLIIKRVLEQNKD
FT                   RLKYFGSNLSNTGFVSEMKSVISEMLQYDIKPDVMQDAAGAAYSDSEGSAALQYKLDDI
FT                   VLVYNAFAEYIDKNYITKEEILDKLCSKVTESERIKNCEIVFDGFTGFTPVQYNLMTIL
FT                   LSMCPKIYVSLTIDASERENSVRGREELFFMSKDCVSKLYKICDEEHVKVLEPVYIAGK
FT                   AVPGKNVIVNVNSRFKNSEELDFLEQNLFRNNSGRFNQKTDNIVIYEGAVAKEELTFAA
FT                   GEIIRLTRLCGYRYNEIAIVTADMDGYGKLAANILKQNDIPYFLDYKRHVTDNPFIAAI
FT                   NGALGIIENNYSYDSILGFLRTGMSGMEREDIDLLDNYCVAVGIRGRGKWHEPWIRKFR
FT                   GTVNNTDLEKLNSLRTMITDMLDPLEEVLKSKESNVADMVKALYEFLVREDMEQKVSVL
FT                   NDSEYTGDEYVQLYKKVIEVLDKMYALLGSEKVGIKEFNKILASGFQEIKIGLIPQTND
FT                   CVVIGDIERTRLDNIKVMFFVGINDGNVPKKADSRSVLSESDREYLEDKGIVMSASVRE
FT                   KAFTQRFYLYLIMTKSAEKLYMSYAVKNSEGAALMPSYIIRSMRKMFSHCLKLSYKDTA
FT                   QQNSYVTIPQAANSFDNTEIAANVDEDIIDSLTGGRLVGSVTSFENFAECPLRYYLRYG
FT                   VDLKEREEFTFSPVNFGVVLHAVIREVCDEIKKNGESYYLISDEKRREMVKRSVAAITD
FT                   IYQNSILKDSSRNSFMIKRMEDLADRTVWAMGEQLKCGDFVPFVFEHKFNMEVGDGDRK
FT                   QLMSGTIDRVDICENGTDVYVRIIDYKTGKKDFNIVKTYYGIDIQLMVYMEAAMKLVAK
FT                   MRPGKNVIPAGVFYYNISDPIVSATTESAEEIEDKIKGELRLKGMVNSDKDIAEKMDNT
FT                   EGTSLNIPVSRKADGGFDSRRSKVMNTEQFNILGRFVDVRAIDTADRIAGGDIRRSPYK
FT                   DGQFSSCDRCPYGAVCGFSVDLPGCNYRKLKKFDDEVLWNNIKEGVDENGKKMDTGAEE
FT                   RD"
FT   gene            562016..565678
FT                   /locus_tag="EUBELI_00555"
FT   CDS_pept        562016..565678
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00555"
FT                   /product="DNA helicase II / ATP-dependent DNA helicase
FT                   PcrA"
FT                   /note="Psort-B: Cytoplasmic, score:8.87; COG1074
FT                   ATP-dependent exoDNAse (exonuclease V) beta subunit
FT                   (contains helicase and exonuclease domains);
FT                   HMMPfam:IPR000212; HMMPanther:IPR000212; HMMTigr:IPR014152;
FT                   K03657 DNA helicase II / ATP-dependent DNA helicase PcrA"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00555"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71568"
FT                   /db_xref="GOA:C4Z484"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR011604"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR014152"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="InterPro:IPR038726"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z484"
FT                   /protein_id="ACR71568.1"
FT                   /translation="MRMERKWTPAQKSAIDIRDCNVLVSAAAGSGKTAVLVERIISMIT
FT                   DPDKNIDIDRLVVVTFTKAAAAQMKDKIRKALDSMLDENPGDVNLLRQITLLNNAQITT
FT                   IDSFCLWIIRNHFPEVNLDPGFRIMDEGEKKLIENDVLEDVLEEFYAEADEEFFNLVDA
FT                   FGMGRDDSGLVSIIDKIYRFSRSNPWIDEWFDECMLVYDDETYDNPAIKELYDSIKNAL
FT                   LDYRDKYNRLVDICSEPAGPAAYTGALQSDLLGINEMINSQDFGELGRRIRIFSFEALS
FT                   RKKDAGADPDIKEYVKGQRKLFKDYIGRLNDKIFLKDDEGIFADMQGAGIQIRTLLKVA
FT                   KVYAKRVSEVKREKGIIDFNDMEHLALSILVKKEDGKLVYTETADKLANRFEEILIDEY
FT                   QDSNQLQEVILNAVSKTRLSGENNNIYMVGDVKQSIYKFRLACPELFIEKYDTYGETGD
FT                   NVRIELQKNFRSRENVLECANDVFSHIMNKNFSGIGYDESVRLNAGFPYPEYSDSNYGD
FT                   EANKSTDVILISSENEEEATTRELEADRLAKLIEGIVSSGVNVYDADENIYRPAEYRDI
FT                   VILTRSVTGWADTFADALMDRGIPAYTDSSTGYFSVREIQVILSMLTIVDNPVQEISLA
FT                   AAMMSYFGGFTAAELGMVRKLGREHADKNTHNNLYEHLKAVAVLGGAGKMQESDVKQLS
FT                   GKCALFLAKLTEYRDKSSVESLYDLCWEMIYDSGYYDYVGTMPAGAQRQANLNVLLERA
FT                   AGYGKSSYSGLFNFLRYIERLKKFDEDFAEGAASLDNENLVRIMSIHKSKGLEFPIVIL
FT                   AGAHKSINFMDATAPVLVDQNLGIAVDYVDLERRTKTPTIIKGAMARRIVRESIAEEER
FT                   LLYVAMTRAREKLIITGVVKDADKTLDKYMGRAEQLAADGMLSFADSENIKNYLDMIMP
FT                   VCLMDSDKLKGSFKVMVDAGEDSWVDAFEAGEMAGEANAVRIGELADENMEAVSYPLLD
FT                   ELPEYVPDDNAARRMKLTVSQLKAMQADDDSEENAYMDESVKTALKKEACDETNSIIPK
FT                   FISGEEVQLAANERGSAYHRVMECLDYSVSVNLDGVKADINRMLETGKMNELQVKSVNP
FT                   WDINTFVQSDTGRRVANAVNCGSVRREQPFVFEYEGQLIQGIIDLYFEEDGEFVLVDYK
FT                   TDRVMKGEAGEKELVRRYAIQLDYYAKALTQLTGKKVKEKIIYSFALGKGLSVY"
FT   gene            565764..566024
FT                   /locus_tag="EUBELI_00556"
FT   CDS_pept        565764..566024
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00556"
FT                   /product="Hypothetical protein"
FT                   /note="Psort-B: Cytoplasmic, score:8.87"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00556"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71569"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z485"
FT                   /protein_id="ACR71569.1"
FT                   /translation="MTRTYAVKYKSKSKMLTTPELVAQTEEDIKALELVKDVVIKEDGQ
FT                   VVTVEVENEEDFEPVMDRVINIFRRIDDKSEVSYKFGLNRE"
FT   gene            566151..567743
FT                   /locus_tag="EUBELI_00557"
FT   CDS_pept        566151..567743
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00557"
FT                   /product="peptide chain release factor RF-3"
FT                   /note="Psort-B: Cytoplasmic, score:9.98; COG4108 Peptide
FT                   chain release factor RF-3; HMMPfam:IPR000795;
FT                   HMMPfam:IPR004161; HMMTigr:IPR004548; HMMTigr:IPR005225;
FT                   ScanRegExp:IPR000795; superfamily:IPR009000;
FT                   superfamily:IPR009022; K02837 peptide chain release factor
FT                   RF-3"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00557"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71570"
FT                   /db_xref="GOA:C4Z486"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004548"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR032090"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR038467"
FT                   /db_xref="InterPro:IPR041732"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z486"
FT                   /protein_id="ACR71570.1"
FT                   /translation="MSLESEIKKRRTFAIISHPDAGKTTLTEKFLLYGGAINLAGSVKG
FT                   KKTAKHAVSDWMEIEKERGISVTSSVLQFNYEGYCINILDTPGHEDFSEDTYRTLMAAD
FT                   SAVMVIDASKGVEKQTIKLFKVCVMRHIPIFTFINKMDREANDPFELLDEIESVLGIST
FT                   CPINWPIGCGKEFKGVYDRKEKNVSLFKAAMNGQKEVDTEIVDASDEAVFKDRIGDAFY
FT                   DKLQEDIELLDGASAEFDQEMVSAGDLTPVFFGSALTNFGVQTFLEHFLSMTTSPLPRK
FT                   SDQGIIDPFTEDFSAFVFKIQANMNKAHRDRIAFMRICSGKFEAGMEANHVQGGKKIRL
FT                   SQPQQMMAEERHIVDEAYAGDIIGVFDPGIFSIGDTICKSNKKFAFEGIPTFAPEHFAR
FT                   VRQLDTMKRKQFIKGINQIAQEGAIQIFQEFNTGMEEIIVGVVGVLQFEVLEYRLKNEY
FT                   GVDIRLEPLPYEHIRWIENPEEIDVNRIVGTSDMKKIKDLKGNPLLVFANSWSVNMVLE
FT                   RNEGLKLSEFGRN"
FT   gene            567776..569851
FT                   /locus_tag="EUBELI_00558"
FT   CDS_pept        567776..569851
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00558"
FT                   /product="Glycoside Hydrolase Family 73 protein"
FT                   /note="distantly related to
FT                   endo-b-N-acetylglucosaminidases; C-terminal domain related
FT                   to cellulosomal dockerin domains; Psort-B: Extracellular,
FT                   score:9.73; COG4193 Beta- N-acetylglucosaminidase;
FT                   HMMPfam:IPR002105; HMMPfam:IPR013247; ScanRegExp:IPR002048;
FT                   K01227 mannosyl-glycoprotein
FT                   endo-beta-N-acetylglucosaminidase"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00558"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71571"
FT                   /db_xref="GOA:C4Z487"
FT                   /db_xref="InterPro:IPR002105"
FT                   /db_xref="InterPro:IPR003646"
FT                   /db_xref="InterPro:IPR016134"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="InterPro:IPR025883"
FT                   /db_xref="InterPro:IPR036439"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z487"
FT                   /protein_id="ACR71571.1"
FT                   /translation="MKSVYKCSVKRIAALAVMVCMLVLAGLAFTSVVNTKAESVIAQGH
FT                   VNYDVTNLRIRKSPVTGEIITTVDGGFKFDIYEEVNTDSGTVWYSIGFSYDGSYTRGYV
FT                   TSSYTTIDKRIDYKPDADFEEYLNSQGFPDSYKDSLRQLHAQYPNWVFVADHNGKDWSD
FT                   VVDNQNVIGRSLIHGSAVSSWKSVADGCYDWESGEYTGLDGSWVQASSALVEYALDPRN
FT                   FLNATNIFMFENLAFDGSVQDADGLESMTDGTFMDNSSHDLSYNGRSYTYITGLLYAGQ
FT                   ESGVSPYHLTSRILQEQGYDGHGSSISGTQSGYSGYYNYYNIGASPSGGYTAVQNGLRY
FT                   ASKSDSSLLRPWNTRMKSIIGGAIFIGKSYINKGQDTLYYEKFDMTGRGHQYMTNILAP
FT                   RSESVKSAQGYSDSNKESISFVFKIPVYENMPENVCAIPTGDGSPNNRLKNLYVDGWSL
FT                   TPTFSLYTTEYSFIVDYETSSVNIGGSALDSSANVSGLGKYELSVGSNDIKITVTAANG
FT                   DTQDYTITVVRQDKAPDPTPDPEPDKPDNSVSYPGFSTNLSVDESTKYISGISVSSSVS
FT                   DVLDKIKNQEGAYSKVLNKNGNEKDGTVGTGDILITYNSSGNEVSRYEIIIYGDANGDG
FT                   DIDLFDFALIKRALLGISEPSGIYWKAADCNKDGELDLFDFAVVKRYILGIGNISQ"
FT   gene            569867..571468
FT                   /locus_tag="EUBELI_00559"
FT   CDS_pept        569867..571468
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00559"
FT                   /product="Hypothetical protein"
FT                   /note="Psort-B: Unknown cell location; COG2931 RTX toxins
FT                   and related Ca2+-binding proteins; HMMPfam:IPR002102;
FT                   superfamily:IPR008965"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00559"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71572"
FT                   /db_xref="GOA:C4Z488"
FT                   /db_xref="InterPro:IPR008965"
FT                   /db_xref="InterPro:IPR025883"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z488"
FT                   /protein_id="ACR71572.1"
FT                   /translation="MIMNKIKKLIAFISILVMSIMLIPVNYAKADETAKISISSVSGTV
FT                   GDKVTVTLTVSASDSIDAAAIPVSYDNSIIKPVSSGNSGVVSFALLDASAYGSTESISM
FT                   QFEIIAAGTTTLKVAGDAKISVNGERAQVSSSSGTVTAKAPASYSSDNALKSLQISPGT
FT                   LSPAFSPETTTYKATVDSDVEELVVSAVANDGAAKVSISGRRMDPGSNTTTITVTAEDG
FT                   SVRKYVIYTTRPETTQETATEEPSQTEVQQESSSQTQNSEGIVTIDGEKFTISQDYTTH
FT                   ELPDDYDTEEYDYDGSKVIVGKGLKTGLILMYLESDNGNGGFYVYDEKAKTFSPYNTVD
FT                   EPQITYVVLPITDSLNKPSGYTLTKFTMNGKEVQVLIDSDRQYCLFYGVSSLGEKGWFR
FT                   YRISDATIQAYSIDKGDITGTVNTSGKDTKPANNKGYIAVISILSVLIAAFAVVTGILC
FT                   SKLSKVKKVFNMASKDGVDLDSYTEKEIDEYDLGEYEDGEDEDIDQVSDKILYGDDKSG
FT                   QNDVEELKLFDIDDDK"
FT   gene            complement(571528..572583)
FT                   /locus_tag="EUBELI_00560"
FT   CDS_pept        complement(571528..572583)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00560"
FT                   /product="cellulose synthase (UDP-forming)"
FT                   /note="Psort-B: Unknown cell location; COG0463
FT                   Glycosyltransferases involved in cell wall biogenesis;
FT                   HMMPfam:IPR001173; K00694 cellulose synthase (UDP-forming)"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00560"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71573"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z489"
FT                   /protein_id="ACR71573.1"
FT                   /translation="MISISMCMIVKNEQDILARCLDSYAGTYDELIIVDTGSTDNTKEI
FT                   AAHYTDKIYDFEWINDFSAARNFAFSKAGCDYIFSADADEVLNDTNNYALRELKHVLLP
FT                   EIDIVQMYYVNASEYNSVYNAHKELRPKLFKRLRSFTWISPIHETVRLTPVVYDSDIEI
FT                   LHMQAGDHSKRDFSTYFKAFEKGVHIEDYVVTMLCKELLISGEDSDFIAFRNIFENVLS
FT                   KEGRSNDLMKEINCILAKIYMADGDTDSFFKTTLKAVADNPPAEMCLILGTFYMNQADY
FT                   EEAVLWLYNAAFETESILDAASSGNKPLSLLGKCYEKLAAATDDPYQAAQYNEMSADYY
FT                   SQAENWKLPEE"
FT   gene            572703..573485
FT                   /locus_tag="EUBELI_00561"
FT   CDS_pept        572703..573485
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00561"
FT                   /product="Hypothetical protein"
FT                   /note="Psort-B: Cytoplasmic, score:8.87; NOG29758 non
FT                   supervised orthologous group"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00561"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71574"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z490"
FT                   /protein_id="ACR71574.1"
FT                   /translation="MSKKKSEAEPVEYIDSQAFDAAKEKIIGKSHNDKGIGTLSEKTLH
FT                   AVLKMYYEPDEDNHEVAIDGYFADIYNEHGIIEIQTRQLNKLRDKLSVFLNEYQVRVVY
FT                   PMPYEKYLSWIEPETGDITSRRKSPKRCSMYDAMFELYKIKAFLKNQNLKVTLLLIDME
FT                   EYKLLNGWSYDKKRGSVRYDRIPVGIRKIVELDCPQDYMQFVPEGLEKNFTSADFANAA
FT                   HIDRQTAASVLAMLNYMEQVKRVGKTGNAYIYDIEEHY"
FT   gene            573554..575959
FT                   /locus_tag="EUBELI_00562"
FT   CDS_pept        573554..575959
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00562"
FT                   /product="Hypothetical protein"
FT                   /note="Psort-B: Cytoplasmic, score:8.87; COG1199
FT                   Rad3-related DNA helicases; HMMPfam:IPR010614;
FT                   HMMSmart:IPR006554; HMMSmart:IPR006555"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00562"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71575"
FT                   /db_xref="GOA:C4Z491"
FT                   /db_xref="InterPro:IPR006554"
FT                   /db_xref="InterPro:IPR006555"
FT                   /db_xref="InterPro:IPR010614"
FT                   /db_xref="InterPro:IPR014013"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z491"
FT                   /protein_id="ACR71575.1"
FT                   /translation="MCAEGDIDNRNTGSNDVKIMQEGARIHRKIQHSMGTMYHAEVPLK
FT                   IEIPLVSDLGIEYVLQVEGRADGIIADINYDEDGNKEPESDVIIDEIKTMQADVSLLKE
FT                   PVYVHKAQALVYGYIYASQKKLSKIGIQMTYVTPEPETVNKFLEEYTFERIEEWFNKLI
FT                   TGFKRWTDYTFDERLKRTESIRELKFPYEYREGQKNLCVSVYRAIEDSANLYIQAPTGV
FT                   GKTLSTVFPAVQALGQQMADKIFYLTSKTITRTVAEDTYAILRDNGLHMRTVTLTAKDK
FT                   ICPLDERNCNPVACPYAKGHFDRINDAVYDIITSQMVIGRDNVMEYANRHNVCPFEMSL
FT                   DVSYWCDGIICDYNYVFDPDASLKRYFGNGAKGDYVFLVDEAHNLVDRAREMYSAVLKK
FT                   EDFLAAKKLVKEMDKRLAGALDRCNKQLLEYKRQCDTFMVVSGLGTFPASLERVMGLMQ
FT                   KFMERHKGEPVTNELLEFFFAVRHFLNMYDCADEKYVYYNEHDNDGNFLVHLYCVDPSG
FT                   NISERLSQGRSTVFFSATLLPVNYFKEMLSGDVSERAVYAHSSFEPDNKRIVVATDVTS
FT                   RYTRRNAREYAKVHDYIMHMISGRSGRYMVFFPSYSYMESVLECFRWENGVNVTECGGE
FT                   YTFLPESCVNVLVQGRFMKEADKESFLSAFYEELPEGASLAGFCVLGGIFSEGIDLKDE
FT                   SLIGAVIVGTGIPMVCRERNILRDYFDEFGKNGYSYAYVIPGMNKVLQAAGRVIRTDTD
FT                   KGVIALLDDRFMTGEYERMYPREWNRIFPVSLGNAYKCIKDFWTEQDM"
FT   gene            576068..577012
FT                   /locus_tag="EUBELI_00563"
FT   CDS_pept        576068..577012
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00563"
FT                   /product="Hypothetical protein"
FT                   /note="Psort-B: Cytoplasmic, score:8.87"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00563"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71576"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z492"
FT                   /protein_id="ACR71576.1"
FT                   /translation="MGDGLMQNVEEINKNIESKTVDKQVWQSLGFDELQTIEIIRGIEN
FT                   GIDVSVYCKEEFNAAQMKALRLGLEEKLDVSRFADAQYDYMQMEELKQAVRSGINMDDI
FT                   CNPKFSHSVMREIRLASELNYDLTRYAKLGYSGEVLRQIRLAKKEEIDLTFFVEDNYDE
FT                   YQLNEIRLGIHSCVDITKYLLHEYNGKQMEQIRLGLEEGIDVTPYNMVGFSSGQMKQIR
FT                   LGLEEGIDVSEYADPFIDAVSMKEARHRISDKWNDEKPALNELQSQEILMGLTSGVDVS
FT                   LYADPRYTFKEMEKIRLALERGSNLDGLLKYGC"
FT   gene            577079..578500
FT                   /locus_tag="EUBELI_00564"
FT   CDS_pept        577079..578500
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00564"
FT                   /product="hypothetical protein"
FT                   /note="Psort-B: Cytoplasmic, score:8.87; COG1315 Predicted
FT                   polymerase, most proteins contain PALM domain, HD hydrolase
FT                   domain and Zn-ribbon domain; HMMPfam:IPR005646; K09749
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00564"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71577"
FT                   /db_xref="InterPro:IPR005646"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z493"
FT                   /protein_id="ACR71577.1"
FT                   /translation="MSNTEIVNETADIDDIELHEVYVYIADDNMSASVRLGKCDEGYTY
FT                   DEVMNKLSLNGIKTGIDEEKIRWMISQKIYDQPVEIAVGKPVNTGKDGYYEFFFDTDAI
FT                   NNNRPTVREDGSIDYFNQKRFEKVNEGDLLARYHEPTKGEFGFDICGKLLVPKPGKPKP
FT                   RLHGKGFKTSEDGKETYAAISGKIEYCNYDLSVVNVYEVNGNLDMSMGNIDFNGDVNIT
FT                   GSVRSGVTVHAMGSIYVGGFVEGATLIAGKDIVLKDGVNTKNSGKIEAGGNISGRFFEN
FT                   TEVIAKGDLQCNYILNCRVLTYGRVFVEGPIGSIIGGDVTGVMGISTTSCGHESNVKTL
FT                   LRVGSTKEIRKEYAELIMELKEVDGQIETFEMANKKFEMIKQNMPEKYDSKMALRVTQS
FT                   KIVKMAQKAKLEEKSKALYNLIRDSERAVVKVKNHIYPGSRVYMDDKTYMPSSVFSHII
FT                   VKKTPSTIILSDYDE"
FT   gene            578522..579454
FT                   /locus_tag="EUBELI_00565"
FT   CDS_pept        578522..579454
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00565"
FT                   /product="Hypothetical protein"
FT                   /note="Psort-B: Cytoplasmic, score:8.87; COG3608 Predicted
FT                   deacylase; HMMPfam:IPR007036"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00565"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71578"
FT                   /db_xref="GOA:C4Z494"
FT                   /db_xref="InterPro:IPR007036"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z494"
FT                   /protein_id="ACR71578.1"
FT                   /translation="MIEEVVSVELPVHERLVVRKNRLTNEENGIDMPRISIVTGTHGDE
FT                   LDGQYICYEVIRRIEREKNKLKGIVDIYPDINPLGLDTGSRGIPMFDLDMNRVFPGDNN
FT                   GAMAEYVAAGIIEDIIGSDLCIDIHSSNIFVNEMPQVRINDDTQEKLLPYAKMMNAQFV
FT                   WIYSSITVLDATLAYSLNHLGVPTLVTEMGVGNRITPKYCRDIVDGIFNLMSHMGIWDD
FT                   EPKEVNEPIISTEGEVTFLTAKESRIFVSAVDSMGRIGIGTHIGDIIEPIEGRIIQRIE
FT                   SPTDGIIFTLRENPVVHKGALIARVYGGR"
FT   gene            579454..580389
FT                   /locus_tag="EUBELI_00566"
FT   CDS_pept        579454..580389
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00566"
FT                   /product="Hypothetical protein"
FT                   /note="Psort-B: Unknown cell location; COG3608 Predicted
FT                   deacylase; HMMPfam:IPR007036"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00566"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71579"
FT                   /db_xref="GOA:C4Z495"
FT                   /db_xref="InterPro:IPR007036"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z495"
FT                   /protein_id="ACR71579.1"
FT                   /translation="MKKEIIYSLKGIYREDYQIEGYRFGGGEKSACIVGALRGNEIQQL
FT                   YICSQLVKALKELEAHGAISHNHEILVIPSVNRFSMNVGKRFWPTDNSDINRAFPGDVN
FT                   GDTTKQIAGTLFDRIKGYSYGIHFASFYMPGDFIPHVKMMDTGFQSASLANLFGLQYVV
FT                   IRKPKPMDTVTLNYNWQMNGTNAFSIYTNSTDMIDEKSARQAVSSVLRFLTRMGILKYN
FT                   NHSGYIASVINEFDLMAVKTYDAGFYKRLKEPGDPVYHGELIAQILDPCEGTVKSEIIS
FT                   QTDGIVFFAHTGPTVMGNQVVYKIIRRMHE"
FT   gene            580466..584218
FT                   /locus_tag="EUBELI_00567"
FT   CDS_pept        580466..584218
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00567"
FT                   /product="phosphoribosylformylglycinamidine synthase"
FT                   /note="Psort-B: Cytoplasmic, score:8.87; COG0046
FT                   Phosphoribosylformylglycinamidine (FGAM) synthase,
FT                   synthetase domain; HMMPfam:IPR010918; HMMTigr:IPR010141;
FT                   K01952 phosphoribosylformylglycinamidine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00567"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71580"
FT                   /db_xref="GOA:C4Z496"
FT                   /db_xref="InterPro:IPR010141"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="InterPro:IPR041609"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z496"
FT                   /protein_id="ACR71580.1"
FT                   /translation="MSGVKRVFVEKKKPFAVNAKELLEEIGGYLGIKTITDVRVLIRYD
FT                   IENLSEETYKKALTTVFSEPPVDDVYEGTFPAGKDDFVFSVEYLPGQFDQRADSAEQCV
FT                   KFFNENETPVIKTAVTYVLTGTVTDEEKNRIKEHCINPVDSRQAAEDIPETLVTEFKTP
FT                   ADVIYFDGFKDMPEDKLKELYDSLGLAMTFKDFKFIQEHFAGVEKRDPSMTEIRVLDTY
FT                   WSDHCRHTTFATELTDVKFKDGFYKAPMEATYNKYLSDRAEIYKDRKDKFVCLMDLALM
FT                   GAKKLKAEGKLADQEESDEINACSIVVPVEIDGKTEEWLVNFKNETHNHPTEIEPFGGA
FT                   ATCLGGAIRDPLSGRTYVYQAMRITGAADPTVPVSETIHGKLPQRKLVTGAAHGYSSYG
FT                   NQIGLATGYVKEIYHPDYVAKRMEIGAVIAAAPRSAVKRENSDPGDIIILLGGRTGRDG
FT                   CGGATGSSKVHTEKSIEDCGAEVQKGNAPTERKMQRLFRRPEVTKLIKKCNDFGAGGVS
FT                   VAIGELAAGLKVDLDKVPKKYEGLDGTELAISESQERMAVVVDPKDVKEFLQYAAEENL
FT                   EAVEVAVVTEEPRLVLNWRGKDIVNISRAFLDTNGAHQETKVVVDIPSQEDDYLKPVKV
FT                   TDVRGKWLKTLADLNECSQKGLVERFDGSIGAGSVYMPYGGKYQLTETQSMVAKLPVLK
FT                   GSCDTVTMMSYGFDPYLSSWSPYHGAIYAVTDSVAKIVAAGGDFSKIRFTYQEYFRRMT
FT                   EDPERWSQPFAALLGAYEAQMGFGLPSIGGKDSMSGTFEHIDVPPTLCSFAIDVAKEGD
FT                   IITPELKNDGDVLVRFDIKKNQYDLPDFEQVKALYSAIHELIQKKAIVSAYVLDANGLV
FT                   PALSKMAFGNKLGFEISADVKEDDLFAPAYGCIVAEVPADKLSEITTAYTKVGTVKDNG
FT                   KFTYKEVSINVEEALSVWADTLEGVFPTKASKETTPVESKLYEAPSVHVCKNKVAKPTV
FT                   FIPVFPGTNCEYDSAKAFERAGADTIVKVFKNLDAESIRESVDEFEKAINQAQIIMFPG
FT                   GFSAGDEPDGSAKFFATAFRNAKMKEAVEKLLNERDGLALGICNGFQALIKLGLVPNGK
FT                   ITGQDAQSPTLTFNTINRHISKMVYTKVVSNLSPWLANAELGGVYCNPASHGEGRFVAP
FT                   KEWLDKLFANGQVATQYCDLDGNVSMDEEWNINGSYMAIEGITSPDGRCFGKMAHSERR
FT                   GDSVAINIYGEQDIKIFESGVKYFK"
FT   gene            584240..584713
FT                   /locus_tag="EUBELI_00568"
FT   CDS_pept        584240..584713
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00568"
FT                   /product="Hypothetical protein"
FT                   /note="Psort-B: Cytoplasmic, score:8.87; HMMPfam:IPR005182"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00568"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71581"
FT                   /db_xref="InterPro:IPR005182"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z497"
FT                   /protein_id="ACR71581.1"
FT                   /translation="MPLELEGYIMARDKVSTDILWKDRKRILFLGLPWSFTRYSVSKDR
FT                   FFISKGFFSVKDDEVRLYRIMDISLERSFMQRLVGVGTIKVCSGDKTMGDFEIKNIKRP
FT                   RATKELLSDLVEKQRDIKRVVNRENMIDGHDHSDGQADIDDLDNNDDDAPFDR"
FT   gene            584870..585166
FT                   /locus_tag="EUBELI_00569"
FT   CDS_pept        584870..585166
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00569"
FT                   /product="Hypothetical protein"
FT                   /note="Psort-B: Unknown cell location; NOG21970 non
FT                   supervised orthologous group"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00569"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71582"
FT                   /db_xref="InterPro:IPR016772"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z498"
FT                   /protein_id="ACR71582.1"
FT                   /translation="MSVVIIGGNECMERQYQQICKKHGCKAKVFVKEKSGFSKQIGTPD
FT                   LMILFTNTVSHKMVLSAVTEAKKNDVNIVRTHSSSAASLTSVLETYLSESRAC"
FT   gene            585207..585776
FT                   /locus_tag="EUBELI_00570"
FT   CDS_pept        585207..585776
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00570"
FT                   /product="Hypothetical protein"
FT                   /note="Psort-B: Cytoplasmic, score:8.87; NOG11752 non
FT                   supervised orthologous group"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00570"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71583"
FT                   /db_xref="InterPro:IPR024523"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z499"
FT                   /protein_id="ACR71583.1"
FT                   /translation="MVCTDVLGRIEREVIKECSPTLAGLKTGNLFNYRYDNISDFRKEL
FT                   ASVNRKLNAKGVYVTFLKRNEKSALLYVFRPDRLEKDLSQPAVQNVLKTFGYTDYKVGA
FT                   SIKHLKQRVGENTCFPHEIGLFLSYPVEDVIQFIRQKGCNYKCCGVWKVYCDEAFSQKM
FT                   FARYRKCTEVYLRVFDRGRSISALTV"
FT   gene            585810..586232
FT                   /locus_tag="EUBELI_00571"
FT   CDS_pept        585810..586232
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00571"
FT                   /product="Hypothetical protein"
FT                   /note="Psort-B: Cytoplasmic, score:8.87; COG0716
FT                   Flavodoxins; HMMPfam:IPR008254; HMMTigr:IPR010087;
FT                   ScanRegExp:IPR001226"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00571"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71584"
FT                   /db_xref="GOA:C4Z4A0"
FT                   /db_xref="InterPro:IPR001226"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR010087"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z4A0"
FT                   /protein_id="ACR71584.1"
FT                   /translation="MSKVAVVYWSGTGNTETMANAVAEGAKGAGAEVDVLVANDFNSEK
FT                   VAEYDGIAFGCPAMGAENLEESEFEPMFTEVEGSLSGKKIALFGSYGWGSGEWMADWEE
FT                   RSKAAGAVLATDSVICQEAPDDDAVENCKKLGAALA"
FT   gene            586388..586639
FT                   /locus_tag="EUBELI_00572"
FT   CDS_pept        586388..586639
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00572"
FT                   /product="Hypothetical protein"
FT                   /note="Psort-B: Unknown cell location; COG1918 Fe2+
FT                   transport system protein A; HMMPfam:IPR007167;
FT                   superfamily:IPR008988"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00572"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71585"
FT                   /db_xref="GOA:C4Z4A1"
FT                   /db_xref="InterPro:IPR007167"
FT                   /db_xref="InterPro:IPR008988"
FT                   /db_xref="InterPro:IPR038157"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z4A1"
FT                   /protein_id="ACR71585.1"
FT                   /translation="MKNIINMLKRGDELMPLTMIDEGTPYTIQRIGGKEEIRRFLENLG
FT                   FVPGAVVTVVSKAGGNVIVNIKESRVAIGKDMANKIMV"
FT   gene            586693..586911
FT                   /locus_tag="EUBELI_00573"
FT   CDS_pept        586693..586911
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00573"
FT                   /product="ferrous iron transport protein A"
FT                   /note="Psort-B: Cytoplasmic, score:8.87; COG1918 Fe2+
FT                   transport system protein A; HMMPfam:IPR007167;
FT                   superfamily:IPR008988; K04758 ferrous iron transport
FT                   protein A"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00573"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71586"
FT                   /db_xref="GOA:C4Z4A2"
FT                   /db_xref="InterPro:IPR007167"
FT                   /db_xref="InterPro:IPR008988"
FT                   /db_xref="InterPro:IPR038157"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z4A2"
FT                   /protein_id="ACR71586.1"
FT                   /translation="MTLRDVSVGQTVKVTRLNGDGPVKRRIMDMGITKGVEVYVRKVAP
FT                   LGDPVEVTVRGYELSLRKADAEMIEVG"
FT   gene            587014..589518
FT                   /locus_tag="EUBELI_00574"
FT   CDS_pept        587014..589518
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00574"
FT                   /product="ferrous iron transport protein B"
FT                   /note="Psort-B: CytoplasmicMembrane, score:10.00; COG0370
FT                   Fe2+ transport system protein B; HMMPfam:IPR002917;
FT                   HMMPfam:IPR011619; HMMPfam:IPR011640; HMMPfam:IPR011642;
FT                   HMMTigr:IPR003373; HMMTigr:IPR005225; K04759 ferrous iron
FT                   transport protein B"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00574"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71587"
FT                   /db_xref="GOA:C4Z4A3"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR011640"
FT                   /db_xref="InterPro:IPR011642"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030389"
FT                   /db_xref="InterPro:IPR041069"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z4A3"
FT                   /protein_id="ACR71587.1"
FT                   /translation="MSIKIALAGNPNCGKTTLFNALTGSNQFVGNWPGVTVEKKEGKLK
FT                   GHKDVTIMDLPGIYSLSPYTLEEVVARNYLINERPDAIINIVDGTNIERNLYLSTQIME
FT                   LGIPVIMAVNMVDIMEKNGDKVDLAKLGKNLGCEAVEISALKGTGIKEAAEKAVKLAES
FT                   KKLNTIAHKFDDKVEAAISAVEDKLGLDIVEEQKRFFAIKLLEKDDKIKVLMKNVPDVS
FT                   AEIETLEKEFDDDTESIITNERYTYISSIISGCFAKKSEKKLSTSDKIDRIVTNRFLAL
FT                   PIFAVVMFIVYYVSVTTVGTWATDWANDGVFGDGWHLFGIGTSAYEEVADEYGDSDAII
FT                   GAYIDSLGDKGEEYADAIDTEADDYDSDAAVAALKKLENTVPANLTLDYDVEDEENLSV
FT                   TTETTDAAGVKEAIEQCIDNDGAAPDPANYGVWVPGIPVLLESGLDAIGCVDWLKGLIL
FT                   DGIVAGVGAVLGFVPQMLVLFIFLAFLESCGYMARIAFIMDRIFRKFGLSGKSFIPMLI
FT                   GSGCGVPGIMASRTIENDRDRKMTIMTTTFIPCGAKLPFIAMVAGAIFDGAPWVAPSAY
FT                   FLGIFSIICSGIILKKTKLFVGDPAPFVMELPAYHLPTVGTVLRSMWERGWSFIKKAGT
FT                   IITLSTIIIWFTTYFGFVDGTFTMLADDQIDFSILGRIGKAIAWIFAPLGFGNWQATVA
FT                   SITGLVAKENIVGTMGILYSAGEGTVYANMAATFTVVSGYAFLAFNLLCAPCFAAMGAI
FT                   KREMNNTKWFWIAIGYQCGYAYLVGLVINQIAGLITGDTAFNVFTVIAILIIVGFIYLL
FT                   FRPYKESKTLKVDSKKLLNATK"
FT   gene            589548..589688
FT                   /locus_tag="EUBELI_00575"
FT   CDS_pept        589548..589688
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00575"
FT                   /product="Hypothetical protein"
FT                   /note="Psort-B: Unknown cell location"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00575"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71588"
FT                   /db_xref="GOA:C4Z4A4"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z4A4"
FT                   /protein_id="ACR71588.1"
FT                   /translation="MLGTIIVGVILVIIVALIVRSMVHDKKNGKSFTCGGDCGKCKGHC
FT                   H"
FT   gene            589702..590130
FT                   /locus_tag="EUBELI_00576"
FT   CDS_pept        589702..590130
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00576"
FT                   /product="Hypothetical protein"
FT                   /note="Psort-B: Unknown cell location; COG0735 Fe2+/Zn2+
FT                   uptake regulation proteins; HMMPfam:IPR002481;
FT                   BlastProDom:IPR002481"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00576"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71589"
FT                   /db_xref="GOA:C4Z4A5"
FT                   /db_xref="InterPro:IPR002481"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z4A5"
FT                   /protein_id="ACR71589.1"
FT                   /translation="MVRNPDKDKDIIISRLKQQGCRITKQRLMLLDVILEEDCSSCKEI
FT                   YYKAVKKDPKIGAATVYRMVNTLEEIGAINRKNMYRITCDENDNGGYTVRLNDDSSINL
FT                   SESKWSKIIESGLEACGYIKNQKITSVVDRKKAVSVNK"
FT   gene            590228..590572
FT                   /locus_tag="EUBELI_00577"
FT   CDS_pept        590228..590572
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00577"
FT                   /product="Hypothetical protein"
FT                   /note="Psort-B: Unknown cell location"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00577"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71590"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z4A6"
FT                   /protein_id="ACR71590.1"
FT                   /translation="MCNIITVKLKKHLLSNVDREEHSMKIDNLKKPGLFAAGVLFGTAG
FT                   IKILTSKDAKKLYTNCTAAVLRAKSCIMKTATTVQENCEDIYADAKTINETKYNTEEVV
FT                   LDSVDENEEA"
FT   gene            590579..592654
FT                   /locus_tag="EUBELI_00578"
FT   CDS_pept        590579..592654
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00578"
FT                   /product="Hypothetical protein"
FT                   /note="Psort-B: CytoplasmicMembrane, score:9.49; COG2217
FT                   Cation transport ATPase; HMMPfam:IPR005834;
FT                   HMMPfam:IPR008250; HMMPanther:IPR001757; HMMTigr:IPR001757;
FT                   HMMTigr:IPR006416; ScanRegExp:IPR001757;
FT                   superfamily:IPR006121"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00578"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71591"
FT                   /db_xref="GOA:C4Z4A7"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z4A7"
FT                   /protein_id="ACR71591.1"
FT                   /translation="MKFTIKHDVPGRIRVHMDASSMTFAQADTLQYYLKNLQGVTNAKV
FT                   YERTADAVVEYRCSRKTVIEAIAKFRYSNIEVPEDVLATSGRAINSHYTEKLADQVLWR
FT                   MTKKLFIPAPVCAVLTTVSSMKYIYKGIRTLLDRKLEVPVLDATAIGVSILRRDFNTAG
FT                   SVMFLLGIGEIIEDWTHKKSVDDLARTMSLNVNKVWLKTDDAEVQVSVKDVKDGDNVII
FT                   RMGNVIPFDGTVISGEAMVNQASLTGESEPVRRGEGTSVFAGTVVEEGEIVFRVKRAGG
FT                   SSKYDKIVRMIEESEKLKSGLESKAEHLADKLVPYSLGGTALTYLLTRNTTKALSILMV
FT                   DFSCALKLAMPITVLAAIRQASQASATVKGGKFLEAIAEADTIVFDKTGTLTKAKPTVS
FT                   RVYSFNGMPEDELLRIAACLEEHFPHSMAKAVVNEAGRRNLMHEEMHSKVEYIVAHGIS
FT                   TFIDTSKVIIGSHHFVFEDEVCVIPVGKQELFDSLPDDCSHLYMAINGQLAAVICIIDP
FT                   LREEAPEVIEGLKKAGISKVVMMTGDSERTAASIARKVGVTEYYSEVLPEDKAKFVEKE
FT                   RAAGRKVIMIGDGINDSPALSAADVGIAISDGAEIAREIADITVGADDLNQILMLKKLS
FT                   DSLIKKINRNYRVIVGFNSALIALGVTGVIQPTTSALLHNTSTLVISLESMKNLPV"
FT   gene            592809..593024
FT                   /locus_tag="EUBELI_00579"
FT   CDS_pept        592809..593024
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00579"
FT                   /product="Hypothetical protein"
FT                   /note="Psort-B: Cytoplasmic, score:8.87; NOG36108 non
FT                   supervised orthologous group; HMMPfam:IPR001387;
FT                   HMMSmart:IPR001387; superfamily:IPR010982"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00579"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71592"
FT                   /db_xref="GOA:C4Z4A8"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z4A8"
FT                   /protein_id="ACR71592.1"
FT                   /translation="MKITDSEELGNIIRNRRKELKYTQAFLSEYTGLSVSFISDVERGK
FT                   PTVEIGKVIQLISILGLDVNIDVRGR"
FT   gene            593024..594316
FT                   /locus_tag="EUBELI_00580"
FT   CDS_pept        593024..594316
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00580"
FT                   /product="Hypothetical protein"
FT                   /note="Psort-B: Cytoplasmic, score:8.87; COG3550
FT                   Uncharacterized protein related to capsule biosynthesis
FT                   enzymes; HMMPfam:IPR012893; HMMPfam:IPR012894"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00580"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71593"
FT                   /db_xref="InterPro:IPR012893"
FT                   /db_xref="InterPro:IPR017508"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z4A9"
FT                   /protein_id="ACR71593.1"
FT                   /translation="MRNLEVYIECNGNMINVGSITGHNSDDAVFSYSEEYIEDKSSRSI
FT                   SISLPLDERSFSAERTRCFFESLLPEGYTRRCVAGWLHVDENDYISVLSELGSECLGAI
FT                   RIVEGDMNIKQSSYRLLSHEELLEFAREGATKSAELVIKSHLSLAGASGKTGLYYDRNN
FT                   NEWYQPAGLAPSTHILKQSHVRLKKIVANEQLCLLTARKLGIRTPDSFIINLNDKEDDF
FT                   LFATERYDRKILDTSKELMGKKVPLRLHQEDFAQALGITASQKYEKNGKDYLAEAFELI
FT                   KNYSSNPIEDQIRLWDLCIFNYLIGNTDNHVKNIALLYSEDLKGIRLAPAYDLLSTVIY
FT                   DSSTEKMSLNIDGEYDIRNINQKSFENEAKKLGLGKGIATQHFLSMVEKFEMALEQSTY
FT                   ELEEQGYGVAVDIQKQILKKAGIHNFKLTNP"
FT   gene            594366..595622
FT                   /locus_tag="EUBELI_00581"
FT   CDS_pept        594366..595622
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00581"
FT                   /product="glycine hydroxymethyltransferase"
FT                   /note="Psort-B: Cytoplasmic, score:9.98; COG0112
FT                   Glycine/serine hydroxymethyltransferase; HMMPfam:IPR001085;
FT                   Gene3D:IPR015421; HMMPIR:IPR001085; HMMPanther:IPR001085;
FT                   ScanRegExp:IPR001085; superfamily:IPR015424; K00600 glycine
FT                   hydroxymethyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00581"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71594"
FT                   /db_xref="GOA:C4Z4B0"
FT                   /db_xref="InterPro:IPR001085"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR019798"
FT                   /db_xref="InterPro:IPR039429"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z4B0"
FT                   /protein_id="ACR71594.1"
FT                   /translation="MGGSYMYSFDEVLNYDPDLAKAMDDELGRQRSHIELIASENLVSK
FT                   AVMAAMGSPLTNKYAEGYPGKRYYGGCEYVDVVETLAIERAKKLFGCEYANVQPHSGAQ
FT                   ANLAVFFALVNPGDTVMGMSLDCGGHLSHGSPVNISGKYFNIVPYGVTADGFIDYDEVL
FT                   RIAKECKPKMIIAGASAYARTIDFKKFREICDEVGALLMVDMAHIAGLVAGGAHPSPIP
FT                   YADVTTTTTHKTLRGPRGGMILASAEAAEKFKLNKAVFPGIQGGPLMHVIAGKAVCLKE
FT                   ALDPSFKVYAENVVKNASALANGLMNRGFDIVSGGTDNHLMLVNLLSKGKTGKEVEKLL
FT                   DAANITCNKNTIPNDPASPFVTSGIRLGTAAVTTRGFNEADMDVVAEAIAMLVDDVDAN
FT                   QAKAMELVKGLTDKYPLYE"
FT   gene            595678..596586
FT                   /locus_tag="EUBELI_00582"
FT   CDS_pept        595678..596586
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00582"
FT                   /product="Hypothetical protein"
FT                   /note="Psort-B: Cytoplasmic, score:9.98; COG1028
FT                   Dehydrogenases with different specificities (related to
FT                   short-chain alcohol dehydrogenases); HMMPfam:IPR002198;
FT                   HMMPanther:IPR002198; ScanRegExp:IPR002198"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00582"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71595"
FT                   /db_xref="GOA:C4Z4B1"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z4B1"
FT                   /protein_id="ACR71595.1"
FT                   /translation="MQFQALGTIVNGEVQRGTKVKAFVSFFVFRKLRKVRGVMGKLEGK
FT                   VAVITGASKGIGEGIAKVYAKYGAKCVLAARGPKVLELAEQLKSEGYEATGVQVDVSDY
FT                   KSVERIVEVAEKTYGKIDVLVCNAGVCVLEDFLEDDTFENRDLHLDINVKGAWNVAKAV
FT                   IPSMIANGGGAIVVTSSVTGDMVADPGEVAYATSKAALVGFTKALAREFADKNIRVNAI
FT                   CPGYVRTPLVEGMAKQSDPENPERAIQAIADAVPLKRLADPEEVGELAAFLGCYESSYI
FT                   TGTQIVIDGGSTLPETTSMGQ"
FT   gene            596665..597660
FT                   /locus_tag="EUBELI_00583"
FT   CDS_pept        596665..597660
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00583"
FT                   /product="homoserine kinase"
FT                   /note="Psort-B: Cytoplasmic, score:8.87; COG2334 Putative
FT                   homoserine kinase type II (protein kinase fold);
FT                   HMMPfam:IPR002575; ScanRegExp:IPR008266;
FT                   superfamily:IPR011009; K02203 homoserine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00583"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71596"
FT                   /db_xref="GOA:C4Z4B2"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z4B2"
FT                   /protein_id="ACR71596.1"
FT                   /translation="MAFENVDLFDAVANASLEKYGWQDRCEAKLIVLSENATYMVKNKE
FT                   TGEKEGVLRISRPGYHTLDELNSEMKWLRQINDYTPLLVANPIKGLDGKNIQEITGPDG
FT                   NVYFCVICDFLPGEAPDENNEEQMVKQFRYLGETTAYLHRQTEIWNGTDKLDRMVWTYD
FT                   TIIGEHAAWGDWRAFPEMTPEAENILSEVSRIIKRRLERYGTNENNFGLIHADLRLANL
FT                   LIEGDQIKVIDFDDCGFGWHLHDLASALSFIEDKPIVPKLVNAWLAGYKKVLPFTDTDF
FT                   EEIDTFIMMRRLQLTAWLASHQESGPVAELSVGWMDGTMELAERYLRLFG"
FT   gene            597719..599122
FT                   /locus_tag="EUBELI_00584"
FT   CDS_pept        597719..599122
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00584"
FT                   /product="basic amino acid/polyamine antiporter, APA
FT                   family"
FT                   /note="Psort-B: CytoplasmicMembrane, score:9.99; COG0531
FT                   Amino acid transporters; HMMPfam:IPR004841;
FT                   HMMPanther:IPR002293; K03294 basic amino acid/polyamine
FT                   antiporter, APA family"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00584"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71597"
FT                   /db_xref="GOA:C4Z4B3"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z4B3"
FT                   /protein_id="ACR71597.1"
FT                   /translation="MGEKKTNALSKSMKLIYVYAMATGAIFTFMCYWDGIFMSYTGPGT
FT                   FLAFALMTLAVLPTAFVYAEFSTMLPSTGSCLVFNTVSINKHAGFWSAWLIMCAWIAVP
FT                   AAGVLGIIEWLNHQFGLGLIGGKAVIVGSLVLCFWCVLSLYKNVVAGKVQSFMLMAGIA
FT                   GILICSLLFLFSGHWSIANFADFFTSSNEKQWGGNFATGIAWVVGCSFMITPYFGFETV
FT                   PAMVEEGDFPIKDQKKAILGSVITCGAIYTIFYFCLAGAMPWAELTNGGDCHPFITFEA
FT                   LQYCFGDKIAWFVLIMGIVGVVFPIGTSVLGFWYSGVRMIYAMGRQNFLPKQFSYTNKY
FT                   NQPTLPNILILVVSIGFIAMQSITAFFDLMAFACALCYVITSISSLVLLKKHPEWERPY
FT                   KCATGLKIASLIIMAIIAFFCTIGIGKATWLGFAGYMGVGLILWLYMILIKWKHEKVWM
FT                   KTPDGDKEY"
FT   gene            599149..599490
FT                   /locus_tag="EUBELI_00585"
FT   CDS_pept        599149..599490
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00585"
FT                   /product="nitrogen regulatory protein P-II 1"
FT                   /note="Psort-B: Cytoplasmic, score:8.87; COG0347 Nitrogen
FT                   regulatory protein PII; HMMPfam:IPR002187;
FT                   BlastProDom:IPR002187; Gene3D:IPR015867;
FT                   ScanRegExp:IPR002187; superfamily:IPR011322; K04751
FT                   nitrogen regulatory protein P-II 1"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00585"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71598"
FT                   /db_xref="GOA:C4Z4B4"
FT                   /db_xref="InterPro:IPR002187"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="InterPro:IPR017918"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z4B4"
FT                   /protein_id="ACR71598.1"
FT                   /translation="MKELEIVIKPEKLENLKRILDSEGARGVMITTIFGYGHQKGAGQV
FT                   YTRDETPGINLLPKLSVRTVVKDEIVEGIINKVLEELNTNSFGDGKIFIKDIEGVVKIR
FT                   TGETGNDAL"
FT   gene            599649..599783
FT                   /locus_tag="EUBELI_00586"
FT   CDS_pept        599649..599783
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00586"
FT                   /product="Hypothetical protein"
FT                   /note="Psort-B: Unknown cell location"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00586"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71599"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z4B5"
FT                   /protein_id="ACR71599.1"
FT                   /translation="MESVGLDIRAERTHEKVQNESRSVSDWTIERSEGKKKSKKEVEE"
FT   gene            599900..601276
FT                   /locus_tag="EUBELI_00587"
FT   CDS_pept        599900..601276
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00587"
FT                   /product="Hypothetical protein"
FT                   /note="Psort-B: Unknown cell location; COG3468 Type V
FT                   secretory pathway, adhesin AidA"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00587"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71600"
FT                   /db_xref="GOA:C4Z4B6"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z4B6"
FT                   /protein_id="ACR71600.1"
FT                   /translation="MKKRFKVTIVLMMTMALLAGIIASLRMENIFAEENGSSEGVTVVI
FT                   REEYDKKSWQYHYYFDYTIPEDYDEDTIKIDLIGDLMKYYEAETYVPGDGENFYVNIVN
FT                   LSKNEYVYSDGSMKITDGNYVDEKDADMAYTYDNTEAEYIKGAYTSLSNRPIAVKSTVW
FT                   RTSNSALKELLDTTSNAAKYYSNESVTSALINAGYENGLDDLDEYYVDYMNKKYDKTCA
FT                   KLEDFSVIEICNAIFNGYTVNVKEANKNVAALGYNMFYNNLLMFTLDDATVSNDDCVAG
FT                   KFSLGSWMRDENSVDSYMNKKTGTLEVGMKEARNILNAHLHISGPYTTNPYQATSWGME
FT                   FTFTLDKVQPPTEEPTTQEPPTEEPTTQEPTTQEPTTQKPTQPSTEQPTTMSSTSSIAQ
FT                   SSDAESSVTERVAEVAADEEVVRTGDSRKAVMYVSIISAATLVSVIVIIADRKRKISEK
FT                   "
FT   gene            601286..601948
FT                   /locus_tag="EUBELI_00588"
FT   CDS_pept        601286..601948
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00588"
FT                   /product="Hypothetical protein"
FT                   /note="Psort-B: CytoplasmicMembrane, score:9.75"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00588"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71601"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z4B7"
FT                   /protein_id="ACR71601.1"
FT                   /translation="MKISVIGDIINDSLNEKELDIMRHFSRTELKAAINILKEFTSKGN
FT                   FAVLMYMGDTDKLEVSQTLNSDMSCFLLYGSIQPLAFFFAENIPMTAGELEEIINKQSA
FT                   VYEEEMDNYRNALKESGADNGLFITKYESMIHTFIAYDPDQSGDRDCYAPFIEGAFNVE
FT                   PGKGQFVNEVMRLEVYDDEYEDDCVIQKKHFVYLSSVKFMGAFNMRMMMSMVDAQYN"
FT   gene            602040..603212
FT                   /locus_tag="EUBELI_00589"
FT   CDS_pept        602040..603212
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00589"
FT                   /product="phosphoribosylaminoimidazole-succinocarboxamide
FT                   synthase"
FT                   /note="Psort-B: CytoplasmicMembrane, score:9.99; COG0628
FT                   Predicted permease; HMMPfam:IPR002549;
FT                   HMMPanther:IPR002549; K01923
FT                   phosphoribosylaminoimidazole-succinocarboxamide synthase"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00589"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71602"
FT                   /db_xref="GOA:C4Z4B8"
FT                   /db_xref="InterPro:IPR002549"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z4B8"
FT                   /protein_id="ACR71602.1"
FT                   /translation="MNKGHFKDSQVVKGITIGAVLIVIYLALNNVTGILDSISYLAGLV
FT                   MPFIIGAVIAFVFNVPMKAIEKGLNRLFDKRCKKKHPRLIRVLAYMLTLILILAIIAGV
FT                   LFVVVPELVNTIADLIGQVPTAVNNLINWLQVKLSAYPEYEEKLSSISINWDSVLSNVM
FT                   NFLSIGTKGIINGGIGAISGFFSGVANFFIGFVFSVYVLFQKERLTAQCKKLMYVCMPE
FT                   NRADKIVEVLRLTNTTFSNFLSGQCLEACILGTMFVITLSILRMPYALLIGIIIAVTAL
FT                   IPIVGAFIGCIVGVILIMMTSPLKALIFVGVFLILQQIEGNLIYPHVVGSSVGLPGIWV
FT                   LVAVTIGGNLFGIMGMLTFIPISSVCYALLRTYVNRKVEEKEIDKGKFKG"
FT   gene            603212..603385
FT                   /locus_tag="EUBELI_00590"
FT   CDS_pept        603212..603385
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00590"
FT                   /product="Hypothetical protein"
FT                   /note="Psort-B: Cytoplasmic, score:8.87"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00590"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71603"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z4B9"
FT                   /protein_id="ACR71603.1"
FT                   /translation="MLSGNGSQAAVQRFENELHSRLTSFSRKICVGKIGRWSVICGLDA
FT                   GVVKRHVEVQIE"
FT   gene            complement(603740..603859)
FT                   /locus_tag="EUBELI_00591"
FT   CDS_pept        complement(603740..603859)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00591"
FT                   /product="Hypothetical protein"
FT                   /note="Psort-B: Unknown cell location"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00591"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71604"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z4C0"
FT                   /protein_id="ACR71604.1"
FT                   /translation="MVINHVGDVAFIIHYDFLSIHKKFPAYMLILQLFLFNLI"
FT   gene            complement(603890..605116)
FT                   /locus_tag="EUBELI_00592"
FT   CDS_pept        complement(603890..605116)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00592"
FT                   /product="argininosuccinate synthase"
FT                   /note="Psort-B: Cytoplasmic, score:8.87; COG0137
FT                   Argininosuccinate synthase; HMMPfam:IPR001518;
FT                   Gene3D:IPR014729; HMMPanther:IPR001518; HMMTigr:IPR001518;
FT                   ScanRegExp:IPR001518; K01940 argininosuccinate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00592"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71605"
FT                   /db_xref="GOA:C4Z4C1"
FT                   /db_xref="InterPro:IPR001518"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR018223"
FT                   /db_xref="InterPro:IPR023434"
FT                   /db_xref="InterPro:IPR024074"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4Z4C1"
FT                   /protein_id="ACR71605.1"
FT                   /translation="MKEKVILAYSGGLDTTAIIPWLKETYNYDVVCVCADCGQEEELDG
FT                   LEQRALSCGAAKLYIEDITDEFCDNYIVPCVQAHAVYENKYLLGTSMARPLIAKRLVEI
FT                   ARKEGAVAICHGATGKGNDQIRFELTIKALAPDIKIIAPWRDSNWKLQSREDEIEYCRQ
FT                   HGIHLPFSTDCSYSRDRNIWHISHEGLELEDPANEPNYKHLLVLGCTPEEAPDEPEYVT
FT                   MTFEKGVPKSVNGKAMKVSDIIRELNRLGAKHGIGIIDIVENRVVGMKSRGVYETPGGT
FT                   ILYEAHQQLEELVLDRDTTTFKMDVGNKFAQVVYEGKWETPLREALQAFVEKTQEYVTG
FT                   EVKFRLYKGNIIKAGTTSPYSLYNESIASFKTGDMYDHHDADGFINLFGLSLKVRAMKK
FT                   LENEKKNNK"
FT   gene            605393..606439
FT                   /locus_tag="EUBELI_00593"
FT   CDS_pept        605393..606439
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00593"
FT                   /product="N-acetyl-gamma-glutamyl-phosphate reductase"
FT                   /note="Psort-B: Cytoplasmic, score:8.87; COG0002
FT                   Acetylglutamate semialdehyde dehydrogenase;
FT                   HMMPfam:IPR000534; HMMPfam:IPR012280;
FT                   BlastProDom:IPR000706; HMMTigr:IPR000706;
FT                   ScanRegExp:IPR000706; K00145
FT                   N-acetyl-gamma-glutamyl-phosphate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00593"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71606"
FT                   /db_xref="GOA:C4Z4C2"
FT                   /db_xref="InterPro:IPR000534"
FT                   /db_xref="InterPro:IPR000706"
FT                   /db_xref="InterPro:IPR012280"
FT                   /db_xref="InterPro:IPR023013"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4Z4C2"
FT                   /protein_id="ACR71606.1"
FT                   /translation="MIKVGIIGATGYAGNELVRLLLGHKDAEIVWLGSRSYIDQNYSDV
FT                   YRNMFKLVDAKCMDDNMEQLANEVDVIFTATPQGLCASLVNDEILSKTKIIDLSADFRL
FT                   KDVNVYEQWYKLEHKAPQYIDEAVYGLCEINRDKVSKDTRIIANPGCYTTTSILTLYPM
FT                   VKEGIINPDTIIIDAKSGTSGAGRGAKVANLFCEVNESMKAYGVGTHRHTPEIEEQLGY
FT                   ACGRDDLKLIFTPHLVPMNRGILVTAYANLAKDVTYEDVKAAYDKYYDKEYFVRVLPKD
FT                   VCPETRWVEGSNFVDIGFKIEPRTNRLIMMGALDNLVKGAAGQAVQNMNLLFGLPENEG
FT                   LQIAPMFP"
FT   gene            606463..607689
FT                   /locus_tag="EUBELI_00594"
FT   CDS_pept        606463..607689
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00594"
FT                   /product="amino-acid N-acetyltransferase"
FT                   /note="Psort-B: Cytoplasmic, score:9.98; COG1364
FT                   N-acetylglutamate synthase (N-acetylornithine
FT                   aminotransferase); HMMPfam:IPR002813;
FT                   BlastProDom:IPR002813; HMMPanther:IPR002813;
FT                   HMMTigr:IPR002813; K00618 amino-acid N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00594"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71607"
FT                   /db_xref="GOA:C4Z4C3"
FT                   /db_xref="InterPro:IPR002813"
FT                   /db_xref="InterPro:IPR016117"
FT                   /db_xref="InterPro:IPR042195"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z4C3"
FT                   /protein_id="ACR71607.1"
FT                   /translation="MNIIKGGVTAAKGFKAAGCEAQIKYKNGKKDMALVYSEKPCVTAG
FT                   TFTTNKVFAAPVKWDRNIVYNEDFAQAVVVNSGVANACTGVEGDNACAEEAKAVAKVLN
FT                   VPENAVLIGSTGVIGMQLPVDRICAGIEKLAPMLDDSLEAGTQAAEAIMTTDTRSKQVA
FT                   VEVEVAGTKVTIGGMCKGAGMIHPNMATMLCYITTDCDIDKALLQKMTSAIVDDSFNMI
FT                   SVDGDTSTNDTALVLANGMAGNKKITEEGADYNAFYEGLSYVFTELSKMIAGDGEGCTC
FT                   LFEVQVKGATTKAEAKTLAKSIVTSSLTKAAIFGHDANWGRILCAMGYSGADFDPEKVD
FT                   IFFKSEAGELQIVKDGTATDYSEEKATEILSQNPVIAIADVKQGDASATAWGCDLTFDY
FT                   VKINADYRS"
FT   gene            607670..608653
FT                   /locus_tag="EUBELI_00595"
FT   CDS_pept        607670..608653
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00595"
FT                   /product="acetylglutamate kinase"
FT                   /note="Psort-B: Cytoplasmic, score:8.87; COG0548
FT                   Acetylglutamate kinase; HMMPfam:IPR001048;
FT                   Gene3D:IPR001048; HMMPIR:IPR011148; HMMTigr:IPR004662;
FT                   superfamily:IPR001048; K00930 acetylglutamate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00595"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71608"
FT                   /db_xref="GOA:C4Z4C4"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001057"
FT                   /db_xref="InterPro:IPR004662"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR037528"
FT                   /db_xref="InterPro:IPR041727"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z4C4"
FT                   /protein_id="ACR71608.1"
FT                   /translation="MLITEANLTQHFKANRYLNKYEMEIIMSAKDMTEELMKAQVLVEA
FT                   LPYIQKFNRKIIVVKYGGSAMVDEELKRKVIQDVVLLKLVGFKPIIVHGGGKEISKWVE
FT                   KSGMTPEFKNGLRVTDEPTMEIAEMVLNKVNKSLVSMIEQLGVKACGISGKDGGMLKVE
FT                   KKYSKGEDIGYVGEVTDVDTTLIESLLKDDFLPVICPIGYDDDFHAYNINADDAACAIA
FT                   RAVNAEKLAFLTDIEGVYKDFDDKDSLISELSTSEARTLLESGTIGGGMLPKLNNCIDA
FT                   IEHGVSRVHILDGRIPHCLLLEIFTNKGVGTAILSDDAEKFFDSDK"
FT   gene            608704..609921
FT                   /locus_tag="EUBELI_00596"
FT   CDS_pept        608704..609921
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00596"
FT                   /product="acetylornithine aminotransferase"
FT                   /note="Psort-B: Cytoplasmic, score:8.87; COG4992
FT                   Ornithine/acetylornithine aminotransferase;
FT                   HMMPfam:IPR005814; Gene3D:IPR015421; HMMPanther:IPR004636;
FT                   HMMPanther:IPR005814; HMMTigr:IPR004636;
FT                   ScanRegExp:IPR005814; superfamily:IPR015424; K00818
FT                   acetylornithine aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00596"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71609"
FT                   /db_xref="GOA:C4Z4C5"
FT                   /db_xref="InterPro:IPR004636"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z4C5"
FT                   /protein_id="ACR71609.1"
FT                   /translation="MCAHKNRKVRVIMNTQQIIETAEEKLIHTYNRYQIVLDKGDGVRL
FT                   YDTDGKEYLDFGAGIAVFALGYNNKEYNDALKAQIDKLIHTSNYFYNEPAVEAATALTK
FT                   ASGMDRVFFTNSGTEAIEGAVKLAKKYYYVKNGKADAEIIAMQHSFHGRSMGALAVTGN
FT                   KHYQEAFGPMIPGIKFAQYNDLDSVKELVNDKTCAIIFETVQGEGGIYPATKEFIEGVR
FT                   KLCDEKGILLILDEIQCGMGRTGSMFAFQQYGVKPDILTVAKALGCGVPVGAFAATEEV
FT                   AKALVPGDHGTTYGGNPLACAAATKVFELFEKQHVLDNVKEVSAYFEEKLDELVETIDV
FT                   VVERRGMGLMQGLELSVNPKDVIAKALDNGLILFSAGTNVIRFVPPLVITKADVDECIA
FT                   KLKKSF"
FT   gene            609939..611225
FT                   /locus_tag="EUBELI_00597"
FT   CDS_pept        609939..611225
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00597"
FT                   /product="Hypothetical protein"
FT                   /note="Psort-B: Unknown cell location; COG1653 ABC-type
FT                   sugar transport system, periplasmic component;
FT                   HMMPfam:IPR006059"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00597"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71610"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z4C6"
FT                   /protein_id="ACR71610.1"
FT                   /translation="MKLRRFISMMLIVTMLTVFAGCGNKDDRTQAARTLNLDGPITVNV
FT                   WFNNNDYEPYLEFVAKQFKQANELVTINPVYVEADSYINYIYDESVRNDNACDLYFLTS
FT                   EEIEKAYLMGLMSENDMYPQVYNEDVFGKAAMTACSYNGKLYGYPVSFNTSFLVYNKKY
FT                   AEPVETIDQIRQISDNYQVTDENQDVSMVFQWAPGSMFLNYPACGKYINIGGNNSEDSS
FT                   SVSVDGDSIKKVLSKYAELNSAFGTDRNNTSLETCVDLFSTGNLLYTILDADSISKIDL
FT                   SEIDYGICKYPSMGNDVESKAMSVTTMAVVNPYTKNVDASKAVARAISYDYADYMESTA
FT                   KKSCARADIKVKRNVENYKAMHDIYSDSVVKAKYIGVGEVYMRYEIMLHQVYDGTNVDE
FT                   AYNSFAACIDRMAKQTEASSVNSGNSSSK"
FT   gene            611290..611739
FT                   /locus_tag="EUBELI_00598"
FT   CDS_pept        611290..611739
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00598"
FT                   /product="hypothetical protein"
FT                   /note="Psort-B: CytoplasmicMembrane, score:9.99; COG3238
FT                   Uncharacterized protein conserved in bacteria;
FT                   HMMPfam:IPR006750; K09936 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00598"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71611"
FT                   /db_xref="GOA:C4Z4C7"
FT                   /db_xref="InterPro:IPR006750"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z4C7"
FT                   /protein_id="ACR71611.1"
FT                   /translation="MAGFLIAIISGALMSLQGAFNTNVTKASSVWVTAMFVQLTALATC
FT                   AIMWVIDGRPDIMKLFKVDNKVTLLGGVIGAFITFTVIKSISGLGIAKAEVTIVVAQII
FT                   VSYLLGLFGLFGSEKTTFSWIKLVSLLITVAGVCMFYFLGNPSTD"
FT   gene            611746..613008
FT                   /locus_tag="EUBELI_00599"
FT   CDS_pept        611746..613008
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00599"
FT                   /product="putative SAM-dependent methyltransferase"
FT                   /note="Psort-B: Cytoplasmic, score:8.87; COG1092 Predicted
FT                   SAM-dependent methyltransferases; HMMPfam:IPR010456; K06969
FT                   putative SAM-dependent methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00599"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71612"
FT                   /db_xref="GOA:C4Z4C8"
FT                   /db_xref="InterPro:IPR002478"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR019614"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR036974"
FT                   /db_xref="InterPro:IPR041532"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z4C8"
FT                   /protein_id="ACR71612.1"
FT                   /translation="MNNYDKCQKNLAGRNRMEDLFSVCGKIRLRKGEGRTLKAGGAWVY
FT                   DNEIEWMSDGIIDGHLVEVLDFDDYFMGIGFINRKSKITVRMLARHTDVVDEAFIEERV
FT                   RAAVEYRFDTVDTSACRLIFGEADFLPGLVIDKYSDVLVVESLALGIDRFKPLIVEKVK
FT                   EILHEKGIDIRGVYERSDAKVRTLEGMERVKGFIGDEFDTNVEIVENGVHYMIDVVNGQ
FT                   KTGFFLDQKYNRLAMQKLCKDKRVLDCFTHMGTFALNAGIAGAKEVTGLDISEYAVEQA
FT                   RANAKLNGLEDTVHFKCANVLDELPKLNEAGEKYDVVILDPPAFTKSREATKNAIKGYR
FT                   EINMKGLKLVKDGGYLASCSCSHFMTQELLTKTIKEAAKAVHKRLRQVEFRTQSPDHPI
FT                   LWEAQESYYLKFFIFQVVDEK"
FT   gene            complement(613087..613650)
FT                   /locus_tag="EUBELI_00600"
FT   CDS_pept        complement(613087..613650)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00600"
FT                   /product="chromate transporter"
FT                   /note="Psort-B: CytoplasmicMembrane, score:9.99; COG2059
FT                   Chromate transport protein ChrA; HMMPfam:IPR003370; K07240
FT                   chromate transporter"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00600"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71613"
FT                   /db_xref="GOA:C4Z4C9"
FT                   /db_xref="InterPro:IPR003370"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z4C9"
FT                   /protein_id="ACR71613.1"
FT                   /translation="MLMIYLELFYIFLKIGAFTFGGGYAMLPLIQDEVIAHNWIDSQSL
FT                   IDFIAVSESTPGPFAVNIATYVGAEVGGIFGSFCATLGVILPSFIIILIVAKCFIQFQK
FT                   SIVIKGCMSGLKPAVVGLIGSAVISMSSTVFIPDGFNTTVFTDISFYTTLIIFLISVVL
FT                   AFKKLNPILIICLSAILGIVCGYI"
FT   gene            complement(613644..614201)
FT                   /locus_tag="EUBELI_00601"
FT   CDS_pept        complement(613644..614201)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00601"
FT                   /product="chromate transporter"
FT                   /note="Psort-B: CytoplasmicMembrane, score:9.99; COG2059
FT                   Chromate transport protein ChrA; HMMPfam:IPR003370; K07240
FT                   chromate transporter"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00601"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71614"
FT                   /db_xref="GOA:C4Z4D0"
FT                   /db_xref="InterPro:IPR003370"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z4D0"
FT                   /protein_id="ACR71614.1"
FT                   /translation="MNTKFPKAIQLFLTFIKIGAFTFGGGYAMLPLIQKEIVEKKHWIT
FT                   DNDILEIVAISESTPGPIAINAATFVGFRICGFWGALFATLGVVIPSYLIILIISFVLK
FT                   EFQSIKIIQYAFNGIRAGVLALIIKALWSMYIQCPKNVISYIIMACSFVFTALLNVNVL
FT                   IVIISCAILGLVTSIVISRRKC"
FT   gene            complement(614191..615084)
FT                   /locus_tag="EUBELI_00602"
FT   CDS_pept        complement(614191..615084)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00602"
FT                   /product="Hypothetical protein"
FT                   /note="Psort-B: Unknown cell location; COG0613 Predicted
FT                   metal-dependent phosphoesterases (PHP family);
FT                   HMMPfam:IPR004013; HMMSmart:IPR003141"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00602"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71615"
FT                   /db_xref="GOA:C4Z4D1"
FT                   /db_xref="InterPro:IPR003141"
FT                   /db_xref="InterPro:IPR004013"
FT                   /db_xref="InterPro:IPR016195"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z4D1"
FT                   /protein_id="ACR71615.1"
FT                   /translation="MKQIDLHVHSTCSDGTDSPAVLVDKAVDKGLAAFALTDHDTTRGV
FT                   KEALLACENVNNNGHKLEVIPGVEISTNFDNTEIHVVGLFIDYNDNEFNSFLNKQLSSR
FT                   DERNKQVCERFQNIGINITYEDMIKTYGDAVITRAHFADRLVAIGAVGDRNEAFDRYLG
FT                   QGKPCFVPRAKVDPAEAIERIHQAGGIAILAHPVLYHLGNAQMNKLLDHMCSAGLDGIE
FT                   AIYSTYKMGDELSIRRIASERNLLISGGSDYHGKNKPHIQLGTGMGHLFVPYELLDKMK
FT                   DSMPITNTQKETYDEY"
FT   gene            615235..615822
FT                   /locus_tag="EUBELI_00603"
FT   CDS_pept        615235..615822
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00603"
FT                   /product="Hypothetical protein"
FT                   /note="Psort-B: Cytoplasmic, score:8.87; COG4728
FT                   Uncharacterized protein conserved in bacteria;
FT                   HMMPfam:IPR012868"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00603"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71616"
FT                   /db_xref="InterPro:IPR023387"
FT                   /db_xref="InterPro:IPR037135"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z4D2"
FT                   /protein_id="ACR71616.1"
FT                   /translation="MERQLVPGGFYKHFKNKLYQVKCVAYHSETKEKMVVYQAMYGEYA
FT                   VYVRPYDMFMSEVDHVKYPDVAQKYRFEQVDPLTMQEISDNLQAVRVNSDNRIDEAYTL
FT                   KEDSVDNSLAQPEQQVAAGDSVLDKFLDARGYEEKLDVLIRYKSRFTNPMIDIMAESLE
FT                   IVVPEGELSGRIDSLRKVLQAHTKYEGSHLRP"
FT   gene            615852..617000
FT                   /locus_tag="EUBELI_00604"
FT   CDS_pept        615852..617000
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00604"
FT                   /product="D-alanine-D-alanine ligase"
FT                   /note="Psort-B: Cytoplasmic, score:9.98; COG1181
FT                   D-alanine-D-alanine ligase and related ATP-grasp enzymes;
FT                   HMMPfam:IPR011095; HMMPfam:IPR011127; Gene3D:IPR013816;
FT                   Gene3D:IPR013817; HMMTigr:IPR005905; ScanRegExp:IPR000291;
FT                   K01921 D-alanine-D-alanine ligase"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00604"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71617"
FT                   /db_xref="GOA:C4Z4D3"
FT                   /db_xref="InterPro:IPR000291"
FT                   /db_xref="InterPro:IPR005905"
FT                   /db_xref="InterPro:IPR011095"
FT                   /db_xref="InterPro:IPR011127"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z4D3"
FT                   /protein_id="ACR71617.1"
FT                   /translation="MDYINILQLSDNFTKNLQLTKNVNNYVDIVEKFRDKGEIMRIVVL
FT                   AGGTSTERDVSLVTGYRVCESLRRNGHEANMLDIFLGVDDSEVKTFFTEKNDLGELSDN
FT                   LKKKTADIPAEVKRRTEARESFFGRNVLELCKEADMVFMGLHGSNGEDGKVQATFDLLG
FT                   IRYTGTDYLSSAISMSKELAKKVLVPEGIPMPKGVTLHKGHKIEYVPFPCVVKPCCGGS
FT                   SVGVSIAHNEKEFEDALDEAFSYEDTVLVEEFVDGREFSVAVLDGKALPVIEIEPLEGF
FT                   YDYKNKYKAGSTKETCPANIPEDIASQMQFWAEKCCQAAGVTTYARVDELLDKNNNIFC
FT                   LEINTLPGMTDTSLIPQEAAAVGISYDELTEKIIEISLAKYE"
FT   gene            617054..617614
FT                   /locus_tag="EUBELI_00605"
FT   CDS_pept        617054..617614
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00605"
FT                   /product="Hypothetical protein"
FT                   /note="Psort-B: Cytoplasmic, score:8.87; COG0778
FT                   Nitroreductase; HMMPfam:IPR000415"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00605"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71618"
FT                   /db_xref="GOA:C4Z4D4"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR023312"
FT                   /db_xref="InterPro:IPR029478"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z4D4"
FT                   /protein_id="ACR71618.1"
FT                   /translation="MIKELVKKNRSYRRFYQEKKLTKQQLMELVETARLTPSTANRQPF
FT                   KYRIVCDEEENEKVFRLLGFAGYLKDWDGPSEGEKPTGYIVITCPENINDEVDAGIVGQ
FT                   TMLLAATEAGFGGCFFGNVKRDELKAQLNIPSELKIVYVIAFGYPKEEVVLEDIPADGD
FT                   IKYYRDENQVHHVPKKRIEDIVL"
FT   gene            617611..619020
FT                   /locus_tag="EUBELI_00606"
FT   CDS_pept        617611..619020
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00606"
FT                   /product="UDP-N-acetylmuramoylalanyl-D-glutamyl-2,
FT                   6-diaminopimelate--D-alanyl-D-alanine ligase"
FT                   /note="Psort-B: Cytoplasmic, score:9.98; COG0770
FT                   UDP-N-acetylmuramyl pentapeptide synthase;
FT                   HMMPfam:IPR000713; HMMPfam:IPR004101; HMMPfam:IPR013221;
FT                   HMMPanther:IPR005863; HMMTigr:IPR005863; K01929
FT                   UDP-N-acetylmuramoylalanyl-D-glutamyl-2,
FT                   6-diaminopimelate--D-alanyl- D-alanine ligase"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00606"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71619"
FT                   /db_xref="GOA:C4Z4D5"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005863"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR035911"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z4D5"
FT                   /protein_id="ACR71619.1"
FT                   /translation="MKGMTLRAMTQAVNGIYHGNGEDYDKEITAITIDSRKVAEGGLFI
FT                   AIKGERSDGHDFIGQCFEKGAACVISEKELPDEEHSYIQVESSLQALKDLALLYRNNLD
FT                   VKVVGITGSVGKTSTKETISSVLSEKYRVLKTLGNFNNEIGLPLTVFRLTEDDEVAVLE
FT                   MGISDFGEMDRLSKIAQPDICVITNIGLCHLENLGTRDGILKAKTEIFNHMNPDGIVIL
FT                   NGDDDKLSTISQVHGKRPLVFGISNKDGVYADNIKSLGLDGTSFTIHGLDTADKYSTFD
FT                   MTVPVPGHHMVYNAMAAALVGSVLGLSSLEIERGVRNLKTIAGRNNIIKENGFTIIDDC
FT                   YNANPVSMKASLDVLDTAIGRKVAILGSMFELGENEKQMHYDVGMYLGTKDIDVLITAG
FT                   DLAAQIAAGTRAYIDTNYNAHGCEVHDFETRDDMLKSIGHILKTGDNILIKASHGMEFS
FT                   KVVEAVKTINT"
FT   gene            619030..619356
FT                   /locus_tag="EUBELI_00607"
FT   CDS_pept        619030..619356
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00607"
FT                   /product="Hypothetical protein"
FT                   /note="Psort-B: Unknown cell location"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00607"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71620"
FT                   /db_xref="InterPro:IPR040984"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z4D6"
FT                   /protein_id="ACR71620.1"
FT                   /translation="MSRVVRRIGIIAVFVLVIGAFAGCGKKESVVGTWEGDDYAYTFNA
FT                   DGTGTQQIGGINVNISSYQAKDGKLSITVTYLGTDDTTEFTYTLKKDVLTLTNGDDTII
FT                   LNKK"
FT   gene            619513..619692
FT                   /locus_tag="EUBELI_00608"
FT   CDS_pept        619513..619692
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00608"
FT                   /product="Hypothetical protein"
FT                   /note="Psort-B: Unknown cell location"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00608"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71621"
FT                   /db_xref="GOA:C4Z4D7"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z4D7"
FT                   /protein_id="ACR71621.1"
FT                   /translation="MHDIIEHYGKVVIALAGVLAAVLLTAAVVTIVTDRTKGAVSDISY
FT                   KEHIYDAIDASKSQ"
FT   gene            619711..620748
FT                   /locus_tag="EUBELI_00609"
FT   CDS_pept        619711..620748
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00609"
FT                   /product="pilus assembly protein CpaF"
FT                   /note="Psort-B: Cytoplasmic, score:8.87; COG0630 Type IV
FT                   secretory pathway, VirB11 components, and related ATPases
FT                   involved in archaeal flagella biosynthesis;
FT                   HMMPfam:IPR001482; BlastProDom:IPR001482; K02283 pilus
FT                   assembly protein CpaF"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00609"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71622"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z4D8"
FT                   /protein_id="ACR71622.1"
FT                   /translation="MEKEQLQQLIENNKDDLFSEIKEEISDESVTDIEWDGYNLWITQL
FT                   GRGCYIAMKELSDRYMDNLSIRLANIMGVPFNRVHPILEANTEILRISIWHESRCGKKS
FT                   MAIRKIPGKLRFGHVDLIQSDYAPESIITLLENCVTAHLSTVIGGQPHAGKTELLKYLA
FT                   TYIPAEEKVGVYEDNQEIHYRQINPHSKCVEFFVDSKISYQDIIKAGLRHNIDWVLLSE
FT                   SRGPEVMELLNSLSTGAYCMTTMHLDDIRDMPDRMYSMLGKGESSERFINSIYKYIDLV
FT                   VLVDCDRFEKRKIRQVGFLSRNHGNNSCTVVFEDGEFKDVDIPEDIKEKFIRFGIDNPY
FT                   VWRHD"
FT   gene            620784..622214
FT                   /locus_tag="EUBELI_00610"
FT   CDS_pept        620784..622214
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00610"
FT                   /product="Hypothetical protein"
FT                   /note="Psort-B: CytoplasmicMembrane, score:9.99"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00610"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71623"
FT                   /db_xref="GOA:C4Z4D9"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z4D9"
FT                   /protein_id="ACR71623.1"
FT                   /translation="MKDIADVNGVMSVKRFIITTIMAGSAVFGACMLYRINYILSLLVM
FT                   VMALLLIPGLVRGYFKERYDAARFSDVDIYLHQISYSFTRTPKINMALRDVYEISSGNL
FT                   KECIGKALEELQYGMGDRVYNDALKIIEEEYDCARIRTLHKFIISVEEKGGRYAGAMDV
FT                   LLEDFDRWVNNVYRYQEEIRKIKRDISVGIIISMVLAMLTTIMCNMLNMFSDKTVSITD
FT                   SVAYQSAAVVFVMLCMSFFTYTRKHYRFDWLGKSRTDKQIMYDYNIVFKSDVWRLTIKL
FT                   LPVWLILIIAMAMLFIFDMKLPAVCMLAIIIVLVSTPFLQKKGAQRRVKNDLYLGFTEW
FT                   LRELSVNLENKPLLSAVEDTYDCCPVIMKEPLEKFICDIENNPSDVMPYYGFLGEFGVI
FT                   DIQAAVRMLYSIGELEQDSMSATINAIVRRNYELSDKAELTRYMDSTSMMRFSEYVPTF
FT                   FVALKMAVDMMLVVTMYL"
FT   gene            622355..622492
FT                   /locus_tag="EUBELI_00611"
FT   CDS_pept        622355..622492
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00611"
FT                   /product="Hypothetical protein"
FT                   /note="Psort-B: Unknown cell location"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00611"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71624"
FT                   /db_xref="GOA:C4Z4E0"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z4E0"
FT                   /protein_id="ACR71624.1"
FT                   /translation="MKEIIEQYADVCVGGLMVIFTTMMLGYAFGIYKDILLEIIKVCLG
FT                   "
FT   gene            622500..622877
FT                   /locus_tag="EUBELI_00612"
FT   CDS_pept        622500..622877
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00612"
FT                   /product="Hypothetical protein"
FT                   /note="Psort-B: Unknown cell location"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00612"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71625"
FT                   /db_xref="GOA:C4Z4E1"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z4E1"
FT                   /protein_id="ACR71625.1"
FT                   /translation="MKGIIEASVYLILFAFICMFSIDFIRINRDVSDAGEVSQYIENYI
FT                   EACCGDGLAEKLTEEQRASKLALLKTSVESNGALLDFGDRMKTGDYEYIEYTFSYKLKA
FT                   AMFAYSSWHQYKGLARYCVTE"
FT   gene            622895..623314
FT                   /locus_tag="EUBELI_00613"
FT   CDS_pept        622895..623314
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00613"
FT                   /product="Hypothetical protein"
FT                   /note="Psort-B: Cytoplasmic, score:8.87"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00613"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71626"
FT                   /db_xref="GOA:C4Z4E2"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z4E2"
FT                   /protein_id="ACR71626.1"
FT                   /translation="MEWRPCLRGVVTCSGFIVVFAIIIITHAVITGNNIRREEVNQSLD
FT                   SAMDYAFDRMGDVYADVNYTVYTDKRKQEILTQLMNEFCRVLCKRIASDGRIQVALIYA
FT                   DMDKGLFQIGVTEEYEYPFGGRTGKCYYEKTYSFN"
FT   gene            623358..623984
FT                   /locus_tag="EUBELI_00614"
FT   CDS_pept        623358..623984
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00614"
FT                   /product="Hypothetical protein"
FT                   /note="Psort-B: CytoplasmicMembrane, score:9.99; COG0671
FT                   Membrane-associated phospholipid phosphatase;
FT                   HMMPfam:IPR000326; HMMSmart:IPR000326;
FT                   superfamily:IPR000326"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00614"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71627"
FT                   /db_xref="GOA:C4Z4E3"
FT                   /db_xref="InterPro:IPR000326"
FT                   /db_xref="InterPro:IPR036938"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z4E3"
FT                   /protein_id="ACR71627.1"
FT                   /translation="MSVLERYDKETIMELQILHWFESLHNPVTDPVMYAITCLGNAGIF
FT                   WILLCAAFLFIPVFKKDRKLGLSMAIGLILSLIMCNGIMKNMSARIRPFNADPTFENLY
FT                   GIFNGIKDWSFPSGHTSASFAAALAIILWDRKKGIPAVILAALIAVSRLYLTVHYPTDV
FT                   LASLLLGSLYGVIGYFVTKLIMNRSEKARKVFSGEEPYRKLFAKA"
FT   gene            624033..624890
FT                   /locus_tag="EUBELI_00615"
FT   CDS_pept        624033..624890
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00615"
FT                   /product="Hypothetical protein"
FT                   /note="Psort-B: CytoplasmicMembrane, score:9.97; NOG06142
FT                   non supervised orthologous group"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00615"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71628"
FT                   /db_xref="GOA:C4Z4E4"
FT                   /db_xref="InterPro:IPR021552"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z4E4"
FT                   /protein_id="ACR71628.1"
FT                   /translation="MMDVVFDTIIDSVKLLPFLFLTYLAMEYLEHKTSARTKKFVKDSG
FT                   KAGPVIGALLGAVPQCGFSTAASNLYAGKVITMGTLIAIFMSTSDEMIPVFLSEQVDVL
FT                   VLVKLILIKVFIGLIMGVAIDLIVRRSKKSYNMVEKIGHVCDHDHCGCETSIFKSALRH
FT                   TITIFAFIVVISFALNTLIHFVGEETLGNLILNKPVIGPLIAGIIGLIPNCASSVVLTQ
FT                   LYIEGVLGLGSLMAGLLAGSGVGILVLFRENDDMKDNFRILAILYVSGVAWGIIIDALS
FT                   KIIL"
FT   gene            625066..625671
FT                   /locus_tag="EUBELI_00616"
FT   CDS_pept        625066..625671
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00616"
FT                   /product="Hypothetical protein"
FT                   /note="Psort-B: Cytoplasmic, score:8.87"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00616"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71629"
FT                   /db_xref="InterPro:IPR032358"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z4E5"
FT                   /protein_id="ACR71629.1"
FT                   /translation="MQSVLDAGFKKYGRVIADIDTSEIVKLMDSYDMPEDVVYVAGDEK
FT                   LENTKIHKIMEESVYGGTPVQTGYCNGHNQKLNALEYHRSSEVNIAATDMILLLGSRED
FT                   VEDDFTYDTSKVEGFFVPEGTAIEVYATTLHYAPCGVDGQGFKCVVVLPKGTNLDVVNT
FT                   HATAEDKLLAASNKWLIAHEDAHIDGAFNGLRGENITV"
FT   gene            625689..627173
FT                   /locus_tag="EUBELI_00617"
FT   CDS_pept        625689..627173
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00617"
FT                   /product="Hypothetical protein"
FT                   /note="Psort-B: Cytoplasmic, score:8.87; COG2407 L-fucose
FT                   isomerase and related proteins; superfamily:IPR009015"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00617"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71630"
FT                   /db_xref="GOA:C4Z4E6"
FT                   /db_xref="InterPro:IPR009015"
FT                   /db_xref="InterPro:IPR015888"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z4E6"
FT                   /protein_id="ACR71630.1"
FT                   /translation="MNNTPVMKIGIVAVSRDCFPESLSVTRRQNLVKAYEAKYGKGDIY
FT                   ECPVCIVESEIHMMQALEDIKNAGCNALCVYLGNFGPEIAETMLAKNFNGPKMFIAAAE
FT                   ETSANGGLVQGRGDAYCGMLNASYNLKLRGVKAYIPEYPVGTAEECADMIHEFIPVAKA
FT                   VYALSNLKIISFGPRPNNFLACNAPIAGLYNLGVEIEENSELDLFESFNKHAGDERIPD
FT                   VVRDMEKELGTGNKKPEILSRLAQYELTLTDWVESHKGSRKYVAVAGKCWPAFQTQFGC
FT                   VPCYVNSRLTSRGIPVSCEVDIYGALSEFIGEVVSDDIVTLLDINNTVPADIYNEDIAG
FT                   RYAYTQKDTFMGFHCGNTASSKLSFCEMRNQMIMARSLPEEVTNGTLEGDIVPGDITFF
FT                   RLQNSSDNKLSAYIAQGEVLPVRTRSFGAIGIFAIPEMGRFYRHVLIEGNFPHHGAVAF
FT                   GHFGKTLFDVFKYIGVEDVSFNQPKGMLYKSENPFA"
FT   gene            627217..628695
FT                   /locus_tag="EUBELI_00618"
FT   CDS_pept        627217..628695
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00618"
FT                   /product="xylulokinase"
FT                   /note="Psort-B: Cytoplasmic, score:8.87; COG1070 Sugar
FT                   (pentulose and hexulose) kinases; HMMPfam:IPR000577;
FT                   HMMPanther:IPR000577; HMMTigr:IPR006000;
FT                   ScanRegExp:IPR000577; K00854 xylulokinase"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00618"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71631"
FT                   /db_xref="GOA:C4Z4E7"
FT                   /db_xref="InterPro:IPR000577"
FT                   /db_xref="InterPro:IPR006000"
FT                   /db_xref="InterPro:IPR018483"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z4E7"
FT                   /protein_id="ACR71631.1"
FT                   /translation="MNYIGIDLGTSSVKLVLMDTAGHIIANVSKSYPIDYPKAGWSEQN
FT                   PYDWYDACMEGMKELLDGQDESTVSGISFGGQMHGLVILDKNDEVIRPAILWNDGRTTK
FT                   QCEYLNEVIGRDKLSEYTANIAFAGFTAPKILWVKENEPDNFAKIDKIMLPKDYIAYRL
FT                   TGVHCTDVSDASGMLLFDVKNRRWSRQMLDICGVTEAQMPRIFESSECVGTVKKDIADE
FT                   LGIGSEVIVAAGAGDNAAAAVGTGTVGDGHCNVSLGTSGTIFISSKEFGVDSNNALHSF
FT                   AHADGKYHLMGCILSAASANGWWMDKILGTNDYAGEQSQITDDDLGNNNVYFLPYLMGE
FT                   RSPHNDEFARGTFTGMTMDTERKDMTQAVLEGVAFAIRDCFEVAKSLGIRVESTRMCGG
FT                   GAKSELWCKIMANVLGIPVELLESEEGPAMGAAMLAMVAAGEYNCVEDASNALVKVRKT
FT                   IRPDEKIIERYEDKYNKFRCIYPAMKNVFRTINE"
FT   gene            628692..629369
FT                   /locus_tag="EUBELI_00619"
FT   CDS_pept        628692..629369
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00619"
FT                   /product="transaldolase"
FT                   /note="Psort-B: Cytoplasmic, score:8.87; COG0176
FT                   Transaldolase; HMMPfam:IPR001585; Gene3D:IPR013785;
FT                   HMMPanther:IPR001585; HMMTigr:IPR004731;
FT                   ScanRegExp:IPR001585; K00616 transaldolase"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00619"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71632"
FT                   /db_xref="GOA:C4Z4E8"
FT                   /db_xref="InterPro:IPR001585"
FT                   /db_xref="InterPro:IPR004731"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018225"
FT                   /db_xref="InterPro:IPR022999"
FT                   /db_xref="InterPro:IPR033919"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z4E8"
FT                   /protein_id="ACR71632.1"
FT                   /translation="MINKENFIMKFFIDTANVEDIRKANDMGVICGVTTNPSLIAKEGR
FT                   DFKEVIKEITSIVDGPISGEVKATTEDAEGMIKEGREIAAIHPNMVVKIPMTVEGLKAT
FT                   KVLSSEGIKVNVTLIFSANQALLAARAGAAYVSPFLGRLDDISQPGINLIQDIADIFAN
FT                   YDLKTEIICASVRNPIHITDCALAGADIATVPYKVIEQMVHHPLTDAGIEKFKKDYIAV
FT                   FGE"
FT   gene            629415..630551
FT                   /locus_tag="EUBELI_00620"
FT   CDS_pept        629415..630551
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00620"
FT                   /product="N-acetylglucosamine repressor"
FT                   /note="Psort-B: Cytoplasmic, score:9.98; COG1940
FT                   Transcriptional regulator/sugar kinase; HMMPfam:IPR000600;
FT                   HMMPfam:IPR001808; HMMSmart:IPR001808; K02565
FT                   N-acetylglucosamine repressor"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00620"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71633"
FT                   /db_xref="GOA:C4Z4E9"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="InterPro:IPR012318"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z4E9"
FT                   /protein_id="ACR71633.1"
FT                   /translation="MDSSQKLTNTDVKKLNKNRIFRLIYNSDKISRQEIADQLGLSLPT
FT                   VNQNLKMLMEDGLIEYVGNFTSTGGRRAQAITIDNNARKAISVNIKADYINVDVVGLKG
FT                   QIIYSMAVKAHFSKSSAYIEKLKDAVRHAVDYVGADADDILGVGITVPGILDDEKQILI
FT                   SAPPLKAKNYDFTKLISAIDYPVVVMNDARAEAYADHWFNGKPEDEKIYIMLGEGVGGA
FT                   YINASAIRNGVHNRGGEFGHMVIHPEGKQCLCGKKGCFEAYVSEKVLSSELDMTLDNFF
FT                   ELAVQGNKNNSNVLDEYMDNLALGINNIYTMMDCDIVLGGTVAPYLKQYENSIKERLVN
FT                   DYSFDTDADYLRISDGGGRKSGLGAALSFVARFIDGVE"
FT   gene            631076..631969
FT                   /locus_tag="EUBELI_00621"
FT   CDS_pept        631076..631969
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00621"
FT                   /product="ABC-2 type transport system ATP-binding protein"
FT                   /note="Psort-B: CytoplasmicMembrane, score:9.49; COG1131
FT                   ABC-type multidrug transport system, ATPase component;
FT                   HMMPfam:IPR003439; BlastProDom:IPR003439;
FT                   HMMSmart:IPR003593; ScanRegExp:IPR001360; K01990 ABC-2 type
FT                   transport system ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00621"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71634"
FT                   /db_xref="GOA:C4Z4F0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z4F0"
FT                   /protein_id="ACR71634.1"
FT                   /translation="MCKTVFWGGRRMISLSGVNKRLGSFRLKDISIEIPDGYICALVGQ
FT                   NASGKTTLIKMILGLCRPDDGTVVIDGLNYQEAESEKRIRDITGIVPVNELMNSELSLL
FT                   ENGRCYGRFYSRYDESIYMEYLERFGLDRKIKFGKLSKGQKIKAQFAFALSTDPKYLIL
FT                   DEPTANFDPDFKQDFLNVIMQFMESGKKSVIIASHILDELDRIADYLIYLDKGELVYSG
FT                   DIESFRDKYRIISGESYKVKLLKQEDIIHVEDRKYGTKALVVNHGYSKYDGALTVTVPT
FT                   LEEFMYHYSKRGESVI"
FT   gene            631966..632619
FT                   /locus_tag="EUBELI_00622"
FT   CDS_pept        631966..632619
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00622"
FT                   /product="Hypothetical protein"
FT                   /note="Psort-B: CytoplasmicMembrane, score:9.99"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00622"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71635"
FT                   /db_xref="GOA:C4Z4F1"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z4F1"
FT                   /protein_id="ACR71635.1"
FT                   /translation="MKYLMRDYIYGWHWENFKASYEHGNSAIFNFLAVQLIFVAQIIKT
FT                   AGWAQLVIASGYFISLAICCLSIFTHPAELRTMYYVCPLTTNEREKLVRNSYIFRVAVH
FT                   MLILTIGNIFMMMAVRFSASVFIYITINAFIISTLLPYGKKDGLLSYVMVLIIICTITD
FT                   CWQFDILMSSFTPIIEERFLYSIMVLIEFPVCIGYARQVKRKLKSAAVYEEVVL"
FT   gene            632616..632996
FT                   /locus_tag="EUBELI_00623"
FT   CDS_pept        632616..632996
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00623"
FT                   /product="GntR family transcriptional regulator"
FT                   /note="Psort-B: Cytoplasmic, score:8.87; COG1725 Predicted
FT                   transcriptional regulators; HMMPfam:IPR000524;
FT                   Gene3D:IPR011991; HMMSmart:IPR000524; K07979 GntR family
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00623"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71636"
FT                   /db_xref="GOA:C4Z4F2"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z4F2"
FT                   /protein_id="ACR71636.1"
FT                   /translation="MSININILPQGTLAIYEQIIMQLKNAIVTGELKSGEALPSIRALA
FT                   ADLQVSVITTKRAYEELEKEGLIRSVAGKGFYVCEYNTDYLKEKQLMMIEKRTQEIIYE
FT                   AKNAGLSCDDLVDMIRTLYEEK"
FT   gene            632999..633658
FT                   /locus_tag="EUBELI_00624"
FT   CDS_pept        632999..633658
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00624"
FT                   /product="ABC-2 type transport system ATP-binding protein"
FT                   /note="Psort-B: CytoplasmicMembrane, score:9.49; COG1131
FT                   ABC-type multidrug transport system, ATPase component;
FT                   HMMPfam:IPR003439; BlastProDom:IPR003439;
FT                   HMMSmart:IPR003593; K01990 ABC-2 type transport system
FT                   ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00624"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71637"
FT                   /db_xref="GOA:C4Z4F3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z4F3"
FT                   /protein_id="ACR71637.1"
FT                   /translation="MENIALTLENVTGKGLGFKLKDISAKFENGYIYAITGKNGAGKTT
FT                   LFNYILAQRKQYTGSIKMSGYELERNHSKAMEIIGFVSEDNVFFENRTGKQNADILGLV
FT                   YDDFDVELFNECMKKMNVSTATTLWRMSRGERMKFQLAFAIAHHSRLYLLDEATAGMDA
FT                   VFKIELFDMLRELIAQECCVIMTTHDMTEIMKNTDYVAVMEGGRLGEFSESIECTV"
FT   gene            633683..634183
FT                   /locus_tag="EUBELI_00625"
FT   CDS_pept        633683..634183
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00625"
FT                   /product="Hypothetical protein"
FT                   /note="Psort-B: CytoplasmicMembrane, score:9.99"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00625"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71638"
FT                   /db_xref="GOA:C4Z4F4"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z4F4"
FT                   /protein_id="ACR71638.1"
FT                   /translation="MTIKTDIKQQKKLEKFFKEENTWFPDNVGEKFLAIFFFIISGILA
FT                   CAPNKMIDFSDLNNDMKVVLIGYMFYLLGVTYMVMKYKSYQEAYSTNRKRITTRELLKN
FT                   MPIDRMQLWIFITKKKIKPCAVMTAIIIAIRIIITLAAYRNIYLSDILMVLVFNLIVPV
FT                   LIA"
FT   gene            complement(634387..635367)
FT                   /locus_tag="EUBELI_00626"
FT   CDS_pept        complement(634387..635367)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00626"
FT                   /product="ribonuclease III"
FT                   /note="Psort-B: Unknown cell location; COG0463
FT                   Glycosyltransferases involved in cell wall biogenesis;
FT                   HMMPfam:IPR001173; K01162 ribonuclease III"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00626"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71639"
FT                   /db_xref="GOA:C4Z4F5"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z4F5"
FT                   /protein_id="ACR71639.1"
FT                   /translation="MSENKKNCLYIVIPCYNEEQVLPVTSGMFLDELNHLIKAGKISSG
FT                   SRIMFVNDGSSDSTWDIITDLSKKDEHFIGISQSRNRGHQSSVLAGLMEASQYADITIS
FT                   IDCDGQDDIHAMEDMVDAYHDGCDIVYGVRNDRSTDTFFKRNTAKGFYKIMAKLGAETV
FT                   YNHADYRLLSKRVINELAQFKETNLYLRGLIPLVGFKSTSVYYSRSERLAGKSHYPFSK
FT                   MLNLALNGITSLSVKPLRLVMSLGIIVSIISFIGVIWAVVDNLLGNTVTGWASTVCIVC
FT                   FMGGIQLMCLGVIGEYIGKIYIEVKNRPRFIISERTYECNEDKNQ"
FT   gene            complement(635387..637108)
FT                   /locus_tag="EUBELI_00627"
FT   CDS_pept        complement(635387..637108)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00627"
FT                   /product="Hypothetical protein"
FT                   /note="Psort-B: CytoplasmicMembrane, score:9.99; NOG14939
FT                   non supervised orthologous group"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00627"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71640"
FT                   /db_xref="GOA:C4Z4F6"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z4F6"
FT                   /protein_id="ACR71640.1"
FT                   /translation="MSKVLYSIYRYTVLGLFLVINIWLFLLSIFSTSKMTTDASEYTYY
FT                   TGDYVWVHLIVLACIAVLTYILVKKKLFIILNRYLTDNDKAFRKVRNICLIIIGITGAV
FT                   WVILTQSHAGADQYYVLDAAAGLRSHDYTMFMRDGYIAKYTNQIGLLFIEYIIGFVVGD
FT                   YNYIFWQLLNVIMIVFTYKMLADLFSIWKLPRLASVLFLVLGILFFPWTLYSVFIYGNI
FT                   AGLFFAVMAFKYTMLFVGASNTDNSIHISYIAVTGAAMMMSVMVKSNYLIFMIALILYT
FT                   IAETLRHKNIQIILVTCAIAAGFAIQAVFPKLIIEKISGYNLDNGASSWTWIDMGLHST
FT                   TATVYADGWYNSRIASLYERNDYDSKKEAQAAKADIKGYINNYKSDPNAFTSFLSKKIA
FT                   SQWNNPGFQCFWITNVRNSSITQSGFITDILSLKGGIPFMNYLNILQSIILFGSMLYAV
FT                   YALFFNSAPVSTVLPLTFIGGFIFHIFWEGKCQYTLPYFVLLLPLSIIGFFYMAKVFID
FT                   FSKKNIYHCAAGLIVLILVTIIFNHFIIINHDNKSYKEYKDYTIKVESGEITETDN"
FT   gene            637239..638426
FT                   /locus_tag="EUBELI_00628"
FT   CDS_pept        637239..638426
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00628"
FT                   /product="aspartate aminotransferase"
FT                   /note="Psort-B: Cytoplasmic, score:8.87; COG0436
FT                   Aspartate/tyrosine/aromatic aminotransferase;
FT                   HMMPfam:IPR004839; Gene3D:IPR015421; Gene3D:IPR015422;
FT                   ScanRegExp:IPR004838; superfamily:IPR015424; K00811
FT                   aspartate aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00628"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71641"
FT                   /db_xref="GOA:C4Z4F7"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z4F7"
FT                   /protein_id="ACR71641.1"
FT                   /translation="MIADSMVSLVKNSSVIRAMFEEGNRLAKLYGAENVYDFSLGNPNV
FT                   PAPAEVNEAVKDIVDNEESTFIHGYMSNAGYEDVRQTIAESLNRRFGTHFNHTNIVMTV
FT                   GAAGGLNTIFKTLLNPGEEVMTFAPFFGEYRNYVSNFGGKLVVVSPNTVDFQPKLDEFE
FT                   AKITPKTRAVIVNNPNNPTGVVYSEDTIKKMAAIMDKKQKEYGTEIYLIADEPYRELAY
FT                   DGVDVPYLTKYYDNTIVGYSYSKSLSLPGERIGYLVIPDEVTDSEDVKSAASVATRILG
FT                   FVNAPSLMQRVVAKCVDAQVNLEAYDKNRKAIYEGLTKLGFECVKPEGAFYLFVKSPVE
FT                   DETVFCEAAKKHNILMVPASSFGCPGYVRIAYCVSYDTIVNSLPHFAEVAKEMGL"
FT   gene            638433..639518
FT                   /locus_tag="EUBELI_00629"
FT   CDS_pept        638433..639518
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00629"
FT                   /product="histidinol-phosphate aminotransferase"
FT                   /note="Psort-B: Cytoplasmic, score:8.87; COG0079
FT                   Histidinol-phosphate/aromatic aminotransferase and cobyric
FT                   acid decarboxylase; HMMPfam:IPR004839; Gene3D:IPR015421;
FT                   Gene3D:IPR015422; HMMTigr:IPR005861; ScanRegExp:IPR001917;
FT                   superfamily:IPR015424; K00817 histidinol-phosphate
FT                   aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00629"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71642"
FT                   /db_xref="GOA:C4Z4F8"
FT                   /db_xref="InterPro:IPR001917"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR005861"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z4F8"
FT                   /protein_id="ACR71642.1"
FT                   /translation="MKEEDLYMKTWEKNIRRVEPYVPGEQPKVKDVVKLNTNENPYPPT
FT                   PKVHEAAERMNISDLRLYPDPEVTDLVHAIAAYYGMNDNQVFVGVGSDDVLSMCFLTFF
FT                   NSDKPILFPNISYSFYSVWADLYRIPYEKQPLDKDFNIIPEDYYKENGGVVFPNPNAPT
FT                   ALYMELDKVEDIIKHNQDVVVIVDEAYIDFGGKSAMELVNKYENVLVVQTFSKSRAMAG
FT                   MRIGYCFGNPELIKALNDVKFSFNSYTMNRTSISYGIESVNDKEYFEECVGKIVKTREN
FT                   AKERLSQLGFSFPDSKANFIFATHKSVSAKEIFEKLKEKNIFVRYFNQPLIDNYLRISI
FT                   GTDEQMEKLYAALEEITGQVK"
FT   gene            639520..640137
FT                   /locus_tag="EUBELI_00630"
FT   CDS_pept        639520..640137
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00630"
FT                   /product="hypothetical protein"
FT                   /note="Psort-B: Cytoplasmic, score:8.87; COG1636
FT                   Uncharacterized protein conserved in bacteria;
FT                   HMMPfam:IPR003828; K09765 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00630"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71643"
FT                   /db_xref="GOA:C4Z4F9"
FT                   /db_xref="InterPro:IPR003828"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z4F9"
FT                   /protein_id="ACR71643.1"
FT                   /translation="MGIPFEQRNFQKELDKKIAGFQKDGIVPTLLLHSCCAPCSSHCIE
FT                   YLSDYFHITVFYYNPNISVEEEYRKRVEEQKRFISEFPAKYKVSFIEGDYDTKEFYDIA
FT                   KGYEQCREGGERCFRCYELRLRKTCKTAKAGGFDYFTTTLTISPLKNSVKLNEIGLKLS
FT                   EEYDMPYLLSDFKKKEGYKRSIELSHEYNLYRQNYCGCVYSR"
FT   gene            640203..641003
FT                   /locus_tag="EUBELI_00631"
FT   CDS_pept        640203..641003
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBELI_00631"
FT                   /product="Hypothetical protein"
FT                   /note="Psort-B: Unknown cell location; COG0419 ATPase
FT                   involved in DNA repair"
FT                   /db_xref="EnsemblGenomes-Gn:EUBELI_00631"
FT                   /db_xref="EnsemblGenomes-Tr:ACR71644"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z4G0"
FT                   /protein_id="ACR71644.1"
FT                   /translation="MCEQGGFNTMAKKHGLAKVVLGVGAAAVAGKVAFDKFKQTKERFA
FT                   KEENDSFDDEIRKYNAIGEKKVIEVEDEVFAGCELKAVASKTVLDLGLAVFEKDVYINF
FT                   SSNASSVTIILPEGVNATCDISRKIAGVKNLVDNVDEEGIHTVYIIGKAVCSNVEVIPV
FT                   NFYVDEEDEEDSDFVEEDDCLASDDDFDDDVIFDEKDGDVEVEVKVINGKVSDNEQKKP
FT                   EASETNTDKEEAEETEKEEAEETEKEEAAADDTEETETIDIEEV"
FT   gene            641027..641707
FT                   /locus_tag="EUBELI_00632"
FT   CDS_pept        641027..641707
FT                   /codon_start=1
FT                   /transl_table=11
FT