(data stored in SCRATCH zone)

EMBL: CP001107

ID   CP001107; SV 1; circular; genomic DNA; STD; PRO; 3449685 BP.
XX
AC   CP001107;
XX
PR   Project:PRJNA29071;
XX
DT   05-JUN-2009 (Rel. 101, Created)
DT   30-AUG-2017 (Rel. 134, Last updated, Version 3)
XX
DE   [Eubacterium rectale] ATCC 33656 chromosome, complete genome.
XX
KW   .
XX
OS   [Eubacterium] rectale ATCC 33656
OC   Bacteria; Firmicutes; Clostridia; Clostridiales; Lachnospiraceae.
XX
RN   [1]
RP   1-3449685
RX   DOI; 10.1073/pnas.0901529106.
RX   PUBMED; 19321416.
RA   Mahowald M.A., Rey F.E., Seedorf H., Turnbaugh P.J., Fulton R.S.,
RA   Wollam A., Shah N., Wang C., Magrini V., Wilson R.K., Cantarel B.L.,
RA   Coutinho P.M., Henrissat B., Crock L.W., Russell A., Verberkmoes N.C.,
RA   Hettich R.L., Gordon J.I.;
RT   "Characterizing a model human gut microbiota composed of members of its two
RT   dominant bacterial phyla";
RL   Proc. Natl. Acad. Sci. U.S.A. 106(14):5859-5864(2009).
XX
RN   [2]
RP   1-3449685
RA   Mahowald M.A., Henrissat B., Coutinho P.M., Cantarel B.L., Wollam A.,
RA   Fulton R.S., Fulton L.A., Wilson R.K., Gordon J.I.;
RT   ;
RL   Submitted (18-JUN-2008) to the INSDC.
RL   Center for Genome Science, Washington University in St. Louis, 4444 Forest
RL   Park Ave., St. Louis, MO 63108, USA
XX
DR   MD5; d8bfc78d2ca0be51d1dd0bf2c0619c67.
DR   BioSample; SAMN02603082.
DR   EnsemblGenomes-Gn; EBG00001018739.
DR   EnsemblGenomes-Gn; EBG00001018740.
DR   EnsemblGenomes-Gn; EBG00001018741.
DR   EnsemblGenomes-Gn; EBG00001018742.
DR   EnsemblGenomes-Gn; EBG00001018743.
DR   EnsemblGenomes-Gn; EBG00001018744.
DR   EnsemblGenomes-Gn; EBG00001018745.
DR   EnsemblGenomes-Gn; EBG00001018746.
DR   EnsemblGenomes-Gn; EBG00001018747.
DR   EnsemblGenomes-Gn; EBG00001018748.
DR   EnsemblGenomes-Gn; EBG00001018749.
DR   EnsemblGenomes-Gn; EBG00001018750.
DR   EnsemblGenomes-Gn; EBG00001018751.
DR   EnsemblGenomes-Gn; EBG00001018752.
DR   EnsemblGenomes-Gn; EBG00001018753.
DR   EnsemblGenomes-Gn; EBG00001018754.
DR   EnsemblGenomes-Gn; EBG00001018755.
DR   EnsemblGenomes-Gn; EBG00001018756.
DR   EnsemblGenomes-Gn; EBG00001018757.
DR   EnsemblGenomes-Gn; EBG00001018758.
DR   EnsemblGenomes-Gn; EBG00001018759.
DR   EnsemblGenomes-Gn; EBG00001018760.
DR   EnsemblGenomes-Gn; EBG00001018761.
DR   EnsemblGenomes-Gn; EBG00001018762.
DR   EnsemblGenomes-Gn; EBG00001018763.
DR   EnsemblGenomes-Gn; EBG00001018764.
DR   EnsemblGenomes-Gn; EBG00001018765.
DR   EnsemblGenomes-Gn; EBG00001018766.
DR   EnsemblGenomes-Gn; EBG00001018767.
DR   EnsemblGenomes-Gn; EBG00001018768.
DR   EnsemblGenomes-Gn; EBG00001018769.
DR   EnsemblGenomes-Gn; EBG00001018770.
DR   EnsemblGenomes-Gn; EBG00001018771.
DR   EnsemblGenomes-Gn; EBG00001018772.
DR   EnsemblGenomes-Gn; EBG00001018773.
DR   EnsemblGenomes-Gn; EBG00001018774.
DR   EnsemblGenomes-Gn; EBG00001018775.
DR   EnsemblGenomes-Gn; EBG00001018776.
DR   EnsemblGenomes-Gn; EBG00001018777.
DR   EnsemblGenomes-Gn; EBG00001018778.
DR   EnsemblGenomes-Gn; EBG00001018779.
DR   EnsemblGenomes-Gn; EBG00001018780.
DR   EnsemblGenomes-Gn; EBG00001018781.
DR   EnsemblGenomes-Gn; EBG00001018782.
DR   EnsemblGenomes-Gn; EBG00001018783.
DR   EnsemblGenomes-Gn; EBG00001018784.
DR   EnsemblGenomes-Gn; EBG00001018785.
DR   EnsemblGenomes-Gn; EBG00001018786.
DR   EnsemblGenomes-Gn; EBG00001018787.
DR   EnsemblGenomes-Gn; EBG00001018788.
DR   EnsemblGenomes-Gn; EBG00001018789.
DR   EnsemblGenomes-Gn; EBG00001018790.
DR   EnsemblGenomes-Gn; EBG00001018791.
DR   EnsemblGenomes-Gn; EBG00001018792.
DR   EnsemblGenomes-Gn; EBG00001018793.
DR   EnsemblGenomes-Gn; EBG00001018794.
DR   EnsemblGenomes-Gn; EBG00001018795.
DR   EnsemblGenomes-Gn; EBG00001018796.
DR   EnsemblGenomes-Gn; EBG00001018797.
DR   EnsemblGenomes-Gn; EBG00001018798.
DR   EnsemblGenomes-Gn; EBG00001018799.
DR   EnsemblGenomes-Gn; EBG00001018800.
DR   EnsemblGenomes-Gn; EBG00001018801.
DR   EnsemblGenomes-Gn; EBG00001018802.
DR   EnsemblGenomes-Gn; EBG00001018803.
DR   EnsemblGenomes-Gn; EBG00001018804.
DR   EnsemblGenomes-Gn; EBG00001018805.
DR   EnsemblGenomes-Gn; EBG00001018806.
DR   EnsemblGenomes-Gn; EBG00001018807.
DR   EnsemblGenomes-Gn; EBG00001018808.
DR   EnsemblGenomes-Gn; EBG00001018809.
DR   EnsemblGenomes-Gn; EBG00001018810.
DR   EnsemblGenomes-Gn; EBG00001018811.
DR   EnsemblGenomes-Gn; EBG00001018812.
DR   EnsemblGenomes-Gn; EBG00001018813.
DR   EnsemblGenomes-Gn; EBG00001018814.
DR   EnsemblGenomes-Gn; EBG00001018815.
DR   EnsemblGenomes-Gn; EBG00001018816.
DR   EnsemblGenomes-Gn; EBG00001018817.
DR   EnsemblGenomes-Gn; EBG00001018818.
DR   EnsemblGenomes-Gn; EBG00001018819.
DR   EnsemblGenomes-Gn; EBG00001018820.
DR   EnsemblGenomes-Gn; EBG00001018821.
DR   EnsemblGenomes-Gn; EBG00001018822.
DR   EnsemblGenomes-Gn; EBG00001018823.
DR   EnsemblGenomes-Gn; EBG00001018824.
DR   EnsemblGenomes-Gn; EBG00001018825.
DR   EnsemblGenomes-Gn; EBG00001018826.
DR   EnsemblGenomes-Gn; EBG00001018827.
DR   EnsemblGenomes-Gn; EBG00001018828.
DR   EnsemblGenomes-Gn; EBG00001018829.
DR   EnsemblGenomes-Gn; EBG00001018830.
DR   EnsemblGenomes-Gn; EUBREC_0010.
DR   EnsemblGenomes-Gn; EUBREC_0011.
DR   EnsemblGenomes-Gn; EUBREC_0012.
DR   EnsemblGenomes-Gn; EUBREC_0013.
DR   EnsemblGenomes-Gn; EUBREC_0014.
DR   EnsemblGenomes-Gn; EUBREC_0015.
DR   EnsemblGenomes-Gn; EUBREC_0305.
DR   EnsemblGenomes-Gn; EUBREC_0338.
DR   EnsemblGenomes-Gn; EUBREC_0339.
DR   EnsemblGenomes-Gn; EUBREC_0340.
DR   EnsemblGenomes-Gn; EUBREC_0341.
DR   EnsemblGenomes-Gn; EUBREC_0342.
DR   EnsemblGenomes-Gn; EUBREC_0343.
DR   EnsemblGenomes-Gn; EUBREC_0344.
DR   EnsemblGenomes-Gn; EUBREC_0345.
DR   EnsemblGenomes-Gn; EUBREC_0346.
DR   EnsemblGenomes-Gn; EUBREC_0347.
DR   EnsemblGenomes-Gn; EUBREC_0348.
DR   EnsemblGenomes-Gn; EUBREC_0349.
DR   EnsemblGenomes-Gn; EUBREC_0537.
DR   EnsemblGenomes-Gn; EUBREC_0611.
DR   EnsemblGenomes-Gn; EUBREC_0678.
DR   EnsemblGenomes-Gn; EUBREC_0679.
DR   EnsemblGenomes-Gn; EUBREC_0705.
DR   EnsemblGenomes-Gn; EUBREC_0806.
DR   EnsemblGenomes-Gn; EUBREC_0844.
DR   EnsemblGenomes-Gn; EUBREC_0845.
DR   EnsemblGenomes-Gn; EUBREC_0846.
DR   EnsemblGenomes-Gn; EUBREC_0847.
DR   EnsemblGenomes-Gn; EUBREC_0848.
DR   EnsemblGenomes-Gn; EUBREC_0849.
DR   EnsemblGenomes-Gn; EUBREC_0850.
DR   EnsemblGenomes-Gn; EUBREC_0851.
DR   EnsemblGenomes-Gn; EUBREC_0852.
DR   EnsemblGenomes-Gn; EUBREC_0853.
DR   EnsemblGenomes-Gn; EUBREC_0854.
DR   EnsemblGenomes-Gn; EUBREC_0855.
DR   EnsemblGenomes-Gn; EUBREC_0856.
DR   EnsemblGenomes-Gn; EUBREC_0913.
DR   EnsemblGenomes-Gn; EUBREC_0914.
DR   EnsemblGenomes-Gn; EUBREC_0915.
DR   EnsemblGenomes-Gn; EUBREC_0916.
DR   EnsemblGenomes-Gn; EUBREC_0917.
DR   EnsemblGenomes-Gn; EUBREC_0918.
DR   EnsemblGenomes-Gn; EUBREC_0971.
DR   EnsemblGenomes-Gn; EUBREC_0974.
DR   EnsemblGenomes-Gn; EUBREC_1188.
DR   EnsemblGenomes-Gn; EUBREC_1189.
DR   EnsemblGenomes-Gn; EUBREC_1416.
DR   EnsemblGenomes-Gn; EUBREC_1437.
DR   EnsemblGenomes-Gn; EUBREC_1438.
DR   EnsemblGenomes-Gn; EUBREC_1439.
DR   EnsemblGenomes-Gn; EUBREC_1440.
DR   EnsemblGenomes-Gn; EUBREC_1455.
DR   EnsemblGenomes-Gn; EUBREC_1540.
DR   EnsemblGenomes-Gn; EUBREC_1542.
DR   EnsemblGenomes-Gn; EUBREC_1543.
DR   EnsemblGenomes-Gn; EUBREC_1544.
DR   EnsemblGenomes-Gn; EUBREC_1545.
DR   EnsemblGenomes-Gn; EUBREC_1546.
DR   EnsemblGenomes-Gn; EUBREC_1547.
DR   EnsemblGenomes-Gn; EUBREC_1548.
DR   EnsemblGenomes-Gn; EUBREC_1552.
DR   EnsemblGenomes-Gn; EUBREC_1948.
DR   EnsemblGenomes-Gn; EUBREC_2160.
DR   EnsemblGenomes-Gn; EUBREC_2221.
DR   EnsemblGenomes-Gn; EUBREC_2299.
DR   EnsemblGenomes-Gn; EUBREC_2300.
DR   EnsemblGenomes-Gn; EUBREC_2301.
DR   EnsemblGenomes-Gn; EUBREC_2302.
DR   EnsemblGenomes-Gn; EUBREC_2354.
DR   EnsemblGenomes-Gn; EUBREC_2363.
DR   EnsemblGenomes-Gn; EUBREC_2690.
DR   EnsemblGenomes-Gn; EUBREC_2807.
DR   EnsemblGenomes-Gn; EUBREC_2961.
DR   EnsemblGenomes-Gn; EUBREC_3284.
DR   EnsemblGenomes-Gn; EUBREC_3694.
DR   EnsemblGenomes-Tr; EBT00001621762.
DR   EnsemblGenomes-Tr; EBT00001621763.
DR   EnsemblGenomes-Tr; EBT00001621764.
DR   EnsemblGenomes-Tr; EBT00001621765.
DR   EnsemblGenomes-Tr; EBT00001621766.
DR   EnsemblGenomes-Tr; EBT00001621767.
DR   EnsemblGenomes-Tr; EBT00001621768.
DR   EnsemblGenomes-Tr; EBT00001621769.
DR   EnsemblGenomes-Tr; EBT00001621770.
DR   EnsemblGenomes-Tr; EBT00001621771.
DR   EnsemblGenomes-Tr; EBT00001621772.
DR   EnsemblGenomes-Tr; EBT00001621773.
DR   EnsemblGenomes-Tr; EBT00001621774.
DR   EnsemblGenomes-Tr; EBT00001621775.
DR   EnsemblGenomes-Tr; EBT00001621776.
DR   EnsemblGenomes-Tr; EBT00001621777.
DR   EnsemblGenomes-Tr; EBT00001621778.
DR   EnsemblGenomes-Tr; EBT00001621779.
DR   EnsemblGenomes-Tr; EBT00001621780.
DR   EnsemblGenomes-Tr; EBT00001621781.
DR   EnsemblGenomes-Tr; EBT00001621782.
DR   EnsemblGenomes-Tr; EBT00001621783.
DR   EnsemblGenomes-Tr; EBT00001621784.
DR   EnsemblGenomes-Tr; EBT00001621785.
DR   EnsemblGenomes-Tr; EBT00001621786.
DR   EnsemblGenomes-Tr; EBT00001621787.
DR   EnsemblGenomes-Tr; EBT00001621788.
DR   EnsemblGenomes-Tr; EBT00001621789.
DR   EnsemblGenomes-Tr; EBT00001621790.
DR   EnsemblGenomes-Tr; EBT00001621791.
DR   EnsemblGenomes-Tr; EBT00001621792.
DR   EnsemblGenomes-Tr; EBT00001621793.
DR   EnsemblGenomes-Tr; EBT00001621794.
DR   EnsemblGenomes-Tr; EBT00001621795.
DR   EnsemblGenomes-Tr; EBT00001621796.
DR   EnsemblGenomes-Tr; EBT00001621797.
DR   EnsemblGenomes-Tr; EBT00001621798.
DR   EnsemblGenomes-Tr; EBT00001621799.
DR   EnsemblGenomes-Tr; EBT00001621800.
DR   EnsemblGenomes-Tr; EBT00001621801.
DR   EnsemblGenomes-Tr; EBT00001621802.
DR   EnsemblGenomes-Tr; EBT00001621803.
DR   EnsemblGenomes-Tr; EBT00001621804.
DR   EnsemblGenomes-Tr; EBT00001621805.
DR   EnsemblGenomes-Tr; EBT00001621806.
DR   EnsemblGenomes-Tr; EBT00001621807.
DR   EnsemblGenomes-Tr; EBT00001621808.
DR   EnsemblGenomes-Tr; EBT00001621809.
DR   EnsemblGenomes-Tr; EBT00001621810.
DR   EnsemblGenomes-Tr; EBT00001621811.
DR   EnsemblGenomes-Tr; EBT00001621812.
DR   EnsemblGenomes-Tr; EBT00001621813.
DR   EnsemblGenomes-Tr; EBT00001621814.
DR   EnsemblGenomes-Tr; EBT00001621815.
DR   EnsemblGenomes-Tr; EBT00001621816.
DR   EnsemblGenomes-Tr; EBT00001621817.
DR   EnsemblGenomes-Tr; EBT00001621818.
DR   EnsemblGenomes-Tr; EBT00001621819.
DR   EnsemblGenomes-Tr; EBT00001621820.
DR   EnsemblGenomes-Tr; EBT00001621821.
DR   EnsemblGenomes-Tr; EBT00001621822.
DR   EnsemblGenomes-Tr; EBT00001621823.
DR   EnsemblGenomes-Tr; EBT00001621824.
DR   EnsemblGenomes-Tr; EBT00001621825.
DR   EnsemblGenomes-Tr; EBT00001621826.
DR   EnsemblGenomes-Tr; EBT00001621827.
DR   EnsemblGenomes-Tr; EBT00001621828.
DR   EnsemblGenomes-Tr; EBT00001621829.
DR   EnsemblGenomes-Tr; EBT00001621830.
DR   EnsemblGenomes-Tr; EBT00001621831.
DR   EnsemblGenomes-Tr; EBT00001621832.
DR   EnsemblGenomes-Tr; EBT00001621833.
DR   EnsemblGenomes-Tr; EBT00001621834.
DR   EnsemblGenomes-Tr; EBT00001621835.
DR   EnsemblGenomes-Tr; EBT00001621836.
DR   EnsemblGenomes-Tr; EBT00001621837.
DR   EnsemblGenomes-Tr; EBT00001621838.
DR   EnsemblGenomes-Tr; EBT00001621839.
DR   EnsemblGenomes-Tr; EBT00001621840.
DR   EnsemblGenomes-Tr; EBT00001621841.
DR   EnsemblGenomes-Tr; EBT00001621842.
DR   EnsemblGenomes-Tr; EBT00001621843.
DR   EnsemblGenomes-Tr; EBT00001621844.
DR   EnsemblGenomes-Tr; EBT00001621845.
DR   EnsemblGenomes-Tr; EBT00001621846.
DR   EnsemblGenomes-Tr; EBT00001621847.
DR   EnsemblGenomes-Tr; EBT00001621848.
DR   EnsemblGenomes-Tr; EBT00001621849.
DR   EnsemblGenomes-Tr; EBT00001621850.
DR   EnsemblGenomes-Tr; EBT00001621851.
DR   EnsemblGenomes-Tr; EBT00001621852.
DR   EnsemblGenomes-Tr; EBT00001621853.
DR   EnsemblGenomes-Tr; EUBREC_0010-1.
DR   EnsemblGenomes-Tr; EUBREC_0011-1.
DR   EnsemblGenomes-Tr; EUBREC_0012-1.
DR   EnsemblGenomes-Tr; EUBREC_0013-1.
DR   EnsemblGenomes-Tr; EUBREC_0014-1.
DR   EnsemblGenomes-Tr; EUBREC_0015-1.
DR   EnsemblGenomes-Tr; EUBREC_0305-1.
DR   EnsemblGenomes-Tr; EUBREC_0338-1.
DR   EnsemblGenomes-Tr; EUBREC_0339-1.
DR   EnsemblGenomes-Tr; EUBREC_0340-1.
DR   EnsemblGenomes-Tr; EUBREC_0341-1.
DR   EnsemblGenomes-Tr; EUBREC_0342-1.
DR   EnsemblGenomes-Tr; EUBREC_0343-1.
DR   EnsemblGenomes-Tr; EUBREC_0344-1.
DR   EnsemblGenomes-Tr; EUBREC_0345-1.
DR   EnsemblGenomes-Tr; EUBREC_0346-1.
DR   EnsemblGenomes-Tr; EUBREC_0347-1.
DR   EnsemblGenomes-Tr; EUBREC_0348-1.
DR   EnsemblGenomes-Tr; EUBREC_0349-1.
DR   EnsemblGenomes-Tr; EUBREC_0537-1.
DR   EnsemblGenomes-Tr; EUBREC_0611-1.
DR   EnsemblGenomes-Tr; EUBREC_0678-1.
DR   EnsemblGenomes-Tr; EUBREC_0679-1.
DR   EnsemblGenomes-Tr; EUBREC_0705-1.
DR   EnsemblGenomes-Tr; EUBREC_0806-1.
DR   EnsemblGenomes-Tr; EUBREC_0844-1.
DR   EnsemblGenomes-Tr; EUBREC_0845-1.
DR   EnsemblGenomes-Tr; EUBREC_0846-1.
DR   EnsemblGenomes-Tr; EUBREC_0847-1.
DR   EnsemblGenomes-Tr; EUBREC_0848-1.
DR   EnsemblGenomes-Tr; EUBREC_0849-1.
DR   EnsemblGenomes-Tr; EUBREC_0850-1.
DR   EnsemblGenomes-Tr; EUBREC_0851-1.
DR   EnsemblGenomes-Tr; EUBREC_0852-1.
DR   EnsemblGenomes-Tr; EUBREC_0853-1.
DR   EnsemblGenomes-Tr; EUBREC_0854-1.
DR   EnsemblGenomes-Tr; EUBREC_0855-1.
DR   EnsemblGenomes-Tr; EUBREC_0856-1.
DR   EnsemblGenomes-Tr; EUBREC_0913-1.
DR   EnsemblGenomes-Tr; EUBREC_0914-1.
DR   EnsemblGenomes-Tr; EUBREC_0915-1.
DR   EnsemblGenomes-Tr; EUBREC_0916-1.
DR   EnsemblGenomes-Tr; EUBREC_0917-1.
DR   EnsemblGenomes-Tr; EUBREC_0918-1.
DR   EnsemblGenomes-Tr; EUBREC_0971-1.
DR   EnsemblGenomes-Tr; EUBREC_0974-1.
DR   EnsemblGenomes-Tr; EUBREC_1188-1.
DR   EnsemblGenomes-Tr; EUBREC_1189-1.
DR   EnsemblGenomes-Tr; EUBREC_1416-1.
DR   EnsemblGenomes-Tr; EUBREC_1437-1.
DR   EnsemblGenomes-Tr; EUBREC_1438-1.
DR   EnsemblGenomes-Tr; EUBREC_1439-1.
DR   EnsemblGenomes-Tr; EUBREC_1440-1.
DR   EnsemblGenomes-Tr; EUBREC_1455-1.
DR   EnsemblGenomes-Tr; EUBREC_1540-1.
DR   EnsemblGenomes-Tr; EUBREC_1542-1.
DR   EnsemblGenomes-Tr; EUBREC_1543-1.
DR   EnsemblGenomes-Tr; EUBREC_1544-1.
DR   EnsemblGenomes-Tr; EUBREC_1545-1.
DR   EnsemblGenomes-Tr; EUBREC_1546-1.
DR   EnsemblGenomes-Tr; EUBREC_1547-1.
DR   EnsemblGenomes-Tr; EUBREC_1548-1.
DR   EnsemblGenomes-Tr; EUBREC_1552-1.
DR   EnsemblGenomes-Tr; EUBREC_1948-1.
DR   EnsemblGenomes-Tr; EUBREC_2160-1.
DR   EnsemblGenomes-Tr; EUBREC_2221-1.
DR   EnsemblGenomes-Tr; EUBREC_2299-1.
DR   EnsemblGenomes-Tr; EUBREC_2300-1.
DR   EnsemblGenomes-Tr; EUBREC_2301-1.
DR   EnsemblGenomes-Tr; EUBREC_2302-1.
DR   EnsemblGenomes-Tr; EUBREC_2354-1.
DR   EnsemblGenomes-Tr; EUBREC_2363-1.
DR   EnsemblGenomes-Tr; EUBREC_2690-1.
DR   EnsemblGenomes-Tr; EUBREC_2807-1.
DR   EnsemblGenomes-Tr; EUBREC_2961-1.
DR   EnsemblGenomes-Tr; EUBREC_3284-1.
DR   EnsemblGenomes-Tr; EUBREC_3694-1.
DR   EuropePMC; PMC2660063; 19321416.
DR   EuropePMC; PMC3187458; 21914882.
DR   EuropePMC; PMC3584212; 23239474.
DR   EuropePMC; PMC6299973; 30567498.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00029; Intron_gpII.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00162; SAM.
DR   RFAM; RF00168; Lysine.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00230; T-box.
DR   RFAM; RF00557; L10_leader.
DR   RFAM; RF01051; c-di-GMP-I.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01699; Clostridiales-1.
DR   RFAM; RF01731; TwoAYGGAY.
DR   RFAM; RF01750; pfl.
DR   RFAM; RF01831; THF.
DR   RFAM; RF01854; Bacteria_large_SRP.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   RFAM; RF01998; group-II-D1D4-1.
DR   RFAM; RF02001; group-II-D1D4-3.
DR   RFAM; RF02012; group-II-D1D4-7.
DR   SILVA-LSU; CP001107.
DR   SILVA-SSU; CP001107.
DR   StrainInfo; 109588; 1.
XX
CC   This genome was sequenced by the Genome Sequencing Center,
CC   Washington University School of Medicine, Washington University in
CC   St. Louis.
CC   Source DNA is available from Jeffrey I. Gordon, jgordon@wustl.edu.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3449685
FT                   /organism="[Eubacterium] rectale ATCC 33656"
FT                   /strain="ATCC 33656"
FT                   /mol_type="genomic DNA"
FT                   /note="type strain of Eubacterium rectale"
FT                   /db_xref="taxon:515619"
FT                   /culture_collection="ATCC:33656"
FT                   /type_material="type strain of [Eubacterium] rectale"
FT   gene            1..1362
FT                   /locus_tag="EUBREC_0001"
FT   CDS_pept        1..1362
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0001"
FT                   /product="chromosomal replication initiation protein"
FT                   /note="Cytoplasmic, score:9.98; COG0593 ATPase involved in
FT                   DNA replication initiation; KEGG:K02313 chromosomal
FT                   replication initiation protein; HMMPfam:IPR013159;
FT                   HMMPfam:IPR013317; FPrintScan:IPR001957;
FT                   HMMSmart:IPR003593; HMMSmart:IPR013159; HMMTigr:IPR001957;
FT                   ScanRegExp:IPR001957; superfamily:IPR010921"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ACR73812"
FT                   /db_xref="GOA:C4Z937"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z937"
FT                   /protein_id="ACR73812.1"
FT                   /translation="MDKVMEKWNEILQMVKEEHGLTDVSFNTWIKPLEVFAIDGNTLYI
FT                   LVPSEQMGLSYINKKYYLPLKVAIGEVTGIEYDIQFILPDQAQSLKFKNNDTPQLEQQT
FT                   PVKGDHSNLNPNYTFDTFVVGNNNRFAHSASLAVAESPGEAYNPLYIYGGPGLGKTHLM
FT                   HSIGHFIIDQNPDTKVLYVTSEEFTNEVIESIRNGNSSAMTKFRDKYRTVDVLMIDDIQ
FT                   FIIGKESTQEEFFHTFNTLQTQGKQIILTSDKPPKEMETLEERIRSRFEWGLMADIGTP
FT                   DYETRMAILRKKAETDNFDIDDDILNYIASNISSNIRELEGALNKLLAFHNLEHTHITM
FT                   DIAERELSNIITPDKPREITAQLIIEVVSEHFHISVDQMISKTRSSEIARPRQIAMYLC
FT                   KTMTSDSLDVIGQLLGGRDHSTIIHGIKKVTKDYEENDSTRTLIETIKKKINPN"
FT   gene            1648..2760
FT                   /locus_tag="EUBREC_0002"
FT   CDS_pept        1648..2760
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0002"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /note="Cytoplasmic, score:8.87; COG0592 DNA polymerase
FT                   sliding clamp subunit (PCNA homolog); KEGG:K00961 DNA
FT                   polymerase III, beta subunit HMMPfam:IPR001001;
FT                   Gene3D:IPR001001; HMMSmart:IPR001001; HMMTigr:IPR001001"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ACR73813"
FT                   /db_xref="GOA:C4Z938"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="PDB:3T0P"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z938"
FT                   /protein_id="ACR73813.1"
FT                   /translation="MKLICSKANLLKGVNIVSKAVPTRTTMAILECILIDASANEIKLM
FT                   ANDMELGIETIIDGTIEERGIIALDAKIFSEIVRKLPDNDVTIETDASFKTVISCEKAK
FT                   FNIIGKSGDDFSYIPYVERNESIVLSQFTLKEVIRQTIFSIADNDNNKLMTGELFEIEE
FT                   NKLRVVSLDGHRISIRYIEMKNHYDSKKVVVPGKTLQEISKIIPGSADEDVVIYITNNH
FT                   IVFEFENTTVVSRLIEGEYFKIDQMLSSDYDTKVRINKRELLDCIDRATLLVKEGDKKP
FT                   IIMNITDGNMELRINSFIGSMNEDIDIDKDGKDIMIGFNPKFFIDALRVIDEEEVNLYM
FT                   VNPKAPCFIKDDEGKFIYLILPVNFNTAAN"
FT   gene            2769..2984
FT                   /locus_tag="EUBREC_0003"
FT   CDS_pept        2769..2984
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0003"
FT                   /product="Hypothetical protein"
FT                   /note="Unknown cell location; COG2501 Uncharacterized
FT                   conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ACR73814"
FT                   /db_xref="GOA:C4Z939"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z939"
FT                   /protein_id="ACR73814.1"
FT                   /translation="MKQISIREQDEFIKLGQALKKADLVSSGVEAKIVIQDGQVTVNGE
FT                   TELQRGKKLHDGDVFSYDGETVKVVK"
FT   gene            2984..4072
FT                   /locus_tag="EUBREC_0004"
FT   CDS_pept        2984..4072
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0004"
FT                   /product="DNA replication and repair protein RecF"
FT                   /note="Cytoplasmic, score:8.87; COG1195 Recombinational DNA
FT                   repair ATPase (RecF pathway); KEGG:K03629 DNA replication
FT                   and repair protein RecF; HMMPfam:IPR003395;
FT                   HMMTigr:IPR001238; ScanRegExp:IPR001238"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ACR73815"
FT                   /db_xref="GOA:C4Z940"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4Z940"
FT                   /protein_id="ACR73815.1"
FT                   /translation="MIIKSIQLSNFRNYEKLDISFDTETNIIYGDNAQGKTNILEAAYL
FT                   SGTTKSHKGSKDKEMIRFGEDEAHIRTIVEKNDKEYRIDMHLRKNGAKGVAINKMPIKK
FT                   ASELFGILNIVFFSPEDLNIIKNGPAERRRFIDLELCQLDKIYLSNLSKYNKTLVQRNR
FT                   LLKDIAYRPDLIDTLQVWDMQLLEYGRHVIKKRREFVNELNEIIQDIHSNISGGREKLI
FT                   LKYEPSIDDIFFEDELLKARSRDLKLCQTTVGPHRDDMLFSVDGVDIRKYGSQGQQRTS
FT                   ALSLKLSEISLVKKNINSTPVLLLDDVLSELDGNRQNYLLNSLSDTQTIITCTGLDEFV
FT                   KNRFQVDKVFHVVKGQVEVIDE"
FT   gene            4065..6002
FT                   /locus_tag="EUBREC_0005"
FT   CDS_pept        4065..6002
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0005"
FT                   /product="DNA gyrase, B subunit"
FT                   /note="Cytoplasmic, score:8.87; COG0187 Type IIA
FT                   topoisomerase (DNA gyrase/topo II, topoisomerase IV), B
FT                   subunit; KEGG:K02470 DNA gyrase, B subunit
FT                   HMMPfam:IPR002288; HMMPfam:IPR003594; HMMPfam:IPR006171;
FT                   HMMPfam:IPR013506; BlastProDom:IPR011558;
FT                   FPrintScan:IPR000565; FPrintScan:IPR001241;
FT                   Gene3D:IPR003594; Gene3D:IPR013759; Gene3D:IPR014721;
FT                   HMMSmart:IPR001241; HMMSmart:IPR003594; HMMTigr:IPR011557;
FT                   ScanRegExp:IPR001241; superfamily:IPR003594;
FT                   superfamily:IPR013760"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ACR73816"
FT                   /db_xref="GOA:C4Z941"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR034160"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z941"
FT                   /protein_id="ACR73816.1"
FT                   /translation="MSKEIQQNNQEYGADQIQILEGLEAVRKRPGMYIGSTSSRGLHHL
FT                   VYEIVDNAVDEALAGYCKNIEVTIEEDNSITVQDDGRGIPVGTNHKAKKSALEVVFTVL
FT                   HAGGKFGGGGYKVSGGLHGVGASVVNALSTWLTVEVYKDGNIYRQSYKRGKTDDTVKIV
FT                   GQCDESLHGTKVHFLPDPEIFEETVYDYDTLKQRLRETAFLTKGLKITLKDVRENSHHN
FT                   HVFHYEGGIKEFVEYLNRGKEALYDEVIYCEGTQNGVYVEVALQHNDSFNDSTFSFVNN
FT                   VITPEGGTHLAGFRNALTKTFNAYAREKKILKDSDPALTGDDIREGLTAIISIKIEEPQ
FT                   FEGQTKQKLGNSEARGAVDAVVSEKLTYFLEQNPDVAKNICEKSLLAQRAREAARKARD
FT                   LTRRKTSLDGGTLPGKLADCSDKDPKNCEIFIVEGDSAGGSAKTARSRATQAILPLRGK
FT                   ILNVEKARLDRIYDNAEIRAMITAFGTGIHEDFDITKLRYDKIIIMTDADVDGAHIATL
FT                   MLTFLYRFMPDLIKEGHVYLATPPLYKVEKNKGVWYAYDDDELKQILNDIGRDNNNKIQ
FT                   RYKGLGEMDADQLWETTMDPDHRILKQVMIDGENSSELDVTFTTLMGDKVEPRKEFIEA
FT                   NAKYVTNLDI"
FT   gene            6021..8579
FT                   /locus_tag="EUBREC_0006"
FT   CDS_pept        6021..8579
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0006"
FT                   /product="DNA gyrase, A subunit"
FT                   /note="Cytoplasmic, score:8.87; COG0188 Type IIA
FT                   topoisomerase (DNA gyrase/topo II, topoisomerase IV), A
FT                   subunit; KEGG:K02469 DNA gyrase, A subunit
FT                   HMMPfam:IPR002205; HMMPfam:IPR006691;
FT                   BlastProDom:IPR002205; Gene3D:IPR013757; Gene3D:IPR013758;
FT                   HMMSmart:IPR002205; HMMTigr:IPR005743;
FT                   superfamily:IPR013760"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ACR73817"
FT                   /db_xref="GOA:C4Z942"
FT                   /db_xref="InterPro:IPR002205"
FT                   /db_xref="InterPro:IPR005743"
FT                   /db_xref="InterPro:IPR006691"
FT                   /db_xref="InterPro:IPR013757"
FT                   /db_xref="InterPro:IPR013758"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR035516"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z942"
FT                   /protein_id="ACR73817.1"
FT                   /translation="MDDKIFDQIQQVDLKKTMESSYIDYAMSVIASRALPDVRDGLKPV
FT                   QRRVLYSMVELGNTPDKPHRKCARIVGDTMGKYHPHGDSSIYGALVNMAQDWSMRYTLV
FT                   DGHGNFGSVDGDGAAAMRYTEARLSKISLELIKDIGKNTVDFEPNFDETEKEPTVLPSR
FT                   YPNLLVNGTTGIAVGMATNIPPHNLREVVNAVVRLIDNDIEDKETTIDELIDVVKGPDF
FT                   PTGGIILGTSGIKEAYRTGRGKIRVRAVTNIEPMENGKNRIVVTELPYNVNKARLIEKI
FT                   AELHKDKKIDGITDLRDETSREGMRIVVELRRDVNPSVVLNLLFKHTQLQDTFGVINLA
FT                   LVNGEPKVLNLYDLLNYYLIHQKDVVTRRTKFDLDKAEARAHIVEGLIIAQDNIDEVIS
FT                   IIRSSQTTQQAKTRLMERFGLTDEQSQAIVDMRLRALTGLEREKLEAEYKELMAQIAQL
FT                   KAILADEKKLLGVIREEIIAIADKYGDDRKTEIGYDEYDMSMEDLIPETNTVITMTKVG
FT                   YIKRMSTDNFKAQHRGGKGIKGMETIEDDYIVEMLMTTSHHYLMFFTNTGRVYRIKAYE
FT                   IPEASRTSRGTAIINLIPLQPDEKITAMIPIKEYEDDKYLFMATRNGIVKKTPIKDYEN
FT                   IRKNGLAAINLREDDKLIEVKVTDNSEDILLFTKFGQCIRFKETDVRSTGRTTMGVIGM
FT                   NLAPNDVIIAMQTASMGEAVLLVSSNGLGKRTRIDEFTTQNRGGKGVKCYKITEKSGNL
FT                   VGVKSVENDDELMLITTEGIIIRIQVSDVTVLGRITTGVKLINLKEGVSVASIAKVVED
FT                   KTLMPPEEAKEENDESENSDEDSAENNNSHAEAIENNTEA"
FT   gene            8836..9681
FT                   /locus_tag="EUBREC_0007"
FT   CDS_pept        8836..9681
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0007"
FT                   /product="hydro-lyase, Fe-S type, tartrate/fumarate
FT                   subfamily, alpha subunit"
FT                   /note="Cytoplasmic, score:8.87; COG1951 Tartrate
FT                   dehydratase alpha subunit/Fumarate hydratase class I,
FT                   N-terminal domain; KEGG:K01675 hydro-lyase, Fe-S type,
FT                   tartrate/fumarate subfamily, alpha subunit
FT                   HMMPfam:IPR004646; HMMTigr:IPR004646"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ACR73818"
FT                   /db_xref="GOA:C4Z943"
FT                   /db_xref="InterPro:IPR004646"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z943"
FT                   /protein_id="ACR73818.1"
FT                   /translation="MIREINVSEITAAIKEMCIQANHFLSPDMDKALKAATANEESPLG
FT                   KKILNQLQENLKIAGEDMIPICQDTGMAVFFIEIGQDVHFTGGVLEDAINEGVRQGYTD
FT                   GYLRKSVVKDPLIRENTKDNTPAVIHYSIVSGDKVKITFAPKGFGSENMSRVFMLKPAD
FT                   GIEGVKNAILTAVSDAGPNACPPMVVGVGVGGTFEKCAIMAKKALTREAGTHSDIEYVA
FT                   ELEKEMLEKINNLGIGPGGLGGSTTALAVNINTYPTHIAGLPVAVNICCHVNRHVVKEL
FT                   "
FT   gene            complement(9719..9862)
FT                   /locus_tag="EUBREC_0008"
FT   CDS_pept        complement(9719..9862)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0008"
FT                   /product="Hypothetical protein"
FT                   /note="Extracellular, score:8.82"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ACR73819"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z944"
FT                   /protein_id="ACR73819.1"
FT                   /translation="MLYVFPFFSPDSFIFTVFLFFQHNITCNNYSFLITLHISLFHYSC
FT                   NN"
FT   gene            9844..10395
FT                   /locus_tag="EUBREC_0009"
FT   CDS_pept        9844..10395
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0009"
FT                   /product="fumarate hydratase subunit B"
FT                   /note="Cytoplasmic, score:8.87; COG1838 Tartrate
FT                   dehydratase beta subunit/Fumarate hydratase class I,
FT                   C-terminal domain; KEGG:K01678 fumarate hydratase subunit B
FT                   HMMPfam:IPR004647; Gene3D:IPR004647; HMMTigr:IPR004647"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ACR73820"
FT                   /db_xref="GOA:C4Z945"
FT                   /db_xref="InterPro:IPR004647"
FT                   /db_xref="InterPro:IPR036660"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z945"
FT                   /protein_id="ACR73820.1"
FT                   /translation="MEKHITTPITQKITKDLRSGDYVYITGEMYVARDAAHKRMIEALD
FT                   RKEELPIDIKDSTIYYMGPSPARDGRPIGSAGPTTATRMDKYAPRLLDLGEKAMIGKGK
FT                   RSKEVIDAVIRNKAVYFAAVGGAGALLSKCIKSSEVICYDDLGAEAIRKIYVEDFPVIV
FT                   VIDSEGNNLYETSIKEFKKI"
FT   gene            10488..10575
FT                   /locus_tag="EUBREC_0010"
FT   tRNA            10488..10575
FT                   /locus_tag="EUBREC_0010"
FT                   /product="tRNA-Ser"
FT   gene            10914..12434
FT                   /locus_tag="EUBREC_0011"
FT   rRNA            10914..12434
FT                   /locus_tag="EUBREC_0011"
FT                   /product="16S ribosomal RNA"
FT   gene            12495..12611
FT                   /locus_tag="EUBREC_0012"
FT   rRNA            12495..12611
FT                   /locus_tag="EUBREC_0012"
FT                   /product="5S ribosomal RNA"
FT   gene            12954..15836
FT                   /locus_tag="EUBREC_0013"
FT   rRNA            12954..15836
FT                   /locus_tag="EUBREC_0013"
FT                   /product="23S ribosomal RNA"
FT   gene            15899..15970
FT                   /locus_tag="EUBREC_0014"
FT   tRNA            15899..15970
FT                   /locus_tag="EUBREC_0014"
FT                   /product="tRNA-Asn"
FT   gene            15989..16059
FT                   /locus_tag="EUBREC_0015"
FT   tRNA            15989..16059
FT                   /locus_tag="EUBREC_0015"
FT                   /product="tRNA-Cys"
FT   gene            complement(16307..17296)
FT                   /locus_tag="EUBREC_0016"
FT   CDS_pept        complement(16307..17296)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0016"
FT                   /product="putative oxidoreductase"
FT                   /note="Cytoplasmic, score:8.87; COG0673 Predicted
FT                   dehydrogenases and related proteins; KEGG:0putative
FT                   oxidoreductase HMMPfam:IPR000683; HMMPfam:IPR004104;
FT                   ScanRegExp:IPR000583"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ACR73821"
FT                   /db_xref="GOA:C4Z9H3"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z9H3"
FT                   /protein_id="ACR73821.1"
FT                   /translation="MKQLNWATLGCGVIANELAHALSKEGRTLYSVANRTHEKAVAFAQ
FT                   KYGISKVYDNIDDVFYDPDVDIIYISTPHNTHINYLRKALSNGKHVLCEKSITLNIAEL
FT                   DEAVSLAKENNVILAEAMTIYHMPVYKKLNEIIASGQLGRLNLIQVNFGSYKDYNMTNR
FT                   FFSRKLAGGALLDIGVYSLSLIRWFFKETPTQVSSQVKYAPTGVDEQAGILLMNDAVEM
FT                   ATVTLSLHSKQPKRATLSFDKAYVEIFEYPRGMQATITYTEDGHKEVIDAGDTSDALYY
FT                   EVRDMEKAVSSASSDEIETLMHCQYTYDVMKIMSDIRAEWGMKYPEEE"
FT   gene            17878..18621
FT                   /locus_tag="EUBREC_0017"
FT   CDS_pept        17878..18621
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0017"
FT                   /product="transcription repressor of fructose operon FruR"
FT                   /note="Unknown cell location; COG1349 Transcriptional
FT                   regulators of sugar metabolism; KEGG:K03436 transcription
FT                   repressor of fructose operon FruR; HMMPfam:IPR001034;
FT                   HMMPfam:IPR014036; FPrintScan:IPR001034;
FT                   HMMSmart:IPR001034; ScanRegExp:IPR001034"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ACR73822"
FT                   /db_xref="GOA:C4Z9H4"
FT                   /db_xref="InterPro:IPR001034"
FT                   /db_xref="InterPro:IPR014036"
FT                   /db_xref="InterPro:IPR018356"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z9H4"
FT                   /protein_id="ACR73822.1"
FT                   /translation="MLAEDRCKKILDILDSMGSVTVQQLMDELDTSESTIRRDLVAMDK
FT                   KGYLTKVHGGAIVNNTNIHTQDEKVINRLKQNRNEKEQIARYAASLIVDNDFVYIDAGT
FT                   TTAVMIDYITAKNVVFVTNSLTNAKRISDRGYTVYILGGEFKSTTEAIVGDEAVVTLDK
FT                   YNFTKGFWGTNGITVKNGFTTPEIKEAMVKKKSMENSKEKYILADDSKFSQVSSIKFAD
FT                   FEDAVIITNALSNDNYKKYKNIKEV"
FT   gene            18623..19540
FT                   /locus_tag="EUBREC_0018"
FT   CDS_pept        18623..19540
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0018"
FT                   /product="fructose-1-phosphate kinase"
FT                   /note="Unknown cell location; COG1105 Fructose-1-phosphate
FT                   kinase and related fructose-6-phosphate kinase (PfkB);
FT                   KEGG:K00882 fructose-1-phosphate kinase HMMPfam:IPR011611;
FT                   ScanRegExp:IPR002173"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ACR73823"
FT                   /db_xref="GOA:C4Z9H5"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR017583"
FT                   /db_xref="InterPro:IPR022463"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z9H5"
FT                   /protein_id="ACR73823.1"
FT                   /translation="MIYTVTFNPSLDYIVDVTDFKTGVVNRTTGEKIFAGGKGINVSMV
FT                   LKNLGMSNTSLGFTAGFTGNEIKRLLAKKGVDTDFIEVEDGISRINVKLRSNEESEING
FT                   QGPAITEDNIKKLYEKLDCLKESDVLVLAGSIPDVMPSSMYMDIMKHLEGRGINIVVDA
FT                   TRNLLTNVLPYKPFLIKPNNHELGEIFGVEITDKDDVIKYAKKLQEQGARNVLVSMAGD
FT                   GAVLVTEDGQEFKANAPKGKLKNSVGAGDSMVAGFVYGYLKSNDYKQAFIYGVCTGSAS
FT                   AFSEELATKPEVEALIDKWDSASN"
FT   gene            19607..21535
FT                   /locus_tag="EUBREC_0019"
FT   CDS_pept        19607..21535
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0019"
FT                   /product="PTS system, fructose-specific, IIABC component"
FT                   /note="CytoplasmicMembrane, score:10.00; COG1299
FT                   Phosphotransferase system, fructose-specific IIC component;
FT                   KEGG:K00890 PTS system, fructose-specific, IIABC component
FT                   HMMPfam:IPR002178; HMMPfam:IPR003352; HMMPfam:IPR003353;
FT                   BlastProDom:IPR002178; Gene3D:IPR002178; HMMTigr:IPR003353;
FT                   HMMTigr:IPR004715; HMMTigr:IPR006327; ScanRegExp:IPR002178"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ACR73824"
FT                   /db_xref="GOA:C4Z9H6"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="InterPro:IPR003353"
FT                   /db_xref="InterPro:IPR003501"
FT                   /db_xref="InterPro:IPR004715"
FT                   /db_xref="InterPro:IPR006327"
FT                   /db_xref="InterPro:IPR013011"
FT                   /db_xref="InterPro:IPR013014"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="InterPro:IPR036095"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z9H6"
FT                   /protein_id="ACR73824.1"
FT                   /translation="MTIRDLLAAESINLNGTPAGKTEALNQCIDLMAKSGKIADVEKYR
FT                   KGVFAREEEGTTGIGMGIAIPHCKSDAVTKAGLAAMVVKDGVDFESLDGTPAKIIFLIA
FT                   APNTEDNVHLQVLSKLSVMLMDEQFTNSLINAGSVDEFLNIIDSAEKAKDEKEAAKEAK
FT                   AKEPVEVKKDDVFIVAVTACPTGIAHTYMAAEAIEKKAKELGYQVKVETRGSGGAKNVL
FT                   TDDEIAKAAGVIVACDTNVPTDRFDGKKVIECQVSDGINKAEELIKRIAAGDAPVFKAS
FT                   GKKEASHSSVGGKESVGHQIYKHLMNGVSHMLPFVVGGGILIAIAFLIDGFSVDLNSLP
FT                   ADQRANFGTITQAAAMFKGIGGTAFGFMLPILAGFIAMSIADRPGLAVGFVGGSIAANG
FT                   TSGFLGALVAGFVAGYIVLLLKKVFSKLPESLDGMKPVLLYPLLGIFLVGVIMQFVVEP
FT                   PIGALNTAINNGLNGLNGASAVVLGVLLGGMMSVDMGGPVNKAAYVFGTASIAAGNYNI
FT                   MAAVMIGGMVPPIAIALATIFFKNKFTADERKAGPTNFIMGLSFITEGAIPFAASDPLH
FT                   VLPACVVGSAVAGGLSMAFGCTLMAPHGGIFVVPTIGNPLMYLVALVIGSFIACGLLGL
FT                   LKKKVSE"
FT   gene            21774..23534
FT                   /locus_tag="EUBREC_0020"
FT   CDS_pept        21774..23534
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0020"
FT                   /product="chaperone protein DnaK"
FT                   /note="Cytoplasmic, score:9.65; COG0443 Molecular
FT                   chaperone; KEGG:K08070 chaperone protein DnaK
FT                   HMMPfam:IPR013126; BlastProDom:IPR013126;
FT                   FPrintScan:IPR001023; HMMPanther:IPR001023;
FT                   HMMTigr:IPR012725; ScanRegExp:IPR013126"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ACR73825"
FT                   /db_xref="GOA:C4Z9H7"
FT                   /db_xref="InterPro:IPR012725"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR018181"
FT                   /db_xref="InterPro:IPR029047"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z9H7"
FT                   /protein_id="ACR73825.1"
FT                   /translation="MGKVIGIDLGTTNSCVAVLENNQPVVITNSEGQRTTPSVVAFTKN
FT                   GERLVGEAAKRQAAVNVDRTFFSIKRQMGSDFRAKVDGKLYSAPEISSMILRKLKKDAE
FT                   DYIGEAVTDAVITVPAYFSDAQRQATKDAGRIAGLNVLRIINEPTSAALAYGLDHGQQQ
FT                   KILVYDLGGGTFDVSVIEIGDNLIEVLATAGDNHLGGDDFDERITNYLVTEFYRQQNVD
FT                   LRKDNTAMQRVREEAEKAKKVLSSSSSTTINLPFITTVKGQPVHMEMNLTRAEFNEITK
FT                   DLVERTAIPVNQALSDAGISAAELGMVLLVGGSTRVPAVVEEVRRITGKEPSHNLNPDE
FT                   CVALGAAVQGGKLGGAIVAGSSAAEIILMDVTPLSLGIETVGGVSTKIIDRNTTIPTRY
FT                   SQIFTTAGSFQTSVDIKVLQGERQFARDNKLIGNFRLKGIKPAPAGVPQIEVTFDIDAN
FT                   GIVQVSAKDLGTGKHQEITITASSNLSDSEIEQAIREAQEYEATDGQRKAYIDARSEAD
FT                   TLVRQVENVMADKEKRKAMDSAQKKSVKSSLSYVKKLISRTKPGNVSEEQAAEIKHAAD
FT                   ELRNAAAGLI"
FT   gene            23680..24552
FT                   /locus_tag="EUBREC_0021"
FT   CDS_pept        23680..24552
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0021"
FT                   /product="Hypothetical protein"
FT                   /note="Cytoplasmic, score:8.87; COG5244 Dynactin complex
FT                   subunit involved in mitotic spindle partitioning in
FT                   anaphase B"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ACR73826"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z9H8"
FT                   /protein_id="ACR73826.1"
FT                   /translation="MNANDKTEKVLREIHIMLSKAEPYKPEPSRVIINKQQMIDLLAEL
FT                   NKCIYAIQDEYELTEQSRNHAEREFRKKGDQIVWDASRKAEDVYAASVIYTDEALSRVR
FT                   DIINDTNESLEKLCKNMKDKIAEQEKIVKTNQYELKGQLQDLSDTEKYLKIIDDRNKEI
FT                   ERQKNAGKPVEERTIDNEEKSIYANRQTEIKVNMDYIRKLGLAEGEDLGDGVVGEVKLA
FT                   DDTPDAGLNHSNDKDEAKAAGSKSSVDEDYKAISRKAGNPPVINTKEGKELTDGIHRMW
FT                   QSITGNKGK"
FT   gene            24731..25423
FT                   /locus_tag="EUBREC_0022"
FT   CDS_pept        24731..25423
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0022"
FT                   /product="DNA-binding response regulator"
FT                   /note="Cytoplasmic, score:9.98; COG0745 Response regulators
FT                   consisting of a CheY-like receiver domain and a
FT                   winged-helix DNA-binding domain; KEGG:K07659 DNA-binding
FT                   response regulator; HMMPfam:IPR001789; HMMPfam:IPR001867;
FT                   BlastProDom:IPR001789; BlastProDom:IPR001867;
FT                   HMMSmart:IPR001789; superfamily:IPR011006"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ACR73827"
FT                   /db_xref="GOA:C4Z9H9"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z9H9"
FT                   /protein_id="ACR73827.1"
FT                   /translation="MTILVCDDDKEIVEAIEIYLMQEGYDVEKAYDGIQAVEIMKNKKI
FT                   DLMIIDVMMPKLDGIRATLQIRKESRVPIIILSAKTEDADKILGLNVGADDYVTKPFNP
FT                   LELVARVKSQLRRYTTLSSNDAAGDKVYEAGGLLVNDDLKKVTVDGEEVKLTPIEYNIL
FT                   LLLLKNKGKVYSINEIYESIWNEEAIGADNTVAVHIRHIREKIEINPKEPRYLKVVWGV
FT                   GYKIEDNK"
FT   gene            25420..26793
FT                   /locus_tag="EUBREC_0023"
FT   CDS_pept        25420..26793
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0023"
FT                   /product="hypothetical protein"
FT                   /note="CytoplasmicMembrane, score:9.97; COG0642 Signal
FT                   transduction histidine kinase; KEGG:0hypothetical protein
FT                   HMMPfam:IPR003594; HMMPfam:IPR003661; Gene3D:IPR003594;
FT                   HMMSmart:IPR003594; HMMSmart:IPR003661;
FT                   superfamily:IPR003594; superfamily:IPR009082"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ACR73828"
FT                   /db_xref="GOA:C4Z9I0"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z9I0"
FT                   /protein_id="ACR73828.1"
FT                   /translation="MKQYTIGKKAAVIVLHQLCMILMVTGVFATGYAFRHDAHENIDIY
FT                   TLISLAGLVGSFVSLAYMANVAGRKSEDDYTIYYLPIDKVYSDVMLVIFTLLMVFMGKV
FT                   ISGVKNQHFDYASLIMTAGTFTFLFDMAFIILYQSIVRKIKGNILCTHSLMYKGYELLK
FT                   RVIEKKDIHTQKTKEIMRIQEALEAISEGALDTTLNVNEFHGQQKKVAEAVNHIRQGLM
FT                   SSVNESLKNEKLKADLITNVSHDIKTPLTSIVNYVDLLKRENLENENAKYYIHVLEEKS
FT                   QRLKQLTEDLVETSKITSGNVKLNMQKLDLVELLYQTGGEFNERFESRNLTIVTKIPSE
FT                   QIFIYADGRQLYRSIENLYTNAAKYALENTRVYVELEKADTKAVFTIKNVSKNELDIVS
FT                   NGNVDLTERFVRGERSRTTEGSGLGLSIAKNLTHLMGGKFEIKVDGDLFIATITYNII"
FT   gene            26839..29124
FT                   /locus_tag="EUBREC_0024"
FT   CDS_pept        26839..29124
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0024"
FT                   /product="hypothetical protein"
FT                   /note="Cytoplasmic, score:9.98; COG1048 Aconitase A;
FT                   KEGG:K01680 hypothetical protein HMMPfam:IPR000573;
FT                   HMMPfam:IPR001030; BlastProDom:IPR001030;
FT                   FPrintScan:IPR001030; Gene3D:IPR015928; Gene3D:IPR015931;
FT                   Gene3D:IPR015932; HMMPanther:IPR015935;
FT                   HMMPanther:IPR015937; superfamily:IPR001030;
FT                   superfamily:IPR015928"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ACR73829"
FT                   /db_xref="InterPro:IPR000573"
FT                   /db_xref="InterPro:IPR001030"
FT                   /db_xref="InterPro:IPR015931"
FT                   /db_xref="InterPro:IPR015932"
FT                   /db_xref="InterPro:IPR036008"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z9I1"
FT                   /protein_id="ACR73829.1"
FT                   /translation="MKLYENGAYLLNGKEVIIDGPEAQAAVKSKTGMDIDKQTAKQETI
FT                   AYGILKEHNTSGNMDKLQIKFDKLTSHDITFVGIIQTARASGLEKFPIPYVLTNCHNSL
FT                   CAVGGTINEDDHMFGLTCAKKYGGIYVPPHQAVIHQFAREMLAGGGKMILGSDSHTRYG
FT                   ALGTMAVGEGGPELVKQLLEQTYDIDMPEVVGIYLTGEPIKGVGPQDVALAIIGEVFGN
FT                   GFVKNKVMEFVGPGVSNLSVDFRIGVDVMTTETTCLSSIWRTDDQVKEFFEIHGRAEDH
FT                   KELNPGEVAYYDRFIEIDLSQIRPMIAMPFHPSNTYTIDELNANLMDILDDCEKRAEVS
FT                   FDGKVKLDLKSKVRDGKLYVDQGIIAGCAGGGFENICDAADILNGHSIGADEFTLSVYP
FT                   ASTPIYMELVKNGAVAKLLETGAIVKTAFCGPCFGAGDTPANNAFSIRHSTRNFPNREG
FT                   SKVQNGQISSVALMDARSIAATAANKGFLTSAADIDVNFTKPKYFFDKTIYENRVFDSH
FT                   GVADPSVEIQFGPNIKDWPAMSALPENMLLKVVSEIHDPVTTTDELIPSGETSSYRSNP
FT                   LGLAEFALSRKDPEYVGRAKEIQKAQKAIESGECAGKAVPEVAEIMGVVKKKFPEASHE
FT                   NMGFGSTIFAVKPGDGSAREQAASCQKVLGGWANIANEYATKRYRSNLINWGMLPFIID
FT                   EGELPFHNLDYIFLPGIKKEIEDAKTEFEAYVVKDGELKPFTLKMGELTDDEREIILKG
FT                   CLINYNRK"
FT   gene            29140..30453
FT                   /locus_tag="EUBREC_0025"
FT   CDS_pept        29140..30453
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0025"
FT                   /product="protein of unknown function UPF0118"
FT                   /note="CytoplasmicMembrane, score:9.99; COG0628 Predicted
FT                   permease; KEGG:K03548 protein of unknown function UPF0118;
FT                   HMMPfam:IPR002549; HMMPanther:IPR002549;
FT                   ScanRegExp:IPR000719"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ACR73830"
FT                   /db_xref="GOA:C4Z9I2"
FT                   /db_xref="InterPro:IPR002549"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z9I2"
FT                   /protein_id="ACR73830.1"
FT                   /translation="MEETGKAGKKSNIEINADKGAKQNSHPGREEWPHLIRIGVMVFVT
FT                   FAVSILFFFALYRFEGFAGIWSKLLAAAMPIIMGLVLAYLMNPVMLWLERCFKKLLSKK
FT                   MKSESKLRKVSRALAITGSVIILVAIISLLIAAIVPSVIASISGLMKTLPNDVAAFINM
FT                   IKNGNFGDSKIAELASTGLQNATDYIENYATEKLIPEAQKYVAQITTGVISIVRGLFNF
FT                   IIGIIVMVYVMSIQETLAGQSKKIIYAVCKPKTGNIIIETIRKTNEIFGGFISGKIIDS
FT                   LIIGVIAYFGCLILRIPSSVLVAVIIGVTNVIPVFGPFIGAIPSLLIVVIQSPWHALYL
FT                   LIFIVVLQQVDGNIIGPKILGSSTGLSTFWVMFAILIGGGMFGFLGMLLGVPTFAVIYY
FT                   IVKRVVNYALRKKKLPEDTRDYTKTTGVDTKNNKLKYE"
FT   gene            30463..33096
FT                   /locus_tag="EUBREC_0026"
FT   CDS_pept        30463..33096
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0026"
FT                   /product="Hypothetical protein"
FT                   /note="Cytoplasmic, score:8.87; COG0419 ATPase involved in
FT                   DNA repair; HMMPfam:IPR013105; Gene3D:IPR011990"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ACR73831"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z9I3"
FT                   /protein_id="ACR73831.1"
FT                   /translation="MDKYEYNLKLDQIKALSAEEGYMSAAEIADSINWNKIKNVNTLVK
FT                   IGEIYEKAERYQDARDILLMAYDRSPIGRMIIYRLAEVAIKMGDYDAATEYYDEFVEIA
FT                   PHDDMKYVLRYAIKKGQGASFDELITILEEYKDEEYTEEWAYELAYLYHKAGKADKCID
FT                   ACDELILWFGDGPYVERALELKMLYQPLTKAQEEKYRRFKAEKEKPAKIKDEAEVTEIG
FT                   AMEMVKGGEIVHDDVTIPQITVNQEKFNTVNLQQEIAKGMQQIMEAKGKNEVADTMDTI
FT                   KKIVEDIPYLKLEKEQEEYAQQPEETEHIATDEEIDGSLKLNFKELLGEDADGQMSMVM
FT                   SEKTQLEHQITGQMSIQDVLEEWEKTRHAAEIALKEAEQQKLESAKARALQEAGDIMER
FT                   LNDVIPKLDAGVTPKELLEEEYLKVPVDIIEQKAAVKEPEEEQKPDMQELYAEETVDEV
FT                   QEPQEAPEDTIDEAQEPQEAPEEAIEEAIEEVQESREVPEEAADEAREPVGEPEDIIMA
FT                   EESEKDEILMQPTTMMPEITDDMLNVDDDTSDDETSQEKENVSEKRDFDHVTSFIEQEI
FT                   AKMTAKNPGLEKKLDMAKTRKMPDISLPEDLDSEEDDSKLKETKHIKELTSEQKAIFSY
FT                   FIPVKGMEDQICKAYNAVLDHFNRKENASTGNLIIQGEQGCGKTMLATSFIKVLQKDGE
FT                   QLTGKMGKIDAAALNKKDVQQVVRKITGGCLIIERAGDIDRSIAAQLSFLMEHDITGTL
FT                   YILEDTSKGIKKALSMDEGFASKFTEKISVPIFTNDELVLFAKSYSAELGYKIDEMAIL
FT                   ALHNRISNIERIDQATTLTEVKDIIDEAIDREAHSGLKKAISILTARRYTDDDRIVLKE
FT                   DHFREK"
FT   gene            33103..35076
FT                   /locus_tag="EUBREC_0027"
FT   CDS_pept        33103..35076
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0027"
FT                   /product="1,4-alpha-glucan branching enzyme"
FT                   /note="Cytoplasmic, score:8.87; COG0296 1,4-alpha-glucan
FT                   branching enzyme; KEGG:K00700 1,4-alpha-glucan branching
FT                   enzyme HMMPfam:IPR004193; HMMPfam:IPR006047;
FT                   HMMPfam:IPR006048; Gene3D:IPR013780; Gene3D:IPR013781;
FT                   Gene3D:IPR013783; HMMSmart:IPR006589; HMMTigr:IPR006407"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ACR73832"
FT                   /db_xref="GOA:C4Z9I4"
FT                   /db_xref="InterPro:IPR004193"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR006048"
FT                   /db_xref="InterPro:IPR006407"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR037439"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z9I4"
FT                   /protein_id="ACR73832.1"
FT                   /translation="MGGIYMCNFTAMDCYLFGQATHYDIYKKMGAHLAERKGKKGVCFD
FT                   VWAPHAREVYVFGEFNDWNETSHEMKRVEPETMGVYELFVPGAQKGQMYKFIIVTEQGD
FT                   KLYKADPYANYAELRPGTASIITDIEHFTWTDKEWMDKRAAKSDADVYSSPMAIYECHP
FT                   GSWMRHPGRDDEGFYTYRELAKSLISYVKTMGYTHIELMGISEYPFDGSWGYQVTGYYA
FT                   PTSRYGEPEDFAYFVDQCHKNNIGVILDWVPAHFPKDAHGLANFDGTATYEYADPRKGE
FT                   HPDWGTKIFDYGKNEVKNFLIGSALMWIENYHVDGLRVDAVASMLYLDYGKNDGQWVPN
FT                   KFGGNKNLEAVEFFKHINTLILGRNHGTVMIAEESTAWPKVTGKVEEDGLNFSYKWNMG
FT                   WMHDFLDYMKLDPYFRKNNHNKMTFAMSYNESEKYILVLSHDEVVHLKCSMLNKMPGLE
FT                   GDKFKNLMAGYAFMMGHCGKKLLFMGQEFAQKQEWSEERELDWYLLENPEHKKIQNWVK
FT                   ELLHLYRRNRCLYELDSSWEGFEWINANDADRSIFSFIRKSKDGKNNMLFVINFTPVER
FT                   PDYRVGVPKHKTYQLVLDSEDPKFTGKTVQAPVKKAAKGRGKAAKQSYKKLDYKAVKSE
FT                   CDGRPFSFAYPLAPYGVAVFKY"
FT   gene            35258..38398
FT                   /locus_tag="EUBREC_0028"
FT   CDS_pept        35258..38398
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0028"
FT                   /product="Hypothetical protein"
FT                   /note="Cytoplasmic, score:8.87; COG4733 Phage-related
FT                   protein, tail component"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ACR73833"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z9I5"
FT                   /protein_id="ACR73833.1"
FT                   /translation="MQIENLINKSTDTKNTDTKTINDMTAGMRVSDYIKTDSSDNMSKK
FT                   AAVVGSSNSVDMSDTIYARPQAKNEAGNNDGTDMAENLLNDMNQTSENRRNDMIVTAST
FT                   TTSDDYKAAKDDGYDVIVTETDKIKAVLAKAGVDISIYGDDLSRQQLTDITGSQTEAAM
FT                   LVNQMKAYDIPATDDNIKAGTDAIDRAKSLTNISNETKAYLVRNNMNPTVSNVYKATYS
FT                   SSQVQDYRQKTKMTEISDELFEELKPQLKQILEEAHIDSSDENLNQCRWLIDEDIAVTP
FT                   DNVLLANQVDCINAAGENVSSDFYARAVTEALAMGKKATDATMSQDGLIFDMAKKACDV
FT                   LGEATADDIVTLESDNIPVTIENLSKLIAARGKDSAASQASANKAADNQITDSREARLV
FT                   TAQRKLEEARLSMTAEANLSLIKKGVSIDTEPIERVVELLKQQENKYYGALFGDSSVEA
FT                   SDDRVRMYNNVCDIFNQMKQQPAYVLTLESADDTVYELYTAGKAMKQSLEAAASGYETL
FT                   MTSPRADMGDSISKAFQNVDDILKELQIDTSESNRRAVRILAYNSTDITEDNIKQIKSV
FT                   DEQVQRAFSDMTPAVTIEMIKRGISPLDMSMSDISDTARRIKSENPDERDEKFSEFLWK
FT                   LEKKNEISEKERDSYIGIYRLISQVEQSDGAVIGSLVNQGADITMKNLLTAVRVRGKSA
FT                   MDYKVDDTFAGVDSVSRGIKIDSQIESAYHTNCLRDVLDTLSPEKMEFVQYDSWLDMTP
FT                   EQLRQAVYEAGEDNALSEQYATEQLRQFNQAVSVPENVYAFLEKYDVKTTAVNLMAASR
FT                   LMKNPSEAVRNLWERGDSATARALLDETLRRFSESVKNPKELAQAQETLADTAEHVMDS
FT                   MIIEDRHTGSIDLRQMKLLCSQLRIASNMSRQENYIVPIETADGVTGMKLRIVRGEDKK
FT                   GLVDIFLEDKKCGRVAAFFEAKENSVSAMIVTDDEQTKKLFEDNITMFEAGISDGEQRV
FT                   RIDVALEHDISAKESKMSDNETKKLLDGSESVQTTRLYHIAEQFIVNVQRVIAQDSL"
FT   gene            complement(38355..39077)
FT                   /locus_tag="EUBREC_0029"
FT   CDS_pept        complement(38355..39077)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0029"
FT                   /product="germination-specific N-acetylmuramoyl-L-alanine
FT                   amidase"
FT                   /note="Unknown cell location; COG0860
FT                   N-acetylmuramoyl-L-alanine amidase; KEGG:K01446
FT                   germination-specific N-acetylmuramoyl-L-alanine amidase
FT                   HMMPfam:IPR002508; Gene3D:IPR002508; HMMSmart:IPR002508"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ACR73834"
FT                   /db_xref="GOA:C4Z9I6"
FT                   /db_xref="InterPro:IPR002508"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z9I6"
FT                   /protein_id="ACR73834.1"
FT                   /translation="MKKYMYIIKKNKYCLILALFILSFYLGRGVCALAKNTGKNTNSTV
FT                   IVIDPGHGGSDPGKISTSGVMEKDVNLSIAMALKQLFENRGFTVVMTRTTDCDLAPDNS
FT                   KHPKTDDLTKRTALMSKSNVAVSISIHQNSFEDNSSCGPQVFYYEASDAGKELASSVLG
FT                   ALNTSLCVAKPRSIKPNKEYFILKKSTSPTVIVECGFLSNPAETLLLTDKNYQDDLAHA
FT                   IYIGVTDYLAQSPSGHLQ"
FT   gene            complement(39229..40962)
FT                   /locus_tag="EUBREC_0030"
FT   CDS_pept        complement(39229..40962)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0030"
FT                   /product="hypothetical protein"
FT                   /note="Unknown cell location; COG3858 Predicted glycosyl
FT                   hydrolase; KEGG:K06306 hypothetical protein;
FT                   HMMPfam:IPR001223; Gene3D:IPR013781; HMMSmart:IPR003646;
FT                   HMMSmart:IPR011583; ScanRegExp:IPR001579"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ACR73835"
FT                   /db_xref="GOA:C4Z9I7"
FT                   /db_xref="InterPro:IPR001223"
FT                   /db_xref="InterPro:IPR003646"
FT                   /db_xref="InterPro:IPR011583"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR029070"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z9I7"
FT                   /protein_id="ACR73835.1"
FT                   /translation="MKKKLLPALIVTGLIILVVIIMGITALINKYTPTKKTEDLKEYFN
FT                   ISSDDEAALIVDNELSDYKAKIIDKKIYVDYKFVHDSLNSRFYWDANENVLLYTTASDI
FT                   ISAAADSNSYSVTKQTNDFGYPIVKATSDSALIALDYVKQYSNITFKSYDDPARIVITS
FT                   KWDEIDSATVNKSTQVRVKGGIKSPILKEVKKDDKITILDSGDKWDKVATEDGVIGYIK
FT                   SKALSESKKTKLTNPDYEEETFTHIKKDKDICLAWNQVTSQSANSKVPQVISSTKGINV
FT                   MSPTWFYLNDNNGNLADIASKDYVSYCHSQGIEVWGLFSNFENTDVDAAYVLTHTSTRT
FT                   TLINQIMSAAFNYELDGVNIDFENITEAAYGDSYIEFIRELAIKCHNNGISLSVDVTVP
FT                   ASFNKFFNRSDMANFADYIVIMGYDEHYKGSDAGSVSSIPWVTEGVESTLKEVPADQII
FT                   LGMPFYTRIWELTPKEDDDAVTDTEDQSKYTVASQVYSMDAAAAQLATNNATAALDEES
FT                   GQNYAEWSVSNKLYKVWLEDTTSLEKRLKLVDDNKLAGAAFWKLGFENSSVWDTVIKYL
FT                   N"
FT   gene            41080..41247
FT                   /locus_tag="EUBREC_0031"
FT   CDS_pept        41080..41247
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0031"
FT                   /product="Hypothetical protein"
FT                   /note="Cytoplasmic, score:8.87"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ACR73836"
FT                   /db_xref="GOA:C4Z9I8"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z9I8"
FT                   /protein_id="ACR73836.1"
FT                   /translation="MHFGAEGAKASPAHIAFLFKICLLVVFLHLNGVKDQKYADIDFFR
FT                   VIKMILIVNE"
FT   gene            complement(41538..42008)
FT                   /locus_tag="EUBREC_0032"
FT   CDS_pept        complement(41538..42008)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0032"
FT                   /product="Hypothetical protein"
FT                   /note="Cytoplasmic, score:8.87"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ACR73837"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z9I9"
FT                   /protein_id="ACR73837.1"
FT                   /translation="MYRTAYVELNGTHEILSLSKTADEKVFTYKNVDFFPHAVMSTLTE
FT                   ILNMRYERVIIDFGILNPNTLKEFMRCDVRIAVCTISKWNRGSLNRIIELFNSNKITDS
FT                   ESVKILFNLVEKKKTINHKHFKYPVVGFPYLEDPFLINTSLFGTLDKISERN"
FT   gene            complement(42089..43354)
FT                   /locus_tag="EUBREC_0033"
FT   CDS_pept        complement(42089..43354)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0033"
FT                   /product="serine/threonine protein kinase fused to TPR
FT                   repeats domain"
FT                   /note="CytoplasmicMembrane, score:9.49; COG0515
FT                   Serine/threonine protein kinase; KEGG:K08884
FT                   serine/threonine protein kinase fused to TPR repeats domain
FT                   HMMPfam:IPR000719; BlastProDom:IPR000719;
FT                   HMMSmart:IPR002290; superfamily:IPR011009"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ACR73838"
FT                   /db_xref="GOA:C4Z9J0"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z9J0"
FT                   /protein_id="ACR73838.1"
FT                   /translation="MDQERALKKVPKSSAFAESALSEARLLKSLEHPSIPRIFDFEEDN
FT                   AFYYIVEEYIDGETLDSFLLHQQLISPGLFFNICEQLCNVFIYLHTQISTPIIYRDLKP
FT                   EHIIVCHNKLKLIDYGVSAYVIQDGNNFNHYGNIEFSAPECFTEDTITPAADIYSLGQL
FT                   LQYILTFTPDSFSHKFQHIIQKATTSDASLRYVTVAELYQEIQEIQKLTGQPHLIHKIA
FT                   VLGSHRGCGSTHVAVSLTCELNILGYHGIYIDSAKSILCHGNHDGLQIFKQKNGYYYYK
FT                   SFQGIPDYSDGIQFNIPKDAIQIYDLGTDVCNEKIYDMDLVLYVCNGGFWHLNDIYRNH
FT                   SILKKMTASLSVICNMCSRQDASAIAALLNCSVYHFPYDSDMFKSSVQKETLIQKLLEL
FT                   KGGASLSDTLKGYLRKSILHHS"
FT   gene            43361..43639
FT                   /locus_tag="EUBREC_0034"
FT   CDS_pept        43361..43639
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0034"
FT                   /product="Hypothetical protein"
FT                   /note="Unknown cell location"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ACR73839"
FT                   /db_xref="GOA:C4Z9J1"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z9J1"
FT                   /protein_id="ACR73839.1"
FT                   /translation="MSDKRNATGAAGSEIFNHLIFVKQRMICIFHTLLLGRAHISWITY
FT                   NIPVKLLQHFFYFFLIDLALYNMTGVYYNSFTIYTDIFGKGCEKYEN"
FT   gene            43629..44369
FT                   /locus_tag="EUBREC_0035"
FT   CDS_pept        43629..44369
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0035"
FT                   /product="Hypothetical protein"
FT                   /note="Cytoplasmic, score:8.87; COG4862 Negative regulator
FT                   of genetic competence, sporulation and motility;
FT                   HMMPfam:IPR008681"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ACR73840"
FT                   /db_xref="InterPro:IPR008681"
FT                   /db_xref="InterPro:IPR038471"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z9J2"
FT                   /protein_id="ACR73840.1"
FT                   /translation="MKIEKVNDNQIRCTLTREDLEDRHIKISELAYGSAKAKSLFKDMV
FT                   EQANYEFGFETNDIPLMVEAIPLPSESIVLIITKVEYPDELDTRFSKFSEADDDFTDLG
FT                   NAGQPPVIKGAADILELFERIKKENEKTADSEQGTDDITEEQAEADVVKLFVFDKFDDV
FT                   RRISHVLDGFYSGRNDLYRDASSNKYYLVAHKSEHTPKEFNKVCNIISEYAYQKNYVPA
FT                   NEAFFKEHGNVIIEEAAIQTLAAL"
FT   gene            complement(44427..44636)
FT                   /locus_tag="EUBREC_0036"
FT   CDS_pept        complement(44427..44636)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0036"
FT                   /product="Hypothetical protein"
FT                   /note="Cytoplasmic, score:8.87; NOG16895 non supervised
FT                   orthologous group"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ACR73841"
FT                   /db_xref="InterPro:IPR015077"
FT                   /db_xref="InterPro:IPR023883"
FT                   /db_xref="InterPro:IPR038062"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z9J3"
FT                   /protein_id="ACR73841.1"
FT                   /translation="MARVTKDTMIGDLLQIDQNVAPLLLNIGMHCLGCPSSQMETIEEA
FT                   AMVHGLDPDDLVVEINTFIDHDLG"
FT   gene            44806..46236
FT                   /locus_tag="EUBREC_0037"
FT   CDS_pept        44806..46236
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0037"
FT                   /product="flagellin"
FT                   /note="Extracellular, score:9.55; COG1344 Flagellin and
FT                   related hook-associated proteins; KEGG:K02406 flagellin;
FT                   HMMPfam:IPR001029; HMMPfam:IPR001492;
FT                   BlastProDom:IPR001029; ScanRegExp:IPR000362"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ACR73842"
FT                   /db_xref="GOA:C4Z9J4"
FT                   /db_xref="InterPro:IPR001029"
FT                   /db_xref="InterPro:IPR001492"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z9J4"
FT                   /protein_id="ACR73842.1"
FT                   /translation="MKINRNMSAVRANKQLLGTENRLSKSMKRLSSGYKINSAEDNPAG
FT                   MAISNKMKAQIEALDQAKSNSSDAQNVMKIADGALGEVSSMLQRIRELAVQGASDTYSE
FT                   NDKKALQSEIDELTKEVDRISGDTEYNTKSLLDGSSDTRVYVRQKDANGNMTQVNSYIT
FT                   RINFSDNVASDKYELTVNSLATQATGSLASATKPDAEGTISINGVSVAVKADMTQDEYI
FT                   QALQKAATTAGTTMQVNGDSISFLSNEYGSDSTVNISLSSSLKALAGAGYENADDGSGN
FT                   MQLKSNGKDAVVTGGENLSDKTIRADGNRVYVVGNSGFSMDFLLSSDMDMTAGSSNLQI
FT                   DISDIGNMAVQIGANEGQEMKIRIPEVSSQTLYLDTVDVTVKGGADKAMSTLDEAIEYV
FT                   SGVRSRIGAFQNRLESAESSLSETSENMTGAYSNIMDTDMATEMTEYAAQNILDQAGIS
FT                   VLSQANDLPQQVLSLLSR"
FT   gene            46243..46716
FT                   /locus_tag="EUBREC_0038"
FT   CDS_pept        46243..46716
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0038"
FT                   /product="Hypothetical protein"
FT                   /note="Unknown cell location; COG1516 Flagellin-specific
FT                   chaperone FliS"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ACR73843"
FT                   /db_xref="GOA:C4Z9J5"
FT                   /db_xref="InterPro:IPR003713"
FT                   /db_xref="InterPro:IPR036584"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z9J5"
FT                   /protein_id="ACR73843.1"
FT                   /translation="MKNELKQELTRRLCACNNGGLVLVMYDIYFGFSDDVKNALVSEDR
FT                   EALRKGVSDVQAALDELMGALDFKYPLAGQLYPLYSYCKRLFSTVLYSLDVSVVDETDG
FT                   IMKKLRSSFETVAAGDKSAPLMDNAQKVYAGMTYGKGRLTESFINDDNRGFLA"
FT   gene            complement(46747..46959)
FT                   /locus_tag="EUBREC_0039"
FT   CDS_pept        complement(46747..46959)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0039"
FT                   /product="Hypothetical protein"
FT                   /note="Unknown cell location"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ACR73844"
FT                   /db_xref="InterPro:IPR019644"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z9J6"
FT                   /protein_id="ACR73844.1"
FT                   /translation="MKLFKETPVNDGYKTLQDDIKKTTDELQIVYTNLENVVEPDLIDY
FT                   YIYQAKAVSMRYKFLLNCAKRLNEV"
FT   gene            47241..47729
FT                   /locus_tag="EUBREC_0040"
FT   CDS_pept        47241..47729
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0040"
FT                   /product="Hypothetical protein"
FT                   /note="CytoplasmicMembrane, score:9.99; NOG16686 non
FT                   supervised orthologous group; HMMPfam:IPR000045"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ACR73845"
FT                   /db_xref="GOA:C4Z9J7"
FT                   /db_xref="InterPro:IPR000045"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z9J7"
FT                   /protein_id="ACR73845.1"
FT                   /translation="MLYILLTVAAIGDFKNYRISNRLILTGLGCAFLFRLVGGKVASII
FT                   WFLPDIVFPVVILYFLYLSGILGAGDIKLFSVVCAFTNLRFTALCMAAAFVAAAGYGLI
FT                   SMVLKKELFVRMRDGFLYLNGILCGRFMRYRGQGKAVSFAVYVLLGTAMADIWVYGMR"
FT   gene            47755..48753
FT                   /locus_tag="EUBREC_0041"
FT   CDS_pept        47755..48753
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0041"
FT                   /product="Hypothetical protein"
FT                   /note="Cytoplasmic, score:8.87"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ACR73846"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z9J8"
FT                   /protein_id="ACR73846.1"
FT                   /translation="MKKIRLGIYIEDSEYGDRLTCYFMNHYKVQLEIHMYTMKEQLEHL
FT                   EGEIDIMLSSELDQWNNKYIPLIQIVEETPIESEEGIYFVEKYQEVNRIVEEILKHVGG
FT                   EVRDLKSEGSLIGQTRLISVYSLADNQYQMPFAMTLSSILSENEKVLLMDFQENSGLSR
FT                   MLEQSVEHNLDELLVMAESGRYSTNRINSCIGRKHKLDYVYPIENTECLCEINTVICNN
FT                   LLQMLGKEMHYDCIVLNMGTRFKGFFDILDRCSDIYLVQKKGGISQWREYEFTEELMER
FT                   GLSNVVERIKLIEPPVITTPVSTCDKLVELWKWNEFGDVIRNMTRGISCAG"
FT   gene            48743..49960
FT                   /locus_tag="EUBREC_0042"
FT   CDS_pept        48743..49960
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0042"
FT                   /product="Flp pilus assembly protein"
FT                   /note="Cytoplasmic, score:8.87; COG4962 Flp pilus assembly
FT                   protein, ATPase CpaF; KEGG:K02283 Flp pilus assembly
FT                   protein; HMMPfam:IPR001482; BlastProDom:IPR001482;
FT                   ScanRegExp:IPR000217"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ACR73847"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z9J9"
FT                   /protein_id="ACR73847.1"
FT                   /translation="MLDDFGQRIRDIILSEMDLSRELSDEEICDLIGSVVSREARDRPM
FT                   TIKDRAELERTIFNSLRKLDVLQELVDDRDVTEIMVNGPNDIFYEKAGRIQRFKGHFSS
FT                   EEKLEDVIQQIVGRHNRVVNQASPIVDTRLSDGSRVNIVLNPISIGGSAVSIRKFPEHP
FT                   MSMERLVEIEALSPEVARLLQILTQAKYNIFISGGTGSGKTTFLNALSQYIPDDERIIT
FT                   IEDSAELQLLGAKNIVRLETRNANTDGVTPITIRDLIRTALRMRPDRIIVGECRGAEAL
FT                   DMLQAMNTGHDGSLSTGHANSPHDIISRIETMVLQGQDFPLNAIRQQIASGIDIIVQLG
FT                   RLRDKSRRVLEISEVDGFMDGEIVLHTLYRFEETAVLDSGRIQGFLKKAGTLCHTDKLM
FT                   AAGLSV"
FT   gene            50015..50791
FT                   /locus_tag="EUBREC_0043"
FT   CDS_pept        50015..50791
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0043"
FT                   /product="Hypothetical protein"
FT                   /note="Cytoplasmic, score:8.87; COG4965 Flp pilus assembly
FT                   protein TadB"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ACR73848"
FT                   /db_xref="GOA:C4Z9K0"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z9K0"
FT                   /protein_id="ACR73848.1"
FT                   /translation="MLLNSYEGFDYMDYSRYSMSTKDWGIVFIKSMAATVIIAYLFYDS
FT                   PIVVIAFPAVFAYCAKLCRQEGVRRQKEKLNEEFMNVLKVLSSNMLAGYSVENAWQEAE
FT                   KEMELMYGNDSLMLSEIREMNRQIKMNQTFEAVLSEFAHRSGLEDIVNFSDIFSFAKRS
FT                   GGRFVDIIESTTYRMWTKYDTNRQIEVAVSAKRLEQKTMNYIPIFLLAFLKLSSRDYMS
FT                   ALYGNLIGVIFMSTCLLAYAGAIKLAKKFLQVGIGI"
FT   gene            50788..52014
FT                   /locus_tag="EUBREC_0044"
FT   CDS_pept        50788..52014
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0044"
FT                   /product="Hypothetical protein"
FT                   /note="Unknown cell location; COG2064 Flp pilus assembly
FT                   protein TadC"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ACR73849"
FT                   /db_xref="GOA:C4Z9K1"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z9K1"
FT                   /protein_id="ACR73849.1"
FT                   /translation="MTGGKRLRIAALFVIVLVFAFIMDMSSNAITDNTLIRNDTGDGDA
FT                   VYDLVLNADGLDEDYSYQLKVMEEQPSDKQANELFTQAKKEIDDSFCEENQSVEQVRGH
FT                   VIMKDAYASGAVEAEWTLSDYDVVDINGDVNQDAFEEADDEQGKLISASVELSCGEHRQ
FT                   LYDFSFVVFPDELEAGERLIKDINRHIDSEMSKTGTKKLTLPDEVDGVKLSWSQEKSNT
FT                   AAKIAMLEVVVIVLLVLEKKEKKKTAQKERNIQLQLEYPEIVSKMAVLMGSGMTVEQAW
FT                   NRITARYLDERKNNDKNIMPAYEEMLVTEREISDGVTGRKAYAGFAERVKLPCYQKLVR
FT                   IILQSIHKGSKGVCEMLEKESEDAFDERRLLALKLGEEAGTKMLMPMMIMMAIVIAIVI
FT                   APAIIDFKI"
FT   gene            52027..52194
FT                   /locus_tag="EUBREC_0045"
FT   CDS_pept        52027..52194
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0045"
FT                   /product="Hypothetical protein"
FT                   /note="Unknown cell location"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ACR73850"
FT                   /db_xref="GOA:C4Z9K2"
FT                   /db_xref="InterPro:IPR031564"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z9K2"
FT                   /protein_id="ACR73850.1"
FT                   /translation="MLGFKNFLLDEDGAGVVEMILIIVVLIGLVLIFKKQLTTLVNNIF
FT                   QTISREAGKV"
FT   gene            52191..53765
FT                   /locus_tag="EUBREC_0046"
FT   CDS_pept        52191..53765
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0046"
FT                   /product="Hypothetical protein"
FT                   /note="Unknown cell location"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ACR73851"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z9K3"
FT                   /protein_id="ACR73851.1"
FT                   /translation="MRGSITIFATMLLMLVSQFLFTVLEAGRNLTLTNIACMNSEAVAE
FT                   SVFAQYCRPLWDEYHLLAYDAGSDAMGNVDIENVKSYMKKLTTDNFKISDSGAFAGGTI
FT                   VNGTSMLRLSMDELESMKYVLMTDDGGDVYTNAVVSYMKKNIGYETVKNLYSQYSSLNE
FT                   NKSAGEYDDSKIDSALKALKDNAAHEGGGKSIARSSPPRAYSAHLSVSKTKQTSESKAE
FT                   STEGGNAIENPLVKVQKVKASGILSQVVDESTVSGNSIDTSARVSGRSLHKGTGGWSES
FT                   GDDWYAKVLMQQYILTYMSCYTDTNPNHALNYEVEYIIGGRASDKDNLKIVIAEILALR
FT                   AAANMAYLAGSASKQAQAMALAAIIGGITLTPEVIEGVEKGILAAWAFCESVLDLRALL
FT                   DGDKIPLIKSDTSWTSSLYGMTSMLTGQVKAKSSNEGIGYKSYLGMLLFTKSMKNIAYR
FT                   SMDVQEATVRMTGAHESFRMDNAICELNADVSYKYHGIFLCFVNLLDGADNEYTIKNKA
FT                   KYSYYGR"
FT   gene            53787..54635
FT                   /locus_tag="EUBREC_0047"
FT   CDS_pept        53787..54635
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0047"
FT                   /product="Hypothetical protein"
FT                   /note="Unknown cell location"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ACR73852"
FT                   /db_xref="GOA:C4Z9K4"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z9K4"
FT                   /protein_id="ACR73852.1"
FT                   /translation="MKVSFVNKVKFHIKKLYRKAKLPGDDSSQKMPSCTCLKASYTLEA
FT                   AVIFPLVAGFFVFILFFFRVVQVESQVKAALYYSSRMSALASSANDSSVVSVATAEVLF
FT                   RSRISDSKHIDTYVSGGRYGVSLLGSSMDGDDVSLKAKYKVKLPVSFFTVDGIWIEDYS
FT                   NSRKWTGKNPGEKTDPYVFYTDYGSVYHLSEQCNYLDLSIKSIKWSHVGASRNKDGRKY
FT                   HACYCAADKKIEGSTVFITDYGTNYHGKLGCSKLKRTVHKVHKSEVNGKNLCSKCKGEG
FT                   T"
FT   gene            54632..55039
FT                   /locus_tag="EUBREC_0048"
FT   CDS_pept        54632..55039
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0048"
FT                   /product="Hypothetical protein"
FT                   /note="CytoplasmicMembrane, score:9.99; COG1989 Type II
FT                   secretory pathway, prepilin signal peptidase PulO and
FT                   related peptidases"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ACR73853"
FT                   /db_xref="GOA:C4Z9K5"
FT                   /db_xref="InterPro:IPR000045"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z9K5"
FT                   /protein_id="ACR73853.1"
FT                   /translation="MIQLIILLGIISIIDFSTKKIPVVVLVVMGIVGIASSFYAKQSII
FT                   SVAVALIPGIVLMAAAFLTGEQIGYGDAAVVTLMGLFVTADIVCSTMVMGLTIAGIISV
FT                   ILIASGRAGRKKQIAFTPFLLLGYGLTEVFM"
FT   gene            55040..55273
FT                   /locus_tag="EUBREC_0049"
FT   CDS_pept        55040..55273
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0049"
FT                   /product="Hypothetical protein"
FT                   /note="Unknown cell location"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ACR73854"
FT                   /db_xref="GOA:C4Z9K6"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z9K6"
FT                   /protein_id="ACR73854.1"
FT                   /translation="MENKLNVDLSYGLKGSYTVEGTIIIPIFIVMLAIAMKMGLVLYNE
FT                   MKADSSYEYATDMWLVDDFYNYQVLKEVVNEF"
FT   gene            55263..56456
FT                   /locus_tag="EUBREC_0050"
FT   CDS_pept        55263..56456
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0050"
FT                   /product="Hypothetical protein"
FT                   /note="Cytoplasmic, score:8.87; COG1716 FOG: FHA domain;
FT                   HMMPfam:IPR000253; HMMSmart:IPR000253;
FT                   superfamily:IPR008984"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ACR73855"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z9K7"
FT                   /protein_id="ACR73855.1"
FT                   /translation="MNSNEIVYERKMTGSFMKLRCDEVRPLDEKILLKNNIPGFLPMEK
FT                   CYVNNEGQYWYDISGVQSLEMRCQYNDIKLEFLEKLVVSICNKMELLENHLVSTESLVL
FT                   DPQLIHIKGVNQDEEIYFTAYPAQMKTICNTFSHLMEYMLTKLDHSDAEAIHIAYGIYE
FT                   KTINGNYSIADIRNAIIEERQKKVAEKPVEEVIAPISQPQVRVEEPKEQIKPTLYDKLR
FT                   VYLLEQLDIRLPERKKQASVIEKPKKPDINRKWFKKEKRKENREKLDDTMLIHPSSEAA
FT                   PEPVPRQIHPTVCLSDYREHPQGMLLYEGMENRSNIIIDKDCTRIGQGDEADAVIGKDT
FT                   ISHFHAVINRENQEFYLEDLNSTNGTFVNNEVLAYKQKKQLKSNDIIRFADVKYRFV"
FT   gene            56569..57147
FT                   /locus_tag="EUBREC_0051"
FT   CDS_pept        56569..57147
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0051"
FT                   /product="hypothetical protein"
FT                   /note="CytoplasmicMembrane, score:9.99; COG0705
FT                   Uncharacterized membrane protein (homolog of Drosophila
FT                   rhomboid); KEGG:K08641 hypothetical protein
FT                   HMMPfam:IPR002610; HMMPanther:IPR002610"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ACR73856"
FT                   /db_xref="GOA:C4Z9K8"
FT                   /db_xref="InterPro:IPR022764"
FT                   /db_xref="InterPro:IPR035952"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z9K8"
FT                   /protein_id="ACR73856.1"
FT                   /translation="MTIGIIVVNIIVFVLMSISGSTLDAQYMAAHGAMYPEYIKDGQYW
FT                   RLFTSMFMHFGLMHILNNMVVLGAVGQIVEKAMGHVKLLITFLVSGMCGSVLSYIVMLY
FT                   NNDYAVSAGASGAIFGLVGALVWIVIANRGFYEGVSRKQAVFMVILMIYYGVSTQGVDN
FT                   WAHGGGLVGGFVISIVLYRKKRYNKYNIN"
FT   gene            57171..58160
FT                   /locus_tag="EUBREC_0052"
FT   CDS_pept        57171..58160
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0052"
FT                   /product="Hypothetical protein"
FT                   /note="Cytoplasmic, score:8.87"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ACR73857"
FT                   /db_xref="InterPro:IPR003033"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="InterPro:IPR036527"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z9K9"
FT                   /protein_id="ACR73857.1"
FT                   /translation="MKINIYYGGRGLLDDPTLYVISRIENVLKELRVKVERYNIYEHKN
FT                   EIATLPQTFKDVDGIILATTVEWLGIGGYMQQFLDACWLYGDKEKISNTYMQPIVMSTT
FT                   YGEREAETTLCNAWEILGGLPCSGLCGYVEDITTFQLNKEYNLIIEKRAENLYRTISQK
FT                   IKSLPTSNQAVKQSVLRTQQLNLTPQESEQLSKYVSDDTYVKQQKEDIEELATMFKDML
FT                   GQQASTDDMPYIKELEAHFIPLREFKACYSFNIEGIKNPLYIKVDEDKLDIHYGEEDIV
FT                   DVYAKFSKSIMESIIDGHMTFQRAFMTGEMTAKGNFKTLRMLDQIFPF"
FT   gene            58216..58632
FT                   /locus_tag="EUBREC_0053"
FT   CDS_pept        58216..58632
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0053"
FT                   /product="cell cycle regulation histidine triad (HIT)
FT                   protein"
FT                   /note="Cytoplasmic, score:8.87; COG0537 Diadenosine
FT                   tetraphosphate (Ap4A) hydrolase and other HIT family
FT                   hydrolases; KEGG:K02503 cell cycle regulation histidine
FT                   triad (HIT) protein; HMMPfam:IPR001310; Gene3D:IPR011151;
FT                   HMMPanther:IPR001310; ScanRegExp:IPR001310;
FT                   superfamily:IPR011146"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ACR73858"
FT                   /db_xref="GOA:C4Z9L0"
FT                   /db_xref="InterPro:IPR001310"
FT                   /db_xref="InterPro:IPR011146"
FT                   /db_xref="InterPro:IPR019808"
FT                   /db_xref="InterPro:IPR036265"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z9L0"
FT                   /protein_id="ACR73858.1"
FT                   /translation="MKDDNCIFCKLANGDIPTNSIYEDDDFKVILDASPATKGHALILP
FT                   KQHYANIFEIEDETLAKAAKLAKKIMTHEKDVLGCEGYNLVQNNGEVAGQTVFHFHMHL
FT                   IPRYESDDNKNVIEWNHKEFTDDEMKKICDEMSM"
FT   gene            complement(58753..59829)
FT                   /locus_tag="EUBREC_0054"
FT   CDS_pept        complement(58753..59829)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0054"
FT                   /product="Glycosyltransferase Family 28-like
FT                   undecaprenyldiphospho-muramoylpentapeptide
FT                   b-N-acetylglucosaminyltransferases"
FT                   /note="Unknown cell location; COG0707
FT                   UDP-N-acetylglucosamine:LPS N-acetylglucosamine
FT                   transferase;
FT                   KEGG:0UDP-N-acetylglucosamine--N-acetylmuramyl-
FT                   (pentapeptide) pyrophosphoryl-undecaprenol
FT                   N-acetylglucosamine transferase HMMPfam:IPR004276;
FT                   HMMPfam:IPR007235; HMMTigr:IPR006009"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ACR73859"
FT                   /db_xref="GOA:C4Z9L1"
FT                   /db_xref="InterPro:IPR004276"
FT                   /db_xref="InterPro:IPR006009"
FT                   /db_xref="InterPro:IPR007235"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z9L1"
FT                   /protein_id="ACR73859.1"
FT                   /translation="MKKIVMTGGGTAGHVTPNIALMPALKEAGYDIEYIGSVNGMEKGL
FT                   IEAQKIPYHGISSGKLRRYFDWKNFTDPFRVLKGYGQAVSLMKKIKPDVVFSKGGFVSV
FT                   PVVLAAKHCHVPAIIHESDITPGLANKIAIKGAKKVCCNFPETMKYLPADKAVLTGSPI
FT                   RRELFSGVAENAIKLCNFPDHNKPVILIIGGSLGSKKVNEAVREILPELLKDFYVIHLC
FT                   GKGNLDNKLAGITGYAQFEYANAELTDMFALADMAISRAGANSICELLALHKPNILIPL
FT                   SAAASRGDQVLNAKSFKKQGFSYVIEEEELTKDSLLSAVKEVYGNRDKYKDAMAKSGQM
FT                   DSIATIIDLINSQVKKSS"
FT   gene            60083..60349
FT                   /locus_tag="EUBREC_0055"
FT   CDS_pept        60083..60349
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0055"
FT                   /product="Hypothetical protein"
FT                   /note="Cytoplasmic, score:8.87"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ACR73860"
FT                   /db_xref="GOA:C4Z9L2"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z9L2"
FT                   /protein_id="ACR73860.1"
FT                   /translation="MELSMDNMDIVAGGILAIMLALFMLTVIVTLFALSHRIRLLSNEI
FT                   YKIEKQVSDYIDELSRSESDKLEIEHKAHQNGVISSVLQEIFP"
FT   gene            60457..61692
FT                   /locus_tag="EUBREC_0056"
FT   CDS_pept        60457..61692
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0056"
FT                   /product="putative spore cortex-lytic enzyme"
FT                   /note="Unknown cell location; COG3773 Cell wall hydrolyses
FT                   involved in spore germination; KEGG:K01449 putative spore
FT                   cortex-lytic enzyme HMMPfam:IPR011105; HMMPfam:IPR013247;
FT                   HMMSmart:IPR003646"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ACR73861"
FT                   /db_xref="GOA:C4Z9L3"
FT                   /db_xref="InterPro:IPR003646"
FT                   /db_xref="InterPro:IPR011105"
FT                   /db_xref="InterPro:IPR042047"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z9L3"
FT                   /protein_id="ACR73861.1"
FT                   /translation="MEDYMKLNKKVIDSITVCGLCAMLTVTAVTNSGRSEVKAEDKVLA
FT                   NTGLEHTGYNSYAGVAATLFDYEKGLTAENAVTVEKENVEMVAAAQDAQQEAQPQLTQE
FT                   QQEWQTKLMPKVEESLNVRAQADEQSDIVGKLYKGSVADIVENDGTWAHIKSGNVDGYV
FT                   NVSYCVTGTDALSYAYDRCGEIATVNTDGLRVREAADTNSKALEVADQGKTYQVDRAAQ
FT                   AQDGWIAVVCDSQTGYIAADYATRSLNTRVGITIEEEQAQIAAQKEAERKAAEEKAAKE
FT                   AAKAAKESKKTETTQGEAVSAGADDLTLLAAIIECEAGGESYECQLAVGAAVINRVKSG
FT                   SYPNSISGVIYQKGQFGPASSGKLARKLSGRISSSCYSAAQEAMSGVDNTGGCTSFNDH
FT                   GSGISIGNMKFR"
FT   gene            61928..62917
FT                   /locus_tag="EUBREC_0057"
FT   CDS_pept        61928..62917
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0057"
FT                   /product="ornithine carbamoyltransferase"
FT                   /note="Cytoplasmic, score:9.98; COG0078 Ornithine
FT                   carbamoyltransferase; KEGG:K00611 ornithine
FT                   carbamoyltransferase HMMPfam:IPR006131; HMMPfam:IPR006132;
FT                   HMMTigr:IPR002292; ScanRegExp:IPR006130;
FT                   superfamily:IPR006130"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ACR73862"
FT                   /db_xref="GOA:C4Z9L4"
FT                   /db_xref="InterPro:IPR002292"
FT                   /db_xref="InterPro:IPR006130"
FT                   /db_xref="InterPro:IPR006131"
FT                   /db_xref="InterPro:IPR006132"
FT                   /db_xref="InterPro:IPR024904"
FT                   /db_xref="InterPro:IPR036901"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z9L4"
FT                   /protein_id="ACR73862.1"
FT                   /translation="MQLKGRNFLKLMDYTPEEITYLIDLSQELKEKKKKGIRHDELTGK
FT                   NIALIFEKTSTRTRCSFEVAAHDLGMHVTYLDPSGSQIGKKESIADTARVLGRMFDGIE
FT                   YRGYGQEIVEELAKYAGVPVWNGLTNEFHPTQMIADMLTIREHLGRLGGVKFVYMGDAR
FT                   YNMGNSLMVTCAKLGMDFVACTNKKYFPNDELVKYCKDVAETTGASITLTEDVAEGTKD
FT                   ADVIYTDVWVSMGEPEEVWAERINDLKPYQVNAKAFENAKDSAIFMHCLPAFHDLKTTI
FT                   GKQVYEKFGLSELEVTDEVFESERSVVFDEAENRMHSIKAIMRATLAD"
FT   gene            62971..63951
FT                   /locus_tag="EUBREC_0058"
FT   CDS_pept        62971..63951
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0058"
FT                   /product="putative transcriptional repressor of the biotin
FT                   operon birA"
FT                   /note="Cytoplasmic, score:8.87; COG0340 Biotin-(acetyl-CoA
FT                   carboxylase) ligase; KEGG:K01947 K03524 putative
FT                   transcriptional repressor of the biotin operon birA
FT                   HMMPfam:IPR003142; HMMPfam:IPR004143; HMMPfam:IPR013196;
FT                   Gene3D:IPR011991; HMMPanther:IPR004408; HMMTigr:IPR004408;
FT                   superfamily:IPR008988"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ACR73863"
FT                   /db_xref="GOA:C4Z9L5"
FT                   /db_xref="InterPro:IPR003142"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="InterPro:IPR004408"
FT                   /db_xref="InterPro:IPR008988"
FT                   /db_xref="InterPro:IPR013196"
FT                   /db_xref="InterPro:IPR030855"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z9L5"
FT                   /protein_id="ACR73863.1"
FT                   /translation="MKEEILRLLRSADGYISGQELCNRFRVSRTAVWKAINQLKEAGYE
FT                   IEAQQNKGYRLMAAPDLMTEAEIKSLMHTDWVAKEVLYFDTIDSTNIKAQELAEKGYPS
FT                   GTLVVADKQESGKGRRGRSWVSPSGTGIFMTLMIKPDINPNNASMLTLVAALAVAKAIT
FT                   SVTGEEALIKWPNDIVVNGKKVCGILTEMNAQFDYINHIVVGIGINVHNESFPEEISQM
FT                   ASSLMIEAGGKRFHRAQIIAETMSYFEQYYDTFLKTQDLSALVREYDELLVNRNKSVRV
FT                   LDPKEPFDGKAMGITPKGELIVDTWESRKLVSSGEVSVRGIYGYV"
FT   gene            63944..64279
FT                   /locus_tag="EUBREC_0059"
FT   CDS_pept        63944..64279
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0059"
FT                   /product="Hypothetical protein"
FT                   /note="Cytoplasmic, score:8.87"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ACR73864"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z9L6"
FT                   /protein_id="ACR73864.1"
FT                   /translation="MSKEVVLCVSNAYQKKYYLNENFNGLPQTIRDELKIMCVLYTEDV
FT                   GGILELVFDEDGNLDFRTSCKENDFFYDEIGSVLKIKQYRNERRELLESIETYYRIVFL
FT                   GEGLEEE"
FT   gene            64283..65065
FT                   /locus_tag="EUBREC_0060"
FT   CDS_pept        64283..65065
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0060"
FT                   /product="pantothenate kinase"
FT                   /note="Cytoplasmic, score:8.87; COG1521 Putative
FT                   transcriptional regulator, homolog of Bvg accessory factor;
FT                   KEGG:K03525 pantothenate kinase HMMPfam:IPR004619;
FT                   HMMTigr:IPR004619"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ACR73865"
FT                   /db_xref="GOA:C4Z9L7"
FT                   /db_xref="InterPro:IPR004619"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4Z9L7"
FT                   /protein_id="ACR73865.1"
FT                   /translation="MILALDVGNTNITCGVFDGDRIKASFRITTKMPRTSDEYGMLLST
FT                   LLERNQVGMDDIHDAIICSVVPNIMHSLQNGLIKYFNIRPIIVEAGIKTGIRIATPNPQ
FT                   QIGADRIVDAVAAYELYGGPVLVIDFGTATTYDMVDENGTFMGGITAPGIRISAKALWE
FT                   DAAKLPEIEIKKPDNILGKDTITSMQAGLVYGQIGQTEYIINKVKEETGMYDAKVVVTG
FT                   GLGRIISNETENVDVYDPDLTLKGINLVYRKQNRKGVK"
FT   gene            65070..66041
FT                   /locus_tag="EUBREC_0061"
FT   CDS_pept        65070..66041
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0061"
FT                   /product="tRNA-dihydrouridine synthase"
FT                   /note="Cytoplasmic, score:8.87; COG0042 tRNA-dihydrouridine
FT                   synthase; KEGG:0tRNA-dihydrouridine synthase
FT                   HMMPfam:IPR001269; Gene3D:IPR013785; HMMPIR:IPR001269;
FT                   HMMPanther:IPR001269; HMMTigr:IPR004652;
FT                   ScanRegExp:IPR001269"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ACR73866"
FT                   /db_xref="GOA:C4Z9L8"
FT                   /db_xref="InterPro:IPR001269"
FT                   /db_xref="InterPro:IPR004652"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018517"
FT                   /db_xref="InterPro:IPR024036"
FT                   /db_xref="InterPro:IPR035587"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z9L8"
FT                   /protein_id="ACR73866.1"
FT                   /translation="MDIHQIRKLQIGSVTLPNNLILGPMAGVTDLPFRLLCKEQGAGLL
FT                   CMEMVSAKAILYKNKNTESLLSIDEREKPVSLQMFGSDPQIMAQIAKQIEERPFDILDI
FT                   NMGCPVPKIVNNGEGSALMKNPLLAGQIIESIVKAIDKPVTVKIRKGFDDEHVNAVELA
FT                   HVAEESGASAVAVHGRTREQYYSGKADWDIIRQVKEAVSIPVIGNGDLLSAEDVIKMQE
FT                   QTGCDGFMIARGAQGNPWIFSQILHYFETGEHQEKPSFEEVRRMILRHARMMIEFKGEY
FT                   TGIHEMRKHTAWYTAGYPHSSRLRAAVNTVESLEQLEELLYK"
FT   gene            66345..66902
FT                   /locus_tag="EUBREC_0062"
FT   CDS_pept        66345..66902
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0062"
FT                   /product="transcription elongation factor GreA"
FT                   /note="Cytoplasmic, score:8.87; COG0782 Transcription
FT                   elongation factor; KEGG:K03624 transcription elongation
FT                   factor GreA; HMMPfam:IPR001437; BlastProDom:IPR001437;
FT                   Gene3D:IPR001437; HMMTigr:IPR006359; ScanRegExp:IPR001437;
FT                   superfamily:IPR001437"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ACR73867"
FT                   /db_xref="GOA:C4Z9L9"
FT                   /db_xref="InterPro:IPR001437"
FT                   /db_xref="InterPro:IPR006359"
FT                   /db_xref="InterPro:IPR018151"
FT                   /db_xref="InterPro:IPR022691"
FT                   /db_xref="InterPro:IPR023459"
FT                   /db_xref="InterPro:IPR028624"
FT                   /db_xref="InterPro:IPR036805"
FT                   /db_xref="InterPro:IPR036953"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z9L9"
FT                   /protein_id="ACR73867.1"
FT                   /translation="MGSFILANQHNKIKEKEDRRVRIMDNKKNILTYAGLKKLEDELEQ
FT                   LKVVKRKEVSQKIKEAREQGDLSENAEYDAAKDEQRDIEARIEEIEKILKNAEVVVEEE
FT                   VDLDKISIGCKIRILDCEFDEELEYKIVGSTEANSLKGKISNESPVGKALLGKKVGDTV
FT                   TVETQVGELTYKVLEIQRAEEN"
FT   gene            66915..68528
FT                   /locus_tag="EUBREC_0063"
FT   CDS_pept        66915..68528
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0063"
FT                   /product="lysyl-tRNA synthetase"
FT                   /note="Cytoplasmic, score:10.00; COG1190 Lysyl-tRNA
FT                   synthetase (class II); KEGG:K04567 lysyl-tRNA synthetase
FT                   HMMPfam:IPR004364; HMMPfam:IPR004365; Gene3D:IPR012340;
FT                   HMMPanther:IPR002313; HMMPanther:IPR004364;
FT                   HMMTigr:IPR002313"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ACR73868"
FT                   /db_xref="GOA:C4Z9M0"
FT                   /db_xref="InterPro:IPR002313"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018149"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z9M0"
FT                   /protein_id="ACR73868.1"
FT                   /translation="MANQNNNKGGQQQDVNQLLKVRREKLQNLQEAGKDPFQITKYNVT
FT                   HHSSDVKELYNAHEAEILGDRKAPDVEGLDDAAKREVINNDYNERREIMDAKPIEVSIA
FT                   GRMMFKRVMGKASFCNIQDLKGNIQVYVARDNVGEDSYADFKKSDIGDIYGVKGFAFRT
FT                   KTGEISIHAEEITLLSKSLQILPEKFHGLTDTDTRYRQRYVDLIMNQESKEVFIKRSQI
FT                   LKEIRNFLAGRDFMEVETPMLVSNAGGAAARPFETHYNALNEDVKLRISLELYLKRLIV
FT                   GGLERVYEIGRVFRNEGVDTRHNPEFTLMELYQAYTDYEGMMELTESMFRYLAEKVCGS
FT                   TKISYNGVEIDLGKPFARMTMIDAIKKYAGVDFDQVPDDAAAKKLADEHHIEYEERHKK
FT                   GDIVNLFFEEYCEKELIQPTFIMDHPIEISPLTKKKPSDPTKVERFELFCNTWEMCNAY
FT                   SELNDPIDQRERFAAQDANAAAGDDEAEHTDEDFLNALEIGMPPTGGIGYGIDRLVMLL
FT                   TDSQAIRDVLLFPTMKSLDK"
FT   gene            68768..69037
FT                   /locus_tag="EUBREC_0064"
FT   CDS_pept        68768..69037
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0064"
FT                   /product="Hypothetical protein"
FT                   /note="Unknown cell location; COG3451 Type IV secretory
FT                   pathway, VirB4 components"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ACR73869"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z9M1"
FT                   /protein_id="ACR73869.1"
FT                   /translation="MNESKNSEFVALLKQANTDSSKMAEVIGVSEAQLRFVTNTASGMG
FT                   LIKCGSVVIPFDNQISKDTDLYRLYNTNIHEKIAEQKKKEAMLQ"
FT   gene            complement(69629..70780)
FT                   /locus_tag="EUBREC_0065"
FT   CDS_pept        complement(69629..70780)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0065"
FT                   /product="Hypothetical protein"
FT                   /note="Cytoplasmic, score:8.87; NOG06536 non supervised
FT                   orthologous group; HMMPfam:IPR007069"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ACR73870"
FT                   /db_xref="GOA:C4Z9M2"
FT                   /db_xref="InterPro:IPR007069"
FT                   /db_xref="InterPro:IPR026889"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z9M2"
FT                   /protein_id="ACR73870.1"
FT                   /translation="MDKPTVQDIFHRFYPAYLDQYSPSPVQAKVAHNIMNCKTGAYGAN
FT                   VCVCEDCGFVQIHYNSCRNRCCPMCQAVPKEMWMDARREDVLDAPYFHLVFTVPDILNP
FT                   VIYSNQRLLYDALYHAASSTISELTADPKHLGAKVGYICILHTWGSEMNFHPHIHTILL
FT                   GGGLASNNQWKDNGENFFLPIRVISKMFRGKYLEELKRLWEEDKLVFQGTAEKFRNHYT
FT                   FKELLDSCYGMDWIPHCKKTFNGAQTVIKYLGKYTHRIAVSNHRIVRMDDDTVTFLVKD
FT                   YRNEGQWKELTISGVEFVRRFLMHVPPRHFVRIRHYGLLCSRTKSQKLTLCRNLLGCKK
FT                   YLSKLRDMEMPEILEHLYGIKVCVCKACGGHLGKPQMRMPLRC"
FT   gene            complement(70773..71621)
FT                   /locus_tag="EUBREC_0066"
FT   CDS_pept        complement(70773..71621)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0066"
FT                   /product="putative phage integrase/recombinase"
FT                   /note="Cytoplasmic, score:8.87; COG0582 Integrase;
FT                   KEGG:K04763 putative phage integrase/recombinase;
FT                   HMMPfam:IPR002104; HMMPfam:IPR004107; Gene3D:IPR013762;
FT                   superfamily:IPR010998; superfamily:IPR011010"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ACR73871"
FT                   /db_xref="GOA:C4Z9M3"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z9M3"
FT                   /protein_id="ACR73871.1"
FT                   /translation="MYEKYLLQLEEAGKIRNLKERSINCYKNYVSYFLNYMEKHPEELT
FT                   CQDVRDFLLAKKDNGLKATTLNLYNSAIRFFYRNVLHVLWDDITVPRMIIEHKLPTVLS
FT                   TDEIDRLLDATDDLKYKAMFATMYSSGMRVSEVIHLHYDDISRTNMQIHVRDTKNRMDR
FT                   YTILSERNLALLTEYWFRKGRPKGILFPNQFTGQYLTVSTLEQVIRRSASAAGLSGVTP
FT                   HCLRHSFATHLMEQGVEQRNIQALLGHRDPKSTEVYLHVSNKSIMGIRSPFDRKDGTAN
FT                   G"
FT   gene            71757..71885
FT                   /locus_tag="EUBREC_0067"
FT   CDS_pept        71757..71885
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0067"
FT                   /product="Hypothetical protein"
FT                   /note="Unknown cell location"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ACR73872"
FT                   /db_xref="GOA:C4Z9M4"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z9M4"
FT                   /protein_id="ACR73872.1"
FT                   /translation="MIVGCGDLTILLLGLGFHCFLFRKRKTASQPWQAIAQRFCSI"
FT   gene            71977..72672
FT                   /locus_tag="EUBREC_0068"
FT   CDS_pept        71977..72672
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0068"
FT                   /product="Hypothetical protein"
FT                   /note="Unknown cell location; COG1340 Uncharacterized
FT                   archaeal coiled-coil protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ACR73873"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z9M5"
FT                   /protein_id="ACR73873.1"
FT                   /translation="MIRAANLTQVTDYYKSNTVSKQNNTEKAKDVQPNAQKIKSSEDKL
FT                   SSKAQKYLETLRKDNADFDFIIADKGDDFRGLVDQSDKEFTVVFSSAELERMASDEKYA
FT                   REKLSTVKTAVEMSDKINEQFGFERAWGTTDNSGTVLNKLTMSFDDDGKMTLFADLEKI
FT                   TEKQKERLEELKEKRAEEKKQEKKDVTVKRTTIQANSKEELFEKISELDWSKITEEKAT
FT                   QGMKFDITI"
FT   gene            72705..73496
FT                   /locus_tag="EUBREC_0069"
FT   CDS_pept        72705..73496
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0069"
FT                   /product="Hypothetical protein"
FT                   /note="Cytoplasmic, score:8.87; COG5022 Myosin heavy chain"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ACR73874"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z9M6"
FT                   /protein_id="ACR73874.1"
FT                   /translation="MIAGTIRNAVNQMQLVNDWEQKKATGDVVKKQEGMTVTSQEESMI
FT                   QHFREQLERDKESSAYSQIYNKIASGQELTASEEDAIRQKDPKAYMEYKAARMEQEAYE
FT                   RRLERCKTKEEAQRLQVNEMNGNLAELKSIVNNPNIPKSEKLKEAQRIMGNTFRAVESF
FT                   TRFVKSTEYRDLPTEEEIVETSIEKGQVAEDSNDTEMSEQLTSDTTVSVDEAAKIVNDS
FT                   KRDLQLSDVHQIEKDVIEEMKDIEIKHFGEKKSSVRIDITV"
FT   gene            73621..75459
FT                   /locus_tag="EUBREC_0070"
FT   CDS_pept        73621..75459
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0070"
FT                   /product="Hypothetical protein"
FT                   /note="Unknown cell location; COG0791 Cell wall-associated
FT                   hydrolases (invasion-associated proteins);
FT                   HMMPfam:IPR000064"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ACR73875"
FT                   /db_xref="GOA:C4Z9M7"
FT                   /db_xref="InterPro:IPR000064"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z9M7"
FT                   /protein_id="ACR73875.1"
FT                   /translation="MRKLKIRKVDDKPMVIHTKEKAKIHAHEPKGAKIKGSNIYTVERG
FT                   PKTAGAKVTDTDRKKSYRKSTIHQSEPKNKGLSRFKQNLKESNTSIKTKNTNLHIAGRT
FT                   GALVAGAVTDQVEGGQEVSQAAYLAYEASRPVTGTASKGAALFRKKAAAEAKKRIKKVE
FT                   AGKKLAKKTAKKAAKDTAKTVAKETAKETAKTTAKVATKTATKAAATAAGTAVAPGVGT
FT                   AIGMAAGYAAGVSIEVKDEKMTNRSRKIKFFLDKMKAQENQTDSVAKLVKDLIVRKAIT
FT                   WVKAAAPIIGLVLLLLVLVVAMIAVPVIAVIAILYNSPFALFLPPLESGDTVQTVTSAY
FT                   VQEFNRDVNTKVNEHTGYDLGELVYVDYEGMEENPSNYYDIMAVYMVKHGVGDTATVMN
FT                   DTSKGWLQAVVNDMCSYTTSTGTKDVEETDADGNVTTVTKSVLYVNVTLKSYRDMISVY
FT                   GFDANQVEMLEQIMSADFMGQLGYAGSGSGGGGGSPGVSSMTEDEINAILSGITDSRQK
FT                   KVCSYALHRVGFPYSQDMRDSGNYYDCSSLAYYSWKDAGVDISYGGATTAAAEAQGLDE
FT                   AGKTVSFDELQPGDLIFYSFTSNGRYKNISHIKLVR"
FT   gene            75456..75746
FT                   /locus_tag="EUBREC_0071"
FT   CDS_pept        75456..75746
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0071"
FT                   /product="Hypothetical protein"
FT                   /note="Unknown cell location; HMMPfam:IPR001387;
FT                   HMMSmart:IPR001387; superfamily:IPR010982"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ACR73876"
FT                   /db_xref="GOA:C4Z9M8"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z9M8"
FT                   /protein_id="ACR73876.1"
FT                   /translation="MIRDIRKDKGLLIEEVAAKTGISVSTLGQVEQGGRNLSMKNLYML
FT                   MEVYETDANSLLAIDCTPDSLDSRLKRLPADKQDYLKKTFDFMIEQALKSA"
FT   gene            75757..76128
FT                   /locus_tag="EUBREC_0072"
FT   CDS_pept        75757..76128
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0072"
FT                   /product="Hypothetical protein"
FT                   /note="Cytoplasmic, score:8.87"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ACR73877"
FT                   /db_xref="GOA:C4Z9M9"
FT                   /db_xref="InterPro:IPR036162"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z9M9"
FT                   /protein_id="ACR73877.1"
FT                   /translation="MRRKIKKMDCIEYLSVQAPLEKVNMLEDKQSKYIHEFVKRKEYSI
FT                   VGKMRRNGFSQRDVDRQWNQIVNMIRKKQISGVVVANMAAISSSVADAYFKVGLVIEAG
FT                   GIVVTVDEGRLDMHIKKGA"
FT   gene            76131..76565
FT                   /locus_tag="EUBREC_0073"
FT   CDS_pept        76131..76565
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0073"
FT                   /product="Hypothetical protein"
FT                   /note="Cytoplasmic, score:8.87; Gene3D:IPR011067;
FT                   superfamily:IPR011067"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ACR73878"
FT                   /db_xref="GOA:C4Z9N0"
FT                   /db_xref="InterPro:IPR003477"
FT                   /db_xref="InterPro:IPR011067"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z9N0"
FT                   /protein_id="ACR73878.1"
FT                   /translation="MSRRTEKRKYGKYNKFDVVYADFGKNPHGIQGGIRPGIIISCDAS
FT                   NHDGAPQVSVVPLSSKLKDIPVHVILNPKDVSGFGLSKISDFMPEDAQTISKGCIRAKS
FT                   GTVIEDSGVREEIDRALIRQFDLLPVARKMVMEQSGDMSR"
FT   gene            complement(76645..77931)
FT                   /locus_tag="EUBREC_0074"
FT   CDS_pept        complement(76645..77931)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0074"
FT                   /product="transposase"
FT                   /note="Cytoplasmic, score:8.87; COG3547 Transposase and
FT                   inactivated derivatives; KEGG:K07486 transposase;
FT                   HMMPfam:IPR002525; HMMPfam:IPR003346; ScanRegExp:IPR001425"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ACR73879"
FT                   /db_xref="GOA:C4Z9N1"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z9N1"
FT                   /protein_id="ACR73879.1"
FT                   /translation="MLKINPLSTLYVGIDVSSKSNYVCALDFYKNKYINSSFANNQPGA
FT                   EELAKKILECLKEHPDLNTIVAALESTSVYSIHIANFLSSCEELMHFKPYVFVLNPKCT
FT                   ANYKKSYIGLGKSDPIDAFVIADYARAGNIETEPWRGSQFLALKRLTRHRLHLVECMTR
FT                   EKTYLVSNLYLKFSELQMLEGDDQPFCDIYGATSSSVLTEYLSPEEIIDSSEEDLISFL
FT                   AQKSRNRIKDISKTAELLRKAARDSYRLDKALYEPLNVSIASSFNCIETFKKEIKLIDI
FT                   AIEREIRGLNPNAFIILQSIDGIGPVFAGGIVAEIGDISAFHSSDALAKYAGLMWKSNQ
FT                   SGDFDGEDTPMSKAGNRYLRYYLGEAANSMRKHNVEYGAYYRKKYNEVPKHQHKRALAL
FT                   TSRKFVRLVYGLLARNQLYSGVSLDTSNE"
FT   gene            78069..78188
FT                   /locus_tag="EUBREC_0075"
FT   CDS_pept        78069..78188
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0075"
FT                   /product="Hypothetical protein"
FT                   /note="Unknown cell location"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ACR73880"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z9N2"
FT                   /protein_id="ACR73880.1"
FT                   /translation="MKHLCKRNVTYDSGCKLHKQAPETGLKGLKAVPLDIRLC"
FT   gene            78348..78560
FT                   /locus_tag="EUBREC_0076"
FT   CDS_pept        78348..78560
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0076"
FT                   /product="Hypothetical protein"
FT                   /note="Cytoplasmic, score:8.87"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ACR73881"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z9N3"
FT                   /protein_id="ACR73881.1"
FT                   /translation="MDSRTKKTNNKRFVRYSEGAEMYSMSVSKFMQLAKDAKACYKVNQ
FT                   LVLVNLDIIDEYLETFHIVDDEFYK"
FT   gene            78563..78682
FT                   /locus_tag="EUBREC_0077"
FT   CDS_pept        78563..78682
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0077"
FT                   /product="Hypothetical protein"
FT                   /note="Cytoplasmic, score:8.87"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ACR73882"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z9N4"
FT                   /protein_id="ACR73882.1"
FT                   /translation="MRNDALVIEEIQTSMEKNEPREKKCIDFRSDQKYNMIKI"
FT   gene            78696..78872
FT                   /locus_tag="EUBREC_0078"
FT   CDS_pept        78696..78872
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0078"
FT                   /product="Hypothetical protein"
FT                   /note="Unknown cell location"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ACR73883"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z9N5"
FT                   /protein_id="ACR73883.1"
FT                   /translation="MARTGRPKADKPFDHKVTVKFKEEEYQIMVEYAENHNLSISQLIR
FT                   MGVELQMKQQANQ"
FT   gene            78905..80140
FT                   /locus_tag="EUBREC_0079"
FT   CDS_pept        78905..80140
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0079"
FT                   /product="integrase/recombinase, XerC/CodV family"
FT                   /note="Cytoplasmic, score:8.87; COG4974 Site-specific
FT                   recombinase XerD; KEGG:K03733 integrase/recombinase,
FT                   XerC/CodV family; HMMPfam:IPR002104; HMMPfam:IPR004191;
FT                   Gene3D:IPR013087; Gene3D:IPR013762; superfamily:IPR010998;
FT                   superfamily:IPR011010"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ACR73884"
FT                   /db_xref="GOA:C4Z9N6"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004191"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR016177"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z9N6"
FT                   /protein_id="ACR73884.1"
FT                   /translation="MACRKDGKGRVLRKGEGYRKGDGRYSYVYIDPLGKKKTIYAKSLV
FT                   KLREREEQLQKDQLDGLDVYVAGKADVNFLFDRYISTKTELRSTTYSNYLYTWNHFIRD
FT                   TFGKKKVRDVKYSDVLFFYTDLINNQGLQINTLETINTVLRPTFQLAVRDDIIRKNPVD
FT                   GAYCEVKKRNGGARKTRRALTVDQQRKFMEYVAKNPFFYHWYPFFVFLLGTGCRIGEAI
FT                   GIRWDDIDLENRIIDINHSLTYYQRADDSYKCEFRVSLPKTEAGNRRIPMMQQVYDVLQ
FT                   EEYERQKQEGFCVENVDGMTNFVFTNRFGMPHNPAAVNRAIKRIVDTHNSEEEVAAKKE
FT                   KREPVMIPRFSCHIFRHTFASRFCENETNIKVIQEVMGHADVSTTMNIYAEANPDVTKS
FT                   VIEKLSKNMDIF"
FT   gene            80417..80875
FT                   /locus_tag="EUBREC_0080"
FT   CDS_pept        80417..80875
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0080"
FT                   /product="methionyl-tRNA synthetase"
FT                   /note="Cytoplasmic, score:9.98; COG0073 EMAP domain;
FT                   KEGG:K01874 methionyl-tRNA synthetase HMMPfam:IPR002547;
FT                   Gene3D:IPR012340"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ACR73885"
FT                   /db_xref="GOA:C4Z9N7"
FT                   /db_xref="InterPro:IPR002547"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z9N7"
FT                   /protein_id="ACR73885.1"
FT                   /translation="MKSIGGVKDENGVSSKPSEEVKAEPEKIDFSNVKIEPLFEEEVDF
FT                   DTFSKSDFRAVKVKECVAVPKSKKLLQFTLDDGTGTDRTILSGIHSFYEPEELVGKTLI
FT                   AITNLPPRAMMGIDSCGMLLSAIHEEEGEEKLHLLMVDDHIPAGAKLY"
FT   gene            81139..82023
FT                   /locus_tag="EUBREC_0081"
FT   CDS_pept        81139..82023
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0081"
FT                   /product="Hypothetical protein"
FT                   /note="Cytoplasmic, score:8.87; COG0789 Predicted
FT                   transcriptional regulators; HMMPfam:IPR000551;
FT                   HMMSmart:IPR000551; superfamily:IPR009061"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ACR73886"
FT                   /db_xref="GOA:C4Z9N8"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z9N8"
FT                   /protein_id="ACR73886.1"
FT                   /translation="MLLNEIINEVGMTKRAVKYYEEKGLLSVDKDNNGYRNYTAQDVET
FT                   LKKISVYRKLGISIKDIQSLLETGDKSILLRIYQEKVQEKVLKDSELEALKQFIDDGDA
FT                   DKANEALDYQTVENAIESLLPGKEWGDYFKSHFKPFLNVRLKTLEQKQALQNILEYCDE
FT                   TTLKVPFIMGIGAKMIGWIAQETRTADEMIAYYRDMSESEYERLKEKVWKGAKIKNGIM
FT                   KYHPAFIAQRKMQKELQNKGYNDIFIPNLMVLSPTYAEYKKALDNVNDRMCRELGLYYD
FT                   SNYNLVIKKDNSK"
FT   gene            82039..82260
FT                   /locus_tag="EUBREC_0082"
FT   CDS_pept        82039..82260
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0082"
FT                   /product="Hypothetical protein"
FT                   /note="Unknown cell location"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ACR73887"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z9N9"
FT                   /protein_id="ACR73887.1"
FT                   /translation="MGEEKSFSQRAFSIYTDIRKLQDKAKTSYTLSTRRLRFGYEQQFS
FT                   RSTPRAYYGMVGEELTAYLILEMAGAMR"
FT   gene            82257..82391
FT                   /locus_tag="EUBREC_0083"
FT   CDS_pept        82257..82391
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0083"
FT                   /product="Hypothetical protein"
FT                   /note="Unknown cell location"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ACR73888"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z9P0"
FT                   /protein_id="ACR73888.1"
FT                   /translation="MTPAELAKKDEFYSIYWSEYNLVKESGSPELYDKIHNRNNYADI"
FT   gene            82452..83192
FT                   /locus_tag="EUBREC_0084"
FT   CDS_pept        82452..83192
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0084"
FT                   /product="Hypothetical protein"
FT                   /note="Unknown cell location; COG0419 ATPase involved in
FT                   DNA repair"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ACR73889"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z9P1"
FT                   /protein_id="ACR73889.1"
FT                   /translation="MNVSTTTAAYANYQNNYKTGTANKKKETAQTTENTKLKENTTESI
FT                   AEKNLSKAAQKMLENLRGSRNDMDFMVADFENGDNAKDILAQSDKEYTVIFSKEEMEKM
FT                   ASDPKYYAEKMHSIEGVLRMTDEINAQFGFERAFGKTNDNADADTKITKFGISFNSDGT
FT                   TTFFAQLEKSSASQKEYLEKLQEKKAAEKKEAKKKEQSKQTEVRKTTVQANSKEELLDK
FT                   IKNIDWDSIKPEENKIGGRFDFSI"
FT   gene            83167..83880
FT                   /locus_tag="EUBREC_0085"
FT   CDS_pept        83167..83880
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0085"
FT                   /product="Hypothetical protein"
FT                   /note="Unknown cell location"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ACR73890"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z9P2"
FT                   /protein_id="ACR73890.1"
FT                   /translation="MEGLIFQSSEFGTDEIYANMEEYIMQITRDNYSQYAQMVQQMFGK
FT                   KASSNDPLAQCDYGNFSLRFKPVDINFTKPNWDTIMTKRDKPAMSEEEFDEAIKELARK
FT                   EFATGKRDDDAYRKLCMQHGETVSPDRKAIYESSMKKTGGKMNAACMFWDSKGNKTLSY
FT                   NPESRNWKAISTDEEFARARVFTSIYNDELARLKEEYGEKAKGNVSYSKIKVDISAERS
FT                   KEKNNNEGNTIDLQI"
FT   gene            84219..84365
FT                   /locus_tag="EUBREC_0086"
FT   CDS_pept        84219..84365
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0086"
FT                   /product="Hypothetical protein"
FT                   /note="Unknown cell location"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ACR73891"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z9P3"
FT                   /protein_id="ACR73891.1"
FT                   /translation="MNKRMLICIACGNGSIEYRIELSKTRRQKSSSNLYFFLLGYISVR
FT                   NEI"
FT   gene            84383..85096
FT                   /locus_tag="EUBREC_0087"
FT   CDS_pept        84383..85096
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0087"
FT                   /product="bacteriocin ABC transporter, ATP-binding protein,
FT                   putative"
FT                   /note="CytoplasmicMembrane, score:9.49; COG1131 ABC-type
FT                   multidrug transport system, ATPase component; KEGG:K09687
FT                   bacteriocin ABC transporter, ATP-binding protein, putative;
FT                   HMMPfam:IPR003439; BlastProDom:IPR003439;
FT                   HMMSmart:IPR003593; ScanRegExp:IPR003439"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ACR73892"
FT                   /db_xref="GOA:C4Z9P4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR022501"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z9P4"
FT                   /protein_id="ACR73892.1"
FT                   /translation="MEMMLQTQNLCKYFRKQKAVNNVSLNIEKGQIYGLLGPNGAGKST
FT                   TLKMLTGMMKPTAGKIYFDGKLLDRKDLSKIGALIENPPIYENLSARENLKVRQLLLGT
FT                   DENRIDEVLQIVSLTNTGKKKAGQFSLGMKQRLGIAMALLGEPELLILDEPTNGLDPIG
FT                   IEELRELIRSFPEQGITVILSSHILSEVQLLADKVGIISGGILGYEGALKQGDNLEDLF
FT                   MNVVRKNQKAGEIHG"
FT   gene            85089..85820
FT                   /locus_tag="EUBREC_0088"
FT   CDS_pept        85089..85820
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0088"
FT                   /product="bacteriocin ABC transporter, permease protein
FT                   subunit, putative"
FT                   /note="CytoplasmicMembrane, score:9.99; NOG17940 non
FT                   supervised orthologous group; KEGG:K09686 bacteriocin ABC
FT                   transporter, permease protein subunit, putative"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ACR73893"
FT                   /db_xref="GOA:C4Z9P5"
FT                   /db_xref="InterPro:IPR021205"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z9P5"
FT                   /protein_id="ACR73893.1"
FT                   /translation="MVNIIKAEHQKAKRTMRKKFIWGFPLLTFVMAFIFTLGMTNAYAE
FT                   SVWNWWYTLLLPGMIALFCYLSVAQEKKIKYYHLMTIPTDRRKLLLGKIIYIGYMILFS
FT                   NVIVFAGATLGGFLLTTHVPVKGALIAVLFLTVSELWEIPVALFLSERFGMIVNLFVCL
FT                   FITVSGVVISQTRIWYVLVSAIPMRMMCPLLHVLPNGLAAEAGNPLLDTGVIVPGMCLS
FT                   IIWFVFVTVLFLKWFERREVK"
FT   gene            85822..86562
FT                   /locus_tag="EUBREC_0089"
FT   CDS_pept        85822..86562
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0089"
FT                   /product="bacteriocin ABC transporter, permease protein
FT                   subunit, putative"
FT                   /note="CytoplasmicMembrane, score:9.99; NOG31276 non
FT                   supervised orthologous group; KEGG:K09686 bacteriocin ABC
FT                   transporter, permease protein subunit, putative"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ACR73894"
FT                   /db_xref="GOA:C4Z9P6"
FT                   /db_xref="InterPro:IPR022294"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z9P6"
FT                   /protein_id="ACR73894.1"
FT                   /translation="MIGRSLNADLRKMKGTSVILAHLLIPIITSVIFLIYYFFSPWNEN
FT                   MKVIAFYQAIGAGLPVLIGIFTASVMEQEQNAGDFQNLLSLPDKPAAFLSKLLMLLVLC
FT                   LCSILLTAIIFGIGFGRIASSDIEIMKGCIFAALLLWGSSVPLYLWQLILAFQFGKGVS
FT                   IGAGIISGLISALMLTGLGDHVWKYVFVCWTGRVPYTYLQSVLGETSVGEWLSFIPGCL
FT                   IFTGISMVYYFWWVNHWEGNRISE"
FT   gene            86577..87239
FT                   /locus_tag="EUBREC_0090"
FT   CDS_pept        86577..87239
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0090"
FT                   /product="hypothetical protein"
FT                   /note="Cytoplasmic, score:9.98; COG0745 Response regulators
FT                   consisting of a CheY-like receiver domain and a
FT                   winged-helix DNA-binding domain; KEGG:K07775 hypothetical
FT                   protein; HMMPfam:IPR001789; HMMPfam:IPR001867;
FT                   BlastProDom:IPR001789; BlastProDom:IPR001867;
FT                   HMMSmart:IPR001789; superfamily:IPR011006"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ACR73895"
FT                   /db_xref="GOA:C4Z9P7"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z9P7"
FT                   /protein_id="ACR73895.1"
FT                   /translation="MAKILAVDDEPAILEMIESILNKDGHLVTKVSNPLKINMEELHRY
FT                   DLILLDIMMPGIDGFELCKRIRALVDCPILFLTAKTEENSLVNGLSLGADDYISKPFGV
FT                   MELRARINAHLRREHREHSVRMVLGRVCIQISQKKLLVDDKELPLTKAEYEICEFLAKN
FT                   RGQVFSKEQILEAVFGFDNESNDSTIITHIKNIRAKFADYDYTPVKTVWGIGYKWEE"
FT   gene            87227..88603
FT                   /locus_tag="EUBREC_0091"
FT   CDS_pept        87227..88603
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0091"
FT                   /product="subtilin biosynthesis sensor protein SpaK"
FT                   /note="Unknown cell location; COG0642 Signal transduction
FT                   histidine kinase; KEGG:0subtilin biosynthesis sensor
FT                   protein SpaK HMMPfam:IPR003594; HMMPfam:IPR003661;
FT                   Gene3D:IPR003594; HMMSmart:IPR003594; HMMSmart:IPR003661;
FT                   superfamily:IPR003594; superfamily:IPR009082"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ACR73896"
FT                   /db_xref="GOA:C4Z9P8"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR008358"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z9P8"
FT                   /protein_id="ACR73896.1"
FT                   /translation="MGRVKRSNALSRIFMRYVLVMLGSLVGLVIVAYLLLYLLISVGCI
FT                   YPANYAEQKINEAYDTILRADKVTAEMIPALCDYVIFSENGEKIGGDLSEQYEQIAWNV
FT                   AKHGNASGKYFYKVIVRENEYVVLQYRLTPQYHSAFLREHFIGPQNVMIIMSVIGAVAI
FT                   IIIQSIRFGKRIKKQMQPVLDAIGQIKDQNLEYETSCSGIKEFDDCLSAIDDMRDALRE
FT                   SLEKQWKTEHEKKQQMSALAHDIKTPLTIVRGNAELLSETELTTEQKKNITYVLNGTTQ
FT                   IQSYVKQLIDVTKSWNCSDVTYTTVRLEDFFADIKEQALGLVEIYHQKIDWKAEQSDKK
FT                   VTIAYDPMFRAVMNMIQNAVEHTKENGIIYIDAKEQDGRLTFIVEDSGSGFTKEALLHG
FT                   TEQFFMDDTSRNGEAHYGMGLFFAKTVAEKYGGGIKLSNSENTGGARVEIFFLSSQETS
FT                   "
FT   gene            88707..89024
FT                   /locus_tag="EUBREC_0092"
FT   CDS_pept        88707..89024
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0092"
FT                   /product="Hypothetical protein"
FT                   /note="Cytoplasmic, score:8.87"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ACR73897"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z9P9"
FT                   /protein_id="ACR73897.1"
FT                   /translation="MNEEKVDIGDTKVDIENGKVDIQDKKVDIKSVLSEKGSDFSVKTT
FT                   IHIHRLFEKFGFDEVFGRSAVMELLELKGSGASKLLSNLVKADIIEPVSGHGKGKYKFK
FT                   K"
FT   gene            89231..89962
FT                   /locus_tag="EUBREC_0093"
FT   CDS_pept        89231..89962
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0093"
FT                   /product="septum formation inhibitor"
FT                   /note="Cytoplasmic, score:8.87; COG0850 Septum formation
FT                   inhibitor; KEGG:K03610 septum formation inhibitor;
FT                   HMMPfam:IPR005526; HMMTigr:IPR013033"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ACR73898"
FT                   /db_xref="GOA:C4Z9Q0"
FT                   /db_xref="InterPro:IPR005526"
FT                   /db_xref="InterPro:IPR013033"
FT                   /db_xref="InterPro:IPR016098"
FT                   /db_xref="InterPro:IPR036145"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4Z9Q0"
FT                   /protein_id="ACR73898.1"
FT                   /translation="MILEVLMSQSVTIKSNKYGINLILDADMPFADLIKAVVEKFKASA
FT                   NFFKNAKLAISFEGRHLSDEEQQQIIAAIEENTTIEILCIVESGTEQEAIMKEQVEAFN
FT                   EAVQKQCENVATVSVPEQFYRGTLRSGQVITSESSVTIIGDVNPGAKIIAQGNIVILGA
FT                   LKGNVHAGCTGDRSCFVFALDMQPIQIQIGDLIAKSPDEPQPKHRVRRKEKPAQEQAQI
FT                   AIAKDGYIYIEPITKNILNSI"
FT   gene            89985..90776
FT                   /locus_tag="EUBREC_0094"
FT   CDS_pept        89985..90776
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0094"
FT                   /product="septum site-determining protein MinD"
FT                   /note="Cytoplasmic, score:8.87; COG2894 Septum formation
FT                   inhibitor-activating ATPase; KEGG:K03609 septum
FT                   site-determining protein MinD; HMMPfam:IPR002586;
FT                   HMMTigr:IPR010223"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ACR73899"
FT                   /db_xref="GOA:C4Z9Q1"
FT                   /db_xref="InterPro:IPR010223"
FT                   /db_xref="InterPro:IPR025501"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z9Q1"
FT                   /protein_id="ACR73899.1"
FT                   /translation="MSEVIVITSGKGGVGKTTTTANIGTGLAQLNKKVVMIDTDIGLRN
FT                   LDVVMGLENRIVYNLVDVVEGKCRIRQALIKDKKYPDLCLLPSAQTRDKDAVTPEQMVE
FT                   LINELREEFDYILLDCPAGIEQGFKNAVAGADRALVVTTPEVSAIRDADRIVGLLEANE
FT                   MKRIDLIVNRLRVDMVKRGDMMNVDDVTEILAVNLIGAVPDDEQIVISTNRGEPLVGSD
FT                   SLAGKAYMNICRRIMGEEVPFLDLNQKHGVFEKLKDMFKKN"
FT   gene            90792..91073
FT                   /locus_tag="EUBREC_0095"
FT   CDS_pept        90792..91073
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0095"
FT                   /product="cell division topological specificity factor
FT                   MinE"
FT                   /note="Cytoplasmic, score:8.87; NOG22618 non supervised
FT                   orthologous group; KEGG:K03608 cell division topological
FT                   specificity factor MinE; HMMPfam:IPR005527;
FT                   HMMTigr:IPR005527"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ACR73900"
FT                   /db_xref="GOA:C4Z9Q2"
FT                   /db_xref="InterPro:IPR005527"
FT                   /db_xref="InterPro:IPR036707"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4Z9Q2"
FT                   /protein_id="ACR73900.1"
FT                   /translation="MGIMDLFKKKSSGNVAKDRLKLVLVSDRANCSSEMMEMMKRDIIE
FT                   VISRYMDIDAEALDVKITETESDSNNGMVPALVANIPIRDMKHRPDPR"
FT   gene            91373..91945
FT                   /locus_tag="EUBREC_0096"
FT   CDS_pept        91373..91945
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0096"
FT                   /product="Hypothetical protein"
FT                   /note="CytoplasmicMembrane, score:9.26; NOG18662 non
FT                   supervised orthologous group"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ACR73901"
FT                   /db_xref="GOA:C4Z9Q3"
FT                   /db_xref="InterPro:IPR024529"
FT                   /db_xref="InterPro:IPR030949"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z9Q3"
FT                   /protein_id="ACR73901.1"
FT                   /translation="MKKFVTLFTDSARELKSVRTITTMAMLAAVAVILGYFSIEYGQFI
FT                   RIGFSGIPNGIVDYLFGPVAGAVFHGALDIIKYLMKPTGPFCPQLTLVVMLAGVLYGCF
FT                   FYKKKLTIWRVLAAKFVVMLICNVILNTLCLQVLYGQAFMAILPMRALKNLIMWPIDSI
FT                   VFFGIAKALEQIGLFRTFRKQELVKNA"
FT   gene            92319..93533
FT                   /locus_tag="EUBREC_0097"
FT   CDS_pept        92319..93533
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0097"
FT                   /product="acetylornithine delta-aminotransferase"
FT                   /note="Cytoplasmic, score:8.87; COG4992
FT                   Ornithine/acetylornithine aminotransferase; KEGG:K00818
FT                   acetylornithine delta-aminotransferase HMMPfam:IPR005814;
FT                   Gene3D:IPR015421; Gene3D:IPR015422; HMMPanther:IPR004636;
FT                   HMMPanther:IPR005814; HMMTigr:IPR004636;
FT                   superfamily:IPR015424"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ACR73902"
FT                   /db_xref="GOA:C4Z9Q4"
FT                   /db_xref="InterPro:IPR004636"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z9Q4"
FT                   /protein_id="ACR73902.1"
FT                   /translation="MRLKDTGLTAQDIKDKVKKYMIETYERFDFIAETAEGMYLYDENG
FT                   TPYLDFYAGIAVNNAGSRNPKVVAAVKDQVDDIMHTFNYPYTIPQALLAEKVCKTIGMD
FT                   KIFYQNSGTEANEAMIKMARKYGIEKYGPNRYHIVTAKDGFHGRTFGAMSATGQPGNGC
FT                   QVGFGPMTYGFSYAPYNDLKAFKDACTENTIAIMIEPVQGEGGVHPATPEFMKGLREFC
FT                   DEKGMLLLIDEVQTGWCRTGAVMSYMNYGIKPDIVSMAKGLGGGMPIGAICATEEVSKA
FT                   FSAGSHGTTFGGHPVCCAAALAEVNELLDRDLAGNAKKVGDYFAAKLEKLPHVKEVRHQ
FT                   GLLVGVEFDDTISGVDVKHGCFDRHMLITAIGSHIIRMVPPLIVSEEECDKAFDIIKET
FT                   VESLS"
FT   gene            93694..94329
FT                   /locus_tag="EUBREC_0098"
FT   CDS_pept        93694..94329
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0098"
FT                   /product="cytidylate kinase"
FT                   /note="Cytoplasmic, score:8.87; NOG14451 non supervised
FT                   orthologous group; KEGG:K00945 cytidylate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ACR73903"
FT                   /db_xref="GOA:C4Z9Q5"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z9Q5"
FT                   /protein_id="ACR73903.1"
FT                   /translation="MAHLVITIGCEYGAKGNQIGKKVAKDLGIKFYDRDTVDEIIKEVG
FT                   IPKDIMEKVEEGITIAGKGAEGDVRGSFSKYADLTERAIHVQKTIIRKLSDRESCVIIG
FT                   RSADYILKEHKPILRIFIYSPDEVRIENVMKSHNLSEDDAKLFITEKDKRYHKRHMALT
FT                   GSNRGDRHNRDMLIDSSLLGVDGTAELIESLARKVVENESKTEAGGDK"
FT   gene            94329..95852
FT                   /locus_tag="EUBREC_0099"
FT   CDS_pept        94329..95852
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0099"
FT                   /product="cationic amino acid transporter"
FT                   /note="CytoplasmicMembrane, score:10.00; COG0531 Amino acid
FT                   transporters; KEGG:K03294 cationic amino acid transporter;
FT                   HMMPfam:IPR004841; HMMPanther:IPR002293"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ACR73904"
FT                   /db_xref="GOA:C4Z9Q6"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z9Q6"
FT                   /protein_id="ACR73904.1"
FT                   /translation="MEQKKSEFNKVLNAWDVLVIAFGAMIGWGWVVSTGGWIEKGGVLG
FT                   AAIGFVIGGIMIFFVGMTYAELTAAMPQCGGEHVFSYKAMGSTGSFICTWMIILGYVSV
FT                   ACFEACAFPTIITYLWPGFLKGYLYTVAGFDIYASWLIVAIVVAFLIMMINIIGAKTAA
FT                   ILQTVLTCIIGGAGILLIIASVINGTVDNLDGQMFAGSSAGLNVKAIIGVAALSPFYFI
FT                   GFDVIPQAAEEINVPAKKIGSILILSVVLAVVFYALVIVAVGLVMGPQAIVDSEQATGL
FT                   VTADAMAAAFNTKIMAKVIIVGGMCGIVTSWNSFMLGGSRAMYSMAESYMIPKFFAKLH
FT                   PKHKTPINALILIGSLTMLAPFAGRKMLVWISDAGNFGCCVAYCMVALSFIILRKKKPD
FT                   MPRPYKVPAYKFFGTMAVIMSGFMVAMYCIPGSGGTLIVQEWGIVLAWCALGVVFFVFC
FT                   KKKYKESFGTLVELISDEDAATLMPEADEVELDKVIDAAIDRVLAKKAS"
FT   gene            95875..97059
FT                   /locus_tag="EUBREC_0100"
FT   CDS_pept        95875..97059
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0100"
FT                   /product="alcohol dehydrogenase"
FT                   /note="Cytoplasmic, score:9.98; COG1454 Alcohol
FT                   dehydrogenase, class IV; KEGG:K00001 alcohol dehydrogenase
FT                   HMMPfam:IPR001670; ScanRegExp:IPR001670"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ACR73905"
FT                   /db_xref="GOA:C4Z9Q7"
FT                   /db_xref="InterPro:IPR001670"
FT                   /db_xref="InterPro:IPR018211"
FT                   /db_xref="InterPro:IPR039697"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z9Q7"
FT                   /protein_id="ACR73905.1"
FT                   /translation="METFNFSEPQDITVGKGSLSKLPEIAKKLGGKHALIISGPHLEKM
FT                   GLVKKAADYLASVDIKADTFTDIEANPSVTTVEKATAKYLESGADFIVAFGGGSPMDVA
FT                   KAVGVVAKYGGSVTDYEGAHKVPGPIVPLIAIPTTAGTGSEVTAFSVITDHSRNYKLTV
FT                   FSYEILPKYAILDAELITTAPASVAAACGIDAFIHAEEAYVSTAASPFSDALAEKAMAL
FT                   IGKNIRRFVANRNDIEAAEAMMTGSLFAGIAFSFARLGNVHAMSHPVSAFFDVPHGVAN
FT                   AVLLPVIAEYNALADHGKYLTIYNDIRPISAYADEFEPMMLVDAIRELCTDIGIPENLT
FT                   IAINNASKNGTVTKEEIESRIEPMAVDAMKSGNIAVNPRASRQCDIEMLYRKAL"
FT   gene            97085..97654
FT                   /locus_tag="EUBREC_0101"
FT   CDS_pept        97085..97654
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0101"
FT                   /product="Hypothetical protein"
FT                   /note="Cytoplasmic, score:8.87; COG1396 Predicted
FT                   transcriptional regulators; HMMPfam:IPR001387;
FT                   HMMPfam:IPR013096; Gene3D:IPR014710; HMMSmart:IPR001387;
FT                   superfamily:IPR010982; superfamily:IPR011051"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ACR73906"
FT                   /db_xref="GOA:C4Z9Q8"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z9Q8"
FT                   /protein_id="ACR73906.1"
FT                   /translation="MSMDYLSHNVSENLKRIRQSKGMSLDQVAEQTGVSKSMLAQIEKG
FT                   TANPSIGVLGKITSGLRIEFQRLIDPPRVDYALISPDDLVPTKELLGQYRVWTCFPYED
FT                   SREVEVYRIDVEPGGVYTSGGHGEKTREYLTVTDGVLTVECHDHVQEIHRGQVYKFETD
FT                   QPHLYRNDGDRVASCMCFFLDYTNIR"
FT   gene            complement(97660..99435)
FT                   /locus_tag="EUBREC_0102"
FT   CDS_pept        complement(97660..99435)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0102"
FT                   /product="Hypothetical protein"
FT                   /note="Cytoplasmic, score:8.87; NOG08812 non supervised
FT                   orthologous group; HMMPfam:IPR012547"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ACR73907"
FT                   /db_xref="InterPro:IPR012547"
FT                   /db_xref="InterPro:IPR018631"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z9Q9"
FT                   /protein_id="ACR73907.1"
FT                   /translation="MGFSVRRIQQMCKNGELPGAIKEGRKWLIPDETIHMNHFAKNKSL
FT                   PIGVSDFKLATTGYYYVDKTLMIRDFLDKKPMVSLFTRPRRFGKTLNMDMLRVFFEKTN
FT                   EDTSVYFKDKQIWQCGDYYTKHQGQYPVIFLTFKDVKSMTWEETFQKIRRLISLEFIRH
FT                   NELETSSVLTAYEKEQYHLLAGDSGDEVDCQMGLQLLSLLLHKHYGRECIIIIDEYDTP
FT                   IQQGHTCNFYPEIVNFMRNFFSGGLKDNPHLAFGFLTGILRVAKESIFSGMNNLKTYSI
FT                   LDDGYSSYFGFTEKEVKDMLRYYGKDDKYNELSEWYDGYRFGNTEIFNPWSVINYISDN
FT                   CFPKAFWQSTGSNEIIGEIIQAATPEITKDLYKLLCGEKIAAYIDTGVIYPEVQNNPYS
FT                   IYSFLLVAGYLKVANIYPQSDGNFMCDVAIPNKEITFVYEKEVLNRTNQNSLAISISQA
FT                   IFSKDTQKLQALLEDFMVKSISSIDGANEGFYHGMMLGLCAILGNRYKIRSNRESGLGR
FT                   FDIQLMPLTKGMPGFIFEFKHTKDEHTDLSALADSALQQIEAKKYDTELRDNGVNSIIS
FT                   IGIAFRGKSAVVRRG"
FT   gene            99687..101468
FT                   /locus_tag="EUBREC_0103"
FT   CDS_pept        99687..101468
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0103"
FT                   /product="hypothetical protein"
FT                   /note="CytoplasmicMembrane, score:10.00; COG1132 ABC-type
FT                   multidrug transport system, ATPase and permease components;
FT                   KEGG:K06147 hypothetical protein; HMMPfam:IPR001140;
FT                   HMMPfam:IPR003439; BlastProDom:IPR003439;
FT                   HMMSmart:IPR003593; ScanRegExp:IPR003439"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ACR73908"
FT                   /db_xref="GOA:C4Z9R0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z9R0"
FT                   /protein_id="ACR73908.1"
FT                   /translation="MMYVEKQIVLKRTSQEDTMQTLKKFIKYYKPYKTVFFIDLLCATI
FT                   ISAIDLAFPQLLRTLTKTLFAGAPGKIISALIPITIGLLVAYIIQTACRYYVTYAGHMM
FT                   GARMERDMRKELFDQYEKLSFSYYDQNNSGQMMSKLVSDLFDISELAHHGPENLFISLI
FT                   KIIGSFIFLFMINRMLAVPMLILVVLMLVFSYGQNKKMQETFMDNRRKIGDINSSLQDT
FT                   LAGIRVVQSFANERIEQEKFNRSNENFLISKDANYRCMGSFMSGNAFFQGMMYLVTLVF
FT                   GGFLIAHGRMEASDLAMYALYIGIFISPIQILVELTEMMQKGLSGFRRFLEVVETEPDI
FT                   VDAADAKPLKNVKGNVCYEDVSFHYSDDDTPVLSHVSFEIPAGKSIALVGPSGSGKTTI
FT                   CSLLPRFYDVTEGRVTIDGNDVRKLTLESLRSQIGLVSQDVYLFGGSIKDNIAYGKPDA
FT                   TMDEIVDAAKKANIHDFIMELPDKYDTFVGERGTRLSGGQKQRISIARVFLKNPPVLIL
FT                   DEATSALDNESERFIQKSLEELAKDRTTITIAHRLSTIRNADEILVVADCGIAERGTHE
FT                   ELLAQDGIYARYYDMSR"
FT   gene            101577..102050
FT                   /locus_tag="EUBREC_0104"
FT   CDS_pept        101577..102050
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0104"
FT                   /product="Hypothetical protein"
FT                   /note="Cytoplasmic, score:8.87"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ACR73909"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z9R1"
FT                   /protein_id="ACR73909.1"
FT                   /translation="MQAMFIDVDGTLSSPCYKVNGKFQIGMSDVQWADYCSKHGEDTYE
FT                   WCRPVMQVKEYAMKAKEKGTKLYVLTTSGTKIETAAKRRFLDRYYAGMFDDIYAVEHDD
FT                   DKVRFILKKAAELGIEPSDCELVEDTYRILLQTVTEGIKSTHITTILTGGCER"
FT   gene            102163..102438
FT                   /locus_tag="EUBREC_0105"
FT   CDS_pept        102163..102438
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0105"
FT                   /product="Hypothetical protein"
FT                   /note="Unknown cell location"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ACR73910"
FT                   /db_xref="GOA:C4Z9R2"
FT                   /db_xref="InterPro:IPR007412"
FT                   /db_xref="InterPro:IPR031316"
FT                   /db_xref="InterPro:IPR035890"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z9R2"
FT                   /protein_id="ACR73910.1"
FT                   /translation="MRIDAYNQIAQLYGVSRTTKTAKTQSASRMSDQVSISQAGRDYQI
FT                   AKKAVSEASDIREDKVALLKNMVDSGQYQVSGDDFASKLLERYNSL"
FT   gene            102483..102995
FT                   /locus_tag="EUBREC_0106"
FT   CDS_pept        102483..102995
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0106"
FT                   /product="Hypothetical protein"
FT                   /note="Cytoplasmic, score:8.87; NOG18796 non supervised
FT                   orthologous group"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ACR73911"
FT                   /db_xref="GOA:C4Z9R3"
FT                   /db_xref="InterPro:IPR007809"
FT                   /db_xref="InterPro:IPR036679"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z9R3"
FT                   /protein_id="ACR73911.1"
FT                   /translation="MASLVEELINVLTEEEKVYRTLAANGEKKRQIIIDADIPALEALT
FT                   DLDQQAGDELLIMSNKQVSLLTDIANVLGKSDEKMTVTRLIGYLGTQPDIQAKLTAARD
FT                   SLIEAAAQMKEINDLNSQLLAQAIELTEFDITLFKSMKQAPETANYDRNAYNTGDILGS
FT                   SGFDAKQ"
FT   gene            103019..104728
FT                   /locus_tag="EUBREC_0107"
FT   CDS_pept        103019..104728
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0107"
FT                   /product="flagellar hook-associated protein FlgK"
FT                   /note="Unknown cell location; COG1256 Flagellar
FT                   hook-associated protein; KEGG:K02396 flagellar
FT                   hook-associated protein FlgK; HMMPfam:IPR001444;
FT                   HMMPfam:IPR010930; FPrintScan:IPR002371; HMMTigr:IPR002371;
FT                   ScanRegExp:IPR001444"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ACR73912"
FT                   /db_xref="GOA:C4Z9R4"
FT                   /db_xref="InterPro:IPR001444"
FT                   /db_xref="InterPro:IPR002371"
FT                   /db_xref="InterPro:IPR010930"
FT                   /db_xref="InterPro:IPR019776"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z9R4"
FT                   /protein_id="ACR73912.1"
FT                   /translation="MANGFGSFYVGSSGLKNSQNALNTTANNMANVNTTGYVRQQVRFS
FT                   DKHYITRNNPTAGTNIQQSGLGVSVSDVAHVRDIFLDKSYRQENGRKGFYSTLYSTTSY
FT                   VEDIMQEMNGAEFKESISELWQAFQEYGKDPTNSTNQNLIIQKSELFLTRCNTVYSDLQ
FT                   KYQSNINLQIKDQVDRINEIGDKIYALNLEIQKTESGGVETAMTARDARDSLIDELAGY
FT                   AKIEAEEDSTGYVRIKLEGQQFVQDNKCNHIGLTEEKGTGFYTPYWPHITTQESYMPVF
FT                   SDVALPSALAERVGCTQTTNIATSLNNDIGSLKALLVSRGSEYGTYDFMSEENYSRVED
FT                   NVVMETQAEISYLARNIMMAMNDIFCPNTTYTAADGTTYTVLDTANCSVGADGSLPPHE
FT                   LFAREGYDRYTQMEIDGKQFYVYNDETKANNSSWYKLGNVSVNPKLAAQVTLMPSYKQD
FT                   GSANYGLADQITKAWSAENLYINPKDTSKCNFEGYYDKIISHLGTNGSIYKASSDTMTS
FT                   TAAAIDNQRNQIMGVSSDEELTNMIKYQSAYNASSRFITVISQMTELIVQLI"
FT   gene            104770..106623
FT                   /locus_tag="EUBREC_0108"
FT   CDS_pept        104770..106623
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0108"
FT                   /product="flagellar hook-associated protein FlgK"
FT                   /note="Unknown cell location; COG1256 Flagellar
FT                   hook-associated protein; KEGG:K02396 flagellar
FT                   hook-associated protein FlgK; HMMPfam:IPR001444;
FT                   HMMPfam:IPR010930; FPrintScan:IPR002371; HMMTigr:IPR002371"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ACR73913"
FT                   /db_xref="GOA:C4Z9R5"
FT                   /db_xref="InterPro:IPR001444"
FT                   /db_xref="InterPro:IPR002371"
FT                   /db_xref="InterPro:IPR010930"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z9R5"
FT                   /protein_id="ACR73913.1"
FT                   /translation="MASTFFGLHIGSSALSSFQVATNTTANNIANVKTTGYTRQEATLQ
FT                   AKDAINVTARYGSVGTGVTVTSIKQQRDLYYDNKYWENNSCYGRYEQKLYYMEQIQNYF
FT                   KDNGSSVKGFSSVFSQMFSDLDTLRSKPSDKTVRNQFISSAQSLCTYFNQMSDNLSKLQ
FT                   DDCNEEIRNNVDKINSISEKISLLNKEINQIETGTGVEASSLRDERANLIDSLSKIVNV
FT                   SYNETEVQNTNGDNLGGTNFSLYINGEKVVEGKDYRKLICESSKTKNNQTDNDDMYKIY
FT                   WEDTKMEFSATAGTAGGSLKALFEVRDGDNLENFKGKVTKADSYSLTVENTSIDNIKSL
FT                   NLPDKDGKITVNNISYSYDSWEAQVDAQGNIKSVTFNLSKDKAIADPEKTVAEGYLLNA
FT                   GSAINARGIPYYMTQLNEFVRNFSEMFNQIESKGQNLNGDTPPTFFEAITNTAKVYDFS
FT                   ESEAYSKLPDGQTATINSSSNTYYRMTAANFSVNKDVMNDVSLFATSTDYVKTDSCDIV
FT                   DELKKLQSEKTVYRGDKAESFLETIISNVSVDTEKAETYNKLYSNLEQTIANQRTSVSG
FT                   VDEDEEALNLVKFQYSYNMASKIISVMNQMLDKLINDTGVA"
FT   gene            106640..108172
FT                   /locus_tag="EUBREC_0109"
FT   CDS_pept        106640..108172
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0109"
FT                   /product="flagellar hook-associated protein FlgL"
FT                   /note="Unknown cell location; COG1344 Flagellin and related
FT                   hook-associated proteins; KEGG:K02397 flagellar
FT                   hook-associated protein FlgL; HMMPfam:IPR001492;
FT                   BlastProDom:IPR001029"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ACR73914"
FT                   /db_xref="GOA:C4Z9R6"
FT                   /db_xref="InterPro:IPR001029"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z9R6"
FT                   /protein_id="ACR73914.1"
FT                   /translation="MRITNNMIMGNTKTNINSTKVLVDKYNTQMTTQKKISKASEDPVI
FT                   AIRSLRLSTSLSHLDQYKDNNIPDASSWMDVTETALSNMKSLLTDIRTQCVNGSTDTLT
FT                   ADDRNTILQQLTALSEQVYTEGNADYAGRTVFTGYRTSSKLTFQKDTKSTYQITQEFSA
FT                   ADLSEKRYYTNGVTVPNSINAATPDCATDVTEHSFQRIRLGYGNTTDDVKLSIDGKELT
FT                   QGTDYTVYKSVSDFDPSKLSADDTAYIQETGEFVFGKNVAASIKNNEKKLSVTYVKTGF
FT                   DSSDARPEYYYNCKDITNAVTLDAGGNVPHDAAGDIIYSDPSKVVDFKFSSQEIKDTVA
FT                   NSTDITVNTQAKDVMDTGIKRDVDELIDVVQNAVNAHDKVSQIKKMMQQQQYSDKDSQA
FT                   KLKTYLEAAEQEADYADNNLQKTYSQYITRFDDHLNKVNLALTNSGSTKSRLTLIKNRV
FT                   EEQQTTIEELKSTNEDRDISDIIIDFYAMYNAYQSSLTAASKANSQTLLDYL"
FT   gene            108242..108706
FT                   /locus_tag="EUBREC_0110"
FT   CDS_pept        108242..108706
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0110"
FT                   /product="Hypothetical protein"
FT                   /note="Cytoplasmic, score:9.97; COG1699 Uncharacterized
FT                   protein conserved in bacteria; HMMPfam:IPR003775;
FT                   ScanRegExp:IPR002114"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ACR73915"
FT                   /db_xref="GOA:C4Z9R7"
FT                   /db_xref="InterPro:IPR003775"
FT                   /db_xref="InterPro:IPR024046"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z9R7"
FT                   /protein_id="ACR73915.1"
FT                   /translation="MRAKTRIFGEIDIPQDKIITMEKGMIGFSELKNYTLIYNSEKEND
FT                   KKSIMWLQSMDDGDIAFPVMTPDIIMPDYKPTVNEELLAPLGDLNEENMYVIVTVNVPS
FT                   DITKIACNLKAPIVVNTDSNKAAQLIVEDDYKVHFPIYDIIKGKKERAGE"
FT   gene            108708..108926
FT                   /locus_tag="EUBREC_0111"
FT   CDS_pept        108708..108926
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0111"
FT                   /product="probable carbon storage regulator"
FT                   /note="Unknown cell location; COG1551 Carbon storage
FT                   regulator (could also regulate swarming and quorum
FT                   sensing); KEGG:K03563 probable carbon storage regulator;
FT                   HMMPfam:IPR003751; BlastProDom:IPR003751;
FT                   HMMTigr:IPR003751"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ACR73916"
FT                   /db_xref="GOA:C4Z9R8"
FT                   /db_xref="InterPro:IPR003751"
FT                   /db_xref="InterPro:IPR036107"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4Z9R8"
FT                   /protein_id="ACR73916.1"
FT                   /translation="MLALTRKKGESLVINNDIEITILEIRGDQIKLGVSAPKEVPIYRK
FT                   EVYTQIQQENRKSADAQNAQALKELFG"
FT   gene            109120..109836
FT                   /locus_tag="EUBREC_0112"
FT   CDS_pept        109120..109836
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0112"
FT                   /product="Hypothetical protein"
FT                   /note="Cytoplasmic, score:8.87; COG0789 Predicted
FT                   transcriptional regulators; HMMPfam:IPR000551;
FT                   HMMSmart:IPR000551; superfamily:IPR009061"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ACR73917"
FT                   /db_xref="GOA:C4Z9R9"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z9R9"
FT                   /protein_id="ACR73917.1"
FT                   /translation="MISDAAAAVDVETHVLRYWEDELGLDVPRNELGHRYYTRDNIKQF
FT                   LRIKELKEKGYQLRAIRDMLHSDAPGEPLNPPNPAAMEKSVQPVNYTNITNQAAKQEMS
FT                   GYNPAYHDELPGYNHTYRSRTADERMDEFRELMSNIVGRAIALNNEELSQQISTEVQER
FT                   ILKEMNYLMREQDIAQEERYKKLDAAIRGNLRRKGLFSRKRNADMPADTKISAADTKGK
FT                   KGRDKTHTHELNPVRL"
FT   gene            110515..112023
FT                   /locus_tag="EUBREC_0113"
FT   CDS_pept        110515..112023
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0113"
FT                   /product="putative translation factor (SUA5)"
FT                   /note="Cytoplasmic, score:8.87; COG0009 Putative
FT                   translation factor (SUA5); KEGG:K07566 putative translation
FT                   factor (SUA5); HMMPfam:IPR000106; HMMPfam:IPR005145;
FT                   HMMPfam:IPR006070; HMMSmart:IPR000106; HMMTigr:IPR004388;
FT                   superfamily:IPR000106"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ACR73918"
FT                   /db_xref="GOA:C4Z9S0"
FT                   /db_xref="InterPro:IPR005145"
FT                   /db_xref="InterPro:IPR006070"
FT                   /db_xref="InterPro:IPR017945"
FT                   /db_xref="InterPro:IPR023485"
FT                   /db_xref="InterPro:IPR036196"
FT                   /db_xref="InterPro:IPR038385"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z9S0"
FT                   /protein_id="ACR73918.1"
FT                   /translation="METKIIKIDQDNLDHKLMQEAGDLIAAGELVAFPTETVYGLGGDA
FT                   LDPEASKKIYSAKGRPSDNPLIVHISDFSDLERIAKTVPEDARKLSDAFWPGPLTMIVE
FT                   KGDAVPYATTGGMDTVAVRMPNHPIALDLIRRSGCLIAAPSANTSGRPSPTEAAHVAED
FT                   LSGKIAMIIDGGPVGIGIESTIIDLTEDTPMVLRPGYITPQMLSKVLGKEVIIDPGIIA
FT                   ADDTRKPKAPGMKYKHYAPKADMVIVDGTRKHVIAKINELVASHRDDGKKIAVIATEET
FT                   KQFYDADVVLSMGSRADEDSIAHELYRILRDCDELDVDVIFSESFSTPRIGQAIMNRML
FT                   KAAGHQVIDTHVKYDKIIFVAQTGTCREQMAKGIMNDFVLKVPMEIEARGLVVQFPEPV
FT                   NQKAEAVLISNGISTEGMVSTQLEESDITESTMVFTMESSQRERIIESFADIDPEQVFV
FT                   LSQYVGDELEILDPYGGTLQSYGLCYESLRATLKKLVKLLNANT"
FT   gene            112071..112700
FT                   /locus_tag="EUBREC_0114"
FT   CDS_pept        112071..112700
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0114"
FT                   /product="uracil phosphoribosyltransferase"
FT                   /note="Cytoplasmic, score:8.87; COG0035 Uracil
FT                   phosphoribosyltransferase; KEGG:K00761 uracil
FT                   phosphoribosyltransferase HMMPfam:IPR000836;
FT                   HMMTigr:IPR005765"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ACR73919"
FT                   /db_xref="GOA:C4Z9S1"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005765"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR034332"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4Z9S1"
FT                   /protein_id="ACR73919.1"
FT                   /translation="MGKVVVMDHPLIQHKIGIMRRTDTGSKDFRTLVSEVAMLECYEAT
FT                   RDLELTDVEIETPICKATVKELKGKKLAVVPILRAGLGMVEGMLELIPAAKVGHIGMYR
FT                   DPETAEPIEYYCKLPADCANREVFVVDPMLATGGSAVAALDMLKKRGVKNIHFMCIIAA
FT                   PEGVKRLTEAHPDVDVYIGALDDHLNEHKYIVPGLGDAGDRIFGTK"
FT   gene            112806..113291
FT                   /locus_tag="EUBREC_0115"
FT   CDS_pept        112806..113291
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0115"
FT                   /product="dCMP deaminase"
FT                   /note="Cytoplasmic, score:8.87; COG2131 Deoxycytidylate
FT                   deaminase; KEGG:K01493 dCMP deaminase HMMPfam:IPR002125;
FT                   HMMPanther:IPR015517"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ACR73920"
FT                   /db_xref="GOA:C4Z9S2"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR015517"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR016473"
FT                   /db_xref="InterPro:IPR035105"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z9S2"
FT                   /protein_id="ACR73920.1"
FT                   /translation="MGASEKRKDYISWDEYFMGIAMLSGMRSKDPNTQVGACIVDPEHK
FT                   ILSMGYNGFPLGCSDDEFTWAREGEDNKYFYSTHSELNAILNYRGGSLEGATIYVTLFP
FT                   CNECAKAIIQSGIREVVYDCDKYEGTASVTASKRMLRAAGVTIRRYEHTDREVTLVL"
FT   gene            113425..113751
FT                   /locus_tag="EUBREC_0116"
FT   CDS_pept        113425..113751
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0116"
FT                   /product="Hypothetical protein"
FT                   /note="Unknown cell location"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ACR73921"
FT                   /db_xref="GOA:C4Z9S3"
FT                   /db_xref="InterPro:IPR032820"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z9S3"
FT                   /protein_id="ACR73921.1"
FT                   /translation="MKRDNKKEVMNALIMVFQFGINMIVPIFLCTLAGVWIGKKTGADW
FT                   VTVPLFFLGAFAGANNIYRMVQKFLKPEDDGRAVRQTPGRQSTTETEISDSISRVEKDV
FT                   KKNK"
FT   gene            113732..114163
FT                   /locus_tag="EUBREC_0117"
FT   CDS_pept        113732..114163
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0117"
FT                   /product="Hypothetical protein"
FT                   /note="CytoplasmicMembrane, score:9.26"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ACR73922"
FT                   /db_xref="GOA:C4Z9S4"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z9S4"
FT                   /protein_id="ACR73922.1"
FT                   /translation="MLKRINDALPGLVFGIVFYGIVVQLIGVWFVTDKISYSIGLWYGI
FT                   AIAVGIAVNIATVIYDATAIYGQKDANRRIVAKSLLRYIVVAVLLFILGLFDFGNLIMA
FT                   FVGMLGLKISAYLQPLFMKVTDRFSGRSDASSAGEMETE"
FT   gene            114203..114940
FT                   /locus_tag="EUBREC_0118"
FT   CDS_pept        114203..114940
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0118"
FT                   /product="AtpB"
FT                   /note="CytoplasmicMembrane, score:10.00; COG0356 F0F1-type
FT                   ATP synthase, subunit a; KEGG:K01550 AtpB
FT                   HMMPfam:IPR000568; FPrintScan:IPR000568;
FT                   HMMPanther:IPR000568; HMMTigr:IPR000568;
FT                   ScanRegExp:IPR000568; superfamily:IPR000568"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ACR73923"
FT                   /db_xref="GOA:C4Z9S5"
FT                   /db_xref="InterPro:IPR000568"
FT                   /db_xref="InterPro:IPR023011"
FT                   /db_xref="InterPro:IPR035908"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z9S5"
FT                   /protein_id="ACR73923.1"
FT                   /translation="MNQAILLESNADNIDFMIHGIFSIKVFGQEVWITTSHACILIVMA
FT                   IMVIFAIVANRKLKKAKEVPDGFQNIIELIVEMLDKMVEGTMGKWAPRFVNYISTIFIF
FT                   ILMSNISGLFGLRPPTADYGTTLALALITFFMIRFNKAKHQSAKDIWTGMCSPLPPWLP
FT                   IWAPINIISEIAIPISLSLRLFANVLSGTVIMALVYGLLRFIAIAWPSVLHVYFDLFSG
FT                   AIQTYVFCMLTMTYVTQACETDE"
FT   gene            114974..115228
FT                   /locus_tag="EUBREC_0119"
FT   CDS_pept        114974..115228
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0119"
FT                   /product="Hypothetical protein"
FT                   /note="Unknown cell location; COG0636 F0F1-type ATP
FT                   synthase, subunit c/Archaeal/vacuolar-type H+-ATPase,
FT                   subunit K; HMMPfam:IPR002379; Gene3D:IPR002379;
FT                   HMMTigr:IPR005953; ScanRegExp:IPR000454;
FT                   superfamily:IPR002379"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ACR73924"
FT                   /db_xref="GOA:C4Z9S6"
FT                   /db_xref="InterPro:IPR000454"
FT                   /db_xref="InterPro:IPR002379"
FT                   /db_xref="InterPro:IPR005953"
FT                   /db_xref="InterPro:IPR020537"
FT                   /db_xref="InterPro:IPR035921"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z9S6"
FT                   /protein_id="ACR73924.1"
FT                   /translation="MDINGQDLIRACSAIGAGLAVIAGIGPGVGQGIAAGHGAAAVGRN
FT                   PGARGQIMSTMLLGQAVAETTGLYGLVVALLLLFVHPLG"
FT   gene            115294..115824
FT                   /locus_tag="EUBREC_0120"
FT   CDS_pept        115294..115824
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0120"
FT                   /product="Hypothetical protein"
FT                   /note="Unknown cell location; COG0711 F0F1-type ATP
FT                   synthase, subunit b; HMMPfam:IPR002146; HMMTigr:IPR005864"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ACR73925"
FT                   /db_xref="GOA:C4Z9S7"
FT                   /db_xref="InterPro:IPR002146"
FT                   /db_xref="InterPro:IPR005864"
FT                   /db_xref="InterPro:IPR028987"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z9S7"
FT                   /protein_id="ACR73925.1"
FT                   /translation="MLAQGYTFLFNLDAQLLFDTVLLAVAVFFLFMLMSYLLFNPARKM
FT                   LKDRQDRIESDINTAIADKESAAALKAEYEGKLKDIDKEAEAILTDARQKALKNQNKIV
FT                   DDAKEEASRIIKRAREEAELEKKHAMDDMKQEMIQIASLMAQKAVAASITTDIQDTLVE
FT                   ETLKEMGESTWLS"
FT   gene            115812..116378
FT                   /locus_tag="EUBREC_0121"
FT   CDS_pept        115812..116378
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0121"
FT                   /product="ATP synthase, delta (OSCP) subunit"
FT                   /note="Cytoplasmic, score:8.87; COG0712 F0F1-type ATP
FT                   synthase, delta subunit (mitochondrial oligomycin
FT                   sensitivity protein); KEGG:K02113 ATP synthase, delta
FT                   (OSCP) subunit HMMPfam:IPR000711; Gene3D:IPR000711;
FT                   HMMPanther:IPR000711; HMMTigr:IPR000711;
FT                   superfamily:IPR000711"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ACR73926"
FT                   /db_xref="GOA:C4Z9S8"
FT                   /db_xref="InterPro:IPR000711"
FT                   /db_xref="InterPro:IPR026015"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z9S8"
FT                   /protein_id="ACR73926.1"
FT                   /translation="MAKLVSKVYGDALFEAALEDNRLSSLSDEVTAVKEIIAANDDLSK
FT                   LMDHPQIDKEEKVRIIEEIFGGRVSAELVGLMRMIIEKNHYKELTLVFDYFLDRVKEYQ
FT                   NIGTAYVTSAFELSKEQKLAVEKRLLDTTKYVKFEMHFEVDTALIGGMKIRIGDRVVDS
FT                   SVSSRLERLTRDLTKIQLKVGECAP"
FT   gene            116375..117880
FT                   /locus_tag="EUBREC_0122"
FT   CDS_pept        116375..117880
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0122"
FT                   /product="ATP synthase F1, alpha subunit"
FT                   /note="Cytoplasmic, score:8.87; COG0056 F0F1-type ATP
FT                   synthase, alpha subunit; KEGG:K01549 ATP synthase F1, alpha
FT                   subunit HMMPfam:IPR000194; HMMPfam:IPR000793;
FT                   HMMPfam:IPR004100; HMMPanther:IPR005294; HMMTigr:IPR005294;
FT                   ScanRegExp:IPR000194; superfamily:IPR000793;
FT                   superfamily:IPR004100"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ACR73927"
FT                   /db_xref="GOA:C4Z9S9"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR000793"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005294"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR023366"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033732"
FT                   /db_xref="InterPro:IPR036121"
FT                   /db_xref="InterPro:IPR038376"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z9S9"
FT                   /protein_id="ACR73927.1"
FT                   /translation="MNLKPEEISSVIKEQIKRYASQLEVADVGTVIQVADGIARIHGLE
FT                   NAMQGELLEFPGEVYGMVLNLEEDNVGAVLLGQQRNINEGDTVKTTGRVVEVPVGDAML
FT                   GRVVNALGQPIDGKGPIQSDKYRQIERVASGVISRKSVDTPLQTGIKAIDSMVPIGRGQ
FT                   RELIIGDRQTGKTAIAIDTIINQKGQGVKCIYVAIGQKASTVASIVNELEEFGAMSYTT
FT                   VVAATASELAPLQYIAPYSGCAIGEEWMENGQDVLIVYDDLSKHAAAYRTLSLLLKRAP
FT                   GREAYPGDVFYLHSRLLERAARLSDKLGGGSLTALPIIETQAGDVSAYIPTNVISITDG
FT                   QIYLETEMFNAGFRPAINAGLSVSRVGGSAQIKAMKKIAAPIRVELAQYRELAAFSQFG
FT                   SELDASTAEQLAQGARIKEILKQPQYKPMPVEKQVIIIYAATKKYLIDIKIEDILRFEA
FT                   ELFDFIDTRYPEIPEAIREKKVMDDDTEQALIKAIEECKKQFR"
FT   gene            117914..118774
FT                   /locus_tag="EUBREC_0123"
FT   CDS_pept        117914..118774
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0123"
FT                   /product="ATP synthase F1, gamma subunit"
FT                   /note="Unknown cell location; COG0224 F0F1-type ATP
FT                   synthase, gamma subunit; KEGG:K01549 ATP synthase F1, gamma
FT                   subunit HMMPfam:IPR000131; HMMPanther:IPR000131;
FT                   HMMTigr:IPR000131; ScanRegExp:IPR000131;
FT                   superfamily:IPR000131"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ACR73928"
FT                   /db_xref="GOA:C4Z9T0"
FT                   /db_xref="InterPro:IPR000131"
FT                   /db_xref="InterPro:IPR023632"
FT                   /db_xref="InterPro:IPR035968"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z9T0"
FT                   /protein_id="ACR73928.1"
FT                   /translation="MASMRDIKRRKSSITSTQQITKAMKLVSTVKLQKARAHAEATDPY
FT                   FNYMYRTVSSMLAKSGNLEHPYLKAGDSPRKAVVVLTSNRGLAGGYNGNIVKLITHGDF
FT                   KKEELDIYAVGAKGEELLTSKGYHIVESASEMMEDPTYEDAAALCKRVLKAFTDGQVGE
FT                   IYLAYTHFKNTVTQEAKLIKLLPVELDESGADEKEDSNILMNFEPNPEEALELIIPKYV
FT                   TSLFYGALVESFASENGARMQAMDSATSNAEDMISDLTLKYNRARQGSITQELTEIIAG
FT                   ANAIE"
FT   gene            118874..120265
FT                   /locus_tag="EUBREC_0124"
FT   CDS_pept        118874..120265
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0124"
FT                   /product="F0F1 ATP synthase subunit beta"
FT                   /note="Cytoplasmic, score:8.87; COG0055 F0F1-type ATP
FT                   synthase, beta subunit; KEGG:K02112 F0F1 ATP synthase
FT                   subunit beta HMMPfam:IPR000194; HMMPfam:IPR000793;
FT                   HMMPfam:IPR004100; HMMPanther:IPR005722;
FT                   HMMSmart:IPR003593; HMMTigr:IPR005722;
FT                   ScanRegExp:IPR000194; superfamily:IPR000793;
FT                   superfamily:IPR004100"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ACR73929"
FT                   /db_xref="GOA:C4Z9T1"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005722"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR024034"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036121"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z9T1"
FT                   /protein_id="ACR73929.1"
FT                   /translation="MADKNVGKIIQVISAVLDIKFSEGNLPEINDAVEVPLKNGGKLVV
FT                   EVAQHLGDDTVRCIAMGPTDGLVRGMDAIATGAPISVPVGENTLGRMFNVLGEPIDEVE
FT                   PPQTEEKWAIHRPAPSFEEQATSQEMLETGIKVVDLLCPYQKGGKIGLFGGAGVGKTVL
FT                   IQELIHNIATQHGGYSVFTGVGERTREGNDLYYEMKESGVIDKTTMVFGQMNEPPGARM
FT                   RVALAGLTMAEYFRDRGGKDVLLFVDNIFRFTQAGSEVSALLGRMPSAVGYQPTLQTEM
FT                   GALQERITSTKNGSITSVQAVYVPADDLTDPAPATTFAHLDATTVLERSIAELGIYPAV
FT                   DPLASTSRILDPRIVGQEHFEVAHAVQEILQKYKELQDIIAILGMDELSEEDKLVVSRA
FT                   RKVQRFLSQPFFVAGQFTGLEGKYVPIAETIRGFKEILEGKHDDVPESYFLNVGSIDEV
FT                   RAKMQ"
FT   gene            120280..120687
FT                   /locus_tag="EUBREC_0125"
FT   CDS_pept        120280..120687
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0125"
FT                   /product="F0F1-type ATP synthase epsilon subunit"
FT                   /note="mitochondrial delta subunit-like protein;
FT                   Cytoplasmic, score:8.87; COG0355 F0F1-type ATP synthase,
FT                   epsilon subunit (mitochondrial delta subunit); KEGG:K02114
FT                   F0F1-type ATP synthase epsilon subunit (mitochondrial delta
FT                   subunit) HMMPfam:IPR001469; BlastProDom:IPR001469;
FT                   Gene3D:IPR001469; HMMPanther:IPR001469; HMMTigr:IPR001469;
FT                   superfamily:IPR001469"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ACR73930"
FT                   /db_xref="GOA:C4Z9T2"
FT                   /db_xref="InterPro:IPR001469"
FT                   /db_xref="InterPro:IPR020546"
FT                   /db_xref="InterPro:IPR020547"
FT                   /db_xref="InterPro:IPR036771"
FT                   /db_xref="InterPro:IPR036794"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z9T2"
FT                   /protein_id="ACR73930.1"
FT                   /translation="MADNIFDIEIITPDRVFYKGETDFLEFNTQNGEIGVYKNHIPLTT
FT                   VLAPGIVTIHNGDEEKIAAIHSGFAEILGDKVTFLAELAEWPDEIDIDRAQAAKERAEQ
FT                   RLSNHTAEIDVKRAEFALRKALIRIDVAHHM"
FT   gene            complement(120797..121375)
FT                   /locus_tag="EUBREC_0126"
FT   CDS_pept        complement(120797..121375)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0126"
FT                   /product="Hypothetical protein"
FT                   /note="Unknown cell location"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ACR73931"
FT                   /db_xref="GOA:C4Z9T3"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z9T3"
FT                   /protein_id="ACR73931.1"
FT                   /translation="MGETIMGLLYAIFSIFITLFFPKQITNVICYGRHRDRENIKSKKI
FT                   YCLIYVFWTSFFGLFCLMMGSASGVNNTFDRVLDYYGLNFGEYDYFEAASIYDEHDYKH
FT                   EGDFTLVYYIRKNEDNLDDLIKQIVQENNSIYKRYQLSEIDVVSETKGIYYIYEKGEVI
FT                   AKVVVENDGLLKKVSYQWSREKLERNLGG"
FT   gene            121639..122076
FT                   /locus_tag="EUBREC_0127"
FT   CDS_pept        121639..122076
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0127"
FT                   /product="hypothetical protein"
FT                   /note="Cytoplasmic, score:9.65; COG0745 Response regulators
FT                   consisting of a CheY-like receiver domain and a
FT                   winged-helix DNA-binding domain; KEGG:K07659 hypothetical
FT                   protein; HMMPfam:IPR001867; BlastProDom:IPR001867;
FT                   Gene3D:IPR011991"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ACR73932"
FT                   /db_xref="GOA:C4Z9T4"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z9T4"
FT                   /protein_id="ACR73932.1"
FT                   /translation="MISYLFEFTTLYISVNFIYHNIKTTISFISCLVNFYQNPLIQKKN
FT                   LYIMHNNIVLKYDKKRVWHGEEEVHLTSREWKILELLAKNQGKIVTKEVILEQVWDIDE
FT                   NFVDTHAVTVVINRLRKKIENNMTEPVYIRNVFGVGYTFGE"
FT   gene            122117..123769
FT                   /locus_tag="EUBREC_0128"
FT   CDS_pept        122117..123769
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0128"
FT                   /product="Hypothetical protein"
FT                   /note="CytoplasmicMembrane, score:9.75; NOG08812 non
FT                   supervised orthologous group; HMMPfam:IPR012547"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ACR73933"
FT                   /db_xref="InterPro:IPR012547"
FT                   /db_xref="InterPro:IPR018631"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z9T5"
FT                   /protein_id="ACR73933.1"
FT                   /translation="MENSAKICFNRRYIAVKEMNAMGRFVNPGNSAFKVALASEIYIDK
FT                   TGLLDFTNSVLGTKQAYICNSRPRRFGKSITADMLTAYYSKGCDSRELFMNYNIAQTEY
FT                   FEKYLNKYDVIHLDMQWILMDAGAPERISGYINKNVISELADLYKDIDLRDQKTLYGAL
FT                   SVINSMTNNKFVIIIDEWDVLIRDEAANSSVQEEYINFLRGMFKGSEPTKYIELAFLTG
FT                   ILPIKKLKTQSALNNFDEYTMLYAGRLSPYIGFTEDEVRVICDRYGRDFSQVERWYDGY
FT                   MLGDCHVYNPRAVVNYMLQGDLKSYWSETGSYDVIVPLINLDFDGLKTAIIQMLSGGEI
FT                   KVNTGSFMNDTVSFKNKDDVLTYLVHLGYLGFDQKKSCAFIPNEEIRQELTTAVESTRW
FT                   KELITFENESLFLLDATLDMENDIVAKMIGQIHDEYASGIQYNNENSLSSVLTIAYLGA
FT                   MNYYFKPVRELPTGRGFADFVYIPKPEFAIDYPAMVVELKWNKTAKTAINQIREKQYMK
FT                   SIEQYTGNILLVGISYDKKTKKHQCIIEEYMKK"
FT   gene            123818..123964
FT                   /locus_tag="EUBREC_0129"
FT   CDS_pept        123818..123964
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0129"
FT                   /product="Hypothetical protein"
FT                   /note="Extracellular, score:8.82"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ACR73934"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z9T6"
FT                   /protein_id="ACR73934.1"
FT                   /translation="MSRRKRQKTGMINKEKENNSMTQETQTPQQTVDAQQMVIPQESER
FT                   ILT"
FT   gene            124043..124192
FT                   /locus_tag="EUBREC_0130"
FT   CDS_pept        124043..124192
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0130"
FT                   /product="Hypothetical protein"
FT                   /note="Unknown cell location; HMMPfam:IPR001469;
FT                   HMMPanther:IPR001469; superfamily:IPR001469"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ACR73935"
FT                   /db_xref="InterPro:IPR020547"
FT                   /db_xref="InterPro:IPR036794"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z9T7"
FT                   /protein_id="ACR73935.1"
FT                   /translation="MYTKTIDRAQAAKERAEQRLSNHTAEIDVKRAEFALRKALIRIDV
FT                   AHHM"
FT   gene            124173..124358
FT                   /locus_tag="EUBREC_0131"
FT   CDS_pept        124173..124358
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0131"
FT                   /product="Hypothetical protein"
FT                   /note="Unknown cell location"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ACR73936"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z9T8"
FT                   /protein_id="ACR73936.1"
FT                   /translation="MWHIICNYKIPESADKRISGIFNIRPINYFLFSLSNPADRHSFPE
FT                   RYDILSGKFLENYFFM"
FT   gene            complement(124373..125203)
FT                   /locus_tag="EUBREC_0132"
FT   CDS_pept        complement(124373..125203)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0132"
FT                   /product="Ada regulatory protein/6-O-methylguanine-DNA
FT                   methyltransferase"
FT                   /note="Cytoplasmic, score:9.98; COG2207 AraC-type
FT                   DNA-binding domain-containing proteins; KEGG:K00567 Ada
FT                   regulatory protein/6-O-methylguanine-DNA methyltransferase
FT                   HMMPfam:IPR000005; HMMPfam:IPR003313; Gene3D:IPR012287;
FT                   Gene3D:IPR014710; HMMSmart:IPR000005; ScanRegExp:IPR010916;
FT                   superfamily:IPR003313; superfamily:IPR009057"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ACR73937"
FT                   /db_xref="GOA:C4Z9T9"
FT                   /db_xref="InterPro:IPR003313"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="InterPro:IPR037923"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z9T9"
FT                   /protein_id="ACR73937.1"
FT                   /translation="MSNRKFNLDNEVQPEIHFRLLSISASKFENDWTSFPHSHHFTEIF
FT                   FIKDGTGRMLIENESLPVSSNSLVVIGAQVTHTEFSDPENPLDYYVLGVEGLKLNTDKE
FT                   PEYIHVPASANSPFIRQCFENILREMHNKQDRYAEICQHYLDILILYFCRKDHVSYEVV
FT                   DAQNSSRECHKVKRFIEHNYQSMISLDSLAENCSLSKYYLSHRFAELYGKSPIAYLNEV
FT                   RLASARDLLLTTNHSIEEIAGCIGFSSTSYFSQSFQKNFHESPQQFRKSHRVRT"
FT   gene            complement(125306..125425)
FT                   /locus_tag="EUBREC_0133"
FT   CDS_pept        complement(125306..125425)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0133"
FT                   /product="Hypothetical protein"
FT                   /note="Unknown cell location"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ACR73938"
FT                   /db_xref="GOA:C4Z9U0"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z9U0"
FT                   /protein_id="ACR73938.1"
FT                   /translation="MLFFTINSYVSFLTFVIIEYAISFSYPYIALYFIILALF"
FT   gene            125441..126787
FT                   /locus_tag="EUBREC_0134"
FT   CDS_pept        125441..126787
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0134"
FT                   /product="periplasmic protein"
FT                   /note="Unknown cell location; COG1653 ABC-type sugar
FT                   transport system, periplasmic component; KEGG:K10200
FT                   periplasmic protein; HMMPfam:IPR006059"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ACR73939"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="InterPro:IPR022387"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z9U1"
FT                   /protein_id="ACR73939.1"
FT                   /translation="MKKKILCTMISMVMVASLFAGCGTDSGKENSASDTSKTKEAGTTI
FT                   SVAAIETAYGSEMWQKVADAFTEETGIKVELTTDKKLEDVIGPSMQGGEYPDVIHLATG
FT                   REAALTEQFIKGHMITDITDVLSMKVPGEDKLVSEKIAGGFTDTSLTNPYGDGKTYLAP
FT                   MFYSPCGLFYNAGLLEEKGWDVPKTWDEMWELGDKAKEEGIYLFTYPTTGYFDAFFYAL
FT                   MYSAGGPEFFDKATNYAEGIWETPEAQTCFDIVAKLAEYTNPVTPAQANDQDFTQNQQL
FT                   VLDNKAIFMPNGTWIVGEMAEAPRADGFKWGMTALPAVKDGGDAYSYTWFEQAWIPSGA
FT                   EHQDAAKLFISYLYSDKACEIFAKAGAIQPVLGIADKLSGDNVMFYSIYDNGAKAAMGN
FT                   FAAFEAIPGVEVRTVFFDPVNSLVSGDMDEQAWIDGIISASDQMRANLK"
FT   gene            126896..127780
FT                   /locus_tag="EUBREC_0135"
FT   CDS_pept        126896..127780
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0135"
FT                   /product="putative permease protein"
FT                   /note="CytoplasmicMembrane, score:10.00; COG1175 ABC-type
FT                   sugar transport systems, permease components; KEGG:K10201
FT                   putative permease protein; HMMPfam:IPR000515"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ACR73940"
FT                   /db_xref="GOA:C4Z9U2"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z9U2"
FT                   /protein_id="ACR73940.1"
FT                   /translation="MKKARGRSGFLAVCIAPAVILFFVFMILPTLNVFRMSLFEKGAYS
FT                   PNETFVGLKNFKTLISDTNFIRSMQNMILLIVVVTIVTFAFALVFAGILSREQIRGQNF
FT                   FRIIFYIPNILSVVVIAGIFSAIYKPENGMLNSIIGLFHKMENPILWKGESLVIVSLII
FT                   AMIWQAIGYYMVMYMASMASVPKSLYESAGLDGAGRLVQFFQITIPLIWTNIRTTLTFF
FT                   IISTINMAFLFVKAMTSGGPNGASEVSLSYMYGQKDAGLYGYSMAIGVVIFIFSFALSA
FT                   LVNKVTEREPLEF"
FT   gene            127792..128682
FT                   /locus_tag="EUBREC_0136"
FT   CDS_pept        127792..128682
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0136"
FT                   /product="permease protein"
FT                   /note="CytoplasmicMembrane, score:10.00; COG0395 ABC-type
FT                   sugar transport system, permease component; KEGG:K10202
FT                   permease protein; HMMPfam:IPR000515; ScanRegExp:IPR006032"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ACR73941"
FT                   /db_xref="GOA:C4Z9U3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z9U3"
FT                   /protein_id="ACR73941.1"
FT                   /translation="MREKKNPNSAERLYKFFIYLVLIMLAVSIIIPVAWVFMASIKQNK
FT                   EFYGNPWTLPEGFYFQNFIDAWNTAKMGDYMLNSVLVTALALVILLIVALPAAYCLSRF
FT                   KFKGSKFLNAAFMGGLFINVNYIVVPIFLMLRDGDNWLKSVIGKSFLLNNLVILAIVYA
FT                   ATALPFTIYLLSGYFSTLAHDYEEAAYIDGAGYSTTMWKIIFPMAKPSIITIILFNFLS
FT                   FWNEYIISMTLMSSAKGPKTLPVGLLNLMQAQQSAAQYGIMYAGLVIVMLPTLILYICV
FT                   QNKLTQGMTVGGLKG"
FT   gene            128682..128903
FT                   /locus_tag="EUBREC_0137"
FT   CDS_pept        128682..128903
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0137"
FT                   /product="Hypothetical protein"
FT                   /note="CytoplasmicMembrane, score:9.75"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ACR73942"
FT                   /db_xref="GOA:C4Z9U4"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z9U4"
FT                   /protein_id="ACR73942.1"
FT                   /translation="MRREIKMEFWKKHTKCRIILMAALFIAGISLSVFGWGMTGKMTGL
FT                   GIMLIGIICLLIALWIYNCPFAEKKKRK"
FT   gene            128935..131100
FT                   /locus_tag="EUBREC_0138"
FT   CDS_pept        128935..131100
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0138"
FT                   /product="hypothetical protein"
FT                   /note="Cytoplasmic, score:8.87; NOG06132 non supervised
FT                   orthologous group; KEGG:K09162 hypothetical protein;
FT                   HMMTigr:IPR012711"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ACR73943"
FT                   /db_xref="GOA:C4Z9U5"
FT                   /db_xref="InterPro:IPR012711"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR035080"
FT                   /db_xref="InterPro:IPR035356"
FT                   /db_xref="InterPro:IPR035363"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z9U5"
FT                   /protein_id="ACR73943.1"
FT                   /translation="MSEKNTGRVTIPTNLDVVPETIELMKRWGADAIRDCDGTEFPEEL
FT                   TKTGAKIYATYYTTRKDNEWAKANPDEVQQCYIMSGFYTAVESELQIPLMKGISDELMQ
FT                   VNTRDDIKRWWEVVDRSTGQVVSTKQWEYNEESGCVCIHEAEPFHEYTVSFLAYIIWDP
FT                   VHMYNAVTNDWKDFEHQITFDVRQPKTHKYSMERLRKFCEEHPYVNVIRYTTFFHQFTL
FT                   MFDELKREKYVDWYGYSASVSPYILEQFEKEMGYKFRPEYIIDQGYYNNQYRVPGKEYK
FT                   DFQAFQRREVAKLAKEMVDITHECGKEAMMFLGDHWIGTEPFMEEFATIGLDAVVGSVG
FT                   NGSTLRLISDIEGVKYTEGRFLPYFFPDTFHEGGDPVKEAKENWVTARRAILRKPIDRI
FT                   GYGGYLKLALDFPEFLDYVESVCNEFRELYENAKGTTPYCVKKVAVLNSWGKIRSWGCH
FT                   MVHHALYQKQNYSYAGIIEALSGAPFDVKFISFDDILKDKDILKDIDVIINVGDGDTAH
FT                   TGGAVWENAVISTAIREFVYRGGGFIGVGEPAGHQYQGHYLQLADLIGVEKETGFTLNY
FT                   DKYNWEEHKNHFILADTTKPVDFGEGKKNMFAYEGTEILVQRDKEVQMAVHEFGEGRSV
FT                   YISGLPYSFENSRILYRSILWSTHGESLLHQWFSTNFNVEVHAYVKNGKFCVVNNTYEP
FT                   QNTVIYRGDGSSFALKMEANEIKWYAV"
FT   gene            131119..133125
FT                   /locus_tag="EUBREC_0139"
FT   CDS_pept        131119..133125
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0139"
FT                   /product="Hypothetical protein"
FT                   /note="Cytoplasmic, score:8.87; NOG04719 non supervised
FT                   orthologous group; superfamily:IPR011009"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ACR73944"
FT                   /db_xref="GOA:C4Z9U6"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z9U6"
FT                   /protein_id="ACR73944.1"
FT                   /translation="MKKPVLVIMAAGMGSRYGGMKQIDPVDEYGHIIVDFSIYDAYLAG
FT                   FEEVIFVIKRENVEDFHNVIGNRIEKIMKVRYAFQELENLPEGFEVPAGRVKPWGTAHA
FT                   ILSCKDMIDGPFAVINADDYYGREAFKQIYDYLSVHEDNDKYQYAMVGYQLKNTLTENG
FT                   SVARGVCDIDSNGKLVSVTEHTTIVKRGENAAYTEDDGKSYTDLSGDTIVSMNLWGFSK
FT                   GFLSEIAYGFRDFLQEGLQHNPLKCEYYLPSVVSRLLDSNKAEVKVLLTTEKWYGVTYR
FT                   EDKPMVMAAVKKLEENDFYPKQLCGKLEAAANFCFEGVYKEELPWGNGHINDTYRVTFE
FT                   NEQGVKKHYILQQMNKSIFKNPVELMENIVGVTEFLKRKISANGGNPERETLNVIPAKD
FT                   GKPYYVDSEGEYWRAYVFIENTVSYDLIDNPEILYEGGLAFGRFQSMLADYPAKTLHET
FT                   IPGFHDTRERFETFKKAVEEDVCSRADLVREEIQFVLDREEIVDCFQDLLRSGKISFRV
FT                   THNDTKINNVLMDKDTKKGICVIDLDTVMPGVAMNDFGDAVRIGASTALEDEQNLDKVW
FT                   CDLELFEACAKGFIEGCGGKLSQEEIKLLPMGARLMTYECGMRFLMDYIQGDIYFKIHR
FT                   PGQNLDRARTQFKLVSDMEHKWKVMENIVKKYM"
FT   gene            complement(133158..133376)
FT                   /locus_tag="EUBREC_0140"
FT   CDS_pept        complement(133158..133376)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0140"
FT                   /product="Hypothetical protein"
FT                   /note="Unknown cell location; COG1827 Predicted small
FT                   molecule binding protein (contains 3H domain);
FT                   HMMPfam:IPR004173; Gene3D:IPR004173"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ACR73945"
FT                   /db_xref="GOA:C4Z9U7"
FT                   /db_xref="InterPro:IPR004173"
FT                   /db_xref="InterPro:IPR026043"
FT                   /db_xref="InterPro:IPR035922"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z9U7"
FT                   /protein_id="ACR73945.1"
FT                   /translation="MNIRTRRDVKKFLEGLSTGSSSLLKNVTGGYHYHTIEAESEEILD
FT                   DIQNELAEKGFLMQSRRQSGISGTDAF"
FT   gene            133590..133796
FT                   /locus_tag="EUBREC_0141"
FT   CDS_pept        133590..133796
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0141"
FT                   /product="Hypothetical protein"
FT                   /note="Unknown cell location"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ACR73946"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z9U8"
FT                   /protein_id="ACR73946.1"
FT                   /translation="MVVLTSECPNSSCTSFGAAPFLSFFSYRSFCHNRVSPFDIRQSEL
FT                   VKCFLRLSISFLIKNTARKIADA"
FT   gene            complement(133971..134663)
FT                   /locus_tag="EUBREC_0142"
FT   CDS_pept        complement(133971..134663)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0142"
FT                   /product="Hypothetical protein"
FT                   /note="Unknown cell location"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ACR73947"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z9U9"
FT                   /protein_id="ACR73947.1"
FT                   /translation="MEASMKHNNLIIMSALALVISLTGCGNTNKLSEYDMTGISFIEYT
FT                   DIDTVCEDEELITAGSNLLSDQEDNLLLSYVVDSAIELSTELGDYDHLVFTNPKWIENF
FT                   GDSGKLKPIEYSSLSKSMQEFLDSQMPILTNDGSVLPEGTGLYEYEGGGLLAFPINVTL
FT                   GSAKPIEAKNPLVMLIDNPAEILKADSCMLPLTSSGNVLFLDSDNLQQAFENSELKDYG
FT                   DIQKFNKK"
FT   gene            135289..136410
FT                   /locus_tag="EUBREC_0143"
FT   CDS_pept        135289..136410
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0143"
FT                   /product="Hypothetical protein"
FT                   /note="CytoplasmicMembrane, score:7.63; KOG0946 ER-Golgi
FT                   vesicle-tethering protein p115"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ACR73948"
FT                   /db_xref="GOA:C4Z9V0"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z9V0"
FT                   /protein_id="ACR73948.1"
FT                   /translation="MSRRKRQKTGMINKEKENNSMTQETQTPQQTVDAQQMVIPQESER
FT                   IQRAEWIHEQVKLQREAEDEAWEKIMEEQKLLTERRRSIDADINSNRELKRYHEDCMED
FT                   ITDQVYSLHGISVDKLEGIKEYRNALFRGEAFIVFCISVIMAAIVAYAYGPTSQLCLYV
FT                   LMCVGAEGALLSQKRKNILFFIPLILIAAEMAGYKLYPQYLEYVTMAGEALALLLMMIG
FT                   TVGYFVHNPYRKDRKNIKAAKSDLKELHKVAKKSVKKNKKSRIKNEAKEAKLAAKQAKR
FT                   ETKAAIKEQKRQNKLAKKQARYELKEKKRQQKSERVELKHELKKTQLMDKVRRFTPKEQ
FT                   ESESTSSAESIDNNITENNIIENNIIDIERKVN"
FT   gene            complement(136424..138271)
FT                   /locus_tag="EUBREC_0144"
FT   CDS_pept        complement(136424..138271)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0144"
FT                   /product="asparagine synthase (glutamine-hydrolyzing)"
FT                   /note="Cytoplasmic, score:8.87; COG0367 Asparagine synthase
FT                   (glutamine-hydrolyzing); KEGG:K01953 asparagine synthase
FT                   (glutamine-hydrolyzing) HMMPfam:IPR000583;
FT                   HMMPfam:IPR001962; Gene3D:IPR014729; HMMTigr:IPR006426"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ACR73949"
FT                   /db_xref="GOA:C4Z9V1"
FT                   /db_xref="InterPro:IPR001962"
FT                   /db_xref="InterPro:IPR006426"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR033738"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z9V1"
FT                   /protein_id="ACR73949.1"
FT                   /translation="MCGIAGFCNFKEDFEENTDYWNFRLEKMRAVLAHRGNDARGRYLK
FT                   KHIGLSHSRLAIRDILCGDQPMTRTHNGYEYTICYNGEIYNTDELIPELSENGFVCSTT
FT                   SDTEVILYAYIHWGADFVNRLNGIFAFAIWDAAKSRLILYRDRVGVKPLFYAIRGDSLV
FT                   FGSEPKACFAHPAVKPELDKQGLQELLAIGPAHTSGLSLFKDLFEVLPGHFMIYSRDGL
FT                   HDETYWELTSREHTESYRDTVAHTRFLVEDAIKRQMVSDVPVCTFLSGGIDSSIVTAIA
FT                   ANYMNTRGKTLNTFSFDFKDNDRYFKANAFQPERDLPYVNRMLEEYETAHSYLECDENS
FT                   LFKALFAAVDAKDMPGMTDVDSSLLYFCSLVSRKNKVALTGECADEIFGGYPWFYRKEL
FT                   LERYGFPWSSDVAPRLALLRDDVGLELDLSSYQAFRYEESRSKAPLLYGEDGEDESRRI
FT                   IGYLNIKWFMQTLLDRMDRTSMYSELEARVPFADHRIIEYVFNVPWHMKYQNGVEKTLL
FT                   RDAFSDVLPPELLHRKKSPYPKTYHPGYEALLIKGMEEILDSPNAPVRTLIDADKTREF
FT                   LKAPAEYGSPWFGQLMAGPQLIAYFIQINYWMEKYQLSA"
FT   gene            138584..139300
FT                   /locus_tag="EUBREC_0145"
FT   CDS_pept        138584..139300
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0145"
FT                   /product="hypothetical protein"
FT                   /note="CytoplasmicMembrane, score:9.49; COG1136 ABC-type
FT                   antimicrobial peptide transport system, ATPase component;
FT                   KEGG:0hypothetical protein; HMMPfam:IPR003439;
FT                   BlastProDom:IPR003439; HMMSmart:IPR003593;
FT                   ScanRegExp:IPR003439"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ACR73950"
FT                   /db_xref="GOA:C4Z9V2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z9V2"
FT                   /protein_id="ACR73950.1"
FT                   /translation="MSEEERKFLEIVDLKKGFGSGETRQEVLRGMNFSVAKGEFCVLLG
FT                   PSGSGKSTLLNIIGGIDSADSGYISINGDKLKDMSEKKLTQYRRKHLGYVFQMYNLIAN
FT                   LNVKENIEVGAYLSDNALDIDELLHTLGLYEHRYKLPNQLSGGQQQRVSIGRAIVKNPD
FT                   ILLCDEPTGALDYNTSKEILKLIEDVNKKYGNTIIMVTHNEAIKNMADHVIKLRDGAVR
FT                   HNDINTNKVSAEELEW"
FT   gene            139315..141684
FT                   /locus_tag="EUBREC_0146"
FT   CDS_pept        139315..141684
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0146"
FT                   /product="predicted permease"
FT                   /note="CytoplasmicMembrane, score:9.99; COG0577 ABC-type
FT                   antimicrobial peptide transport system, permease component;
FT                   KEGG:0predicted permease; HMMPfam:IPR003838"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ACR73951"
FT                   /db_xref="GOA:C4Z9V3"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR025857"
FT                   /db_xref="InterPro:IPR038766"
FT                   /db_xref="UniProtKB/TrEMBL:C4Z9V3"
FT                   /protein_id="ACR73951.1"
FT                   /translation="MSRKKIKNPLIKRIPKEIIGDWKKYLVVFLFLVLTIGFVSGMYVA
FT                   NDSMLTSADEGVSKYKQEDGHFELKDKADSELVTAIESGEVKTAPDEKDSDSSKTPVKL
FT                   YENFYRNETEDYDADGKKDGTIRVYTKTGNINLACLIEGSFPQNENEIAVDRMHADNVG
FT                   MKVGDTIKVSGKEFKVSGLIAYVNYSTLHEKKTDMMFDAIKFDVAMVTKEGFERLHKSI
FT                   HYTYAWKYEDEPADDIEQKEKSDDFLEAMVSQVMAAGNEVEDYTPRYSNPAINFATDDM
FT                   GSDKAMGGVLLDILIVIIAFIFAVTISNTIANESSAIGTLRASGYTKGELIRHYLSMPV
FT                   IVTFLAAVVGNILGYTVFKDVVVGMYYNSYSLPTYHTIWNPGAFIKTTLAPVIIMLVVN
FT                   LIVIIRMMQHTPLQFLRHDLKKTKRKKAMRLPHWSFMSRFRLRIMFQNVANYLILFVGI
FT                   FFIMVMLAMAVGMPDTLDYYKKNTDSMMFAKYQYVLKSYVDADGNVLETDNSDAEKFDM
FT                   TSLLRRTDEFDEEVSVYGVETDSAYVKLKDMDSLKDNEVYISDSFADKYGIKPGDTIKF
FT                   DAQYEKKTYKFKVKGTYDKSQSIAVFMPIEHFADTFDFADGRFSGFLSDTKIKDIDESN
FT                   IATTITIRDITKMADQLDHSMGSYMQYFQVLCILLSAVMIYLLTKLIIEKNETAISMTK
FT                   ILGYDNREIASLYLASTSIVVVISDIISVVLGAKVMDIVWRIMLQTFSGWFSFHMTHVG
FT                   YVKMFAFVLIGYLIVTVFDFSRIKRIPMDMALKNVE"
FT   gene            141869..143557
FT                   /locus_tag="EUBREC_0147"
FT   CDS_pept        141869..143557
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0147"
FT                   /product="methyl-accepting chemotaxis protein"
FT                   /note="CytoplasmicMembrane, score:9.49; COG0840
FT                   Methyl-accepting chemotaxis protein; KEGG:K03406
FT                   methyl-accepting chemotaxis protein; HMMPfam:IPR003660;
FT                   HMMPfam:IPR004089; HMMSmart:IPR003660; HMMSmart:IPR004089"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ACR73952"
FT                   /db_xref="GOA:C4ZA91"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZA91"
FT                   /protein_id="ACR73952.1"
FT                   /translation="MEQSKTKKRGTFAAKIIVMVILAVIVSNVICMVFILESSKKQITD
FT                   SVKHTMVDVVNTTSKIMENEISNSGVDDLDYDGYANNLSDVKLEGMDSAYMYVVQNDGT
FT                   MLYHPTKEKVGQPVENAVIKGVVQQLQDGKKPGTTVVEYDFNGTTKYSAYTILNNENIL
FT                   VLTADESEALAGITTVTGVAVGIIAIVVLIAITISFIMGRRLMRPLVKVSTIIEDVANG
FT                   NIEADFSVVKESNDEIGLIIEKMKELTQSLGSIVGKIRNSSDTMSSNSYELNDTSSQTL
FT                   AANNEISKAVEDVAEGSTGMAASISKINENLLEMSNETKDINASVDEIKNQTVAVQDSS
FT                   KIMNDKIKSMQDSSHKMDEGISAISKRIETVNTTVDKVSNIVSVIEEISSETNLLSLNA
FT                   SIEAARAGDAGKGFAVVAQEIRVLSDNTNTELENIKQIISSLVEECRYCVQASGTIVED
FT                   NAKQKEEIKAVLDEFGSLDEQIQKTAEKADEIEELVTAMIELNDDITKSSNSLTDVSAA
FT                   NAAATEEMNANIEELNAMMHGVSEMAGHMNDESDGLKEALSFFNN"
FT   gene            143670..143825
FT                   /locus_tag="EUBREC_0148"
FT   CDS_pept        143670..143825
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0148"
FT                   /product="Hypothetical protein"
FT                   /note="Unknown cell location"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ACR73953"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZA92"
FT                   /protein_id="ACR73953.1"
FT                   /translation="MLLWLILVFGGLLIISAKTRIIYIYKKFYCSRLRVAGNTKILIYD
FT                   KQKNEV"
FT   gene            143815..144330
FT                   /locus_tag="EUBREC_0149"
FT   CDS_pept        143815..144330
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0149"
FT                   /product="possible acetyltransferase"
FT                   /note="Cytoplasmic, score:8.87; COG0454 Histone
FT                   acetyltransferase HPA2 and related acetyltransferases;
FT                   KEGG:0possible acetyltransferase HMMPfam:IPR000182"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ACR73954"
FT                   /db_xref="GOA:C4ZA93"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZA93"
FT                   /protein_id="ACR73954.1"
FT                   /translation="MRYKIMTDNFEFRSIHPDEVEQAIAIEQICFPPNEACSPKAMTER
FT                   IAKVPQLFLVVIDKSTGKLAGFLNGVATDEEKFRDEFFTDIDLCDENGKNVMLLGLDVL
FT                   PEYRGQGLARELVHRYSQREKANGRKKLFLTCLEQKVEMYKKFGLQDLGIADSTWGGEE
FT                   WHEMVLKG"
FT   gene            144341..144664
FT                   /locus_tag="EUBREC_0150"
FT   CDS_pept        144341..144664
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0150"
FT                   /product="Hypothetical protein"
FT                   /note="Cytoplasmic, score:8.87"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ACR73955"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZA94"
FT                   /protein_id="ACR73955.1"
FT                   /translation="MENKVSDNVIEKNYRECLKFNEISESGACNFDMATAKAALENLYE
FT                   LYKNGISTGRFTKDKDYVVRCADLVILAEENKDSLFYDAWRIWFRYFVSMGYAGWNELW
FT                   EVV"
FT   gene            144661..144792
FT                   /locus_tag="EUBREC_0151"
FT   CDS_pept        144661..144792
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0151"
FT                   /product="Hypothetical protein"
FT                   /note="Extracellular, score:8.82"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ACR73956"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZA95"
FT                   /protein_id="ACR73956.1"
FT                   /translation="MNKQKIAELRAGLETGFINSGYNSSLAYQPQFLSNNHKEGKNL"
FT   gene            144913..147732
FT                   /locus_tag="EUBREC_0152"
FT   CDS_pept        144913..147732
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0152"
FT                   /product="Hypothetical protein"
FT                   /note="Cytoplasmic, score:8.87; NOG06248 non supervised
FT                   orthologous group"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ACR73957"
FT                   /db_xref="InterPro:IPR018310"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZA96"
FT                   /protein_id="ACR73957.1"
FT                   /translation="MHMSNFSLPEYDQHREWIRNARNRNMKWEEIDYAGRGNDEGLSEF
FT                   LTQQSLLNFWKEVSCSEWKELVRLQKEAEEQTQVIDYLSGQAMIMGEGEDNDVTVPADP
FT                   QSAWQLYRKKLIKGGFKEEIVDEMERTTLKILKRLSSDTTEMKPVKGLVIGNVQSGKTA
FT                   NMAALMAMAADWGWNMFIVLSGTIENLRQQTQNRLLNDLNCQGNLNWNGLEHLSKKPML
FT                   GQRTQDLHFDKTSKQRYFTVCLKNPGRLRGLIQWLQSDGNKQKQMKILVIDDEADQAGI
FT                   NTANVNSSTIRTINRLIRDLVNGRNEKSQEISNKYKAMNYIGYTATPYANILNEAGEDS
FT                   LYPRNFISTLSVSKEYFGPQQIFGLEGGDYDYDGLDIVRIIDEDDLQAIKEIHEEGSLY
FT                   VPLALQDAICWFLCGVACMRIWGYGKPISMLIHTSQKTDHHQNIAEAVRDWIVSKDVDE
FT                   MIRRCEKVWNTETSQFTFEKFREQYPQYDRKDEEINRYPSFEDIRKEITILLSKEPTNI
FT                   PLDEDDEFAYHEGIHMCIDNCKNNGITDDGMYVRLAYPTADNMPTPAPAFIVVGGATLS
FT                   RGLTIEGLISTFFLRSVSQADTLMQMGRWFGYRKGYELLPRLWITSKTNDQFKFLAALD
FT                   QELRDEIHEMDTLGKSPANYGPRVKNTPKASFIRITAKNRMQSAQATDMDFSGSFNQTY
FT                   LFDNDVAVLKHNIVETEKFIASLGQPEERKECNQHAENSFIWRNVEFSLVKKYLEEYKF
FT                   NSRLGVFNDIASVIAWIEKISAEGKLENWNIILAGKGSGSVWNSPVGPVKKVSRTRKKL
FT                   NNESDTVINIGVLRDPKDIIADIDLEGQPQEIVSKVKNFKSKYAKEIRSLAGLDSTPQL
FT                   IVYVIDKDSKAVKGFDTREDLDSVEDIVGICMNIPGGKRGTDYTATVSIHMQNNPFDDE
FT                   GDLEGTNEN"
FT   gene            147722..149809
FT                   /locus_tag="EUBREC_0153"
FT   CDS_pept        147722..149809
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0153"
FT                   /product="Hypothetical protein"
FT                   /note="Cytoplasmic, score:8.87; NOG28040 non supervised
FT                   orthologous group"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ACR73958"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZA97"
FT                   /protein_id="ACR73958.1"
FT                   /translation="MKIEIAEPGRMTQSGSSLLKLIQNNNMPILDLLVRESIQNSLDAK
FT                   NDTDPYVTVDFFTGEFNKISLNKELEGITETLNRKYWKDTYKFIAVRDSNTVGLTGKLH
FT                   YDEVTDNQYGNLLKLIYEISKPQEAEGAGGSWGLGKTVYFRVGIGLVVYYSRILNEEGI
FT                   YESRLAASLVENEMNADSLIPALPGKSKRGIAWWGQEIGSNKTKPITDEKYIEKILNIF
FT                   GIEPYEGDLTGTTIIIPYIDEQMLLENNQIEYKDSEDNRIRPFWRCSIEDYLRISIQRW
FT                   YAPRLNNEKYPYGKFLRARINKKGIGLDNMEPAFQIVQALYNRAVSEEAGNDILAQDGV
FT                   ECKSEDILLRKVLETTKAGTIAYTKVPRKILKTGYPDNKPEPYMYFNCEIKDKEKNKPV
FT                   LFFTRKPGMIVSYEDVGNWVDGISASSKDEFIFAIFVLNSENKLTNTREPYSLEEYVRK
FT                   SEMADHTSWGDFSMGNNNPRIVSKVQAQINSKISKEFFVEEEDTTSRLNSGLGKMFGDL
FT                   LLPPENFGKKPSGGTSGGQGGSGHTETHKNVVFGYESSKTKYFANGMTVKLTIKSRRKI
FT                   LATGINLAIDSETGAIKPKDWEEKMGLSMPFEIVSADIVVTKVDKLKTNLKMAVASSNE
FT                   SSGISDISCELLKTKNGAGYGIHVRSDAEHLIEMELDITLQLNRKDIKPLFNVEKNEGD
FT                   K"
FT   gene            149809..150750
FT                   /locus_tag="EUBREC_0154"
FT   CDS_pept        149809..150750
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0154"
FT                   /product="Hypothetical protein"
FT                   /note="Cytoplasmic, score:8.87"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ACR73959"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZA98"
FT                   /protein_id="ACR73959.1"
FT                   /translation="MAANISLFPVITDDLLSKTRFQASPYQLYYVRNDQEYVLRTEEVD
FT                   SSTIVHKVIDDEGIWSPDDYQLCIRRKYSIRTYQCLFGPNGIACNNAKLGIALMWTSPD
FT                   SKQRGVIPIGEIENSQRDLEFELNYEFSEAQLRGSVEFSTIIYLKEAGTPLWGEEHLAN
FT                   QYGCILGELDNKFVIRLDGNGSVFPMYEIHEPGQPLWYVKCDWIDPTYDLFSDSVSIYI
FT                   NTAHKNYKYLDKTKRTFDEQLLKEIMASALAVIITKLKEQEDYWDATTSGEDLQNGSVS
FT                   EAIHYFIDTLEWDVSGPEAMSLSIRKFFDQRI"
FT   gene            150756..151478
FT                   /locus_tag="EUBREC_0155"
FT   CDS_pept        150756..151478
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0155"
FT                   /product="Hypothetical protein"
FT                   /note="Cytoplasmic, score:8.87"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ACR73960"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZA99"
FT                   /protein_id="ACR73960.1"
FT                   /translation="MIIKTLNRSEAQNAMKEWVLNYPSLPEVEGDYLKIRKDIQEFNQK
FT                   VRSECPDSIAKKDYYIDAHIGILLYDYLWRVPGFNLRAAANDDFWRYLSIKVIPDVVAE
FT                   RWGYDNESHYWSKPARIWLRSIWWYVHLSWQGDMQTTAKVLEAPCFTTDSILNLEERTG
FT                   RKGTFINVYRYIMYYYSHIPQQVLDEYNTNTKTQQDDLFRIVMKLNTAKVMVVDPALYL
FT                   GGEKEYVRSLFIDAGVRV"
FT   gene            151478..152809
FT                   /locus_tag="EUBREC_0156"
FT   CDS_pept        151478..152809
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0156"
FT                   /product="cytosine-specific methyltransferase"
FT                   /note="Cytoplasmic, score:8.87; COG0270 Site-specific DNA
FT                   methylase; KEGG:K00558 cytosine-specific methyltransferase
FT                   HMMPfam:IPR001525; HMMPanther:IPR001525; HMMTigr:IPR001525;
FT                   ScanRegExp:IPR001525"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ACR73961"
FT                   /db_xref="GOA:C4ZAA0"
FT                   /db_xref="InterPro:IPR001525"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR031303"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZAA0"
FT                   /protein_id="ACR73961.1"
FT                   /translation="MLPKIIDLFSGCGGLALGFEKAGFDIVAGIELMPEACKTISYNLS
FT                   WRYGKKETHICGDITEIEASVFKNSFGDEGCIVIGGPPCQAYSMAGRGKLRSLGEDRVN
FT                   IKDARGYLYQDFLRFVFELEARAVVMENVPESTNFGGKNIPEIVCTELTKKGYKAYWTI
FT                   LNSADYGVPQVRERVFVVAIKGDEGKEIKLPNPTHRNEVDVLTQHQKRFEGYKQCQFFV
FT                   EPNGTTDELKPWVTVGDAFSDLPEVFPTADSKYKLVSLNIEYPYKTEAQNEYQELMRTW
FT                   YGKEGFGVSANAFRRNTRDFPIFERMQQGDNYIAATKIAEELFYEEAKLFGYEKDSEEY
FT                   ISLYNKMVPQYDKDKFENKWKRLDETKPSHTLVAHLAKDTYSHIHPIEPRGITVREAAR
FT                   LQSFPDDFFFDCSMGDAFKQIGNAVPPLLAYGVARTVLNTFEEE"
FT   gene            152813..153712
FT                   /locus_tag="EUBREC_0157"
FT   CDS_pept        152813..153712
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0157"
FT                   /product="Hypothetical protein"
FT                   /note="Cytoplasmic, score:8.87; NOG18295 non supervised
FT                   orthologous group"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ACR73962"
FT                   /db_xref="InterPro:IPR025534"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZAA1"
FT                   /protein_id="ACR73962.1"
FT                   /translation="MGILEEIREYFASTQNGAREIKTLPKEYSAMVIRDNEGYGVAIEF
FT                   DDIRDISEKFANSRLFSRTLAIGGIEKKYLILSCMLDSLRYEFATVCAQFVEPGIDGVD
FT                   RKNLMSEPLEWWKKWRELMGNTISNKEAYSVIAEMMVLDDLYNQDNTVEWTAVNSGSHD
FT                   IEGNESSYEVKSTVKRYGATITISGQHQLQSLKRLQLYFCRLEQSRTGISINDMKDRLV
FT                   ADGYDKDKIEQQLYQLGYERGASIREEKYKVLEKRKYEVDDKFPKITKASFKDDHIPES
FT                   ITQITYTIDLDGLEYTVW"
FT   gene            153687..154988
FT                   /locus_tag="EUBREC_0158"
FT   CDS_pept        153687..154988
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0158"
FT                   /product="modification methylase, putative"
FT                   /note="Cytoplasmic, score:8.87; COG0270 Site-specific DNA
FT                   methylase; KEGG:K00558 modification methylase, putative
FT                   HMMPfam:IPR001525; HMMPanther:IPR001525; HMMTigr:IPR001525;
FT                   ScanRegExp:IPR001525"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ACR73963"
FT                   /db_xref="GOA:C4ZAA2"
FT                   /db_xref="InterPro:IPR001525"
FT                   /db_xref="InterPro:IPR018117"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR031303"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZAA2"
FT                   /protein_id="ACR73963.1"
FT                   /translation="MAWNILYGDPGRKEMFRVIETFSGIGSQAKALTRIGKPFEIVNTA
FT                   DWDINAILAYCLIHKGKIDINKYAEISDEDVTNFLKGLSLSSDGKKPMSDETFRRMPMH
FT                   LKRRLYAAIKETRNMVSITDVMGSDIPDNIDLFTYSFPCQDLSLCGCWHGNKSGIARDA
FT                   HNRSGMLWEVERILLEMNEMGKELPRFLLMENVTNILSKPHAADFGDWKATLENLGYYN
FT                   KIYRLNAQNFGIPQKRERAYMISILCKNNAETIAQVEKYFEEHNLEKDEATRLKQRNLR
FT                   LKDILCLDYDDVPRYKEEADASKPNDTPSRRKIWEDNELLYDGKEIRDIVVNTVTTKQD
FT                   RNPNSGLIIYKNRARGKTKWRYLTPRECFKLMGFDESDFDRIISDNPMVTKNRYLYSTE
FT                   KLIKLAGNSIVVDVLEAIFRQIMDINEKILGERK"
FT   gene            154985..155740
FT                   /locus_tag="EUBREC_0159"
FT   CDS_pept        154985..155740
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0159"
FT                   /product="Hypothetical protein"
FT                   /note="Cytoplasmic, score:8.87; COG3440 Predicted
FT                   restriction endonuclease; HMMPfam:IPR002711;
FT                   HMMSmart:IPR003615"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ACR73964"
FT                   /db_xref="InterPro:IPR003615"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZAA3"
FT                   /protein_id="ACR73964.1"
FT                   /translation="MTINQKKSLVAFYISKFNDDAFRELGYGGPVSKAMDDLSVRITGP
FT                   GVEPNAYLRRRRDEFDVFFDNGRVGQRNRKPTETVKELYGQWNVMEFEEITEIVKSVLD
FT                   GTMEESQVINLEVDEETVSEYDVETYLNFDDNTAALNKTVKSVMERTYSKKKVEMLKRL
FT                   YAYRCQICGQNVGEEHGVNIAEAHHIKYFSKSVDNSSDNLLILCPNHHSLIHVLNPKFD
FT                   YDELQYIYPDGKTDKIILDLHLTHGKEEE"
FT   gene            155743..155952
FT                   /locus_tag="EUBREC_0160"
FT   CDS_pept        155743..155952
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0160"
FT                   /product="Hypothetical protein"
FT                   /note="Cytoplasmic, score:8.87; superfamily:IPR010982"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ACR73965"
FT                   /db_xref="GOA:C4ZAA4"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZAA4"
FT                   /protein_id="ACR73965.1"
FT                   /translation="MTISEQIKVLCVRQKISLAELARRLGTTPQNFNAKLKRESFTVAE
FT                   LEDIAEAAGVTFERSFVLDDGDTV"
FT   gene            155933..156400
FT                   /locus_tag="EUBREC_0161"
FT   CDS_pept        155933..156400
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0161"
FT                   /product="very short patch repair endonuclease, putative"
FT                   /note="Cytoplasmic, score:8.87; COG3727 DNA G:T-mismatch
FT                   repair endonuclease; KEGG:0very short patch repair
FT                   endonuclease, putative HMMPfam:IPR004603;
FT                   BlastProDom:IPR004603; Gene3D:IPR004603; HMMPIR:IPR004603;
FT                   superfamily:IPR011335"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ACR73966"
FT                   /db_xref="GOA:C4ZAA5"
FT                   /db_xref="InterPro:IPR004603"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZAA5"
FT                   /protein_id="ACR73966.1"
FT                   /translation="MMETQYKKVIYMADVLTKEQRHKNMKNIHGKDTKIEIILRKALWA
FT                   KGYRYRKNYKKLPGNPDIVLTKYKIAIFCDGEFFHGKDWEVLKPRLQKSNNSAFWVNKI
FT                   SKNRERDDMVNKKLLFMGWTVIRFWGKDIKKHTDECVKAIEEIIFDIKMED"
FT   gene            156466..156678
FT                   /locus_tag="EUBREC_0162"
FT   CDS_pept        156466..156678
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0162"
FT                   /product="Hypothetical protein"
FT                   /note="Unknown cell location"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ACR73967"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZAA6"
FT                   /protein_id="ACR73967.1"
FT                   /translation="MSFMQQSEACQPSAEGIKQAELFRVCGLDWGEQPTATSTQQNFWL
FT                   VGLLRTLESEGIVERDVTTKKWRLK"
FT   gene            156742..157920
FT                   /locus_tag="EUBREC_0163"
FT   CDS_pept        156742..157920
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0163"
FT                   /product="modification methylase"
FT                   /note="Cytoplasmic, score:8.87; COG0270 Site-specific DNA
FT                   methylase; KEGG:K00558 modification methylase
FT                   HMMPfam:IPR001525; HMMPanther:IPR001525; HMMTigr:IPR001525;
FT                   ScanRegExp:IPR001525; superfamily:IPR010985"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ACR73968"
FT                   /db_xref="GOA:C4ZAA7"
FT                   /db_xref="InterPro:IPR001525"
FT                   /db_xref="InterPro:IPR018117"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR031303"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZAA7"
FT                   /protein_id="ACR73968.1"
FT                   /translation="MWYIFFPGGNYMKQMHLRVDDALYEELNTYSVETEQSMQACVREA
FT                   VVYYITDKKKKQIPILKSQFTFIDLFAGIGGMRLAYENVGGRCVYSNEWNKYSQQTYYA
FT                   NFGEQPEGDITKVDAKTIPDHDILVAGFPCQPFSIAGVSKKISLGRKTGFEDKTQGTLF
FT                   FDVCRILKEKRPKAFMLENVKNLKSHDKGRTFKTILESLDELKYKVFFAVLDGQNFVPQ
FT                   HRERIIIVGFDMERYGDDIEFDFDITPVNPKPVMRDILEKKVDDKYTLSDNLWTYLQNY
FT                   AAKHRAAGNGFGYGIAPLDGVSRTISARYHKDGSEILIAQKGKNPRRLTPRECARLQGF
FT                   PESFVIPVSDTQAYRQFGNSVVVPLIENVAKLIVEKIDLLESDVQNEKRKAI"
FT   gene            157920..159095
FT                   /locus_tag="EUBREC_0164"
FT   CDS_pept        157920..159095
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0164"
FT                   /product="putative type II restriction enzyme"
FT                   /note="Cytoplasmic, score:8.87; NOG14036 non supervised
FT                   orthologous group; KEGG:K01155 putative type II restriction
FT                   enzyme HMMPfam:IPR015109; HMMPfam:IPR015300;
FT                   superfamily:IPR011335"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ACR73969"
FT                   /db_xref="GOA:C4ZAA8"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR015109"
FT                   /db_xref="InterPro:IPR015300"
FT                   /db_xref="InterPro:IPR023372"
FT                   /db_xref="InterPro:IPR038365"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZAA8"
FT                   /protein_id="ACR73969.1"
FT                   /translation="MSTEILNKAIESTVASELAFCKFLSANDTGATGGHQGGVLVSVSA
FT                   SRMLFVEILPDNDILKRDVKITWQGDLVTESTFTYYSSKKELRITKFGRDFDIINPDRT
FT                   GSLFVLTKQSWDDYSVFIMDTEDEIEEFLSTFGISATETNCLFGAGGVQRSVIEQQAIE
FT                   TFISSLEVEFPETEVMSSAARNISDAVYNHVEYLITNPDKKIIEWTNMEYALFRALEEY
FT                   RYGDIVRCGFPSVEEFVSVANSVLNRRKSRAGKSLEHHLEAIFVANEIIYDAQPVTEGK
FT                   KKPDFLFPSAVAYRDLTYPVSKLATLAAKTTCKDRWRQILNEANRLKDENKFLCTLQQG
FT                   VSPMQMDEMEAEKVILVVPKPYISCYPRDRQDRIWTISRFVRYIKSIQNTD"
FT   gene            159854..161584
FT                   /locus_tag="EUBREC_0165"
FT   CDS_pept        159854..161584
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0165"
FT                   /product="cassette chromosome recombinase B"
FT                   /note="Cytoplasmic, score:8.87; COG1961 Site-specific
FT                   recombinases, DNA invertase Pin homologs; KEGG:K06400
FT                   cassette chromosome recombinase B; HMMPfam:IPR006119;
FT                   HMMPfam:IPR011109; Gene3D:IPR006119; superfamily:IPR006119"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ACR73970"
FT                   /db_xref="GOA:C4ZAA9"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR011109"
FT                   /db_xref="InterPro:IPR025827"
FT                   /db_xref="InterPro:IPR036162"
FT                   /db_xref="InterPro:IPR038109"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZAA9"
FT                   /protein_id="ACR73970.1"
FT                   /translation="MEVAQMEEKIDITDKTIEIDTDKGSAIKVTMSYGEQSTLEELLIA
FT                   YLEQIAIYLRLSKEDEFVKDESNSITNQRAFIRGFINKNKELRKMSVMEFVDDGYSGKN
FT                   MDRPDMQRMLDLVKRKQISCVIVKDFSRFSRDHIEQGKYIEQIFPFMGVRFIAINDNYD
FT                   SADYVGGIGEIDVAFKGIMYDFFSEEQSSKVSLTLDTKRGNGKYIATYAPYGYVKSPED
FT                   KHKLVVDEFASQIVKRIFKEFLSGKSMYKISEGLNRDGIDTPGVYIAMQTESEKQLARY
FT                   REKKPLWNNVAIGRILENEQYTGTMIYSRFKIENVGDKHAKALPKDEWKRVENCHEAII
FT                   SKEDFEKAAAMRKGNTCASAKRKHETHCLTGKMICGNCGHRLSHTYAGRPKYYCANHYL
FT                   DKTDGKCNISVLDAYMESVVKKALQMMIDVLVDSRKVVDMQREKQAERLKQAEKHLSDM
FT                   EHSRELIEKNLREAYESYKLGMTDKETYLEQRKIYEQMLERLRENIEKQRAAVTKMADV
FT                   DVPEVAGLEMLEGQLKLTGLNREMVDAFVEEIVVYAKDRVEIKWKFKDEFWETEKARKP
FT                   "
FT   gene            161691..162269
FT                   /locus_tag="EUBREC_0166"
FT   CDS_pept        161691..162269
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0166"
FT                   /product="Hypothetical protein"
FT                   /note="CytoplasmicMembrane, score:9.99; NOG22552 non
FT                   supervised orthologous group"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ACR73971"
FT                   /db_xref="GOA:C4ZAB0"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZAB0"
FT                   /protein_id="ACR73971.1"
FT                   /translation="MKKQLIILSLSPLFLLTILQYFPFEKFGCVVGNLFNIQMVYKHLP
FT                   LYIGMWICLIWVIVSLIIFIKFVCFQRYDVVGGYEVKDIKEEKDAGLNFFLTLILPLLV
FT                   NDISTWNGLLLMIFLVVIIICLLSKTNLYYQNPVLIILKYKVYKFKFVDNEHLPDGEYI
FT                   ALIRGNMDSRNTIEYKKIEDNVLVIRKEG"
FT   gene            162274..163227
FT                   /locus_tag="EUBREC_0167"
FT   CDS_pept        162274..163227
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0167"
FT                   /product="Hypothetical protein"
FT                   /note="Cytoplasmic, score:8.87; NOG34373 non supervised
FT                   orthologous group"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ACR73972"
FT                   /db_xref="InterPro:IPR032359"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZAB1"
FT                   /protein_id="ACR73972.1"
FT                   /translation="MNKQEITSKIKEITETGAVCGVDVYVCLKGEEQGFYIEKMISMNS
FT                   LKDRIRSIALEIINTQYLQDEVVYCDILDVIDNKKAVYVLEQSDEYKPFALLNDDSMDE
FT                   VFNFDEKDIGNVLGFLFKINLNSKKLFIYQQAYVGSRLQAKNNLRIIQKDNVFEIVDKE
FT                   MLKIDKRGELLILDNTILVRNVKVLQDFFGFQVFVRNQAQSVISKLEELDIIGNIATLK
FT                   EYQTGEKLTISKKLMKVKNSPVLAMDKDELINKIPLVPRYKNIIHIENGKIRTNTKKDV
FT                   DNLMKLLNDDYVKSELTDMEYDSTSKTLLNSESQDE"
FT   gene            163417..165144
FT                   /locus_tag="EUBREC_0168"
FT   CDS_pept        163417..165144
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0168"
FT                   /product="Hypothetical protein"
FT                   /note="CytoplasmicMembrane, score:9.75"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ACR73973"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZAB2"
FT                   /protein_id="ACR73973.1"
FT                   /translation="MISLERQEEYELRQVLFSEINKDIDNNFQGVYEKISHDFGKEILY
FT                   PLSVVEKKFNDMSMKSLNNGLFANNELMISVNPLREAVYWYIKNIMEKNGKLKYQSAVF
FT                   GEQLPGEYEFIEWVLKIYDEYSKANLIKSIRDGSSKVEIREEKNGNLGFYFPVIKDEYS
FT                   KEMIYYYGLDDALASEAERHVFTECEKYLLDKINVFVLSQNPQLVITYFNILRRMTSVI
FT                   DLKYFELCKKRILIDLNKISSSTLKSRYRDNGESVINSKDELASFLTLFYYLSRVDSVK
FT                   RMLTFTTGYGDGKYYCVYELPKLLALGKQVGLSNDVMKVYVKYFSVDPSVQGGSFLEFP
FT                   FIVCREKVIWIPSSIVLNDFQFSIVNGHYYKAVDFYEKDDTVSQSIVDYVVNHSKKYKN
FT                   IMVRSNYLYNEPGLKFNGRDLKSDIDVAIYDIKTKKLLVLECKWKENVYLNHDDYLQIE
FT                   DAIRKVYSRQLEKHQFYLGLGKEKISKIFDNEIDFDKITNLDILYLFVDKRIQFHDNKK
FT                   NRHAVPIFLLAHLFEKYSTEDELDLNALFEDIRRMESKVSRERVKLLNPVKIGKYTVE"
FT   gene            complement(165155..165349)
FT                   /locus_tag="EUBREC_0169"
FT   CDS_pept        complement(165155..165349)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0169"
FT                   /product="Hypothetical protein"
FT                   /note="Unknown cell location"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ACR73974"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZAB3"
FT                   /protein_id="ACR73974.1"
FT                   /translation="MASLPIAIFNFKGEVQESNLRPLPELVLRLSAALSSLKAVAGYGN
FT                   SFAIIYIVPLLNRFTKHLP"
FT   gene            165437..167752
FT                   /locus_tag="EUBREC_0170"
FT   CDS_pept        165437..167752
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0170"
FT                   /product="DNA/RNA helicase"
FT                   /note="Cytoplasmic, score:8.87; COG3886 Predicted HKD
FT                   family nuclease; KEGG:0DNA/RNA helicase HMMPfam:IPR001650;
FT                   HMMPfam:IPR006935; HMMSmart:IPR001650;
FT                   ScanRegExp:IPR013838"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ACR73975"
FT                   /db_xref="GOA:C4ZAB4"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR021835"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZAB4"
FT                   /protein_id="ACR73975.1"
FT                   /translation="MRELGFKRVLFLVHRGQLARQTKKSYEKIFDKSVSMGLVGAGYSD
FT                   YDRDYVFATVQTLNRDEHLRKYAPDDFDCIILDEAHHSSANTYQKVMNYFTPKLWLGMT
FT                   ATPDKRDDDIDGKNIYQIFNYQIAYEIRLQQAMEENMLCPFHYFGITDVSLLGDKEIKS
FT                   KKLTESSFNQLVGDERVKHIIEQANYFGHSGDRVKGLIFCSRIDESVELSNKFNQTINP
FT                   ETGRFFRTIALNGDATEEERQRAFERLAMDENTLDTTNKTNADQIFDTERTEKTDKVDK
FT                   ADENMQPLDYIFSVEILNEGVDIVEVNQVIMLRPTESPIVFIQQLGRGLRKANGKEYVV
FT                   ILDFIGNYNNNFMIPVALSGDRSYNADTIRKYVISGNNTIPGASTVHFDEIAKDRIFAS
FT                   IGKIKGMKSIIRESYVSLKNRLGRVPYLLDFYENGEVDPLVIIKEYKTYQAFLEAVEKE
FT                   LYTGRLNEQEKTTLEYLSKTILSGTRPFELEILRQLMKKPSLSMKEIREVFTQRYDYEV
FT                   NVQSLDNAADVLQGKFVSKDDEYKRFCRIDILKEDNNNIFRRMNNFTTRLQNEEFKKQI
FT                   DDIIEVGLKRYHDKYQTALKNESPFVLYEKYSRRDVSLLMNCGRDLSSTMYGMKRIDDD
FT                   VFIFVTYHKEESTDEQKNYVDGKPDYADAFEDNMIFRWDSQIGRGVDSSYVSDVVNTKR
FT                   KHLLVKKSDAESNFYYMGEFDIVDVRAARKRDNNGKERDITKFEMKMHHPVREDLLRYL
FT                   QSNLQQRLQNNTQELKAI"
FT   gene            167749..168171
FT                   /locus_tag="EUBREC_0171"
FT   CDS_pept        167749..168171
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0171"
FT                   /product="mutator MutT protein"
FT                   /note="Cytoplasmic, score:8.87; COG0494 NTP
FT                   pyrophosphohydrolases including oxidative damage repair
FT                   enzymes; KEGG:K03574 mutator MutT protein
FT                   HMMPfam:IPR000086; Gene3D:IPR000086; ScanRegExp:IPR003006;
FT                   superfamily:IPR015797"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ACR73976"
FT                   /db_xref="GOA:C4ZAB5"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZAB5"
FT                   /protein_id="ACR73976.1"
FT                   /translation="MKTVRVVAAVIRAVNKENKPIIFATQRGYGEFKGGWEFPGGKIES
FT                   GETPQQALKWEIMEELDTEIAVGELIDTIEYDYPNFHLSMDCFWCEVIHGELILKEAED
FT                   AKWLTKEHLADVEWLPADVTLIEKIGEELHETKDSK"
FT   gene            168173..168514
FT                   /locus_tag="EUBREC_0172"
FT   CDS_pept        168173..168514
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0172"
FT                   /product="Hypothetical protein"
FT                   /note="Unknown cell location; COG1393 Arsenate reductase
FT                   and related proteins, glutaredoxin family;
FT                   HMMPfam:IPR006660; Gene3D:IPR012335; superfamily:IPR012336"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ACR73977"
FT                   /db_xref="InterPro:IPR006660"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZAB6"
FT                   /protein_id="ACR73977.1"
FT                   /translation="MNIQIFGTKKCNDTKKAQRFFKERGIKFQFIDMKEKGMSKGEFNS
FT                   VAQVNGGLDNMINWDGKDKDLLALIKYIADEDKLDKVLENPQVIKTPVVRNGRQSTIGY
FT                   QPDVWKTWK"
FT   gene            168496..168816
FT                   /locus_tag="EUBREC_0173"
FT   CDS_pept        168496..168816
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0173"
FT                   /product="Hypothetical protein"
FT                   /note="Unknown cell location"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ACR73978"
FT                   /db_xref="InterPro:IPR012644"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZAB7"
FT                   /protein_id="ACR73978.1"
FT                   /translation="MEDMEITLKEMKGRKLYMYYVPDGTQQCGYYECKECGSRFLDLKI
FT                   APTLVCPYCGEEADMEIGPDEEMPKVVESANLIQMVRGVEEVEKMDKLLSLAVTGGDFS
FT                   WI"
FT   gene            168874..168999
FT                   /locus_tag="EUBREC_0174"
FT   CDS_pept        168874..168999
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0174"
FT                   /product="Hypothetical protein"
FT                   /note="Extracellular, score:8.82"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ACR73979"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZAB8"
FT                   /protein_id="ACR73979.1"
FT                   /translation="MRRLERHYMKPRTAKSMELEETNARWNECLNSYEKVRRGVC"
FT   gene            168999..169997
FT                   /locus_tag="EUBREC_0175"
FT   CDS_pept        168999..169997
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0175"
FT                   /product="Hypothetical protein"
FT                   /note="Cytoplasmic, score:8.87; COG4804 Uncharacterized
FT                   conserved protein; HMMPfam:IPR009362"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ACR73980"
FT                   /db_xref="InterPro:IPR009362"
FT                   /db_xref="InterPro:IPR041527"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZAB9"
FT                   /protein_id="ACR73980.1"
FT                   /translation="MNTSEYLSVIENIKSEIKAAQYHATIHVNADMLLLYHDIGCVINE
FT                   HKAWGNKFVDNLATDIRSAFPKSKGYSVRNLKYMAKFAETYPDREFVQTVSAQIPWSHN
FT                   IAILEKVKDQEQRVWYIHKTAENGWSHNVLVHQIESGLYQRQVLADKVTNFENRLPSPQ
FT                   SELATQTMKDPYVFDFISFREDMLERDIEQALVRDVTKLLLELGTGFAFLGNQYHLNVG
FT                   GDDFYIDLLFYNLNLRCYVVIELKTGEFKPEYAGQLNFYLSAVDGILKKEQDNPSIGLL
FT                   LCKSKNNVVAEYSLKDISKPIGVSEYKVTSILPDELEEQLPSVEDIQKRIK"
FT   gene            170096..170395
FT                   /locus_tag="EUBREC_0176"
FT   CDS_pept        170096..170395
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0176"
FT                   /product="Hypothetical protein"
FT                   /note="Cytoplasmic, score:8.87"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ACR73981"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZAC0"
FT                   /protein_id="ACR73981.1"
FT                   /translation="MHLADVERHYMKPKTAKSMELYDILIRRGYPEPFCDEITKNLNTD
FT                   WTTQRMIGYLSHYKKLPMEEIADEMLAILSDRNRIMQKHELEETNARWNEYLNR"
FT   gene            170412..170795
FT                   /locus_tag="EUBREC_0177"
FT   CDS_pept        170412..170795
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0177"
FT                   /product="Hypothetical protein"
FT                   /note="Cytoplasmic, score:8.87; BlastProDom:IPR001789;
FT                   superfamily:IPR011006"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ACR73982"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZAC1"
FT                   /protein_id="ACR73982.1"
FT                   /translation="MRVLNIEDDTFKHNDICKALSGCGIKDVEWSNNLADGWKQIKNSI
FT                   DSNNPYDLIITDMYYPDEPGGREEQSGDVLIDRVIKNKITIPVILCSSVNLKYPEIYGC
FT                   VYYSRERNWEADMQKLVNSLVAG"
FT   gene            complement(170798..171259)
FT                   /locus_tag="EUBREC_0178"
FT   CDS_pept        complement(170798..171259)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0178"
FT                   /product="mutator MutT protein"
FT                   /note="Cytoplasmic, score:8.87; COG0494 NTP
FT                   pyrophosphohydrolases including oxidative damage repair
FT                   enzymes; KEGG:K03574 mutator MutT protein
FT                   HMMPfam:IPR000086; BlastProDom:IPR002667;
FT                   FPrintScan:IPR000086; FPrintScan:IPR003562;
FT                   Gene3D:IPR000086; ScanRegExp:IPR000086;
FT                   superfamily:IPR015797"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ACR73983"
FT                   /db_xref="GOA:C4ZAC2"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR003562"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZAC2"
FT                   /protein_id="ACR73983.1"
FT                   /translation="MKITTLCYIEHDGQYLMLHRIKKENDINEGKWIGVGGHAENGESP
FT                   EECLLREVKEETGLTLTSYRFRALITFISDKQEPELMCLFTADEFSGKLITCNEGDLKW
FT                   VDKTIVPTLPTWEGDAIFLKLLLENEENFFTLKLVYEGESLVDQKLEIY"
FT   gene            171481..172116
FT                   /locus_tag="EUBREC_0179"
FT   CDS_pept        171481..172116
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0179"
FT                   /product="Hypothetical protein"
FT                   /note="Cytoplasmic, score:8.87; NOG18663 non supervised
FT                   orthologous group; HMMPfam:IPR009501"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ACR73984"
FT                   /db_xref="InterPro:IPR003741"
FT                   /db_xref="InterPro:IPR009501"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZAC3"
FT                   /protein_id="ACR73984.1"
FT                   /translation="MDVRKMRNELLGKRLVAALESRNMEAYYVETKEDAVKKALELIPK
FT                   GSSINMGGATSVKECGLYEALSNGEYQFYDRDKVSTQEEKQEIALKAFTSDYFLGSVNA
FT                   MSEDGVFINIDGNANRVAAYAYGPKHVLLIVGMNKVVKTEADAMSRARNEAAPINAQRF
FT                   GIDTPCSKNGTCFDCKSPQCICCQILTTRFSRVKGRFQIILVDENLGF"
FT   gene            172148..172375
FT                   /locus_tag="EUBREC_0180"
FT   CDS_pept        172148..172375
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0180"
FT                   /product="Hypothetical protein"
FT                   /note="Cytoplasmic, score:8.87"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ACR73985"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZAC4"
FT                   /protein_id="ACR73985.1"
FT                   /translation="MGYLISETTKEEREAIVAESLGNIEATCDGCMSGLAEMYQDYIDG
FT                   KKELREINMEFNARYVHGEDMPGRSGCGYK"
FT   gene            172462..173625
FT                   /locus_tag="EUBREC_0181"
FT   CDS_pept        172462..173625
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0181"
FT                   /product="transcriptional regulatory protein"
FT                   /note="Cytoplasmic, score:8.87; COG2508 Regulator of
FT                   polyketide synthase expression; KEGG:K09684 transcriptional
FT                   regulatory protein; superfamily:IPR009057"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ACR73986"
FT                   /db_xref="InterPro:IPR012914"
FT                   /db_xref="InterPro:IPR025736"
FT                   /db_xref="InterPro:IPR041522"
FT                   /db_xref="InterPro:IPR042070"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZAC5"
FT                   /protein_id="ACR73986.1"
FT                   /translation="MDGMELVAGATGLDRMVSWTYLVQTKPYKDHMNPGNFALLVVDYK
FT                   RFSMDEAYDAMVELNELGISGFAISVVEDREETPQRMKDKADELKLPLFYIRWEGATFV
FT                   DIAQSVGELLLETSVDNKRTGDYLYNLLFGYEVNDKYIEKISAQFGLTFDRPYRVGIIV
FT                   IDRKYGVNLEQDEHTYTYYTDCLNREVIHMKKKPMYMRFLNKFVLLFEETKDMETEHQI
FT                   ERILGDLDSRAPFAGLIHSTCILGAAYRKPADFGKSYQEAKNLIPKKDILPNPTNKKVI
FT                   SASSMGIYKYMFNSGNQQEIMDYCNEKLKRLEMYDNANGSFLIDTLLNYYMCGFNVGKT
FT                   AQIMYVHRNSLQYRLKKIEEILEISLDDSMEYLDVVNCILVKRLMFN"
FT   gene            173666..174667
FT                   /locus_tag="EUBREC_0182"
FT   CDS_pept        173666..174667
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0182"
FT                   /product="amino acid ABC transporter, amino acid-binding
FT                   protein/permease protein, putative"
FT                   /note="Unknown cell location; COG0834 ABC-type amino acid
FT                   transport/signal transduction systems, periplasmic
FT                   component/domain; KEGG:K02029 K02030 amino acid ABC
FT                   transporter, amino acid-binding protein/permease protein,
FT                   putative; HMMPfam:IPR001638; HMMSmart:IPR001638"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ACR73987"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZAC6"
FT                   /protein_id="ACR73987.1"
FT                   /translation="MQSCFIKFIIRTKQRRWRKTPAPFRISIIKEEKLMMKRSKRFAAL
FT                   ILTGVMAVTTLFGCGSSSGGAASDSSAADSSSKKVLKVGMECAYAPFNWTQDTDTTPDG
FT                   SKAVKIAGSDYYAYGYDVAVAQKLADQMGMDLEVHKVEWSSIGISLDAGDYDCIIAGMG
FT                   KTKEREASYAFTEPYYYRNNCIVVKKGGKYSTVKGLSDLADTGCKVTTQLGTGWIPLLD
FT                   QIKGAEQSGNFETTSECFLAISNGSADVCVIDVPTAESAALTNDDLQIIELDENDTFTG
FT                   DDEMVNVCIATRKDDTALRDKIQDAMNAIGWNDKAKMDELMDQVLTQQPAAN"
FT   gene            174796..175554
FT                   /locus_tag="EUBREC_0183"
FT   CDS_pept        174796..175554
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0183"
FT                   /product="ABC-type amino acid transport/signal transduction
FT                   system, periplasmic component/domain protein"
FT                   /note="CytoplasmicMembrane, score:9.82; COG0765 ABC-type
FT                   amino acid transport system, permease component;
FT                   KEGG:K02029 K02030 ABC-type amino acid transport/signal
FT                   transduction system, periplasmic component/domain;
FT                   HMMPfam:IPR000515; HMMTigr:IPR010065; ScanRegExp:IPR001865"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ACR73988"
FT                   /db_xref="GOA:C4ZAC7"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZAC7"
FT                   /protein_id="ACR73988.1"
FT                   /translation="MMISNPSNSLEWMVFLAQKYSSMFIKGTWLTLYISVVGTLLGFVL
FT                   GYIVGIVNDVKLNDGDNIVKKVLIRIVKVIFTVYVEVFRDTPMIVQAMIVYYGIRQMGY
FT                   ENLTPVFAGILVTVLNTGAYMGETVRAGIGSIDMGQREGAWAMGMSPFKTMLYVVLPQA
FT                   FKNIIPEMANTFLLNLKMTSVLNVIAVQELFMAAKTVGGNYYKYFESYLVIAVIYFVLC
FT                   FVFDKLFKLIEKKLQGKTDYALAVEYMDNE"
FT   gene            175547..176305
FT                   /locus_tag="EUBREC_0184"
FT   CDS_pept        175547..176305
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0184"
FT                   /product="hypothetical protein"
FT                   /note="CytoplasmicMembrane, score:9.49; COG1126 ABC-type
FT                   polar amino acid transport system, ATPase component;
FT                   KEGG:K02028 hypothetical protein HMMPfam:IPR003439;
FT                   BlastProDom:IPR003439; HMMSmart:IPR003593;
FT                   ScanRegExp:IPR003439"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ACR73989"
FT                   /db_xref="GOA:C4ZAC8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030679"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZAC8"
FT                   /protein_id="ACR73989.1"
FT                   /translation="MNRRHNMSETVISIKDLSKSFGDHEVLRKIDIDVHSGEVICIVGS
FT                   SGSGKSTLLRCINKLEKQTSGKILYHDKEVRNVQKDINDYRSKVGMVFQSFNLFNNMTV
FT                   LQNCMLCTRRVLHLQKQEAFDRAITHLKAVGMAPYINAKPSQLSGGQKQRVAIARSLCM
FT                   NPEVLLFDEPTSALDPEMVGEVLNVMKDLARTGLTMIIVTHEMAFARDVSTRTIFMDSG
FT                   YVAEDAAPSELFTNPKNPRTREFLSRYLAG"
FT   gene            176339..177004
FT                   /locus_tag="EUBREC_0185"
FT   CDS_pept        176339..177004
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0185"
FT                   /product="cytidylate kinase"
FT                   /note="Cytoplasmic, score:8.87; NOG14451 non supervised
FT                   orthologous group; KEGG:K00945 cytidylate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ACR73990"
FT                   /db_xref="GOA:C4ZAC9"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZAC9"
FT                   /protein_id="ACR73990.1"
FT                   /translation="MDNFVVTFARGFGTGGKAIASQLAKELGIHCYENRILTLASQLSG
FT                   LDENVFQEVNEKLREEGGFTSFLRGLPRAKGYISRNEKFKSDDRLFEYQSQIINELADK
FT                   ESCVIVGKCADYVLKNRPNVVSIYIEAPRAFCVERTITNMGVTPEVANATIERTDKFRA
FT                   DYYKYYTHGNYWTNPVNYDLTLNSERVGVENCVKTIEQYLIIKGFIKADMIKPAGELI"
FT   gene            complement(177075..177869)
FT                   /locus_tag="EUBREC_0186"
FT   CDS_pept        complement(177075..177869)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0186"
FT                   /product="ABC-type uncharacterized transport system, ATPase
FT                   component"
FT                   /note="CytoplasmicMembrane, score:9.49; COG1101 ABC-type
FT                   uncharacterized transport system, ATPase component;
FT                   KEGG:K05833 ABC-type uncharacterized transport system,
FT                   ATPase component; HMMPfam:IPR003439; BlastProDom:IPR003439;
FT                   HMMSmart:IPR003593; ScanRegExp:IPR003439"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ACR73991"
FT                   /db_xref="GOA:C4ZAD0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZAD0"
FT                   /protein_id="ACR73991.1"
FT                   /translation="MLEIRNVHKTFNPGTINEKHALNGVNLKLEEGDFVTVIGGNGAGK
FT                   STMLNAVAGTWPVDDGSILIDGVDVTGLPEFKRASFLGRVFQDPMTGTTATMQIDENLA
FT                   LAARRGKRRGLGWGITKAEKEHFHELLKELDLGLEDRMTSKVGLLSGGQRQAVTLLMAS
FT                   LQKPKVLLLDEHTAALDPKTASKVLALTDKIIKENSLTAMMVTHNMRDAIAHGNRLIMM
FT                   NNGQVVLNISGEEKKNLTVEDLLMKFEEVSGEEFASDKALLG"
FT   gene            complement(177870..178859)
FT                   /locus_tag="EUBREC_0187"
FT   CDS_pept        complement(177870..178859)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0187"
FT                   /product="protein of unknown function DUF534"
FT                   /note="CytoplasmicMembrane, score:10.00; COG4120 ABC-type
FT                   uncharacterized transport system, permease component;
FT                   KEGG:K05832 protein of unknown function DUF534;
FT                   HMMPfam:IPR001851"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ACR73992"
FT                   /db_xref="GOA:C4ZAD1"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZAD1"
FT                   /protein_id="ACR73992.1"
FT                   /translation="MEVFNKMILMSYFATLNPVAFTNALPGNIAQGLIWGIMALGVYIT
FT                   FRLLDFADLTVDGSFATGGAVTVMMTINGYNIWVSLLCACIAGLLAGLCTGLLHTKLGI
FT                   PPILAGILTQIALYSINLNIMQRHANQALSADKYNLVLSSRNLTHAIIVGVIFSVVIIA
FT                   VLYWYFGTEQGSAIRATGCNPAMSKAQGINIDNMKLIGLALSNAIVALSGGLLSQYSGF
FT                   SDVNMGRGGIVIGLAAVIIGEVLGDAILGKHMNFMGKLIFVIFGGIVYYIVIGIVLWLQ
FT                   MPSDDLKLFTAIIVAIFLAVPYLKGKSKASFKKAGKRSAAALNAKEGK"
FT   gene            complement(178871..179875)
FT                   /locus_tag="EUBREC_0188"
FT   CDS_pept        complement(178871..179875)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0188"
FT                   /product="putative ABC transporter substrate-binding
FT                   protein"
FT                   /note="Unknown cell location; COG2984 ABC-type
FT                   uncharacterized transport system, periplasmic component;
FT                   KEGG:K01989 putative ABC transporter substrate-binding
FT                   protein; HMMPfam:IPR007487"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ACR73993"
FT                   /db_xref="InterPro:IPR007487"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZAD2"
FT                   /protein_id="ACR73993.1"
FT                   /translation="MKKRSKILASLVLAGTMVLGLAGCGDSGSANGGTQSGKNSDAKYQ
FT                   VGICQLVQHEALDAATKGFEDALKDKLGDDVSFDEQNAAGDASTCSTICTKFVTNDYDL
FT                   ILGNATAALQAASAATDSIPILGTSITDYATALDMSDWSGTTGKNISGTTDLAPLDEQA
FT                   KCIKELFPDAKNIGIIYCSSEPNSIYQSTTITKYLEDEGYTVKEYTFSDSNDVAAVTQS
FT                   ACDASDAIYIPTDNTAASCTEAINNVASQAKKPIFAGEEGIAKGCGVATLSISYYDLGY
FT                   TTGEMAYDILVNGTDIKTMEVKSAPKFTKEYLPDRAKELGITVPDGYEEISAE"
FT   gene            180368..180535
FT                   /locus_tag="EUBREC_0189"
FT   CDS_pept        180368..180535
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0189"
FT                   /product="Hypothetical protein"
FT                   /note="Unknown cell location"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ACR73994"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZAD3"
FT                   /protein_id="ACR73994.1"
FT                   /translation="MMVHTGFVERVLAQNKKLFREKRSIQLHVAVNLCHMNFLQMNFQN
FT                   KIWLKVKNPR"
FT   gene            complement(180557..181843)
FT                   /locus_tag="EUBREC_0190"
FT   CDS_pept        complement(180557..181843)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0190"
FT                   /product="tyrosyl-tRNA synthetase"
FT                   /note="Cytoplasmic, score:9.98; COG0162 Tyrosyl-tRNA
FT                   synthetase; KEGG:K01866 tyrosyl-tRNA synthetase
FT                   HMMPfam:IPR002305; FPrintScan:IPR002307; Gene3D:IPR014729;
FT                   HMMPanther:IPR002307; HMMTigr:IPR002307;
FT                   ScanRegExp:IPR001412"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ACR73995"
FT                   /db_xref="GOA:C4ZAD4"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002305"
FT                   /db_xref="InterPro:IPR002307"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR024088"
FT                   /db_xref="InterPro:IPR024107"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZAD4"
FT                   /protein_id="ACR73995.1"
FT                   /translation="MDEGDILFFRIQIHLIRRKIMTIYDELVARGLIAQVTDEKEIKEL
FT                   INNGKATFYIGFDPTADSLHVGHFMALCLMKRLQMAGNKPIVLIGGGTAQIGDPSGRTD
FT                   MRQMMTTETINHNVECFKKQMSRFIDFGEGKAIMVNNADWLMDLNYVDVLREVGAHFSV
FT                   NRMLTAECYKQRMEKGLSFLEFNYMIMQSYDFYTLFQKYGCNMEFGGDDQWSNMLGGTE
FT                   LIRRKLGKDAYAMTINLLLNSEGKKMGKTQSGAVWLDPNKTTPFEFFQYWRNVSDADVL
FT                   KCIRMLTFLPLEEIDKMESWEGAQLNEAKEILAFELTKLVHGEEEATKAKEASHALFAG
FT                   GANNANMPTVTVTAEDFPDGELDIISVLVKAGLCDSRGDGRRNIQQGGVSVADEKVTDI
FT                   STKYTLDDFKGEGLIIRRGKKKFAKVVAE"
FT   gene            complement(182021..182170)
FT                   /locus_tag="EUBREC_0191"
FT   CDS_pept        complement(182021..182170)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0191"
FT                   /product="Hypothetical protein"
FT                   /note="Unknown cell location"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ACR73996"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZAD5"
FT                   /protein_id="ACR73996.1"
FT                   /translation="MKHNYISTGFDGNKYISAILTESCRQVRGARKQIWNTSRSFAPNV
FT                   IPDD"
FT   gene            182394..183458
FT                   /locus_tag="EUBREC_0192"
FT   CDS_pept        182394..183458
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0192"
FT                   /product="Hypothetical protein"
FT                   /note="Cytoplasmic, score:8.87; NOG13752 non supervised
FT                   orthologous group"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ACR73997"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZAD6"
FT                   /protein_id="ACR73997.1"
FT                   /translation="MQNPFTTTFSKTPEYTYIHTEKTEEILENFIYDNPSESVYKITGV
FT                   RGSGKTVILAKVEEELRTNESRYINWLVFDVNPARDILGQIAAMLVKAGFGSQDKKTTG
FT                   INLSATVMGTGGGIGYTAENNNNFFDIGVEVETMIQAAQKKGKKILIGIDEVSKSEEMI
FT                   KFASEYGRWLRAGYPVYFVCTGLYENIQELSNVKNLTFFRRAATVKTEPLNMIRMTEMY
FT                   KSKLDIDSNEAREMAKITKGYAYAFQELGVLYFKKKLDELLEDILPKLKAELFAYSYEK
FT                   IWEEMTEMDRFLAGLLTEKEEYKREEVLKLMGEKSGSYSMYRDRLIKRGILNSRQGYIS
FT                   LALPYFGEYIKEYC"
FT   gene            183596..184483
FT                   /locus_tag="EUBREC_0193"
FT   CDS_pept        183596..184483
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0193"
FT                   /product="Hypothetical protein"
FT                   /note="CytoplasmicMembrane, score:9.99; KOG1721 FOG:
FT                   Zn-finger"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ACR73998"
FT                   /db_xref="GOA:C4ZAD7"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZAD7"
FT                   /protein_id="ACR73998.1"
FT                   /translation="MSMIDGFKSFINLAVMVLTIVASWIMYAKAGEHGWAAIVPFYSSY
FT                   VKFRIAGKQKLFWGYLVASIASIAGCILLMYEIIASGLSVMTSSYMGSYYDSTYGYAGN
FT                   RIGAHMGMLIFAVILIIGAMIAALVMNILCCVGLAHAFGKGAGFACGLIFLNVIFICII
FT                   AFNKNIVYVGDGYNSNNNYYNPYGSNGYGQQYGQNMYGNGANQQYGQNMYGNGANQQYG
FT                   QNMYGNGANQQYGQNMYGNGTNQQYGQNMYGNGANQQYGQNPYGTAQGGDAQNSYGTSQ
FT                   QQSWNDEYNNKDYE"
FT   misc_feature    184610..184849
FT                   /note="EUBREC_0194; RF00230 T-box leader; T-box leader"
FT   gene            184931..185959
FT                   /locus_tag="EUBREC_0195"
FT   CDS_pept        184931..185959
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0195"
FT                   /product="sodium-dependent transporter"
FT                   /note="CytoplasmicMembrane, score:9.99; COG0385 Predicted
FT                   Na+-dependent transporter; KEGG:K03453 sodium-dependent
FT                   transporter; HMMPfam:IPR002657; HMMPanther:IPR002657"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ACR73999"
FT                   /db_xref="GOA:C4ZAD8"
FT                   /db_xref="InterPro:IPR002657"
FT                   /db_xref="InterPro:IPR004710"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZAD8"
FT                   /protein_id="ACR73999.1"
FT                   /translation="MKALQKVSKFLSDYTSIVVIAIAVVTFLVPNLMAWVNQMLFVDPV
FT                   SNKFTCQSIIIGIIMFSMGLTLTTQDFKILAQRPFDICVGAIAQYLIMPFLAFGISKAL
FT                   NLPDGIALGLILVGCCPGGVSSNIMSYLCGGDVAFSVGMTTVSTLLSPFMTPLLVSLLA
FT                   SGTHVSIKALPMFVSIIETVIFPVAVGFLLNYLLGKKKAFAEAQKVMPGIAVLGLAFVV
FT                   GGVVSSQGSKFFTSGVVIFAAVLLHNGLGYLLGYGAGKLVGMNTAKKRTISIEVGMQNA
FT                   GLATNLATTTAQFASTPESAIICAVSCTWHSISGTLLAGAFALKDKMAAKKAEEAAETK
FT                   TA"
FT   gene            186117..187829
FT                   /locus_tag="EUBREC_0196"
FT   CDS_pept        186117..187829
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0196"
FT                   /product="carbon starvation-induced protein"
FT                   /note="CytoplasmicMembrane, score:9.99; COG1966 Carbon
FT                   starvation protein, predicted membrane protein; KEGG:K06200
FT                   carbon starvation-induced protein; HMMPfam:IPR003706"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74000"
FT                   /db_xref="GOA:C4ZAD9"
FT                   /db_xref="InterPro:IPR003706"
FT                   /db_xref="InterPro:IPR025299"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZAD9"
FT                   /protein_id="ACR74000.1"
FT                   /translation="MSGILMMVIAIVVLGGAYLLYGRYLQNKWGIDPNAKTPAYEMEDG
FT                   VDYVPADTNVVFGHQFASIAGAGPINGPIQAAIFGWLPVLLWILIGGVFFGAVQDFASM
FT                   YASVKNKGRTIGYIIEEYIGKLGKKLFLLFCWLFCILVVAAFADVVAGTFNGFAADKAG
FT                   EVTKVVANGAVATTSMLFIIEAVALGFFLKYSKFNKWINTLVAIALLIVAIALGLNFPM
FT                   YLNLSVWHIIIFAYILIASVTPVWALLQPRDYLNSYLLIFMIVGAVIGVFVANPACNLD
FT                   AFTAFAIPDANGNPQYLFPILFVTIACGAVSGFHSLVSSGTASKQIKNEKNMLPVSFGA
FT                   MLMESMLAILALIAVASFGKGEAAAQGLTTQPQIFAGAIANFLSVLGLPHSLVFTLINL
FT                   AVSAFALTSLDSVARVGRLSFQEFWLDSDTDDDNMSPFVKLMTNKYFATIITLVLAFLL
FT                   TKVGYAEIWPLFGSANQLLSVLALVACAVFLKKTKRQGCMLWIPMVFMMAVTFTALGMT
FT                   IYKLTKALFSVGLDLGNSLQLIFAVLLLILGVLVAIQGVKKLCEKSESKKAAA"
FT   gene            complement(187962..188858)
FT                   /locus_tag="EUBREC_0197"
FT   CDS_pept        complement(187962..188858)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0197"
FT                   /product="DAK2 domain/DegV family protein"
FT                   /note="Cytoplasmic, score:8.87; COG1307 Uncharacterized
FT                   protein conserved in bacteria; KEGG:0DAK2 domain/DegV
FT                   family protein; HMMPfam:IPR003797"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74001"
FT                   /db_xref="GOA:C4ZAE0"
FT                   /db_xref="InterPro:IPR003797"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZAE0"
FT                   /protein_id="ACR74001.1"
FT                   /translation="MFEIIVDSAANIPAELCKKYKIKVLSFVNLVNGKEMTCFEPDLTP
FT                   EQERAKGKEYYDAIREGAEIKTGLISSGIFEDTFREIIEADKDVLYFSLSKNISGNYNS
FT                   ARVAADAVLDDYDNGRKIRLVDSLNASLGQGLLAIYASEMREKGMSFDDVADTIETYPA
FT                   RLNGVFTVGNLKYIARTGRLSGTTALVGNMLSIKPILRGSQDGYIVQFRKCRGRKAVLN
FT                   ELVNLLCDNITDPENQIIGVAHADAYEDSLYVIEQIKKRIKVRDVINTTYDFCTGSHVG
FT                   PEALAVFFMGKDRELGA"
FT   gene            189076..189960
FT                   /locus_tag="EUBREC_0198"
FT   CDS_pept        189076..189960
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0198"
FT                   /product="apurinic endonuclease Apn1"
FT                   /note="Cytoplasmic, score:8.87; COG0648 Endonuclease IV;
FT                   KEGG:K01151 apurinic endonuclease Apn1 HMMPfam:IPR012307;
FT                   Gene3D:IPR013022; HMMPanther:IPR001719; HMMSmart:IPR001719;
FT                   HMMTigr:IPR001719; ScanRegExp:IPR001719"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74002"
FT                   /db_xref="GOA:C4ZAE1"
FT                   /db_xref="InterPro:IPR001719"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR018246"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZAE1"
FT                   /protein_id="ACR74002.1"
FT                   /translation="MKQRKNMSDIKLGCHVGMAGKDMFLASAREAASYGANVFMLYTGA
FT                   PQNTRRKEIFELNIDAGWEYAHEHGINEIVVHAPYIINLANTVKPETYELAVEFLEKEI
FT                   VRTAAMKSRILVLHPGSHVNAGEQAGIAQIVKGLNTVLNQNDDDVFIALETMAGKGSEI
FT                   GRSFEELKAIYDGVDRKERLRVCFDTCHVNDAGYDIVNHYDEVFAEFDRVIGLEQIAVF
FT                   HVNDSLNPLGAHKDRHANIGKGTIGYDTLHRLVHDETFANVPKILETPWLCEESSAKKT
FT                   IPPYKEEIEWLLK"
FT   gene            190027..191586
FT                   /locus_tag="EUBREC_0199"
FT   CDS_pept        190027..191586
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0199"
FT                   /product="possible cardiolipin synthase (phospholipase D
FT                   family)"
FT                   /note="CytoplasmicMembrane, score:7.63; COG1502
FT                   Phosphatidylserine/phosphatidylglycerophosphate/cardiolipi
FT                   n synthases and related enzymes; KEGG:K06131 possible
FT                   cardiolipin synthase (phospholipase D family)
FT                   HMMPfam:IPR001736; HMMSmart:IPR001736"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74003"
FT                   /db_xref="GOA:C4ZAE2"
FT                   /db_xref="InterPro:IPR001736"
FT                   /db_xref="InterPro:IPR022924"
FT                   /db_xref="InterPro:IPR025202"
FT                   /db_xref="InterPro:IPR027379"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZAE2"
FT                   /protein_id="ACR74003.1"
FT                   /translation="MKEKTYEGTKKTQNGLKRMFFSVLAILLQAVFMVYMFTRLNEYAA
FT                   AINTTTSVLAIVLVLGLYNREQTASMTTPWIILILAFPIMGVSLYLLVGLNGAPNKMRA
FT                   RFEEVDSMLLPCLPENADILSDMYEKVPQAAGISTYLAKNALYPVYQNTDVTYYDQASK
FT                   GLEAQLSDLSKAKKFIFMEYHAIEDKESWHRIQKVLTERVQAGVEVRVFYDDMGSIFFI
FT                   DRDFSEKMEKLGIKCRVFNPVAPAFNMFLNNRDHRKITVIDGKIAYTGGYNLANEYFNV
FT                   THPYGIWKDTGIRLEGDAVKSFTIAFLEMWNASERKVPREVDVSQYLLHYDYEAKQSGY
FT                   IQPYADSPLDNEQVGEDVYISMANKAQRYCWFITPYLIITDEMSHALTLAAKRGVDVRI
FT                   ITPGIPDKKPIYSVTRSFYNQLVKHGVRIFEWTPGFCHAKMSVADDIMATCGTINLDYR
FT                   SLYHHFENGCFMADCEVVHEIRDDFIRLFTESAEVTEKYRTGRSARRRLGQSIMRLFAG
FT                   LL"
FT   gene            191622..191945
FT                   /locus_tag="EUBREC_0200"
FT   CDS_pept        191622..191945
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0200"
FT                   /product="putative acylphosphatase"
FT                   /note="Cytoplasmic, score:8.87; COG1254 Acylphosphatases;
FT                   KEGG:K01512 putative acylphosphatase HMMPfam:IPR001792;
FT                   BlastProDom:IPR001792; FPrintScan:IPR001792;
FT                   HMMPanther:IPR001792; ScanRegExp:IPR001792;
FT                   superfamily:IPR001792"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74004"
FT                   /db_xref="GOA:C4ZAE3"
FT                   /db_xref="InterPro:IPR001792"
FT                   /db_xref="InterPro:IPR017968"
FT                   /db_xref="InterPro:IPR020456"
FT                   /db_xref="InterPro:IPR036046"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZAE3"
FT                   /protein_id="ACR74004.1"
FT                   /translation="MSDYDSKIIRKQIRVYGSVQGVGFRYRTEHAAESVGATGWVRNDP
FT                   DGSVFMEIQGTEEQIDRVFAMVSQGTYVNIEKMDAKSILVVEDERGFHTRESLGDFWGL
FT                   WHR"
FT   gene            191961..192356
FT                   /locus_tag="EUBREC_0201"
FT   CDS_pept        191961..192356
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0201"
FT                   /product="Hypothetical protein"
FT                   /note="Cytoplasmic, score:8.87"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74005"
FT                   /db_xref="InterPro:IPR031493"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZAE4"
FT                   /protein_id="ACR74005.1"
FT                   /translation="MFFMMGITDGRKDFDFNQVITCDECGRYGRYQVYMTYMVLSLFFI
FT                   PCFKWNRHYYVQTTCCNALYELDPEIGRRIARGEDVEILPQHLQRVNPQYGYGFENESG
FT                   NTTKRCSNCGYTTTEDFEFCPKCGRRL"
FT   gene            192244..192492
FT                   /locus_tag="EUBREC_0202"
FT   CDS_pept        192244..192492
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0202"
FT                   /product="Hypothetical protein"
FT                   /note="Unknown cell location"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74006"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZAE5"
FT                   /protein_id="ACR74006.1"
FT                   /translation="MVMALKMKVETQQKDAAIVDIQLQRTLNSVPNAAGGCNVFHVLMI
FT                   ICFYESTAIRQRMEHRKSFTKSVFDDLVVKIIPLQQV"
FT   gene            complement(192470..192889)
FT                   /locus_tag="EUBREC_0203"
FT   CDS_pept        complement(192470..192889)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0203"
FT                   /product="Hypothetical protein"
FT                   /note="Cytoplasmic, score:8.87; NOG16821 non supervised
FT                   orthologous group"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74007"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZAE6"
FT                   /protein_id="ACR74007.1"
FT                   /translation="MRILADTNVIIDALTSREPWNKSAEEIFLMAANHTIEMYITASSA
FT                   TDIYYLIRKHLHNIEAAKMIMGKLYSLTGILEVTADDCMDALASAISDYEDAVVEKVAS
FT                   RKDMDYIVTRNIKDYQAGGTKIILPDDFVKLVEEE"
FT   gene            complement(192890..193105)
FT                   /locus_tag="EUBREC_0204"
FT   CDS_pept        complement(192890..193105)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0204"
FT                   /product="Hypothetical protein"
FT                   /note="Unknown cell location; HMMTigr:IPR006442"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74008"
FT                   /db_xref="InterPro:IPR006442"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZAE7"
FT                   /protein_id="ACR74008.1"
FT                   /translation="MSITATELKNNLGKYLLLSAKEDVFITKNGKVVAKLTNPHQDRVE
FT                   VAKSLFGILPKDADLNEAKEERLGAK"
FT   gene            193232..193354
FT                   /locus_tag="EUBREC_0205"
FT   CDS_pept        193232..193354
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0205"
FT                   /product="Hypothetical protein"
FT                   /note="Extracellular, score:8.82"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74009"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZAE8"
FT                   /protein_id="ACR74009.1"
FT                   /translation="MSSFLCVSPNSQCALNALAIDNPMEYARLVLDNEMQAWGD"
FT   gene            193734..193904
FT                   /locus_tag="EUBREC_0206"
FT   CDS_pept        193734..193904
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0206"
FT                   /product="Hypothetical protein"
FT                   /note="Unknown cell location"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74010"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZAE9"
FT                   /protein_id="ACR74010.1"
FT                   /translation="METWYYDVVSIDGDYANLKRCDIESDDLKLVARALLPPEIMEGSR
FT                   LKYELMQYEII"
FT   gene            193938..194321
FT                   /locus_tag="EUBREC_0207"
FT   CDS_pept        193938..194321
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0207"
FT                   /product="Hypothetical protein"
FT                   /note="Unknown cell location"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74011"
FT                   /db_xref="InterPro:IPR016621"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZAF0"
FT                   /protein_id="ACR74011.1"
FT                   /translation="MQQKSTQKILLFSVAAQKVEKIKALCKNLGISVQQVEKSDYGQKL
FT                   GAIAGITGFKKDGSRYSGADFPAELLVFSGINSSQMDIFLAEYKKAGIEPIGCKAVVTP
FT                   DNVFWSADKLFREIFREHLFMNR"
FT   gene            complement(194357..195061)
FT                   /locus_tag="EUBREC_0208"
FT   CDS_pept        complement(194357..195061)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0208"
FT                   /product="response regulator of the LytR/AlgR family"
FT                   /note="Unknown cell location; COG3279 Response regulator of
FT                   the LytR/AlgR family; KEGG:K02477 response regulator of the
FT                   LytR/AlgR family; HMMPfam:IPR001789; HMMPfam:IPR007492;
FT                   BlastProDom:IPR001789; HMMSmart:IPR001789;
FT                   superfamily:IPR011006"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74012"
FT                   /db_xref="GOA:C4ZAF1"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR007492"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZAF1"
FT                   /protein_id="ACR74012.1"
FT                   /translation="MIINITILEDNESDFITLSDSIKKWAANTGILINIIWLNSYKKFI
FT                   KSLPTLKCDLFFSDIELNCNNSFTGIDACKQLRESGYTGIIIFLTAFKEYVFDGYDVQA
FT                   FNYLLKPINYGTINNCLDKFIHLFSREFYYYHKGNDIISIPYNDIMYIEKNGHDVILHT
FT                   TSNVFVERISLNEISKRLPVFFIRAHKSYIVNINKVLSLRINELFLPNNVTIPVSRSYL
FT                   TNIKKKLLEIAR"
FT   gene            complement(195076..196392)
FT                   /locus_tag="EUBREC_0209"
FT   CDS_pept        complement(195076..196392)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0209"
FT                   /product="Hypothetical protein"
FT                   /note="CytoplasmicMembrane, score:9.99; COG2972 Predicted
FT                   signal transduction protein with a C-terminal ATPase
FT                   domain; superfamily:IPR003594"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74013"
FT                   /db_xref="GOA:C4ZAF2"
FT                   /db_xref="InterPro:IPR032834"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZAF2"
FT                   /protein_id="ACR74013.1"
FT                   /translation="MFNIIWEFIINLLESFLFAVICNAKFTKRQYHYHTAEQTLFILCK
FT                   SLLITLMNISKISTIISLTSVLLLNIIFLILFFVNPIFNSFFVSFIYCLILITSDALTL
FT                   LIPIKFYNINLSQVLYLGNMRILFSLIYISIIALFVIIFLLFTPQVFVLGKLDKISYFI
FT                   ISTICVILEEIVLIILLKQPIYAENFFHLLLFIFGLTLFLFVYISIYIYRLGKEKEKND
FT                   RLIQSITINQMEARQNEEIINSTHSLRVFKHDIMNHMSILYKLVENGKNSDALKYIYQI
FT                   NNSIERTSYTISTGIIPIDCIMTAKLSKALDNNISIKHQIHFPANYNISDMDLCSLISN
FT                   LLDNAIEANCKLDMTKRRLQIEIKPYNNMLLLFISNSSNGIYLYGGNGNLLTTKTSNKN
FT                   EHGIGIKRINEIVKKYNGIIEFDPGTEIFSVSILFPLDN"
FT   gene            196706..197767
FT                   /locus_tag="EUBREC_0210"
FT   CDS_pept        196706..197767
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0210"
FT                   /product="Hypothetical protein"
FT                   /note="Unknown cell location"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74014"
FT                   /db_xref="GOA:C4ZAF3"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZAF3"
FT                   /protein_id="ACR74014.1"
FT                   /translation="MKKNKILIGVISIMFAGIITLGIIECNNSNTKDNDKLFIGNGKFC
FT                   QAKRLNGLGAIYDDDYIFFDCENQIYESYNYSNKKNDKKLNVNCRNSACSHNNDKCEAY
FT                   VELGEYFVFNSKIYKYYNKSKVVSGENRLYGSIVEEESGKTVFKNSIPTDMSSELAIDD
FT                   SEAILYVRVLSDDIIKVDGDRHAYLLDKNFNIIYCHYNIGKFPWGAILNGNYYYINDIN
FT                   EIVKVNLTTFESKSIASNGKAFMADNDENFIYYSNEFSELYKLSPDDESSIKIADNALF
FT                   FSVQNKYIYASGGDNGNKIIYDKNGKIIADYSACVNMGADSAFQINDKIYTIFNGGVAY
FT                   MDLDGKNYGEMMQ"
FT   gene            197764..198921
FT                   /locus_tag="EUBREC_0211"
FT   CDS_pept        197764..198921
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0211"
FT                   /product="Hypothetical protein"
FT                   /note="CytoplasmicMembrane, score:10.00"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74015"
FT                   /db_xref="GOA:C4ZAF4"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZAF4"
FT                   /protein_id="ACR74015.1"
FT                   /translation="MRYEIKKILSCKILMISMIVAFIFSMAISYNAYANEKIDLREFSA
FT                   YIGDFSERKYDVIEQKVMELQNKYEETQNEDVMDEMFVYLTLDKDALNCHNVVEYRDSV
FT                   ISDSEIKIKTESGYYKRMNETINKLYGKKTNLVIGESETLNEVYDLFCVTDIVDIVFII
FT                   VIILFSSFLFLNEHNNNTFYMIKSSYRGGKLSYRNKIVVTLFFSIMASVVETLGMTIWS
FT                   VFWNKIDQWNTSILLNNAFLHSPYSITLFEMIIGVVIMRAIGFFVLSSVFIFVSLFFKS
FT                   NIVPIAINTFIGLGGIAINYILSGKYFALSGGTIREAENYDILRKYTPFPLISESVNYF
FT                   KEYEPINLMGVPIQLLSYSLIINLVFAIIVIALGYYFYNTNFRES"
FT   gene            198935..199597
FT                   /locus_tag="EUBREC_0212"
FT   CDS_pept        198935..199597
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0212"
FT                   /product="hypothetical protein"
FT                   /note="CytoplasmicMembrane, score:9.49; COG1131 ABC-type
FT                   multidrug transport system, ATPase component; KEGG:K01990
FT                   hypothetical protein; HMMPfam:IPR003439;
FT                   BlastProDom:IPR003439; HMMSmart:IPR003593"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74016"
FT                   /db_xref="GOA:C4ZAF5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZAF5"
FT                   /protein_id="ACR74016.1"
FT                   /translation="MLELIDIKKRYGSKEVLHGISIKFENGIYGLIGPNGSGKSTIMNI
FT                   MSDVLDMSSGKILYNGTDIKELDDRYREKIGFLPQNVGYYPNFTAKKTIEYFGYLRGVN
FT                   KKELDSNVEQVLRDVNLYENRNDKVKSFSGGMKQRLGIAITCVANPEIIIFDEPTVGLD
FT                   PEERARFKNLIRKLSKTKTIVLSTHILSDVEEVADYIILIKEGCLTKFEKIGGKDNE"
FT   gene            199590..200495
FT                   /locus_tag="EUBREC_0213"
FT   CDS_pept        199590..200495
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0213"
FT                   /product="Hypothetical protein"
FT                   /note="CytoplasmicMembrane, score:9.99; COG1277 ABC-type
FT                   transport system involved in multi-copper enzyme
FT                   maturation, permease component"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74017"
FT                   /db_xref="GOA:C4ZAF6"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZAF6"
FT                   /protein_id="ACR74017.1"
FT                   /translation="MNNVTKMELYKVLSKPQVYIIFVVGLIIQSIMAGQMRTTMFNGYH
FT                   KSVYENYMNEMEGEYSIEKKEYINSEYQKFQAIIDDKQKNEIAFNNGKIDGKDYHSIIN
FT                   EEKKAQYRIATVKYIVEKTEYYDSLDKSAQYFYDIEISDYIENLRFNVIPIIVILLIVV
FT                   PMYTDDIYAGTLAMIKSSKNGRMILLKSRLNISLLISLLICILFAFVEFVTKYIIFDLG
FT                   NLNAGVESLMIERTMHLPYIISDLSIWQFIVLLYLFYLIISVMISIIGLLVSKISRGNI
FT                   EAFSIMSVIIVGVSYILNIL"
FT   gene            complement(200582..201901)
FT                   /locus_tag="EUBREC_0214"
FT   CDS_pept        complement(200582..201901)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0214"
FT                   /product="hypothetical protein"
FT                   /note="CytoplasmicMembrane, score:9.99; COG0534 Na+-driven
FT                   multidrug efflux pump; KEGG:K03327 hypothetical protein;
FT                   HMMPfam:IPR002528; HMMPanther:IPR002528; HMMTigr:IPR002528"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74018"
FT                   /db_xref="GOA:C4ZAF7"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZAF7"
FT                   /protein_id="ACR74018.1"
FT                   /translation="MQVQRKTLTQLSIPICFETLFYMLSGMVDTLMLSSVSDQAVGAVG
FT                   TANTYISVFIIMFGVISSGMVAVMTQNIGAGKPGIAYQARQLGLIFNAVIGVLMSVFLA
FT                   VFSGNILRMVSIAPALFDSANTYLRIVGGACFLNALIPIFSSYLRVFGYTKQSLWASII
FT                   GNVINFILNAVFLFVMNWGVMGVATATVISRIINLIIVATMGAVLIKAKDSPERIAPGK
FT                   ILGQIIKIGFPSACETALYNIAMTLVVRFMNQMDADGLNVTARSYATQIANFSYCIGAA
FT                   LAQANAILTGWHIGAKEYDECDRGTRKAAIYGVITASCLSITFALLGNYIVRIFTNDVQ
FT                   MINLVTKLLAIDIVLEFGRVTNLVYGQALKTSGDAVFPVVMGAVFMYLAAVGGTYFFGL
FT                   HLGLLAVGAYIGLASDECIRAVGMVLRWKSGKWKNKGLVD"
FT   gene            complement(202066..202209)
FT                   /locus_tag="EUBREC_0215"
FT   CDS_pept        complement(202066..202209)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0215"
FT                   /product="Hypothetical protein"
FT                   /note="Extracellular, score:8.82"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74019"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZAF8"
FT                   /protein_id="ACR74019.1"
FT                   /translation="MHKVCNFLFVLKVLMNLHCNMNNDSVIDKVEIVQFFLEIIQELFV
FT                   IM"
FT   gene            202301..203179
FT                   /locus_tag="EUBREC_0216"
FT   CDS_pept        202301..203179
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0216"
FT                   /product="2-isopropylmalate synthase"
FT                   /note="Cytoplasmic, score:9.98; COG2207 AraC-type
FT                   DNA-binding domain-containing proteins; KEGG:K01649
FT                   2-isopropylmalate synthase HMMPfam:IPR000005;
FT                   HMMPfam:IPR003313; FPrintScan:IPR000005; Gene3D:IPR012287;
FT                   HMMSmart:IPR000005; ScanRegExp:IPR000005;
FT                   superfamily:IPR009057; superfamily:IPR011051"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74020"
FT                   /db_xref="GOA:C4ZAF9"
FT                   /db_xref="InterPro:IPR003313"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="InterPro:IPR037923"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZAF9"
FT                   /protein_id="ACR74020.1"
FT                   /translation="MYFELKENRPHGTPENPFSQYHISDVKRAFQIPVHWHDELEIIYV
FT                   KQGKLHVTISGENYIGSPKDAFVVSPGSLHLMGSPTGDADYYTFLFPLEYISFQTDDLM
FT                   EKSILSPLKRGRLMISPQINDTAADICERLIEINEQISGKNAEKTDAANIEAQFETKIT
FT                   LIKFIRKMWRNGLILENGTNGTNTTEKEMITYIRQNYTREISLKEFGAQFHLSEKYISR
FT                   YFKEHFHITLSQYVNHLRLEHARQLLEESTASVTEVAMCSGYQNVSYFIRSFKKMYGVS
FT                   PLKYRNFQTLP"
FT   gene            203580..204695
FT                   /locus_tag="EUBREC_0217"
FT   CDS_pept        203580..204695
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0217"
FT                   /product="protein of unknown function DUF534"
FT                   /note="Cytoplasmic, score:8.87; COG2984 ABC-type
FT                   uncharacterized transport system, periplasmic component;
FT                   KEGG:K01989 protein of unknown function DUF534;
FT                   HMMPfam:IPR007487"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74021"
FT                   /db_xref="InterPro:IPR007487"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZAG0"
FT                   /protein_id="ACR74021.1"
FT                   /translation="MTFGLLRQIYEKIANIGKQTLHKESEEFNMKKKVLSVILAAVCTM
FT                   GLMAGCGAEGSKGSTQSGSKGDSYTVGISQFAEHGSLDNCREGFLEGLKEEGIEEGKNL
FT                   KVDYQNAQTDTGTASTIADSFVSEKVDMICAIATPCAASAYNSAMNADIPTVYTAVSDP
FT                   VVAGLAKEDGSSVGNITGSSDVLPVEEQLKMIREMMPDAKKIGILYTTSEANSCSTIEE
FT                   YKELADKYDFEIVDTGINTSADIEIAASDLVSKVDCLCNLTDNTVVNALQTVLDKANGA
FT                   KIPVFGSEIEQVKSGCVASMGIDYYQLGIETGKMAAKILKGEEKASDTPFITASKAELY
FT                   VNTAAADKVGMTLDADYIKDAAETFDKIEVK"
FT   gene            204763..205611
FT                   /locus_tag="EUBREC_0218"
FT   CDS_pept        204763..205611
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0218"
FT                   /product="ABC transporter integral membrane protein"
FT                   /note="CytoplasmicMembrane, score:10.00; COG4120 ABC-type
FT                   uncharacterized transport system, permease component;
FT                   KEGG:K05832 ABC transporter integral membrane protein;
FT                   HMMPfam:IPR001851"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74022"
FT                   /db_xref="GOA:C4ZAG1"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZAG1"
FT                   /protein_id="ACR74022.1"
FT                   /translation="MIYAIMALGIYITYTILDFPDLTVDGSFPLGAALSAVLITKGVNP
FT                   ILTLFVTFAAGAFAGMLTGIIHVKLKVRDLLSGIIMMTALYTVNLRIAGRANLPIYNMT
FT                   TLFDNDFVRNVFKGGLAQFSNVIIILVITLVMKFLLDWYMSTKSGYLLRAVGDNETIVT
FT                   SMGVDKGITKIIGLAIANGLCSLSGCIFAQQQRYFDVSMGTGTMVIGLASVIIGISLLK
FT                   KATFLRVTSSVVIGAIVYKACVAIAIKLGMPSSDLKLITAVLFLIILVLGMDRNKRKKV
FT                   A"
FT   gene            205611..206384
FT                   /locus_tag="EUBREC_0219"
FT   CDS_pept        205611..206384
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0219"
FT                   /product="putative ABC-transporter ATP-binding component"
FT                   /note="CytoplasmicMembrane, score:9.49; COG1101 ABC-type
FT                   uncharacterized transport system, ATPase component;
FT                   KEGG:K05833 putative ABC-transporter ATP-binding component;
FT                   HMMPfam:IPR003439; BlastProDom:IPR003439;
FT                   HMMSmart:IPR003593"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74023"
FT                   /db_xref="GOA:C4ZAG2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZAG2"
FT                   /protein_id="ACR74023.1"
FT                   /translation="MLELNHIHKLYNPGTVNEICLFDDFNLKIDDGQFVSVVGSNGSGK
FT                   TSMLNIICGSIPIDGGSIVVNGTDITKQKDFIRHRRIGRVFQDPSKGTCPSMTILENLS
FT                   IADNKGKTYGLGRGTNHSRIEHYKEMLAELNLGLEDKLHTKVGALSGGQRQTLALLMAT
FT                   MNPIEFLILDEHTAALDPKTAEIVMQLTGKIVAEKKVTTIMVTHNLRYAVEYGDRLIMM
FT                   HQGKAIIDKAGADKKAMQVDDILGTFNEISIECGN"
FT   gene            206471..207139
FT                   /locus_tag="EUBREC_0220"
FT   CDS_pept        206471..207139
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0220"
FT                   /product="Hypothetical protein"
FT                   /note="Cytoplasmic, score:8.87"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74024"
FT                   /db_xref="InterPro:IPR025051"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZAG3"
FT                   /protein_id="ACR74024.1"
FT                   /translation="MLLYHGSDHIIEKPEFGAGKKHNDYGRGFYCTQNIELAKEWAVSE
FT                   DADGYVNKYSIYTSKLEVLDINSDKYTMMHWLGILLKNRIFTLTTPLEREAKQYILDNF
FT                   NISLDGIDIVKGYRADDSYFSYARDFISGVISYEQLSKAMRLGKLGEQYCLISKKAFAA
FT                   LEYTGSEYANFKEWYPRKMLRDMYARKGYKDMEKESYRRGELYISRIIDEEMKKDDLRI
FT                   "
FT   gene            207123..207758
FT                   /locus_tag="EUBREC_0221"
FT   CDS_pept        207123..207758
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0221"
FT                   /product="Hypothetical protein"
FT                   /note="Cytoplasmic, score:8.87; HMMPfam:IPR001387;
FT                   HMMSmart:IPR001387; superfamily:IPR010982"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74025"
FT                   /db_xref="GOA:C4ZAG4"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZAG4"
FT                   /protein_id="ACR74025.1"
FT                   /translation="MIYAYDKVYLRIAQRSLGEMLSYAVYDLGYELEDYYKRFLQSEYS
FT                   MRFSKGDLFVITGMSGAELAIRVLDIPDDDIIMPSYNTAKSQEYWTGWILAYYQWENGK
FT                   TFEMIDKEIPICKIRNMYNPYHEMDISSAILKLREMSQVSRAETYLKKLRKRAGISQSI
FT                   LAEETGIPVKTIQQYEQRRKDINKAQVEYVVRLSKALCCEPQDILEEK"
FT   gene            complement(207781..208509)
FT                   /locus_tag="EUBREC_0222"
FT   CDS_pept        complement(207781..208509)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0222"
FT                   /product="thiamine-phosphate pyrophosphorylase, putative"
FT                   /note="Cytoplasmic, score:8.87; COG0352 Thiamine
FT                   monophosphate synthase; KEGG:K00788 thiamine-phosphate
FT                   pyrophosphorylase, putative HMMPfam:IPR003733;
FT                   BlastProDom:IPR003733; Gene3D:IPR013785"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74026"
FT                   /db_xref="GOA:C4ZAG5"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022998"
FT                   /db_xref="InterPro:IPR036206"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZAG5"
FT                   /protein_id="ACR74026.1"
FT                   /translation="MNKEKLLYEYENSKHALQSDNIIAITNRHLCSRPFMEQLERVCKL
FT                   HPHAIVLREKDMPEAEYLSLARDVIALCKKYDVQCMLHSFINVAMELEHPYIHLPLPIL
FT                   EAYVKKNVSGNISTGMSKSTDNYQQFFKVIGTSVHSVEDAIKAEQLGATYMTAGHIFAT
FT                   DCKKGLPPRGLDFLKNVCDAVGIPVYAIGGINIASNDDSTASDSPSTYDAVPDISVPRL
FT                   ADVMECGAAGGCIMSGMMRV"
FT   gene            complement(208605..209870)
FT                   /locus_tag="EUBREC_0223"
FT   CDS_pept        complement(208605..209870)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0223"
FT                   /product="thiamine biosynthesis protein ThiH"
FT                   /note="Cytoplasmic, score:8.87; COG1060 Thiamine
FT                   biosynthesis enzyme ThiH and related uncharacterized
FT                   enzymes; KEGG:K03150 thiamine biosynthesis protein ThiH;
FT                   HMMPfam:IPR007197; HMMPfam:IPR010722; Gene3D:IPR013785;
FT                   HMMTigr:IPR012726"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74027"
FT                   /db_xref="GOA:C4ZAG6"
FT                   /db_xref="InterPro:IPR010722"
FT                   /db_xref="InterPro:IPR012726"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR034428"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZAG6"
FT                   /protein_id="ACR74027.1"
FT                   /translation="MTNDTNITNDKDINANIAHDDHFNDSIVNEVILEDMKKNRIDHMK
FT                   YLPDMEVLDSDIMDRVVAEMDAYDYDQYTAADVRAALSHEYRTLEDFKALLSPAAQPFI
FT                   EEIAQAAQLETRKHFGNSVCMFTPLYISNYCENYCIYCGFNCHNKINRAKLNASEIEKE
FT                   MAAIAKTGLQEILILTGESKKMSDVEYIGEACKIARKYFKVIGLEVYPMNSDEYAYLHE
FT                   CGADYVTVFQETYNSDKYETLHLAGHKRIFPYRVNAQERALKGGMRGVGFAALLGLDDF
FT                   RKDALATGYHAYLLQKKYPRAEIAFSCPRLCPIINNDRINPKDVHETQLLQVVCAYRLF
FT                   MPFASITISTREVARVRDNLVNIAATKISAGVSTGIGSHVDDIEDKGDDQFEISDGRSV
FT                   DEVFNALLDNGLQPVMSDYIYV"
FT   gene            complement(209907..210695)
FT                   /locus_tag="EUBREC_0224"
FT   CDS_pept        complement(209907..210695)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0224"
FT                   /product="thiazole biosynthesis family protein"
FT                   /note="Cytoplasmic, score:8.87; COG2022 Uncharacterized
FT                   enzyme of thiazole biosynthesis; KEGG:K03149 thiazole
FT                   biosynthesis family protein; HMMPfam:IPR008867;
FT                   Gene3D:IPR013785; superfamily:IPR008867"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74028"
FT                   /db_xref="GOA:C4ZAG7"
FT                   /db_xref="InterPro:IPR008867"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR033983"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZAG7"
FT                   /protein_id="ACR74028.1"
FT                   /translation="MSKNIDLAKDKLVLGGHEFTSRFILGSGKFSLDLVKACIEKADAQ
FT                   IITLALRRANDGGLANILDYIPDNVTLLPNTSGARNADEAVRIARLSRELGCGDFVKIE
FT                   IMRDSKYLLPDNFETIKATEILAKEGFIVMPYMYPDLNVARDLANAGAACIMPLGAPIG
FT                   SNKGICTKEFIQILIDEIDLPIIVDAGIGRPSQACEAMEMGAAAVMANTAVATAGDVEI
FT                   MAEAFKKAIEAGRMAYLSGLGRTLTKGASASSPLTGYLRD"
FT   gene            complement(210746..210943)
FT                   /locus_tag="EUBREC_0225"
FT   CDS_pept        complement(210746..210943)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0225"
FT                   /product="Hypothetical protein"
FT                   /note="Unknown cell location; COG2104 Sulfur transfer
FT                   protein involved in thiamine biosynthesis;
FT                   HMMPfam:IPR003749; Gene3D:IPR012675; HMMTigr:IPR010035"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74029"
FT                   /db_xref="InterPro:IPR003749"
FT                   /db_xref="InterPro:IPR010035"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR016155"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZAG8"
FT                   /protein_id="ACR74029.1"
FT                   /translation="MVKINGKEAADVCGMTVSQYLSANNYNPKHIVVELNEEILPKTEY
FT                   DSTAIADGDVVEILSFMGGG"
FT   gene            complement(211282..211551)
FT                   /locus_tag="EUBREC_0226"
FT   CDS_pept        complement(211282..211551)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0226"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74030"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZAG9"
FT                   /protein_id="ACR74030.1"
FT                   /translation="MYLYFVIISSSNIFSSIKSAIRNFHHYSDPHAHSQNRTILVLYRC
FT                   YAANFAHMCGGGSIRATLRTKKLPLTCKHDASAFLFSVVLNSYF"
FT   gene            211502..211732
FT                   /locus_tag="EUBREC_0227"
FT   CDS_pept        211502..211732
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0227"
FT                   /product="Hypothetical protein"
FT                   /note="Cytoplasmic, score:8.87"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74031"
FT                   /db_xref="GOA:C4ZAH0"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZAH0"
FT                   /protein_id="ACR74031.1"
FT                   /translation="MEENMFDEEMITKYRYIILLLGTAVSFVFGFAVAFALAKLCGVMA
FT                   VKAVLNIAFTAGGITGMLGFVCICLAELRRI"
FT   gene            211989..213614
FT                   /locus_tag="EUBREC_0228"
FT   CDS_pept        211989..213614
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0228"
FT                   /product="glucose-6-phosphate isomerase"
FT                   /note="Cytoplasmic, score:9.98; COG0166 Glucose-6-phosphate
FT                   isomerase; KEGG:K01810 glucose-6-phosphate isomerase
FT                   HMMPfam:IPR001672; FPrintScan:IPR001672;
FT                   HMMPanther:IPR001672; ScanRegExp:IPR001672"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74032"
FT                   /db_xref="GOA:C4ZAH1"
FT                   /db_xref="InterPro:IPR001672"
FT                   /db_xref="InterPro:IPR018189"
FT                   /db_xref="InterPro:IPR023096"
FT                   /db_xref="InterPro:IPR035476"
FT                   /db_xref="InterPro:IPR035482"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZAH1"
FT                   /protein_id="ACR74032.1"
FT                   /translation="MRLVKIRLNDKEEIAMITWNNLDTLESFKELSKVGRVDIKEAMSG
FT                   DNGAKRVKEYNIPMAEGFTYNFAAKQVDADVLEALAKLAKEAQLTEKFEALYNGAVINT
FT                   GENRLVLHQLTRGQLGDAVVADGVDKRKFYVEQQERIAEFANKVHSGEITNAAGEKFTT
FT                   VVQIGIGGSDLGPRAMYLALENWAKKNNTFKMEAKFISNVDPDDAASVLASVDVAHSIF
FT                   ILVSKSGTTLETLTNESFVKDALKNAGLDASKHMIAVTSETSPLAKSDDYLAAFFMDDY
FT                   IGGRYSSTSAVGGAVLSLAFGPEVFAQFLDGAAAEDKLSKNANIMENPEMLDALIGVYE
FT                   RNVLGYPSTAVLPYSQALSRFPAHLQQADMESNGKSVNRFGEPVDYVTGPVIFGEPGTN
FT                   GQHSFYQLLHQGTDIVPLQFIGFKNNQLDTDVVIQDSTSQQKLCANVAAQIVAFACGKA
FT                   DDNKNKNFEGGRPSSIIIGDQVNPASLGALLAHFENKIMFQGFLWNVNSFDQEGVQLGK
FT                   LLAKKVLAHETDGALKELSDMLNI"
FT   gene            213785..214039
FT                   /locus_tag="EUBREC_0229"
FT   CDS_pept        213785..214039
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0229"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74033"
FT                   /db_xref="GOA:C4ZAH2"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZAH2"
FT                   /protein_id="ACR74033.1"
FT                   /translation="MLSLFVCFVKDNIILDIAVASGISMAMAVLSGCITVVLLRTVLHP
FT                   PGIGCSADTNGSTHDNYYCFKHFKSSVLLCQHDAEKMFI"
FT   gene            complement(213794..213985)
FT                   /locus_tag="EUBREC_0230"
FT   CDS_pept        complement(213794..213985)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0230"
FT                   /product="Hypothetical protein"
FT                   /note="Cytoplasmic, score:8.87"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74034"
FT                   /db_xref="GOA:C4ZAH3"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZAH3"
FT                   /protein_id="ACR74034.1"
FT                   /translation="MLETIIIVVCAAVCIGAAAYAWWMENGPEKDDSDAAGKNSHSHAY
FT                   TRCDSNIKDDIVFHKAHK"
FT   gene            complement(214050..214571)
FT                   /locus_tag="EUBREC_0231"
FT   CDS_pept        complement(214050..214571)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0231"
FT                   /product="Hypothetical protein"
FT                   /note="Unknown cell location"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74035"
FT                   /db_xref="GOA:C4ZAH4"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZAH4"
FT                   /protein_id="ACR74035.1"
FT                   /translation="MKKILVLPLLLCLIFCSFLSLDKNLDEFDPDRTAYGSYDHRVVWG
FT                   SYASSDKAALPQQEVLDSRAVLYSESDMSALMDCQYIEEIPSFPAVICRIRTSSLGFLG
FT                   RLTSNLSWLGALLQLIHIILFAYAAIVVMRICLTNTSRRFIIRFIHDKDGHKLISFADY
FT                   FKTRAYAEEI"
FT   gene            complement(214980..215138)
FT                   /locus_tag="EUBREC_0232"
FT   CDS_pept        complement(214980..215138)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0232"
FT                   /product="Hypothetical protein"
FT                   /note="Unknown cell location"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74036"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZAH5"
FT                   /protein_id="ACR74036.1"
FT                   /translation="MFFLLIRESTIICSQYLVSVTLNYDIRAFNVCRLEERELLSACLA
FT                   SCVLSNI"
FT   gene            215234..215479
FT                   /locus_tag="EUBREC_0233"
FT   CDS_pept        215234..215479
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0233"
FT                   /product="Hypothetical protein"
FT                   /note="Unknown cell location; NOG17852 non supervised
FT                   orthologous group"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74037"
FT                   /db_xref="InterPro:IPR023860"
FT                   /db_xref="InterPro:IPR027271"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZAH6"
FT                   /protein_id="ACR74037.1"
FT                   /translation="METRIALIGIIVENPDSVEQLNHLLHEYGSFIVGRMGIPYEKKNV
FT                   NIISVAIDAPQDIISALSGRIGRLDGIGVKTVYSNK"
FT   gene            215505..216563
FT                   /locus_tag="EUBREC_0234"
FT   CDS_pept        215505..216563
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0234"
FT                   /product="biotin synthase"
FT                   /note="Cytoplasmic, score:8.87; COG0502 Biotin synthase and
FT                   related enzymes; KEGG:K01012 biotin synthase
FT                   HMMPfam:IPR007197; Gene3D:IPR013785; HMMSmart:IPR006638"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74038"
FT                   /db_xref="GOA:C4ZAH7"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010722"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR024021"
FT                   /db_xref="InterPro:IPR034422"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZAH7"
FT                   /protein_id="ACR74038.1"
FT                   /translation="MTDNTAIIKIIDEITACRNITLEQLHMLLETDDMQAVDYLRKRAS
FT                   EKAHETYGNQVFIRGLIEFTNYCKNDCLYCGIRHSNTHADRYRLSTEQIMACCESGYEL
FT                   GFRTFVLQGGEDPYYTDERICEIVSGIKAKYPDCAVTLSIGEKSKESYQSYFDAGADRY
FT                   LLRHETADEKHYSRLHPAEMSLENRKQCLWDLKEIGYQVGCGFMVGSPGQTVETLYEDL
FT                   QFIKELEPHMVGIGPFISQKDTPFANEKSGTMDETLRLLSIIRLIHPKVLLPATTALGT
FT                   IHPLGREKGIQSGANVVMPNLSPVNVRDKYKLYDNKICTGDEAAECRYCMENRMKSIGY
FT                   QVVVSRGDYANF"
FT   gene            216620..218047
FT                   /locus_tag="EUBREC_0235"
FT   CDS_pept        216620..218047
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0235"
FT                   /product="thiamine biosynthesis protein ThiH"
FT                   /note="Cytoplasmic, score:8.87; COG1060 Thiamine
FT                   biosynthesis enzyme ThiH and related uncharacterized
FT                   enzymes; KEGG:K03150 thiamine biosynthesis protein ThiH;
FT                   HMMPfam:IPR007197; HMMPfam:IPR010722; Gene3D:IPR013785"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74039"
FT                   /db_xref="GOA:C4ZAH8"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010722"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR024007"
FT                   /db_xref="InterPro:IPR034428"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZAH8"
FT                   /protein_id="ACR74039.1"
FT                   /translation="MYNVKSLKAEEFISDEEIKETLEYAEANKNNIGLIDAIIEKAKLK
FT                   KGLTHREASVLLACEIPEKLDEVYKLAQQIKKDFYGNRIVLFAPLYLSNYCVNGCVYCP
FT                   YHMKNKHIARKKLTQEEIVKEVTALQDMGHKRLAIEAGEDPVNNPIEYILECINTIYSI
FT                   KHKNGAIRRVNVNIAATTVENYRKLKEAGIGTYILFQETYHKESYEQLHPTGPKHDYAY
FT                   HTEAMDRAMEGGIDDVGLGVLFGLDKYKYEFAGLLMHAEHLEAVHGVGPHTISVPRIKH
FT                   ADDIDPDVFDNGISDDTFAKICALIRISVPYTGMIISTRESQTVREKVLPLGVSQISGA
FT                   SKTSVGGYADPEAEKNAEATSEQFDVSDQRTLDEVVNWLMKMDYIPSFCTACYREGRTG
FT                   DRFMALCKSMQILNCCHPNALMTLKEYLEDYASPQTRELGMKLIDREIEKITNPKVKQT
FT                   CYEHIHDIADGKRDFRF"
FT   gene            218010..219374
FT                   /locus_tag="EUBREC_0236"
FT   CDS_pept        218010..219374
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0236"
FT                   /product="GTP-binding protein EngA"
FT                   /note="Cytoplasmic, score:8.87; COG1160 Predicted GTPases;
FT                   KEGG:K03977 GTP-binding protein EngA; HMMPfam:IPR002917;
FT                   HMMTigr:IPR005225"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74040"
FT                   /db_xref="GOA:C4ZAH9"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR023873"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040644"
FT                   /db_xref="InterPro:IPR041606"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZAH9"
FT                   /protein_id="ACR74040.1"
FT                   /translation="MILQTESVISVSKGGNMGNLNETPSANRLHIGIYGKTNSGKSSLI
FT                   NAVTKQEVSIVADVAGTTTDPVYKPMEIHPLGPCVIIDTAGFDDDSELGERRVEKTHLA
FT                   AEKTDIAVVVLDIAEVIAAKKAGVPFKKAFKDEAEWSLLFAKKHTPVVFALNKIDEILL
FT                   SAEAQEKSRGKLDNAAIEAAKCWVYEENSAVMGKNADNSFEVVAVSALKGKGMDAVISA
FT                   LTRLLPEDFGQEFILGDLVSQTDLVLLVMPQDIQAPKGRLILPQVQTLRELLDRKCLVM
FT                   STTTDKMTDALAALSHAPKLIVTDSQVFGYVYEHKPAESMLTSFSVLFAAYKGDLPYYV
FT                   ESARAIDALKPSSRVLIAECCTHAPLAEDIGRVKLPNLLRKRVGEELTVDITSGTDFPD
FT                   NLSQYDLVIQCGACMFNRKYVLSRIDRARTQHVPMTNYGVAIAHLTGILDKVSMP"
FT   gene            219413..220087
FT                   /locus_tag="EUBREC_0237"
FT   CDS_pept        219413..220087
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0237"
FT                   /product="Hypothetical protein"
FT                   /note="Cytoplasmic, score:8.87"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74041"
FT                   /db_xref="InterPro:IPR024539"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZAI0"
FT                   /protein_id="ACR74041.1"
FT                   /translation="MTKTSDFDDKVNYSGDYKGNYSGDYRDNYSSDYSATGYARLAKSL
FT                   IDIVKEQQAKLGYRKEIVRLYYPLSTLRHFFECAGADNKIATGMISEQQMLEILAPNNL
FT                   PKQLTDTIGEIKVTAKNERFCIEIPPEGSEYVHENTADNEFISELIALVGTHGCTMEQI
FT                   TELFYKYSDNIEKKDMQNGEFDCYIRFLNEPDDTYYYCFHDEGCHIIYHRFLPQDYADF
FT                   GF"
FT   gene            220304..220909
FT                   /locus_tag="EUBREC_0238"
FT   CDS_pept        220304..220909
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0238"
FT                   /product="Hypothetical protein"
FT                   /note="Cytoplasmic, score:8.87; COG1309 Transcriptional
FT                   regulator; HMMPfam:IPR001647; Gene3D:IPR012287;
FT                   superfamily:IPR009057"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74042"
FT                   /db_xref="GOA:C4ZAI1"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR039532"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZAI1"
FT                   /protein_id="ACR74042.1"
FT                   /translation="MATFTRKAIMQTFLHILKNKPLDRITVKDICEQCEINRNTFYYYF
FT                   KDIYDVLEAIFEDEVRLVMDEAKEGVTFHDAYARVAALILNNREAIMHIYASENGRVLR
FT                   TYLDAVVTQVVRRFVLEKAEGYSLDDSDIAFITAFYSNGIVGSTIKWIERGSMMSRLPE
FT                   NITANGVGLSKSQYNRDIVKRIGDSFDATIYDMIECCL"
FT   gene            221048..221605
FT                   /locus_tag="EUBREC_0239"
FT   CDS_pept        221048..221605
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0239"
FT                   /product="Hypothetical protein"
FT                   /note="CytoplasmicMembrane, score:9.99; COG3247
FT                   Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74043"
FT                   /db_xref="GOA:C4ZAI2"
FT                   /db_xref="InterPro:IPR005325"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZAI2"
FT                   /protein_id="ACR74043.1"
FT                   /translation="MHTLVRVKNAYTVMTICLIALGAALLFAPQLGLRTLCVVYGVFLI
FT                   VYGVTKLSGYFAKDLFQLAFQFDLALGIVSIVLGIIIIKKTEYIIEILSTAIGIFMLVD
FT                   GAFKIQTAVEAKRFGIKRWWLILVMSFVVAFVGILLLVTPFETAGMIVRLIGLNLSLDG
FT                   ILNLFVVRNTVETIRRNTKWEI"
FT   gene            221593..222963
FT                   /locus_tag="EUBREC_0240"
FT   CDS_pept        221593..222963
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0240"
FT                   /product="coenzyme PQQ biosynthesis protein E"
FT                   /note="Cytoplasmic, score:8.87; COG0535 Predicted Fe-S
FT                   oxidoreductases; KEGG:K06139 coenzyme PQQ biosynthesis
FT                   protein E; HMMPfam:IPR007197; HMMSmart:IPR006638"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74044"
FT                   /db_xref="GOA:C4ZAI3"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR023885"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZAI3"
FT                   /protein_id="ACR74044.1"
FT                   /translation="MGNLGHQAARLAASKICDNIVKGLCKDPETEVVKLIDMWQKFMGD
FT                   EKIDLNYDSARKMICDKDCTLNKYMHRLINEIDPHVLKTIALNLGFEAFVYGTKTIRKN
FT                   REKYGCNVPWLILMDPTSACNLHCTGCWAAEYGHKLNLTFDEMDKVVTQGKELGVYLYM
FT                   FTGGEPLVRKADLVKLCEKHNDCAFLAFTNGTLVDEAFCADLKRIGNLYLAISLEGFSE
FT                   VNDLRRGTGVFAKVMHAMDLLKENGLVFGTSICYTSKNYKTVTSDEFIDMIVEKGCRYA
FT                   LYFHYMPVGNDASLELLPNPKQRLYIKDRVREIRNMTSGKGIFTMDFQNDGEFVGGCIA
FT                   GGRNYFHINANGDAEPCVFIHYSGANIRTHSMLEILKQPLFMAYHDNQPFNENHYRPCP
FT                   MLENPEILQRLVKETGAKSTDLQSPESAEHLCNKCKEYAQAWKPCADKLWAEEGHSN"
FT   gene            222963..223742
FT                   /locus_tag="EUBREC_0241"
FT   CDS_pept        222963..223742
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0241"
FT                   /product="putative deoxyribonuclease"
FT                   /note="Cytoplasmic, score:8.87; COG0084 Mg-dependent DNase;
FT                   KEGG:K03424 putative deoxyribonuclease HMMPfam:IPR001130;
FT                   HMMPIR:IPR012278; HMMPanther:IPR015992; HMMTigr:IPR015991;
FT                   ScanRegExp:IPR001130"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74045"
FT                   /db_xref="GOA:C4ZAI4"
FT                   /db_xref="InterPro:IPR001130"
FT                   /db_xref="InterPro:IPR015991"
FT                   /db_xref="InterPro:IPR018228"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZAI4"
FT                   /protein_id="ACR74045.1"
FT                   /translation="MIFETHAHYDDDRFKDDRDETIKRVHEKGVAPIINVGASIGSTMT
FT                   TIELAKKYDFIYAAVGVHPSDVADLNEETFAWLREQTAWERTVAVGEIGLDYYWDKEPK
FT                   VQENQRYWFKRQLELAAEASLPVIIHSRDAAQDTMEIMTEAAKKDIRGVIHCYSYSPEM
FT                   ALEYVKLGYYIGVGGVVTFKNAKKLVQTVSELPLDRILLETDCPYMAPEPHRGTRNDSS
FT                   NIPYVISKIAEIKGTTPDEVERKTRANAFELFTRVSD"
FT   gene            224170..225036
FT                   /locus_tag="EUBREC_0242"
FT   CDS_pept        224170..225036
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0242"
FT                   /product="dimethyladenosine transferase"
FT                   /note="Cytoplasmic, score:8.87; COG0030 Dimethyladenosine
FT                   transferase (rRNA methylation); KEGG:K00561
FT                   dimethyladenosine transferase HMMPfam:IPR001737;
FT                   HMMPanther:IPR001737; HMMSmart:IPR001737;
FT                   HMMTigr:IPR011530; ScanRegExp:IPR001220;
FT                   ScanRegExp:IPR001737"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74046"
FT                   /db_xref="GOA:C4ZAI5"
FT                   /db_xref="InterPro:IPR001737"
FT                   /db_xref="InterPro:IPR011530"
FT                   /db_xref="InterPro:IPR019825"
FT                   /db_xref="InterPro:IPR020596"
FT                   /db_xref="InterPro:IPR020598"
FT                   /db_xref="InterPro:IPR023165"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZAI5"
FT                   /protein_id="ACR74046.1"
FT                   /translation="MAYLGNPKNTIEVLQKYNFNFQKKFGQNFLIDTGILEEIIDSAGI
FT                   TKDDMILEIGPGIGTMTQYLCESARQVIAVEIDTNLIPILKDTLSEYDNVKVINDDILK
FT                   VDINALAEEYNNGKPIKVVANLPYYITTPIIMGLFESHVPIDSITIMVQKEVADRMQAA
FT                   PGKKDYGALSLAVQYYSHPEIVVNVPPSCFMPQPKVGSSVISLKRYEKPVVDVEDEKLM
FT                   FKIIRASFNQRRKTLANGLNNFGGMGLTKEQIQQSIEALGVPVNVRGEALSLAQFAQLS
FT                   NIIGAAK"
FT   gene            225111..225788
FT                   /locus_tag="EUBREC_0243"
FT   CDS_pept        225111..225788
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0243"
FT                   /product="Hypothetical protein"
FT                   /note="Unknown cell location; COG0739 Membrane proteins
FT                   related to metalloendopeptidases; HMMPfam:IPR002886;
FT                   HMMPanther:IPR002886; superfamily:IPR011055"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74047"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZAI6"
FT                   /protein_id="ACR74047.1"
FT                   /translation="MKKQQIAAAACLVAGAIGFAAVYSTQKPGKDEIPTEISQTSSIVE
FT                   PTEKKTPQKTTEKVDSEKKMGQEESAAGQQENQQPTEKQLHFVPENVTNWPVKGDVLLP
FT                   FSMDKTVYFPTLDQYQYNRGMVIRANEGDAVCSVTEGRIIDIYDSAETGCTVVQDLGDG
FT                   YTATYGQLANLTCSEGDVLEAGETLGTVGKVTRYYTVEGTNVYFAMEQDGKPVNPMDYF
FT                   GDI"
FT   gene            225798..227447
FT                   /locus_tag="EUBREC_0244"
FT   CDS_pept        225798..227447
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0244"
FT                   /product="putative regulatory components of sensory
FT                   transduction system"
FT                   /note="Cytoplasmic, score:8.87; COG2199 FOG: GGDEF domain;
FT                   KEGG:K02488 putative regulatory components of sensory
FT                   transduction system; HMMPfam:IPR000160; HMMSmart:IPR000160;
FT                   HMMTigr:IPR000160"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74048"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZAI7"
FT                   /protein_id="ACR74048.1"
FT                   /translation="MEFNEYNESVKNWTNGILDNYRKDAELTIRYCHELIDYGEKTADS
FT                   KLLGFGYYHLAMILYCLNDYDNIFDIVVRAIDHLEKAQSWSMLARACNILGIITSGRGN
FT                   QPVAYDYYLDGLMYCKKYGLLEEQSIINVNCGALNIKVGRYKEAMEYFQKAMEYIASAP
FT                   DEPSYHTRMISLYENMINCKVLESDFTGIDEILEIVEREHLPYADAIDRLGMLISRTFY
FT                   MHKSGQIEKRDECIRRIDGVITQDMLFMDLIEDFFVYLEVLFESEKIDEFWHLMELMEP
FT                   MINNLKVTSMQMRLLGLKIRFYRKHHMGAEYLQAAGLYYELSERKELEAKAMIKEVIEL
FT                   RANFEKVNRAKKKIEKENKLLAAQSETDPLTGMANRRKLNIQADEMFSHAHKCGHNFAI
FT                   EILDVDYFKEYNDNYGHQEGDRCLIAIADCISKVAGVHGGFCARYGGDEFVVIYENISK
FT                   EDAKEYVEELRRKVMELTLPHRFSKMLPIVTITQGMYCDVPKEENRVWDFLHVADEILY
FT                   SVKTDNRGSCRVVDRAEFMLMSGYGTTIQGQA"
FT   gene            227489..227788
FT                   /locus_tag="EUBREC_0245"
FT   CDS_pept        227489..227788
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0245"
FT                   /product="predicted O-methyltransferase"
FT                   /note="Cytoplasmic, score:8.87; COG2827 Predicted
FT                   endonuclease containing a URI domain; KEGG:K07461 predicted
FT                   O-methyltransferase; HMMPfam:IPR000305; HMMSmart:IPR000305"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74049"
FT                   /db_xref="GOA:C4ZAI8"
FT                   /db_xref="InterPro:IPR000305"
FT                   /db_xref="InterPro:IPR035901"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZAI8"
FT                   /protein_id="ACR74049.1"
FT                   /translation="MDKADMDENYTYIVRCADGTLYTGWTNDLKKRIKAHNSGKGAKYT
FT                   KTRRPVELVYFEHFATKEEAMSREYHIKQLKRAQKQALIDEMNKNNKSIFTQNG"
FT   gene            227989..229425
FT                   /locus_tag="EUBREC_0246"
FT   CDS_pept        227989..229425
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0246"
FT                   /product="hypothetical ABC transporter extracellular
FT                   binding protein"
FT                   /note="Unknown cell location; COG1653 ABC-type sugar
FT                   transport system, periplasmic component; KEGG:K10117
FT                   hypothetical ABC transporter extracellular binding protein;
FT                   HMMPfam:IPR006059"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74050"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZAI9"
FT                   /protein_id="ACR74050.1"
FT                   /translation="MFAKTILILNLLGGFKMKKKLVTVLLASSMVATMLAGCGSGSGDG
FT                   TEKGSSAKGGDGSVYMLNFKPETDQAWQDLAEKYTDETGVQVTVVTAADGQYKTTLKSE
FT                   LAKKEAPTIFNIGSTSDCAEYDKYIYDLKDSEIYKHLTDKSLALEYNGKIASVANCYEC
FT                   YGIIYNKAILEKYCSNYSGAVIKSVDDIKDLDTLEKVATDINEHVDDINKACDLHLTEA
FT                   FASAGLDSGSNWRFTGHLAGLALYYEFKDAGCDLTAGQKEVTGKYMDNFKRVWDMYTNT
FT                   SAADKATLDSGSLNAESELGMEEAVFYQNGDWEYANFADDNENGYTVKQSDLSMMPIYF
FT                   GVDDANEGLAVGTENHWTVNAKADQKDIDATLEFLNWVITSDDGRDAIVNKMGLSAPFD
FT                   TFTGDYESKNAFANVASELAKEGKTSVAWSFNATPSVDDWRADFLAPLTEYTERNGSWD
FT                   DVAKAFSEKWAYYWDLQNEQ"
FT   gene            229513..230370
FT                   /locus_tag="EUBREC_0247"
FT   CDS_pept        229513..230370
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0247"
FT                   /product="permease of ABC transporter possibly for
FT                   oligosaccharides"
FT                   /note="CytoplasmicMembrane, score:10.00; COG1175 ABC-type
FT                   sugar transport systems, permease components; KEGG:K02025
FT                   permease of ABC transporter possibly for oligosaccharides;
FT                   HMMPfam:IPR000515"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74051"
FT                   /db_xref="GOA:C4ZAJ0"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZAJ0"
FT                   /protein_id="ACR74051.1"
FT                   /translation="MEKSIRKKFWIFALPTMAAFTIGFIVPFVYGIFLSFCKFSTVTDW
FT                   KWVGFKNYTRIFVVNGSVDTTFIHSIWYTALFTVVSVLIINIVSFAIAMALTKGIRGTN
FT                   LFRTVFFLPNLIGGIVLSYVWLMIFNSILQNYSKTIVSSEWSAFWGLIAVVCWQQIGYM
FT                   MIIYIAGIQNIPGELIEAAKIDGANRWQLLKSVILPMLMPTITICTFLTLTNGFKLFDQ
FT                   NLALTGGNPGKMSELLALNIYNTMYGTTGWQGVGQAKAVIFFIIVAIIALAQNKITTSK
FT                   EVQD"
FT   gene            230370..231281
FT                   /locus_tag="EUBREC_0248"
FT   CDS_pept        230370..231281
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0248"
FT                   /product="permease of ABC transporter possibly for
FT                   oligosaccharides"
FT                   /note="CytoplasmicMembrane, score:10.00; COG0395 ABC-type
FT                   sugar transport system, permease component; KEGG:K02026
FT                   permease of ABC transporter possibly for oligosaccharides;
FT                   HMMPfam:IPR000515"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74052"
FT                   /db_xref="GOA:C4ZAJ1"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZAJ1"
FT                   /protein_id="ACR74052.1"
FT                   /translation="MAKQKKTQEVSAVRQAKHGWIITLLFTVLSVLWISPIFMVLLNSF
FT                   KRKAYIFKHPFGISTVSITEGFEAFKDGMSRLFCSTLNYKNGLRMTHFWDCFGNSLFIT
FT                   VGSVVLIVLCCSMCAWYIVRVKTKGTKLMYTLCLFSMIVPFQMVMFTLSKFANMLHLSN
FT                   PLGIIIVYLGFGAGLAVFMFTGFVKSISLEIEEAAMIDGCTPLQMYFRVVFPILRPTAV
FT                   TVAILEAMWVWNDYLLPSLVLNINQYKTIPIAIQYLKQSHGMIDWGAMMAMLVLAILPI
FT                   VIFYIVCQKYIIEGVLAGAVKG"
FT   gene            231464..232468
FT                   /locus_tag="EUBREC_0249"
FT   CDS_pept        231464..232468
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0249"
FT                   /product="catabolite control protein A"
FT                   /note="Cytoplasmic, score:9.98; COG1609 Transcriptional
FT                   regulators; KEGG:K02529 catabolite control protein A;
FT                   HMMPfam:IPR000843; HMMPfam:IPR001761; HMMSmart:IPR000843;
FT                   superfamily:IPR010982"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74053"
FT                   /db_xref="GOA:C4ZAJ2"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZAJ2"
FT                   /protein_id="ACR74053.1"
FT                   /translation="MTIVDIAKESGYSVTTVSRVLNNRQDVSPAAKETIMKIVEAHNFV
FT                   PNTNAKRLKQTISRNIYLLVKGTSNMLFANVVEEIQSIIDRTDYSLSITYLDEDSNLSS
FT                   VTDRICRERKPLGIIFLGGSREDFSEDTSSFKVPCVIVTTSAENWSMEELSSVSIDDEK
FT                   AGETIVDYLIEHGHTKIAEIGANLELSQTARLRHNGYLNSLKKHGITPDERYYERARFS
FT                   YDSAYRAMKKLLEKDIEITAVYAISDVMAIGALRAILDKGLRVPEDISITGFDGSTLAE
FT                   YYNPKIVSIRQPHKDMAARSVELLFNMIDLHKGSCHEIIPFELTEGESVARID"
FT   gene            232529..233695
FT                   /locus_tag="EUBREC_0250"
FT   CDS_pept        232529..233695
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0250"
FT                   /product="protein of unknown function UPF0118"
FT                   /note="CytoplasmicMembrane, score:9.99; COG0628 Predicted
FT                   permease; KEGG:K03548 protein of unknown function UPF0118;
FT                   HMMPfam:IPR002549; HMMPanther:IPR002549"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74054"
FT                   /db_xref="GOA:C4ZAJ3"
FT                   /db_xref="InterPro:IPR002549"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZAJ3"
FT                   /protein_id="ACR74054.1"
FT                   /translation="MEVNNKMKHTIKVAWAKGFSQFLALAGAILLVFVLFKFDAIMAQI
FT                   VRIINILMPIIMGIVLAYLINPMVEFYDRKLSNSLGKAIEKKCGKRPSMRGLSILISLA
FT                   IIIAIIVVLIMMVVPQLVSNITNAVSLLPDQIQDLVKKITELAKNNDRAKEIITELYNN
FT                   GISYFTEWVKDNMLGQVTFVINGIMGIFGTAVNCLVAFIVAIYVLLSKDTFKRQTKKLV
FT                   SAFLPERHIQVLSSILKESDKIFGGFISGKIIDSLIIGAICFVCCLILRMPYVALISVI
FT                   VGVTNVIPFFGPYIGAIPSTILIMLDSPSKGVIFLLFIIILQQVDGNIIGPKILGESTG
FT                   LSPFWVVFAIFLGNGLFGVMGLFIGVPTWGVVYYLIKRYVNYRVRKKE"
FT   gene            233885..235228
FT                   /locus_tag="EUBREC_0251"
FT   CDS_pept        233885..235228
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0251"
FT                   /product="hypothetical protein"
FT                   /note="CytoplasmicMembrane, score:9.99; COG0534 Na+-driven
FT                   multidrug efflux pump; KEGG:K03327 hypothetical protein;
FT                   HMMPfam:IPR002528; HMMPanther:IPR002528;
FT                   HMMPanther:IPR015522; HMMTigr:IPR002528"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74055"
FT                   /db_xref="GOA:C4ZAJ4"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZAJ4"
FT                   /protein_id="ACR74055.1"
FT                   /translation="MKTDMTKGNPMKIILLFSIPVLMGNLFQQFYNMVDTIIVGQYLGS
FT                   KALAAVGSTGCIMFLVLGFANGIAQGFGVMASHAFGAKKEKLLKHYVALAIILTVIVSV
FT                   VLTIPTVLASRQLLIWLNTPDDILVMADAYIKVIFAGIFCTMSYNVASGLLRSIGDSKT
FT                   PLYFLIFSSVLNIVLDIFFIVVVKAGTAGAAYATVISQGIAAVLSFIVMFKKYDLLRTS
FT                   REDYYMDWSGIWRMLSIGLQMALNYSITAIGTMIFQAAVNVFGSQVVAAYTAASKVSNI
FT                   ATQTMPTLGTAAATYCGQNLGAGRYDRIFKGMKSCFFICIGCAVLAAAINCFVGPYMIG
FT                   WFITSPTATDIDCAMKYLKIASVFMLPLAWIFAYRNGLQGLNKGLVPMLSGAMELVSRW
FT                   IAILALSKPFGYGGVCFADPAAWLTTGILLIVTYYVWEMRMRKKIQIK"
FT   gene            235312..236931
FT                   /locus_tag="EUBREC_0252"
FT   CDS_pept        235312..236931
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0252"
FT                   /product="Hypothetical protein"
FT                   /note="CytoplasmicMembrane, score:9.99; COG3210 Large
FT                   exoproteins involved in heme utilization or adhesion"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74056"
FT                   /db_xref="GOA:C4ZAJ5"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZAJ5"
FT                   /protein_id="ACR74056.1"
FT                   /translation="MNYYELSNTVTPDTIGYKNGLWQKRYVQIYRVLTVVWSVLTLCLL
FT                   FGMFHRDDYSSGMIKSCLLLFFACIIFLVLMLIAVVNISAKRTENWSLQDRHDYNLAMY
FT                   RTRYRNNRQLQSVVLIVMAKQQLLMSNYDLAAQALAMVDINCVKLPYLRDYYFCNAAVL
FT                   FLCDKPGWQEWLDKCYAVPANQKQMTDMQIGALFLSENAKMDLCQAIYADTRIKHKWPT
FT                   AIVITAILVLYAGIFYGVGGLLSRGYHYRYWFELSSVLITYAGCMVLSLYWIIRWILFS
FT                   DSVSKKSEGVRLFRKVILIVMWLCLMAAMVINLIISFIGMDTEKKVYANGLICMSTSDG
FT                   YSTDEYYNIKVGPFLRRNLTFKETIKFGLINDDDSTDDSGNDAGDSGANDSENSTENNS
FT                   QSYNDASENTENENAGNENADESLDTESMAVYDYMSAAGILSAGDAGIIRNGSTAKGTF
FT                   YSVFETGEADGNTYENRLVYDRVSENGQCDLFVYEQLVSGSDTRLLGFYAVNKTTNEVF
FT                   SADRNSWGGVSSREYQDATGEN"
FT   gene            complement(236959..237984)
FT                   /locus_tag="EUBREC_0253"
FT   CDS_pept        complement(236959..237984)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0253"
FT                   /product="hypothetical protein"
FT                   /note="Cytoplasmic, score:9.98; COG1609 Transcriptional
FT                   regulators; KEGG:K03484 hypothetical protein;
FT                   HMMSmart:IPR000843; superfamily:IPR010982"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74057"
FT                   /db_xref="GOA:C4ZAJ6"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR001761"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZAJ6"
FT                   /protein_id="ACR74057.1"
FT                   /translation="MGKKQVTFADIAEYTHFSKTTISRYFNHPDSLTLENQEKISRALD
FT                   ELGYKKNKLAKVLANGKSEFVGIIVPNLYLHYYSEMLTQLLATYANYHYKFLVFMSDKG
FT                   AAEEENYIDELLAYQIEGLIVLSHTLSSEKLASYHIPIVAIERESMHISSVTSDNYMGA
FT                   LQATSLLIRDKCDILIHINVDVPKYVPAYDRIRAFEDTCTEHNIPYELSLNVSGDSYND
FT                   LFSQMKVIFNNIDEKYPDKKKGVFLANDTYANMFLNLVIQKYGCLPDSYEIVGFDNSPI
FT                   ANEAIIPITTIGQQIDVIARTAMDLLVKQMENRKQRKPEPDLAPTHKKIAPVLIRRETT
FT                   S"
FT   gene            238151..239065
FT                   /locus_tag="EUBREC_0254"
FT   CDS_pept        238151..239065
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0254"
FT                   /product="ABC transporter, permease protein"
FT                   /note="CytoplasmicMembrane, score:10.00; COG4209 ABC-type
FT                   polysaccharide transport system, permease component;
FT                   KEGG:K02025 ABC transporter, permease protein;
FT                   HMMPfam:IPR000515; ScanRegExp:IPR000005"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74058"
FT                   /db_xref="GOA:C4ZAJ7"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZAJ7"
FT                   /protein_id="ACR74058.1"
FT                   /translation="MKEKKQSLKSKVTYVKKNWMLYIFFLMPALLLTIIFKYVPMGGLL
FT                   IAFKDYNVIKGVLGSPWVGLEYFKRFLSSPDFMNYLMNTLKVSIYGLLWGFPVPIILAL
FT                   LLNRIRKEGIKKKIQLLIYAPNFISVIVLCGMVRMFLSPIGPMNKLLGISTNWMTMPAA
FT                   FRTIYIASGIWQGAGWASIMYTAALSNASKELEEAARMDGANIFQQMWYVELPAIKNII
FT                   VIQFILQAGNIMSIGFEKAYALQTDMNLPASEILSTYVYRIGLLNGDYGYSTAVGLFNS
FT                   VINVILLIIVNAVVKKLNDGEGI"
FT   gene            239078..239980
FT                   /locus_tag="EUBREC_0255"
FT   CDS_pept        239078..239980
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0255"
FT                   /product="ABC transporter, permease protein"
FT                   /note="CytoplasmicMembrane, score:10.00; COG0395 ABC-type
FT                   sugar transport system, permease component; KEGG:K02026 ABC
FT                   transporter, permease protein; HMMPfam:IPR000515"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74059"
FT                   /db_xref="GOA:C4ZAJ8"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZAJ8"
FT                   /protein_id="ACR74059.1"
FT                   /translation="MEKDMTIKIKYSRTDKIVLGIGYTLLGLFVLAIIVPLVYVVLASF
FT                   MDPTVLNNQGLSFNIKDWTIDAYRRVLENDMIWRGFFNSFFYSIAFAAISVFVTILAAY
FT                   PMSKKEFVGRKFFNVIFIITMFFGGGMIPTFILINQLHMVNTVWAILIPGAFNVWNMIL
FT                   ARTYYQSVPNELREASAIDGANEIQHFFKIMLPVCKPIIAVLMLWSFVGMWNSYFDAMI
FT                   YLNDANLQPLQLVLRSILVQNTPQPGMIADIQSTAEMAKVAEQLKYATIVVSSLPLLIM
FT                   YPFFQKYFDKGIMVGSVKG"
FT   gene            239989..241689
FT                   /locus_tag="EUBREC_0256"
FT   CDS_pept        239989..241689
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0256"
FT                   /product="ABC transporter, substrate-binding protein"
FT                   /note="Unknown cell location; COG1653 ABC-type sugar
FT                   transport system, periplasmic component; KEGG:K02027 ABC
FT                   transporter, substrate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74060"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZAJ9"
FT                   /protein_id="ACR74060.1"
FT                   /translation="MSMDMKKRSFKKLITLSLTLAMLTGVAGCGKQQSLNAETNPDTPV
FT                   SDVQFPLKEKAELSFITSAPATSTQDPNERTIFKRMEKQTNVHIDWTCFVSDQFSDKKN
FT                   LALAQFGNLPDGLFNAGMSDYDLLRYAKQGIIIPVENLIDKYMPNLQAVFEKYPEYRTM
FT                   CTAPDGHIYSFPWIEQLGAGKEAIQAIGDIPYINKKWLDYLGLEVPTTTDELEQVLIAF
FT                   RDHADELEKEFDIEGGVIPMSFIINNGDQDPAILMNGFGEGYGDTGDHFAVTDEGKVIY
FT                   TPTQEGYKEGIEWLHKLVTEDLIDPEAFTQEWSTYVAKGKNHRYGLCFTWDIANIDNNT
FT                   DYVMLPALTGPDGVRNITRQNNSETSGFDRGRCVLTSSCRDTALAAAWIDQMYAPIQSP
FT                   QNNWGTYGEKDSFNIFEMSTNDEGGQMLKHMDLGDQSPVEVREAQSVNGPLAVLNEYYD
FT                   VYVTEPADAKWRLDNMHEAYLKDMNSKYVYPNVFMSIDDTNKVSQYDTDIKKYAEQKKA
FT                   DWILNGGIDKEWDSYLKKLNKYGLQDYLKIKQKYFDSYQKSLESTSEGK"
FT   gene            241745..243208
FT                   /locus_tag="EUBREC_0257"
FT   CDS_pept        241745..243208
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0257"
FT                   /product="sucrose-6-phosphate hydrolase"
FT                   /note="Cytoplasmic, score:9.98; COG1621 Beta-fructosidases
FT                   (levanase/invertase); KEGG:K01193 sucrose-6-phosphate
FT                   hydrolase HMMPfam:IPR013148; HMMPfam:IPR013189;
FT                   HMMSmart:IPR001362; HMMTigr:IPR006232;
FT                   ScanRegExp:IPR000875; superfamily:IPR008985"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74061"
FT                   /db_xref="GOA:C4ZAK0"
FT                   /db_xref="InterPro:IPR001362"
FT                   /db_xref="InterPro:IPR006232"
FT                   /db_xref="InterPro:IPR013148"
FT                   /db_xref="InterPro:IPR013189"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="InterPro:IPR023296"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZAK0"
FT                   /protein_id="ACR74061.1"
FT                   /translation="MSELLEKARSYEAKKIAATDKESKPLFHISAPAGWINDPNGFSVY
FT                   NGKIHLFYQYYPYLREWGPMHWGHSTTGDMIKWEQLPCALAPDEEYDKKGCFSGSAIEA
FT                   DGKHVLVYTGVTRIKLPDGSEQERQNQCIAFGDGLNYVKHENNPVVTGDMLPENCSRID
FT                   FRDPKIWKEDDTYYLIVGSKDLNNVGQVVLCSSKNLTDWQFETILAANSTGKIGTMWEC
FT                   PDFFGLEDKHVLICSPQSMKADKYEFHNGHNSVYFLGDYDKENHVFIKEEPHTLDYGMD
FT                   FYAPQTTLLPDGRRVMIAWMKSWDACVVPDSQDWQGMMTLPRELEIKDGRIWQKPVKEI
FT                   ENYRANKCHYTDKKIDCYTTFDGIKGRTLDMTVELSGEEYHDFTVEMACDDEYSTAFTY
FT                   NRVAGVLEIDRTCCGVTKDVVCVRKIKIADTDRKLKLRFIMDRQSIELFINDGQQVATT
FT                   AICTPLQADGISFNCDGSAVVDIEKYDII"
FT   gene            243331..244278
FT                   /locus_tag="EUBREC_0258"
FT   CDS_pept        243331..244278
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0258"
FT                   /product="pfkB-type carbohydrate kinase family protein"
FT                   /note="Cytoplasmic, score:9.98; COG0524 Sugar kinases,
FT                   ribokinase family; KEGG:K00847 pfkB-type carbohydrate
FT                   kinase family protein HMMPfam:IPR011611"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74062"
FT                   /db_xref="GOA:C4ZAK1"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZAK1"
FT                   /protein_id="ACR74062.1"
FT                   /translation="MDVVALGELLIDFTENGTSAQDNKLFEANPGGAPCNVLAMLQKLG
FT                   HQTAFIGKVGQDAFGRLLVDAVKEQGIDTTGVRYDDNVHTTLAFVQTAADGDRDFSFYR
FT                   NPGADMMLTADEVDLSLVRNAKIFHFGSLSMTDKICENATKHAIAAAKEAGVLISFDPN
FT                   LRKPLWKSMDDAKEKISWGLSQCDILKISDDEIEFMTGEKDIKTGVKKLIDEYHIPFIC
FT                   ATMGKNGSMAFFDGHIVEAAPFLRDDTVETTGAGDTFCACLLHDVLEHGINDRKDDGVK
FT                   KMLTFANAAASLITTRKGALRVMPEKGEVEAVIK"
FT   gene            244433..246130
FT                   /locus_tag="EUBREC_0259"
FT   CDS_pept        244433..246130
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0259"
FT                   /product="Hypothetical protein"
FT                   /note="Cytoplasmic, score:8.87; NOG08812 non supervised
FT                   orthologous group; HMMPfam:IPR012547"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74063"
FT                   /db_xref="InterPro:IPR012547"
FT                   /db_xref="InterPro:IPR018631"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZAK2"
FT                   /protein_id="ACR74063.1"
FT                   /translation="MVKTIGIGKQDFASVIEDNCFFVDKTSFIKEWWDSKDDVTLITRP
FT                   RRFGKTLNMSMLNCFFSNQYKDRSDLFDSLSIWEDEDYRKIQGTYPVIFMSFASVKADN
FT                   LGDAKIQIKAQIEAVYKRHRYLLEGDTLTADEIADFEGTNTRMGDAESGLKLNILCEYF
FT                   HRYWGKKTIIILDEYDTPIQEAYLHGYWNEFTAYIRSLFNATFKTNPYMERAIMTGITR
FT                   VSKESIFSDLNNLNVITTTSSSYATSFGFTENEVFDAMEEYGLSGEKDTVKKWYDGFKF
FT                   GNHSDIYNPWSITNFLKEKQISPYWASTSSNGLVNRLIRTASAEIKSMMETLLEGDSVE
FT                   VSIDEQLVFEQLDNDENAIWSLLLASGYLKVDSLEKRGLTLEPWYHLSITNLETVSMFS
FT                   NMFRGWFNASVSNYNGFIRALLRGNVKEMNIYMNEVALSTFSSFDSGKHPSGKSEPERF
FT                   YHGFVLGLLVELRDKYEVQSNRESGYGRYDVMIIPRDKNSQAVIIEFKVIDSQEETSLD
FT                   MTADSALKQIEEKNYDAKLLERGYKREAIQHYGFAFEGKKVLIKKAQI"
FT   gene            246131..248269
FT                   /locus_tag="EUBREC_0260"
FT   CDS_pept        246131..248269
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0260"
FT                   /product="hypothetical protein"
FT                   /note="CytoplasmicMembrane, score:9.97; COG0659 Sulfate
FT                   permease and related transporters (MFS superfamily);
FT                   KEGG:K03321 hypothetical protein; HMMPfam:IPR002645;
FT                   HMMPfam:IPR011547; Gene3D:IPR002645; superfamily:IPR002645"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74064"
FT                   /db_xref="GOA:C4ZAK3"
FT                   /db_xref="InterPro:IPR001902"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR011547"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZAK3"
FT                   /protein_id="ACR74064.1"
FT                   /translation="MKQKLSVAPTLKNYDKKNLPKDILAGIIIMAVSIPISMGYAQISG
FT                   LPAVYGLYGSVFPIILFALFSTSPQFIFGVDAAPAALVGAAVLGMGIEAGSKEAMTVVP
FT                   VFTFFVALWLLAFYFMNAGKLVNYISAPVMGGFITGICTTIILMQAPKLMGSAAGTGEL
FT                   FELSEHIWEALHHINAAALVMGIVALAILVVSKRLVPKFPMAVVLMVTGALFTYFGPVK
FT                   EWGVPTLSAVEPGMPRWYIPDFEAVFSVQKASEVIVLSLSVAVVIMAETLLAENNFAQK
FT                   NGYRIDDNTELLAFSIGNMAAAFTGCCPINGSVSRTAMSEQYEGKTQLTGLVAGVSMIA
FT                   VLLFCTGFIGYLPVPVLTAIVISALMGATEFHLAKRLWKVSRTEFFIFVGAFFGVLILG
FT                   TINGVLIGIILSFAEMIIRSAKPATCFLGVQPGHSHFRDIRESTNIHEIDGVIIYRFSS
FT                   GLFFANAKVLVRDIEDHLKHDTKAVIIDAGAIGSIDITGADSIESLYRSLKQKGVKLYI
FT                   TEHIAELNEQLRKLGLGYLIEQGCVRRTIHIALKDMGINRPYPLEGGVDNEERSASRKR
FT                   ADNRVQEFVWAFGAESEEQIEKQIKLQIEQLKKTKDIEEIMHGRWAHMDEFDQDEWLEH
FT                   LEEHLKEIVNISGKDVHTLAADIEMHRREVHERIAREHPELAERFAQRRHLLDKHLKER
FT                   RPEVYRIIVQLREDNKHK"
FT   gene            248266..250245
FT                   /locus_tag="EUBREC_0261"
FT   CDS_pept        248266..250245
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0261"
FT                   /product="hypothetical protein"
FT                   /note="Cytoplasmic, score:8.87; COG0514 Superfamily II DNA
FT                   helicase; KEGG:K03654 hypothetical protein
FT                   HMMPfam:IPR001650; HMMPfam:IPR002121; HMMPfam:IPR011545;
FT                   HMMPanther:IPR004589; HMMSmart:IPR001650;
FT                   HMMSmart:IPR002121; HMMSmart:IPR014001; HMMTigr:IPR004589;
FT                   superfamily:IPR010997"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74065"
FT                   /db_xref="GOA:C4ZAK4"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR002121"
FT                   /db_xref="InterPro:IPR004589"
FT                   /db_xref="InterPro:IPR010997"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032284"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZAK4"
FT                   /protein_id="ACR74065.1"
FT                   /translation="MNINQTLKQYFGYDSLRTGQEELINGILAGHDVLGIMPTGAGKSL
FT                   CYQLPALMLKGITLVISPLISLMSDQVKALNQAGVHAAYINSSLTENQIRMALSYASQG
FT                   RYKIIYVAPERLNTPRFLDFACNADISMLTVDEAHCISQWGQDFRPSYLEIAGFLTRLP
FT                   RRPIVSAFTATATERVKNDIVASLGLNNPVTMVTGFDRPNLFFRVVTRKGGSQKDNSII
FT                   NYVKKHEDESGIIYCATKKNVDKLYTLLNEQGISAGRYHAGLSNDERKQNQEDFTYDRI
FT                   RVMVATNAFGMGIDKSNVRYVLHYNMPQSLEYYYQEAGRAGRDGEEAECVLFFSKQDIM
FT                   INKFLLQNKASAGDVASDMQKTANDRRKLQQMINYCETDKCLREFILSYFGDTTPCICN
FT                   KCSNCVVVEDEEEETYVETGKKRKKAAQLAGLNELGAALFEKLRSVRTELAAEKSVPPY
FT                   IICSDKTLKDMCAKLPRDKEQLADVYGMGEQKIQNYGEAFVTAVNSFVADNPNPSGSTT
FT                   GERPQTVLSDEEAVEIGSTRKKKLPFYIEPQRLDEVELTDKCRLTELTNKINELCPADK
FT                   EHKKLAASFINELLIAEGYLEEVTEDGNKIKRVTEKGRSVGIDEEERKAKFGGSYYAIT
FT                   HSKQSQQVIIEMLKKHYGSIKPQE"
FT   gene            250430..251020
FT                   /locus_tag="EUBREC_0262"
FT   CDS_pept        250430..251020
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0262"
FT                   /product="Hypothetical protein"
FT                   /note="CytoplasmicMembrane, score:9.99; COG4720 Predicted
FT                   membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74066"
FT                   /db_xref="GOA:C4ZAK5"
FT                   /db_xref="InterPro:IPR009825"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZAK5"
FT                   /protein_id="ACR74066.1"
FT                   /translation="MRNEKVQKLTLTALMAALSYVIFTFLQIKVTLPGGSATSFHLGNA
FT                   VVVLAALLLGGVYGGIGGAIGMTIGDLLDPIYITGAPKTFFLKLMIGVITGLVAHKLGK
FT                   ITYSTDKKHVFKWTVLAACAGMLFNFIFDPIISYFYDMLILGKPMAQLKIAWSVTTTGV
FT                   NAVISVIAATIVYVALRPVLIKANLFFKIGKEK"
FT   gene            complement(251085..251750)
FT                   /locus_tag="EUBREC_0263"
FT   CDS_pept        complement(251085..251750)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0263"
FT                   /product="phosphoribosylanthranilate isomerase"
FT                   /note="Cytoplasmic, score:8.87; COG0135
FT                   Phosphoribosylanthranilate isomerase; KEGG:K01817
FT                   phosphoribosylanthranilate isomerase HMMPfam:IPR001240;
FT                   Gene3D:IPR013785; superfamily:IPR011060"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74067"
FT                   /db_xref="GOA:C4ZAK6"
FT                   /db_xref="InterPro:IPR001240"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZAK6"
FT                   /protein_id="ACR74067.1"
FT                   /translation="MNTQNTAKEISDNNINTNSNTKIKICGLTSPAEARYLNENHVDFA
FT                   GMVLFFPKSKRNISIEQAKDIMAALDASIKRVAVVVSPSIEQIRQIEAAGFDYVQIHGE
FT                   IPETEAEAAIAIPILKAFNVSDMDSYEKYHNDSRIAGYVFDAIEPGSGKTFDWKLVDNI
FT                   PRDEKLLLLAGGLNPDNVRMAIEAVHPDGVDVSSGVENDDKAGKNPDKIHDFVAAIKS"
FT   gene            252225..253250
FT                   /locus_tag="EUBREC_0264"
FT   CDS_pept        252225..253250
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0264"
FT                   /product="conserved uncharacterized protein"
FT                   /note="Unknown cell location; COG1363 Cellulase M and
FT                   related proteins; KEGG:0conserved uncharacterized protein
FT                   HMMPfam:IPR008007; HMMPIR:IPR008007"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74068"
FT                   /db_xref="GOA:C4ZAK7"
FT                   /db_xref="InterPro:IPR008007"
FT                   /db_xref="InterPro:IPR023367"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZAK7"
FT                   /protein_id="ACR74068.1"
FT                   /translation="MSTEKIKEYIGTQLKALTSIASPTGFTKNATDYLMKQLEAMGYAP
FT                   QLSNKGNVSVEIGGVGAPLVLAAHVDTLGAMVRSIKDNGRLRPTTIGGHQWSTADGENC
FT                   MVFTRDGRMYTGVVLNTEPSAHVADEKVETKEENMEILLDENVNDKQGVAALGIQTGDI
FT                   IAMDPRTVITESGYIKSRFLDDKLSAAILLGVAHAVKEEGWRLNRKVTLLFTVYEEVGH
FT                   GGSFVPADTEEMISVDMGCVGADLGCTEHMVSICAKDSGGPYNYELVTELSNLAKSEGL
FT                   DYAIDVYPHYGSDVEATLHSGYDIRHGLIGAGVYASHNYERSHMDGVENTYKLLRKYIT
FT                   K"
FT   gene            253310..253690
FT                   /locus_tag="EUBREC_0265"
FT   CDS_pept        253310..253690
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0265"
FT                   /product="glyoxalase I (glyoxalase family)"
FT                   /note="Cytoplasmic, score:8.87; COG0346 Lactoylglutathione
FT                   lyase and related lyases; KEGG:K08234 glyoxalase I
FT                   (glyoxalase family); HMMPfam:IPR004360"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74069"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037478"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZAK8"
FT                   /protein_id="ACR74069.1"
FT                   /translation="MNLKKVHHIAIIGSDYEKSKHFYVDLLGFSIIRENYRPERDDYKI
FT                   DLQLDEIELELFIIKNCPKRPSYPEAYGLRHLAFAVDSVDDTVRELNKRGIITEPIRLD
FT                   TYTGKRMTFFHDPDNLPLEIHE"
FT   gene            complement(254295..255134)
FT                   /locus_tag="EUBREC_0266"
FT   CDS_pept        complement(254295..255134)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0266"
FT                   /product="Hypothetical protein"
FT                   /note="Cytoplasmic, score:8.87; COG2826 Transposase and
FT                   inactivated derivatives, IS30 family;
FT                   superfamily:IPR012337"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74070"
FT                   /db_xref="GOA:C4ZAK9"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZAK9"
FT                   /protein_id="ACR74070.1"
FT                   /translation="MTKHELRKKDGIVSPLIEQGQSPYQIITNHPELDMSVRSLYTYLD
FT                   QGLFTARNIDLKRKPGFKPRKCHKTQITNRTVFEKRLFSDFSELRLSSFVEMDTVHSSR
FT                   ESNKTLLTFFFTKEKLFLAFLLNRCTKGAVRLIFDRLEKRMGTYEFLSVFEYILTDRGS
FT                   EFGDPVALETGLDEIQRTSIYYCDPMRSGQKGGLEQAHTMLRMVLPKGTSFEFLTQWDV
FT                   NLIVNHINSTPRESLNGSTPYDAALETLGKETLNAFQLKRIDPDLVNLTPKLIRFNH"
FT   gene            255225..255452
FT                   /locus_tag="EUBREC_0267"
FT   CDS_pept        255225..255452
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0267"
FT                   /product="Hypothetical protein"
FT                   /note="Unknown cell location"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74071"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZAL0"
FT                   /protein_id="ACR74071.1"
FT                   /translation="MIYLFCAAITDIGRLIQSFALFLHKILASLITGGAGSAFYIAEND
FT                   FSADIGFPAMEAMNTKVMGIIESTFVIPVG"
FT   gene            256001..259561
FT                   /locus_tag="EUBREC_0268"
FT   CDS_pept        256001..259561
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0268"
FT                   /product="Carbohydrate-Binding Module Family 2 candidate
FT                   secreted modular protein with two N-terminal CBM2 domains"
FT                   /note="Unknown cell location; COG2304 Uncharacterized
FT                   protein containing a von Willebrand factor type A (vWA)
FT                   domain; KEGG:K01179 K01183 chitinase HMMPfam:IPR001919;
FT                   HMMPfam:IPR002035; Gene3D:IPR012291; HMMSmart:IPR001919;
FT                   HMMSmart:IPR002035; ScanRegExp:IPR002048;
FT                   superfamily:IPR008965"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74072"
FT                   /db_xref="GOA:C4ZAL1"
FT                   /db_xref="InterPro:IPR001919"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR008965"
FT                   /db_xref="InterPro:IPR012291"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="InterPro:IPR028974"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZAL1"
FT                   /protein_id="ACR74072.1"
FT                   /translation="MKRLKQRILAGVLAFVMCISTVNVTAFAQENETTSEIQEIIAISE
FT                   AGSENEVSTENIEITDTSVSGNNVEPVEDKPRNKKHKKVANEKVYEGENYNVTFSVTSS
FT                   WESGYNANVKVENTGNDTIQNWYLSFEYDDQITNIWNAEISTHEESQYIIKNADWNQDI
FT                   VVGGSIEFGISGSTAFNEFPENFNVVGENKEVQEEDYSVQYQVDSDWGSGFTGSIQITN
FT                   NTDKTLEDWVLEFDFEREITNIWNAVIESHEGNHYVIRNAGYNANITAGQSVLFGFNGH
FT                   GGSANNVAENCVLYSWEIDTTEYVELSDGKIEKNYLERAIYTNLLLQGLSIDNIRLADD
FT                   YDEDGLTLSQEYEYDTNPFSKDTDEDGLNDYEEINLHKTNPIKYDSDEDGMSDGTEIAC
FT                   GLNPLSSDTDGNGVIDSQEIVTQAVRIDTVEQYQLQEVGTLPNIQITGKGDYSQKIYAT
FT                   ALENDATIMDIDCLVGTAFDFIHDEDLSFENSQLTFTISNEILKKNKLTDLAIAWYNEE
FT                   ENALELLDTTHNMDNCTISAEVSHYSTYMVVSVPDYFFNIDWENEDSIIEAGKADVVFV
FT                   IDTTGSMGNEIQNVKNNIETVVSSLEENKVDIRLGLVEYRDIYADGIGSTKSYDWYTSV
FT                   SSFKSELATLGVSGGGDTPESVVDALYCARNMEYRTGVKKYVILLTDANYKNGTSVDSG
FT                   ATLTDEIRRLVEEELVVSVVTTPSYYSTYNSLVSQTDGVTANINQNFASALAPLITKMG
FT                   EQVNQGCWIRLSNGSVVSLDKDPTLGDETIDTDDDGIPDIIELKSSYKVHAYNPYTKKM
FT                   QEIDTWSFYSNPSKRDTDGDTLSDIDDLQPTKYDTVVIKENDSSIAFNTGRTWYNISCT
FT                   SFDYLDNLMQMVDGKVDNPIPIEQFRQIIQNVANNEKQAFTIEELTYIAIMNNEGSKLY
FT                   MHNLSSVTRENVFQKIAGRESRYYKHSGIWWNENWSEVPKGTESGFFKGTVLSEADINL
FT                   SWEIYCVCDVYTVLTTVAQVGALVIAIVVVAEVTPVVLANIQGLAYYVKTFGIVQGIQM
FT                   YRYLGIQNLPNGVISWLQMDMADGDSSVDDVALAIQKESVEKKLDTYLLNKDHPVGGSK
FT                   ANWFEKALGFTKENAGQLAKQIVFDENVAVQTAVTEHGIKYNQLISIVGANGKKIDVVF
FT                   VWIKNNDGFVRLVTAIPTKK"
FT   gene            259637..259840
FT                   /locus_tag="EUBREC_0269"
FT   CDS_pept        259637..259840
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0269"
FT                   /product="Hypothetical protein"
FT                   /note="Cytoplasmic, score:8.87"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74073"
FT                   /db_xref="InterPro:IPR032568"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZAL2"
FT                   /protein_id="ACR74073.1"
FT                   /translation="MYEELQVVKATKNLSDKVKMGCIGTILYVYFEEKRGYEVEFVNDD
FT                   YETLDILTVGETDIEIVENNMR"
FT   gene            259932..260150
FT                   /locus_tag="EUBREC_0270"
FT   CDS_pept        259932..260150
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0270"
FT                   /product="Hypothetical protein"
FT                   /note="Unknown cell location"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74074"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZAL3"
FT                   /protein_id="ACR74074.1"
FT                   /translation="MWANIEIELHMKPTCLSRRIKTQILKDAYLMKNGDVTAVVWEFFR
FT                   SDITGRGGATQQLLDFLTQNGIQYVIH"
FT   gene            260172..260753
FT                   /locus_tag="EUBREC_0271"
FT   CDS_pept        260172..260753
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0271"
FT                   /product="Hypothetical protein"
FT                   /note="Unknown cell location"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74075"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZAL4"
FT                   /protein_id="ACR74075.1"
FT                   /translation="MQYNGMTPPFELISFEDMKKKQAEQYFVWYIDTIEQRIQNLEKYI
FT                   NLTGTRMVLDKTPNSLIELWDWFSNHIEVCTKDEQELMLESAMRPDWIKAHIMSDRRKL
FT                   SLNTIMIAVDISAYFGEVFIKNNPNIYWGYLSKPKKLHGVNRPRLLGFAGDMSVYAYGR
FT                   VEMCIWKTIETVDNMHLFNMYQVCLKMIQS"
FT   gene            complement(260748..260972)
FT                   /locus_tag="EUBREC_0272"
FT   CDS_pept        complement(260748..260972)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0272"
FT                   /product="Hypothetical protein"
FT                   /note="Unknown cell location"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74076"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZAL5"
FT                   /protein_id="ACR74076.1"
FT                   /translation="MPQTHIRKKVPSGKKPTERNLRNLKPYTKRYNDIKSKLTSRTSTD
FT                   LTKAEIKGRDKIAPLHCVKYYNSKQRKKL"
FT   gene            260958..261362
FT                   /locus_tag="EUBREC_0273"
FT   CDS_pept        260958..261362
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0273"
FT                   /product="Hypothetical protein"
FT                   /note="Cytoplasmic, score:8.87; COG3943 Virulence protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74077"
FT                   /db_xref="InterPro:IPR011204"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZAL6"
FT                   /protein_id="ACR74077.1"
FT                   /translation="MRLWHAARYKTQTILINYYNLDAIISVGYRVNSIQATRFRIWATG
FT                   ILKEYMIKGFAMDDERLKQGKTAFGKDYFRELLERVRSIRASERRIWQQITDIFAECSI
FT                   DYDRDSDTAYHFYATIQNKFHYAITHKVLK"
FT   gene            261535..261954
FT                   /locus_tag="EUBREC_0274"
FT   CDS_pept        261535..261954
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0274"
FT                   /product="hypothetical protein"
FT                   /note="Cytoplasmic, score:8.87; COG1661 Predicted
FT                   DNA-binding protein with PD1-like DNA-binding motif;
FT                   KEGG:0hypothetical protein; HMMPfam:IPR005175"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74078"
FT                   /db_xref="InterPro:IPR005175"
FT                   /db_xref="InterPro:IPR025707"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZAL7"
FT                   /protein_id="ACR74078.1"
FT                   /translation="MEYRKFDNIIIARIDKGEEILEQLKAIAITENIKLASINALGAIN
FT                   DFTVGVYKTDEKKYYSNSFKGYYEITSLTGTINTMDGEYYAHLHLSAGNEKGEVFGGHL
FT                   NRAVVSATCELVITVIDGKVDRVYDEETGLNVFNF"
FT   gene            262101..262607
FT                   /locus_tag="EUBREC_0275"
FT   CDS_pept        262101..262607
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0275"
FT                   /product="Hypothetical protein"
FT                   /note="Cytoplasmic, score:8.87; NOG06778 non supervised
FT                   orthologous group"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74079"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZAL8"
FT                   /protein_id="ACR74079.1"
FT                   /translation="MIACENSGHSIPDDFPEVRKIVEAGVTTNPKKDYELSRYACYLIV
FT                   QNGDPRKEVIALGQTYFAIQTYRQEVADHFNELDEDNRRLVVRGDIKQWNQMLAETAHN
FT                   AGVITNEEFAIFQNAGYMGLYGGLDVEGILAAVYQSVFGGDVYLSLEEKVANLLFNEIG
FT                   NSQVV"
FT   gene            262579..263262
FT                   /locus_tag="EUBREC_0276"
FT   CDS_pept        262579..263262
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0276"
FT                   /product="hypothetical protein"
FT                   /note="Unknown cell location; COG3738 Uncharacterized
FT                   protein conserved in bacteria; KEGG:K09974 hypothetical
FT                   protein; HMMPfam:IPR009706"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74080"
FT                   /db_xref="GOA:C4ZAL9"
FT                   /db_xref="InterPro:IPR009706"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZAL9"
FT                   /protein_id="ACR74080.1"
FT                   /translation="MKLVTRKLFNGECMKKRITLIVFSVLIIVALYVLYCFNYIPHKKY
FT                   TNADFNIEAYKSNIDKDNDGIDDQTDILNNANNYIKTNPKYKSKYYNTGYPDDEYGVCT
FT                   DVVAFALKDAGYDLMVLVNEDIKNNKELYDIDAVDKNIDFRRVKNLKVYFDNNAISLTT
FT                   DINEIEEWQGGDIVVFKKHIGIISDKRNRKGICFVIHHANPYQIYYEEDILEHRDDIIG
FT                   HYRIS"
FT   gene            263310..263531
FT                   /locus_tag="EUBREC_0277"
FT   CDS_pept        263310..263531
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0277"
FT                   /product="Hypothetical protein"
FT                   /note="Unknown cell location"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74081"
FT                   /db_xref="GOA:C4ZAM0"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZAM0"
FT                   /protein_id="ACR74081.1"
FT                   /translation="MVNMWWSIGGGIIIFALGMFIFLKPGLIWKLTEEWKSYRADEPSE
FT                   FYLKTTKIGGILFALFGIIMIMLPVILE"
FT   gene            complement(263588..263713)
FT                   /locus_tag="EUBREC_0278"
FT   CDS_pept        complement(263588..263713)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0278"
FT                   /product="Hypothetical protein"
FT                   /note="Cytoplasmic, score:8.87"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74082"
FT                   /db_xref="GOA:C4ZAM1"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZAM1"
FT                   /protein_id="ACR74082.1"
FT                   /translation="MSFCIELFCVVTLQYQILVRIAITYFIIEKKKAVNTQKNSS"
FT   gene            complement(263827..264174)
FT                   /locus_tag="EUBREC_0279"
FT   CDS_pept        complement(263827..264174)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0279"
FT                   /product="hypothetical protein"
FT                   /note="Cytoplasmic, score:8.87; COG1373 Predicted ATPase
FT                   (AAA+ superfamily); KEGG:0hypothetical protein;
FT                   superfamily:IPR011335"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74083"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZAM2"
FT                   /protein_id="ACR74083.1"
FT                   /translation="MIHCLSKSRVNNCVFESGRLYENIVCIELLRRGYDVYVGKLYQKK
FT                   IDFVAQRGSEKIYIQVSDNISGQETFEREHSPLLQVRDAYPKMIIARTKHPQYSYEGIE
FT                   IHDIADWLLQE"
FT   gene            complement(264217..265266)
FT                   /locus_tag="EUBREC_0280"
FT   CDS_pept        complement(264217..265266)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0280"
FT                   /product="transcriptional regulator"
FT                   /note="Cytoplasmic, score:9.98; COG1609 Transcriptional
FT                   regulators; KEGG:K03604 transcriptional regulator;
FT                   HMMPfam:IPR001761; HMMSmart:IPR000843;
FT                   superfamily:IPR010982"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74084"
FT                   /db_xref="GOA:C4ZAM3"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZAM3"
FT                   /protein_id="ACR74084.1"
FT                   /translation="MKCTIQNIADHLGLSRNTVSKALKNSSEVSENTRNLVIKTASKLG
FT                   YKNATFATPVIPASETGSNGTILFLTRTYASDSEFWTTVLRGIESILSNANYHLAISIM
FT                   SDSDLKQLNFPQTISDSSIKGIILVEICDKVVCDALSQFNLPIVSVDMPNVPFEELNGI
FT                   DVVTMESKKNLKKIINQLIEKGAESFGFVGDLYSPNVSRGFQERYNALSECLAEHQLPL
FT                   NQKNCLLHQTPEDFRNFQTTVNNLQAMISLPDVFICGNDWTAIQLIYALQFLGFQIPKD
FT                   ICVVGFDNIPAASRISPSLTTISTPQKYLGIAAARQILERIQHPNCPHVFCQYETELII
FT                   RNSTNITSF"
FT   gene            complement(265238..265498)
FT                   /locus_tag="EUBREC_0281"
FT   CDS_pept        complement(265238..265498)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0281"
FT                   /product="Hypothetical protein"
FT                   /note="Unknown cell location"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74085"
FT                   /db_xref="GOA:C4ZAM4"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZAM4"
FT                   /protein_id="ACR74085.1"
FT                   /translation="MHLHYHILCIVSSFCTVFSLFPSFLYFSLIFFVHYLYYSLLFPCI
FT                   LCILFLYCIVCNSCILCYTISETYKYNIKGVYYEMYHSKYC"
FT   gene            265575..267029
FT                   /locus_tag="EUBREC_0282"
FT   CDS_pept        265575..267029
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0282"
FT                   /product="putative beta-fructofuranosidase protein"
FT                   /note="Cytoplasmic, score:8.87; COG1621 Beta-fructosidases
FT                   (levanase/invertase); KEGG:K01193 putative
FT                   beta-fructofuranosidase protein HMMPfam:IPR013148;
FT                   HMMSmart:IPR001362; superfamily:IPR008985"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74086"
FT                   /db_xref="GOA:C4ZAM5"
FT                   /db_xref="InterPro:IPR001362"
FT                   /db_xref="InterPro:IPR013148"
FT                   /db_xref="InterPro:IPR023296"
FT                   /db_xref="InterPro:IPR032507"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZAM5"
FT                   /protein_id="ACR74086.1"
FT                   /translation="MGRLFYKPENAWVGDLIPYYENGTYYGFYLHDPRIRDKEYAEDTT
FT                   WHLIETKDFVNLDYKGESIARGGIHDANKNAYTGSVIKCEKDGLYHVFYTAYNEDFKLR
FT                   GKTIQSVMQATGKNLENLETVKDFLFVSDGKQYEEFDWRDPFVFWNDEDQCYYMLLASR
FT                   VTNRGDLRGGCIALCKSEDLINWTYEKPFYDPKMYITMECPELFKMGEYWYLVFSTFSD
FT                   QFTTHYRISKNWNGPWEIPDDDVFDTRADYAIKTASDGKRRFAFGWIASKYGNTDFGPW
FT                   EWGGTMNFHEIIQNSKNGELRIKAIPEVLDYFSKEIELKKETLYNCKMVQAQDGVSVES
FT                   DTLGALLYPLEGDTFALDMVIKPERYHEFGIALHVDKELETGYFLRMNPKNQLVAWDMW
FT                   PRGEQGRYQWQIKGDVPYQIETARKLPKAEEYRVHIIKEKDICVVYINDEIVLSTRMYN
FT                   HKDGYAGIYVVQGDVKLIQYKEKRSE"
FT   gene            267031..268332
FT                   /locus_tag="EUBREC_0283"
FT   CDS_pept        267031..268332
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0283"
FT                   /product="sugar ABC transporter (sugar-binding protein)"
FT                   /note="Unknown cell location; COG1653 ABC-type sugar
FT                   transport system, periplasmic component; KEGG:K10117 sugar
FT                   ABC transporter (sugar-binding protein); HMMPfam:IPR006059"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74087"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZAM6"
FT                   /protein_id="ACR74087.1"
FT                   /translation="MRKKIISAMLALCMAGSLLTGCGTSADAEKKSKDSGDVTTVKWFT
FT                   SRPVDGAIDQVMHEIADEYSEKMGGKWKIEFETTADRPSYLQKLKTLIAGGNMPDIIDI
FT                   DADPYCQELVDAGMLVDVKKFLKDNGKYDSFYPTALKYQEFTDGSMYTLPLEYHVEMTW
FT                   YNKEIFDKYGLSVPKTMDEWLDVCKTLKENGVTPISVDGVDRWPVQRYLAMMPFRESGN
FT                   DYIINLRDGKEKMAGDEGKEAATFMKNIGQYFNDGFAATDYATAQSMFLDGKSAMYYIG
FT                   DWEIAAMQDAYKAGKIDYFYLPTIENGKTDASEFCVNSGIGMAFNAKTFDAKTKDFILY
FT                   VLDNYGEKYAAKQQMSPIKTELPSDVEFSDLYLRIRDDMDKTGAQFLKPWDTYLDADTN
FT                   TTMQDNLLLLASGDMSVDDFCKLIDDSIATNAKN"
FT   gene            268385..269284
FT                   /locus_tag="EUBREC_0284"
FT   CDS_pept        268385..269284
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0284"
FT                   /product="putative ABC-type sugar transport systems,
FT                   permease component"
FT                   /note="CytoplasmicMembrane, score:10.00; COG1175 ABC-type
FT                   sugar transport systems, permease components; KEGG:K02025
FT                   putative ABC-type sugar transport systems, permease
FT                   components; HMMPfam:IPR000515"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74088"
FT                   /db_xref="GOA:C4ZB13"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZB13"
FT                   /protein_id="ACR74088.1"
FT                   /translation="MEGNMGVIKNRKWFFIFLLPGLLFYILSVFYPIEESIRLSFMEWN
FT                   GIGDKTFAGLQNYVTMFHDPTFYKSFLNNLIYLLIVVVMQLGIGLVFAVLLTFMKKHVT
FT                   FVKTLYYVPCIITTVAIAQLFRSMYATEPMGLINQFFQAIGMEGMVTSWLANIHTALMA
FT                   VSVPEGWRFTGMYMVIFYAALISLDPSVYEAAKVDGATDFQILLKIKLPLIKDIILLTL
FT                   TMCLTGALRGFDIPFLLTSGGPGNASELLSTYMYKKAFSNNQYGYGSALAVFIIIESML
FT                   VVFILRKIFSERKECKES"
FT   gene            269281..270108
FT                   /locus_tag="EUBREC_0285"
FT   CDS_pept        269281..270108
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0285"
FT                   /product="sugar ABC transporter (permease)"
FT                   /note="CytoplasmicMembrane, score:10.00; COG0395 ABC-type
FT                   sugar transport system, permease component; KEGG:K10119
FT                   sugar ABC transporter (permease); HMMPfam:IPR000515;
FT                   BlastProDom:IPR004679"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74089"
FT                   /db_xref="GOA:C4ZB14"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZB14"
FT                   /protein_id="ACR74089.1"
FT                   /translation="MKKKIGKIVFAIVILAFLLIQVYPIIWLFMASVKPTIELSTTPFA
FT                   LPKVVTFENFIKVFSDGKIGIYMWNSLKVTGISLILIIFLSSTVGYALSKFRIRGKKQI
FT                   YKFFTFGIMVPVQITLIPLFIFYSKMGILNTSFSLILPQVGFALPLAVMMFVSFYDFVP
FT                   DELVEAAIVDGCNPGVTFIKIVFPLARNTIITIASMYSILIWNDFIFANTFISDSNAKT
FT                   VAMGLKDYVGAFGNVDWGLTFAAIVISILPPLIIYFALNKWVTAGMTMGATKG"
FT   gene            270117..271241
FT                   /locus_tag="EUBREC_0286"
FT   CDS_pept        270117..271241
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0286"
FT                   /product="Hypothetical protein"
FT                   /note="Cytoplasmic, score:8.87; NOG11699 non supervised
FT                   orthologous group"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74090"
FT                   /db_xref="InterPro:IPR021345"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZB15"
FT                   /protein_id="ACR74090.1"
FT                   /translation="MILGGYEMIFPGDISKMPYLTHGKSRAINAENRTGEKGKGGMAAS
FT                   PLGPSRKGSPCLNNIQPGQEEVLADIEGPGVIQHIWITVDSKTSEGDCFVLRDLIMRMY
FT                   WDGEENPSVEVPLGDFFCCGFGQECIVNSAIITVVPSRGLNSYFAMPFHKHARITIENQ
FT                   HKNPIPAFFYQIDYCLYDSLPEDTSYFHAQWRRQAITEIGKDYVILDNVKGSGHYVGTY
FT                   LGLSALQRYWWGEGEVKFYIDGDEKYPTICGTGMEDYFGGSWSFASNENGRIVEQNYST
FT                   PYLGYPFYSRHDSLVWNQYHNDDCPPMRGFYRWHIPDPVFFEENLKVTVQQIGVSHNGL
FT                   FERQDDLSSVAYWYQSEPHQKFKELLPVEKRWPR"
FT   gene            271380..271505
FT                   /locus_tag="EUBREC_0287"
FT   CDS_pept        271380..271505
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0287"
FT                   /product="Hypothetical protein"
FT                   /note="Extracellular, score:8.82"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74091"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZB16"
FT                   /protein_id="ACR74091.1"
FT                   /translation="MAEIKNSESDMSTQQKAEQDKEKRREERGKKSKKTALQGTE"
FT   gene            271522..271767
FT                   /locus_tag="EUBREC_0288"
FT   CDS_pept        271522..271767
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0288"
FT                   /product="Hypothetical protein"
FT                   /note="Unknown cell location"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74092"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZB17"
FT                   /protein_id="ACR74092.1"
FT                   /translation="MLEEVGNAVTHGIGAGLIQHCCCELRFQSVFEGYTFDKLQIYFQL
FT                   RWHPLSRLGDPIKVIKKMKQTDNFKFAEHDQNKTSS"
FT   gene            complement(271831..272418)
FT                   /locus_tag="EUBREC_0289"
FT   CDS_pept        complement(271831..272418)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0289"
FT                   /product="Hypothetical protein"
FT                   /note="Cytoplasmic, score:8.87; COG1592 Rubrerythrin;
FT                   HMMPfam:IPR003251; HMMPfam:IPR004039;
FT                   BlastProDom:IPR004039; Gene3D:IPR004039; Gene3D:IPR012347;
FT                   superfamily:IPR009078"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74093"
FT                   /db_xref="GOA:C4ZB18"
FT                   /db_xref="InterPro:IPR003251"
FT                   /db_xref="InterPro:IPR009040"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="InterPro:IPR024934"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZB18"
FT                   /protein_id="ACR74093.1"
FT                   /translation="MAKWVCTVCGYVYEGENPPAECPVCHVGADKFKKVEGDLTLAAEH
FT                   EFGVYASTVKNNPEISDEDKKYIFEQLKANFEGECSEVGMYLCMARVAHREGYPEIGLY
FT                   WEKAAYEEAEHAAKFAEMLGEDLEPNMKATTKDNLAWRVDCEFGATAGKTDLAKCAKKN
FT                   NLDAIHDTVHEMARDEARHGRALKGLLDRYFG"
FT   gene            complement(272482..272913)
FT                   /locus_tag="EUBREC_0290"
FT   CDS_pept        complement(272482..272913)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0290"
FT                   /product="ferric uptake regulator, Fur family"
FT                   /note="Cytoplasmic, score:8.87; COG0735 Fe2+/Zn2+ uptake
FT                   regulation proteins; KEGG:K09825 ferric uptake regulator,
FT                   Fur family; HMMPfam:IPR002481; BlastProDom:IPR002481"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74094"
FT                   /db_xref="GOA:C4ZB19"
FT                   /db_xref="InterPro:IPR002481"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZB19"
FT                   /protein_id="ACR74094.1"
FT                   /translation="MISVTIPDFIKKEIHMIKYSRQRESIVNFLASRTDHPTAETIYQN
FT                   IKKEFPNISLGTVYRNLSLLEEIGEIIKISTGVGPDHYDYNTAPHYHFICRGCGRVMDI
FT                   DLDFADELMTQVQESTDLAIESCSVSFTGLCPDCKNELS"
FT   gene            273079..273840
FT                   /locus_tag="EUBREC_0291"
FT   CDS_pept        273079..273840
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0291"
FT                   /product="Hypothetical protein"
FT                   /note="Cytoplasmic, score:8.87"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74095"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZB20"
FT                   /protein_id="ACR74095.1"
FT                   /translation="MKRFVTYLYLYDGRIKGNNAGFIKVEINGEKSAFLVQIKNLGKYS
FT                   GKGKVYLVYEAEESIEAGELTVKNGEAREIYNVDTENVKDSGKTFLQVLGVKIELENAD
FT                   EKFLASCWTDNTEAVIGKPLKVQAELSNKRNPVSTPKPEPGCQKEVHSQNVDDSQDKIR
FT                   RIDISELRTLPAKNWYIVNNSFLTHGYANYKHLVIKTDTDGRQYLGVPGVSEPQERMMA
FT                   GIFGFTEFEPAAPANAADVDSGVFGYWFCPL"
FT   gene            273941..274723
FT                   /locus_tag="EUBREC_0292"
FT   CDS_pept        273941..274723
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0292"
FT                   /product="uridine phosphorylase"
FT                   /note="Cytoplasmic, score:8.87; COG2820 Uridine
FT                   phosphorylase; KEGG:K00757 uridine phosphorylase
FT                   HMMPfam:IPR000845; HMMPanther:IPR000845; HMMTigr:IPR010058;
FT                   ScanRegExp:IPR000845"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74096"
FT                   /db_xref="GOA:C4ZB21"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR010058"
FT                   /db_xref="InterPro:IPR018016"
FT                   /db_xref="InterPro:IPR035994"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZB21"
FT                   /protein_id="ACR74096.1"
FT                   /translation="MKNYSKDPDRQYHIQVAKGEVGRYVIMPGDPKRCVKIAQYLDNPV
FT                   LIADNREFITYTGTLDGVKVSVTSTGIGGPSASIAMEELYRCGADTFVRIGTCGGMQTD
FT                   VKSGDIVIATGAIRMEGTSKEYAPIEFPAVADLDVTNALVAAAKQKNFTHHTGVVQCKD
FT                   AFYGQHEPEKMPAGYELINKWNAWRMLGCLASEMESAALFVVAAKLGVRAGSCFLVVAN
FT                   QEREKLGLENPVVRDTDMAVQVAVSAVRNLISEDCAGE"
FT   gene            274701..275411
FT                   /locus_tag="EUBREC_0293"
FT   CDS_pept        274701..275411
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0293"
FT                   /product="deoxyribose-phosphate aldolase"
FT                   /note="Cytoplasmic, score:9.98; COG0274
FT                   Deoxyribose-phosphate aldolase; KEGG:K01619
FT                   deoxyribose-phosphate aldolase HMMPfam:IPR002915;
FT                   Gene3D:IPR013785; HMMPIR:IPR011343; HMMPanther:IPR011343;
FT                   HMMTigr:IPR011343"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74097"
FT                   /db_xref="GOA:C4ZB22"
FT                   /db_xref="InterPro:IPR002915"
FT                   /db_xref="InterPro:IPR011343"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR028581"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZB22"
FT                   /protein_id="ACR74097.1"
FT                   /translation="MRIAPENKSDIKHRNGEQTLDINEILKHVDHTLLSPQATWDEIRQ
FT                   ICDDAIKYHTASVCIPPSYVSQASKYLGERVKVCTVIGFPNGYSTTAVKAFETEDALAN
FT                   GAKEIDMVINIGWLKDKRYELIEDEIKKLKSICKDKVLKVIIETCFLTDDEKIRMCDIT
FT                   TSAGADYIKTSTGFGTAGATFDDIKLFSVHIGEGVKMKAAGGISSLDDAERFLELGADR
FT                   LGTSRVVKLIKAME"
FT   gene            275447..275866
FT                   /locus_tag="EUBREC_0294"
FT   CDS_pept        275447..275866
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0294"
FT                   /product="cytidine deaminase"
FT                   /note="Cytoplasmic, score:8.87; COG0295 Cytidine deaminase;
FT                   KEGG:K01489 cytidine deaminase HMMPfam:IPR002125;
FT                   HMMPanther:IPR006262; HMMTigr:IPR006262"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74098"
FT                   /db_xref="GOA:C4ZB23"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR006262"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZB23"
FT                   /protein_id="ACR74098.1"
FT                   /translation="MDKKTIEKLIDTAIAQLDFSYAPYSGFNVGAALLAKNQAVYTGCN
FT                   IENAAYTPTNCAERTAFFKAVSEGVRDFEAICIVGGKNQKPTGYTAPCGVCRQVMMEFC
FT                   NPKTFKIILAIDRENYRIFTLEDMLPQGFGPANLE"
FT   gene            275935..276972
FT                   /locus_tag="EUBREC_0295"
FT   CDS_pept        275935..276972
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0295"
FT                   /product="adenosine deaminase"
FT                   /note="Cytoplasmic, score:8.87; COG1816 Adenosine
FT                   deaminase; KEGG:K01488 adenosine deaminase
FT                   HMMPfam:IPR001365; HMMPanther:IPR001365; HMMTigr:IPR006330"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74099"
FT                   /db_xref="GOA:C4ZB24"
FT                   /db_xref="InterPro:IPR001365"
FT                   /db_xref="InterPro:IPR006330"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZB24"
FT                   /protein_id="ACR74099.1"
FT                   /translation="MNISRLNRKWETGNGGNMEREENIRDNIIKLPKIELHCHLDGSLS
FT                   REFVEKRLGRTVQEAELSVSDDCTSLAQYLEKFDLPGQCIQDEKGLEGAAYDVLKGMHR
FT                   ENVVYAEIRFAPLLSENERMSCERVIEAALKGLERGKKDFGIEYGLIVCAMRHHGEEQN
FT                   RRMLHTAREFLGAGVCAADLAGAEVPYPMSGFMELFKYAKQLGLPFTIHAGECGNAQNI
FT                   IDAVEAGAARIGHGIAMRGHDDLERQLSAKGIGIELCPISNLQTKAVASADEYPIREFL
FT                   DAGLKVTINTDNRTVSNTTLSKELEFIEKTYGIRDEELPLMMKNALDVAFADDAVKERI
FT                   FRQLV"
FT   gene            277048..278235
FT                   /locus_tag="EUBREC_0296"
FT   CDS_pept        277048..278235
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0296"
FT                   /product="phosphopentomutase"
FT                   /note="Cytoplasmic, score:8.87; COG1015 Phosphopentomutase;
FT                   KEGG:K01839 phosphopentomutase HMMPfam:IPR006124;
FT                   HMMPfam:IPR013553; Gene3D:IPR001952; HMMPIR:IPR010045;
FT                   HMMTigr:IPR010045"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74100"
FT                   /db_xref="GOA:C4ZB25"
FT                   /db_xref="InterPro:IPR006124"
FT                   /db_xref="InterPro:IPR010045"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR024052"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4ZB25"
FT                   /protein_id="ACR74100.1"
FT                   /translation="MKKYNRIFVIVLDSLGIGAMPDSERFGDTDVDTFGHILERMQTLD
FT                   IPNLTRLGMLNLHCGGQMQPAAEPIGRFTRLAEASNGKDTMTGHWEMMGIKTEKPFKTF
FT                   TEHGFPPELIAELEKQCGKKVIGNKSASGTEIIEELGEEEIKNGSMIVYTSADSVLQIC
FT                   GNEETFDLQNLYRCCEIARKITLKDEWRVGRVIARPYVGKKKGEFVRTSNRHDYALKPT
FT                   GLTALNALKDSGLDVISVGKINDIFCGEGITEAFRSKSSVHGMEQTIDICEKDFTGLCF
FT                   VNLVDFDALWGHRRNVTGYGEEIEKFDKNLGILMEKLRDDDLLILTADHGNDPTYKGTD
FT                   HTREYVPFIAYSKSMKGGGAIEEEATFAVIGATITDNFGVKMPEGTIGHSILEEL"
FT   gene            278279..279112
FT                   /locus_tag="EUBREC_0297"
FT   CDS_pept        278279..279112
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0297"
FT                   /product="purine nucleoside phosphorylase"
FT                   /note="Cytoplasmic, score:8.87; COG0005 Purine nucleoside
FT                   phosphorylase; KEGG:K03783 purine nucleoside phosphorylase
FT                   HMMPfam:IPR001369; HMMPanther:IPR001369;
FT                   HMMPanther:IPR011268; HMMTigr:IPR011268; HMMTigr:IPR011270"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74101"
FT                   /db_xref="GOA:C4ZB26"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR011268"
FT                   /db_xref="InterPro:IPR011270"
FT                   /db_xref="InterPro:IPR035994"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZB26"
FT                   /protein_id="ACR74101.1"
FT                   /translation="MEKKMNSIYEKLTTCLASVREKTDFVPETAIVLGSGLGDYAEQIK
FT                   IETTIDYKDIKGFPTSTVPGHKGRFVFGYVDSVPVVIMQGRVHYYEGYPITDVVLPTRL
FT                   MGMMGAKKLILTNAAGGLNTDFNPGDFMLISDHIATAIPSPLIGANIDELGERFPDMSE
FT                   VYSRRMREIVKEKADKLGIKLREGVYVQLTGPQYETPAEVRMCKILGGDAVGMSTACEA
FT                   LAARHMGLEVCGISCITNLAAGLSDKKLNHKEVQETADRVAKQFTELITAVVRAV"
FT   gene            279170..279625
FT                   /locus_tag="EUBREC_0298"
FT   CDS_pept        279170..279625
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0298"
FT                   /product="Hypothetical protein"
FT                   /note="Cytoplasmic, score:8.87"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74102"
FT                   /db_xref="InterPro:IPR032360"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZB27"
FT                   /protein_id="ACR74102.1"
FT                   /translation="MGWRISMLNIYLGDMENAIYHPPVYFDNTYEDEWITDELSVKMIK
FT                   DIDKSDVIGPHLVQSPILGPISTKELSGGVKTLMLMAFDDSGKIFNASACGDNCAKWIL
FT                   RIAGKKNLTINLHHIMDFGKDFEAKILNTGEMVHSMAEFISVAGKYV"
FT   gene            279634..280602
FT                   /locus_tag="EUBREC_0299"
FT   CDS_pept        279634..280602
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0299"
FT                   /product="Hypothetical protein"
FT                   /note="Cytoplasmic, score:8.87"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74103"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZB28"
FT                   /protein_id="ACR74103.1"
FT                   /translation="MKGKHKIVVKNNRLHYEFEIKRNITIIKGDSATGKTTLINMIRQF
FT                   ANLGNASGIEIECDAPCTVLEGNLWQMLLKNLSGNIIFIDEENQFIRQQEFAELVKASD
FT                   NYFVIITRENLYNLPYSVEEIYGLYSSGKYQNTKQIYQEMYHIYPLNQDLSCKPDKIIV
FT                   EDTNSGYEYFKAISKEKNIVCESAGGKTKIFAMLEQLKAETESICVIADGAAIGPEMDA
FT                   LYKMSVEKGNIKLYLPESFEWIILSSELLEDKEIKDIIDKPENYIESQEYFSWERFFTK
FT                   LLVDKTAGTYLKYQKGKLNPTYLHEKNKNIILKNIKNSIDF"
FT   gene            complement(280669..281214)
FT                   /locus_tag="EUBREC_0300"
FT   CDS_pept        complement(280669..281214)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0300"
FT                   /product="ribosomal-protein-alanine acetyltransferase,
FT                   putative"
FT                   /note="Unknown cell location; COG1670 Acetyltransferases,
FT                   including N-acetylases of ribosomal proteins; KEGG:K03790
FT                   ribosomal-protein-alanine acetyltransferase, putative
FT                   HMMPfam:IPR000182"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74104"
FT                   /db_xref="GOA:C4ZB29"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZB29"
FT                   /protein_id="ACR74104.1"
FT                   /translation="MFFQYETPRLLLKVLRADCAPQVLDFYNRDKELFEMYEIDRVPDF
FT                   YTVKHLQKVLRYEYNMAVKSQLFRFYVFQKENPCRIIGTVCIHNIAPAFYGSCEIGYKF
FT                   SSEFHHMGYATEAVGFCTKLAFNELRMHKVTAVVHPGNVPSMKLLNGLGFVQEGLLHDY
FT                   LILHGKWCNHYIYGLVNK"
FT   gene            281323..281481
FT                   /locus_tag="EUBREC_0301"
FT   CDS_pept        281323..281481
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0301"
FT                   /product="Hypothetical protein"
FT                   /note="Extracellular, score:8.82"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74105"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZB30"
FT                   /protein_id="ACR74105.1"
FT                   /translation="MLICVGWLYSSHLENKKNCCLHASMTHQLFLFSVVLNSYCIIIDY
FT                   NTWSRQI"
FT   gene            281463..281951
FT                   /locus_tag="EUBREC_0302"
FT   CDS_pept        281463..281951
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0302"
FT                   /product="cytidine and deoxycytidylate deaminase family
FT                   protein"
FT                   /note="Cytoplasmic, score:8.87; COG0590 Cytosine/adenosine
FT                   deaminases; KEGG:0cytidine and deoxycytidylate deaminase
FT                   family protein HMMPfam:IPR002125; ScanRegExp:IPR002125"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74106"
FT                   /db_xref="GOA:C4ZB31"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR028883"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZB31"
FT                   /protein_id="ACR74106.1"
FT                   /translation="MEQTNMTQDEKYMKQAIKQAKKAYALDEVPIGCVIVAGDKIIARG
FT                   YNRRNTDKNPLAHAELSAIRKASKKTGDWRLEECTMYVTLEPCQMCAGAIVQARIPRVV
FT                   IGAMNPKAGCAGSIINLLQMQQFNHQVQTDIGICGDECSTMLSTFFKELRKKRKLQGQ"
FT   gene            282081..282641
FT                   /locus_tag="EUBREC_0303"
FT   CDS_pept        282081..282641
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0303"
FT                   /product="putative RNA polymerase sigma factor (ECF
FT                   subfamily)"
FT                   /note="Unknown cell location; COG1595 DNA-directed RNA
FT                   polymerase specialized sigma subunit, sigma24 homolog;
FT                   KEGG:K03088 putative RNA polymerase sigma factor (ECF
FT                   subfamily); HMMPfam:IPR007627; HMMPfam:IPR013249;
FT                   HMMTigr:IPR014284; superfamily:IPR013324;
FT                   superfamily:IPR013325"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74107"
FT                   /db_xref="GOA:C4ZB32"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZB32"
FT                   /protein_id="ACR74107.1"
FT                   /translation="MDDSAIVELFWKRDEQAIAATTEKYNVYCLSIAMNILGNIEDAEE
FT                   CVNDAYLNTWNSIPPNKPKMLSTYLGKIVRNMSFNLYKKNRAKKRTNGSFTLILDELSE
FT                   IITDSKNIEDEGNARFLLENINSFLKEIPAEKRQIFVCRYWYSDSVRDIAKRYGMTENN
FT                   VSVTLKRIRKKLHDYLVERGVDL"
FT   gene            282638..283369
FT                   /locus_tag="EUBREC_0304"
FT   CDS_pept        282638..283369
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0304"
FT                   /product="Hypothetical protein"
FT                   /note="Cytoplasmic, score:8.87"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74108"
FT                   /db_xref="GOA:C4ZB33"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZB33"
FT                   /protein_id="ACR74108.1"
FT                   /translation="MNAEKIFDVMENIDEQYIIEAHQKNVIKNKKKTIRKIVVFAACFS
FT                   LIISITAVVGIGIKRNSTCTVSAAEIGKEEVQLEATMPSIIYYDQDKVIMYDYIGIWVY
FT                   NLKKEKLVGFCDFRPIDMTQIQGYPCVFVEASSDGRYVRFYKSDDSVKFLYNVEKDTYK
FT                   EVKSYDKKLKWTFSLKDVTTQYSISDYSETYEVAKKEYLSYSLDISPDSNEAVRYKDLV
FT                   IVVEKNGQKTEYKPFVVKTTT"
FT   gene            283817..283917
FT                   /locus_tag="EUBREC_0305"
FT   ncRNA           283817..283917
FT                   /locus_tag="EUBREC_0305"
FT                   /product="Bacterial signal recognition particle RNA"
FT                   /note="RF00169 Bacterial signal recognition particle RNA"
FT                   /ncRNA_class="SRP_RNA"
FT   gene            284087..284971
FT                   /locus_tag="EUBREC_0306"
FT   CDS_pept        284087..284971
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0306"
FT                   /product="pyrophosphatase (putative)"
FT                   /note="Cytoplasmic, score:8.87; COG2816 NTP
FT                   pyrophosphohydrolases containing a Zn-finger, probably
FT                   nucleic-acid-binding; KEGG:K03659 pyrophosphatase
FT                   (putative) HMMPfam:IPR000086; HMMPfam:IPR015375;
FT                   HMMPfam:IPR015376; FPrintScan:IPR000086; Gene3D:IPR000086;
FT                   ScanRegExp:IPR000086; superfamily:IPR015797"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74109"
FT                   /db_xref="GOA:C4ZB34"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015376"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZB34"
FT                   /protein_id="ACR74109.1"
FT                   /translation="MIQDIAPHTWDITYKNIQPDPDSRVLFFSRGQLLVQQASDMSADE
FT                   SNQDIHQISFPRYEDIKAECPDAKYQYLFTLDDTAFFRVALSHADKMHILEVTGGKFIN
FT                   RHYMRSAAPKEYVLAAITGFHLDGWYDKNHFCGRCANRLVEDDVERMLRCPVCGNMVYP
FT                   RINPAVIVGVTNGDKLLLTKYNGREYKKYALVAGFNEIGESLEETVRREVMEETGLRVK
FT                   NIRYYKSQPWGFTDNILAGYFCEVDGTDEIEVDMQELSMAKWVSREEIPTSLEELSLTN
FT                   EMISVFRLDKGDF"
FT   gene            285014..285448
FT                   /locus_tag="EUBREC_0307"
FT   CDS_pept        285014..285448
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0307"
FT                   /product="Hypothetical protein"
FT                   /note="Cytoplasmic, score:8.87; COG1959 Predicted
FT                   transcriptional regulator; HMMPfam:IPR000944;
FT                   BlastProDom:IPR000944; HMMTigr:IPR000944;
FT                   ScanRegExp:IPR000944"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74110"
FT                   /db_xref="GOA:C4ZB35"
FT                   /db_xref="InterPro:IPR000944"
FT                   /db_xref="InterPro:IPR030489"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZB35"
FT                   /protein_id="ACR74110.1"
FT                   /translation="MKISTKGRYALRLMMDLAENNTGSPISLKDVAKRQDISDKYLEQI
FT                   ISILNKAGYVRSVRGAQGGYMLKMEPQNYTVGMILRQTEGSLAPVACIEDDEIVCDRQQ
FT                   QCVTSIVYKKINDAISGVVDNITLQDLVDWQNEKNGNYVI"
FT   gene            285468..286661
FT                   /locus_tag="EUBREC_0308"
FT   CDS_pept        285468..286661
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0308"
FT                   /product="cysteine desulfurase NifS"
FT                   /note="Cytoplasmic, score:8.87; COG1104 Cysteine sulfinate
FT                   desulfinase/cysteine desulfurase and related enzymes;
FT                   KEGG:K04487 cysteine desulfurase NifS HMMPfam:IPR000192;
FT                   Gene3D:IPR015421; ScanRegExp:IPR000192;
FT                   ScanRegExp:IPR006025; superfamily:IPR015424"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74111"
FT                   /db_xref="GOA:C4ZB36"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR010240"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR016454"
FT                   /db_xref="InterPro:IPR017772"
FT                   /db_xref="InterPro:IPR020578"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZB36"
FT                   /protein_id="ACR74111.1"
FT                   /translation="MSRLIYLDNAATTQVYPEVVDAMLPYFTEHYGNPSAIYSFADEAE
FT                   RAVDHARGEVADLIGAKKDEIYFTGGGSESDNWALKATAEAYAAKGKHIITSAIEHHAI
FT                   LHTAQWLEKHGFEVTYVGVDEDGKIKLDELKAAIRPDTILISVMAANNEIGTIQPLKEI
FT                   GEIAKEHGILFHTDAVQAFGHIPINVDDMHIDMLSASGHKLNGPKGIGVMYIRKGVKIR
FT                   SFIHGGAQERQRRAGTHNVPGIVGLGKAVELAKANMAERSAYETKLRDHLIERVTSEIP
FT                   YTRLNGHRTDRLPNNANFCFRFIEGESMLILLDQAGICGSSGSACTSGSLDPSHVLLAI
FT                   GLPHEIAHGSLRLTLSEKTTLEDIDYTVDKLKEIIARLRSMSPLYEDFVKKNGKAEA"
FT   gene            286733..287179
FT                   /locus_tag="EUBREC_0309"
FT   CDS_pept        286733..287179
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0309"
FT                   /product="NifU protein"
FT                   /note="Cytoplasmic, score:8.87; COG0822 NifU homolog
FT                   involved in Fe-S cluster formation; KEGG:K04488 NifU
FT                   protein; HMMPfam:IPR002871; HMMPanther:IPR002871"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74112"
FT                   /db_xref="GOA:C4ZB37"
FT                   /db_xref="InterPro:IPR002871"
FT                   /db_xref="InterPro:IPR017787"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZB37"
FT                   /protein_id="ACR74112.1"
FT                   /translation="MAYSEKVMDHFNHPRNVGEMENPSGVGTVGNAKCGDIMRMYLDID
FT                   DNGIIQEAKFKTFGCGAAVATSSMATELVKGKTIQEALEVTNKAVMEALDGLPPVKVHC
FT                   SLLAEEAIHAALWDYAEKNGIKIEGLEKPVNDISEKEEAPEEDY"
FT   gene            287179..288267
FT                   /locus_tag="EUBREC_0310"
FT   CDS_pept        287179..288267
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0310"
FT                   /product="tRNA
FT                   (5-methylaminomethyl-2-thiouridylate)-methyltransferase"
FT                   /note="Cytoplasmic, score:8.87; COG0482 Predicted
FT                   tRNA(5-methylaminomethyl-2-thiouridylate)
FT                   methyltransferase, contains the PP-loop ATPase domain;
FT                   KEGG:K00566 tRNA
FT                   (5-methylaminomethyl-2-thiouridylate)-methyltransferase
FT                   HMMPfam:IPR004506; Gene3D:IPR014729; HMMPanther:IPR004506;
FT                   HMMTigr:IPR004506"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74113"
FT                   /db_xref="GOA:C4ZB38"
FT                   /db_xref="InterPro:IPR004506"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR023382"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZB38"
FT                   /protein_id="ACR74113.1"
FT                   /translation="MKKKVVVGMSGGVDSSVAAYLLKEQGYDVIGVTMQIWQDEDVFKQ
FT                   SQEGGCCGLSAVEDARRVAAVLDIPYYVMNFKADFKKYVIDYFVSEYERAYTPNPCIAC
FT                   NRYVKWESLLHRSLEIGADYIATGHYARIAQLPNGRYTIANSVTAEKDQTYALYNLTQE
FT                   QLRRTLMPVGEYEKPQIRRIAEEAGLPVAHKSDSQDICFVPDHDYASFIENETGKTYEP
FT                   GNFVDESGNILGRHKGLIHYTIGQRKGLGITAATPLFVKELRPATNEVVISTNESLFSD
FT                   TCYISDINYMAQEHITPDTRSIGKVRYSHRGADCTLTPMENGMIKCVFDEPQRAMTPGQ
FT                   AAVFYQDGHVLCGGTIEKMMVN"
FT   gene            complement(288387..288674)
FT                   /locus_tag="EUBREC_0311"
FT   CDS_pept        complement(288387..288674)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0311"
FT                   /product="Hypothetical protein"
FT                   /note="Cytoplasmic, score:8.87; COG1396 Predicted
FT                   transcriptional regulators; HMMPfam:IPR001387;
FT                   HMMSmart:IPR001387; superfamily:IPR010982"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74114"
FT                   /db_xref="GOA:C4ZB39"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZB39"
FT                   /protein_id="ACR74114.1"
FT                   /translation="MKTWNDYKEHVRTVDPEIVKDIDEVENISSIVSAMVEQRTSLGLS
FT                   QRELAAMRGIPQSSVARIESCKTTPNLGTLLNIFQHLGLQLTVRPTKPTI"
FT   gene            complement(288721..289044)
FT                   /locus_tag="EUBREC_0312"
FT   CDS_pept        complement(288721..289044)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0312"
FT                   /product="Hypothetical protein"
FT                   /note="Cytoplasmic, score:8.87; COG2361 Uncharacterized
FT                   conserved protein; HMMPfam:IPR008201"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74115"
FT                   /db_xref="InterPro:IPR008201"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZB40"
FT                   /protein_id="ACR74115.1"
FT                   /translation="MDNVKNDAYYIKRLKQDLEFVVTHMKNVDIEELNANEVLLDSMLF
FT                   RMIQISENAKKLSDEYKLHRGNVPWNAIYGLRNRIVHDYGNVDLNVVFETLKPDIPELL
FT                   EII"
FT   gene            complement(289037..289510)
FT                   /locus_tag="EUBREC_0313"
FT   CDS_pept        complement(289037..289510)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0313"
FT                   /product="Hypothetical protein"
FT                   /note="Cytoplasmic, score:8.87; HMMPfam:IPR001387;
FT                   HMMPfam:IPR002934; superfamily:IPR010982"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74116"
FT                   /db_xref="GOA:C4ZB41"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR041633"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZB41"
FT                   /protein_id="ACR74116.1"
FT                   /translation="MGELKSLRIERKLTQNQAADILGVSLRSYKSYENDEKKADSIKYK
FT                   YMIEKISEINPIDEENGIVDIDYIKRKCSDVFDKYNVNFCYLFGSYSKGKAKPTSDVDL
FT                   LISTDATGLKFYGLVEDIRTALHKKVDVLDINQLKDNFELTQEILKDGIKIYG"
FT   gene            complement(289767..289910)
FT                   /locus_tag="EUBREC_0314"
FT   CDS_pept        complement(289767..289910)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0314"
FT                   /product="Hypothetical protein"
FT                   /note="Extracellular, score:8.82"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74117"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZB42"
FT                   /protein_id="ACR74117.1"
FT                   /translation="MSYHHFVYHAINVILFLYLQASCTYTQNILYCYTFLNLCFLYTLS
FT                   KV"
FT   gene            289847..291265
FT                   /locus_tag="EUBREC_0315"
FT   CDS_pept        289847..291265
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0315"
FT                   /product="hypothetical protein"
FT                   /note="CytoplasmicMembrane, score:9.75; COG1672 Predicted
FT                   ATPase (AAA+ superfamily); KEGG:0hypothetical protein;
FT                   HMMPfam:IPR011579"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74118"
FT                   /db_xref="GOA:C4ZB43"
FT                   /db_xref="InterPro:IPR004256"
FT                   /db_xref="InterPro:IPR011579"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZB43"
FT                   /protein_id="ACR74118.1"
FT                   /translation="MLVGREKELHLLHDIQNDDSSHFVAVYGRMREGKTFLIREAFGYR
FT                   FTFQHAGLSEGGMKEQIYAFTSSLKDAGYEVKKQPQNWLEAFEALKDVIRLSSEKKKII
FT                   FIDELSWMDTQKSDLMVALENFWNGFASARKDIVLIVCASATSWMLSKVVHNKGGLYNR
FT                   LTEQIHLRTFCLRECEAYVKAAGLALNRNQILQYYMIFGGVPYYWGFLKKGLSLSQNID
FT                   SILFEKDAPLRDEFKYLYASVFKKPENYVKIIEALGTKKVGMTREEIITSTKIPNSGDL
FT                   TTKLEELESCGFIRKYNAFGMKKKNAIYQLMDCFTLFYFKFLKSEPTDEHFWTNQINTP
FT                   AVNTWLGLAFERVCMEHVDQIKFKLGISGVLTEINSWYCKSDPDNGIFGSQIDMLIARK
FT                   DQVINLCEMKYSQSEYTITEKVDRSIRNKISDLRVVSGTKYAIYPTLITTYGVVENSYS
FT                   QELQSVVTMDDLFA"
FT   gene            291385..291639
FT                   /locus_tag="EUBREC_0316"
FT   CDS_pept        291385..291639
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0316"
FT                   /product="Hypothetical protein"
FT                   /note="Cytoplasmic, score:8.87; HMMPfam:IPR003756"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74119"
FT                   /db_xref="InterPro:IPR006442"
FT                   /db_xref="InterPro:IPR036165"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZB44"
FT                   /protein_id="ACR74119.1"
FT                   /translation="MLAVKSMDVRENFKSLCDKVFRGETLIVSRPKNENIVMMSESEYN
FT                   EIMKAKRNAEYLAMLDKSMAEAEAGGFITKTVDELGAYE"
FT   gene            291639..291899
FT                   /locus_tag="EUBREC_0317"
FT   CDS_pept        291639..291899
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0317"
FT                   /product="hypothetical protein"
FT                   /note="Unknown cell location; COG4115 Uncharacterized
FT                   protein conserved in bacteria; KEGG:0hypothetical protein
FT                   HMMPfam:IPR009614; HMMTigr:IPR009614"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74120"
FT                   /db_xref="GOA:C4ZB45"
FT                   /db_xref="InterPro:IPR009614"
FT                   /db_xref="InterPro:IPR035093"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZB45"
FT                   /protein_id="ACR74120.1"
FT                   /translation="MNVVFTPTAWQQYTDWQKEDKKIVKRINELIKSIDRDGLLEGIGK
FT                   PEPLKYRKVCSRRITDEHRLTYNFDSNQNLIIYSCKFHYED"
FT   gene            292123..293055
FT                   /locus_tag="EUBREC_0318"
FT   CDS_pept        292123..293055
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0318"
FT                   /product="cysteine synthase K/M/A"
FT                   /note="Cytoplasmic, score:8.87; COG0031 Cysteine synthase;
FT                   KEGG:K01738 cysteine synthase K/M/A HMMPfam:IPR001926;
FT                   HMMTigr:IPR005856; HMMTigr:IPR005859; ScanRegExp:IPR001216"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74121"
FT                   /db_xref="GOA:C4ZB46"
FT                   /db_xref="InterPro:IPR001216"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR005856"
FT                   /db_xref="InterPro:IPR005859"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZB46"
FT                   /protein_id="ACR74121.1"
FT                   /translation="MSNIYQGTLGLIGNTPLVELTHVEKAYGLEARLLAKLEYFNPAGS
FT                   VKDRIAKEMIEQAERDGKLKPGSTIIEPTSGNTGIGLAAIAAAKGYKIIIVLPETMSIE
FT                   RRNIIKAYGAELVLSDGTKGMKGAIAKAEELHEQIPDSFIPEQFENPANPEAHRKTTGP
FT                   EIWNDTDGQVDAFVAGVGTGGTITGTGEYLKSKNPDVKIVAVEPETSAVLSTGKAGAHK
FT                   IQGIGAGFVPNTLNTEVYDEIIPVSNEASFEYGKIIAKEEGVLVGISSGAALYAAIEVA
FT                   KRPEFKGKTVVALLPDSGDRYYSTDLFKD"
FT   gene            293269..293550
FT                   /locus_tag="EUBREC_0319"
FT   CDS_pept        293269..293550
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0319"
FT                   /product="Hypothetical protein"
FT                   /note="Cytoplasmic, score:8.87; COG1396 Predicted
FT                   transcriptional regulators; HMMPfam:IPR001387;
FT                   HMMSmart:IPR001387; superfamily:IPR010982"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74122"
FT                   /db_xref="GOA:C4ZB47"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZB47"
FT                   /protein_id="ACR74122.1"
FT                   /translation="MINLYQKTWTEINNDIAQKIVRLRKRKKITQKQLAARSGVSLGSL
FT                   KRFEQSGEISLQSLTKIAIALDVENELEDLFNNVPFASIEEVINEQTK"
FT   gene            293534..294118
FT                   /locus_tag="EUBREC_0320"
FT   CDS_pept        293534..294118
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0320"
FT                   /product="HipA protein"
FT                   /note="Cytoplasmic, score:8.87; COG3550 Uncharacterized
FT                   protein related to capsule biosynthesis enzymes; KEGG:0HipA
FT                   protein; HMMPfam:IPR012893"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74123"
FT                   /db_xref="InterPro:IPR012893"
FT                   /db_xref="InterPro:IPR017508"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZB48"
FT                   /protein_id="ACR74123.1"
FT                   /translation="MNRLNKLEVFYHERLVGTIALYQNRLAAFEYDSNWLANGFSISPF
FT                   PLPLEKKVFIPKIDPFEGLLETSHRIPNLDYDILMQLTLQLTKSMEECEKLYRLMCFNV
FT                   YAHNRDDHSKNFTYLYDEDECSWKLSPAYDLTYSNSIGGEHATTVNGNGVNPELDDILA
FT                   VAKKIGLNMTMARKTALNIRDCVSEMLGEYL"
FT   gene            complement(294210..294809)
FT                   /locus_tag="EUBREC_0321"
FT   CDS_pept        complement(294210..294809)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0321"
FT                   /product="Mg-dependent DNase"
FT                   /note="Cytoplasmic, score:8.87; COG0535 Predicted Fe-S
FT                   oxidoreductases; KEGG:K03424 Mg-dependent DNase
FT                   HMMPfam:IPR007197"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74124"
FT                   /db_xref="GOA:C4ZB49"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR023821"
FT                   /db_xref="InterPro:IPR023822"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZB49"
FT                   /protein_id="ACR74124.1"
FT                   /translation="MADIIYTYKNEVYANITNKCDCACTFCIRSQKDAIGDATTLWHKV
FT                   DPTYDEIIAAIDAFDFTGYEEFVFCGYGEPTCALDILEKTAKYVKEKYKLPIRVNTNGL
FT                   GNLYHGRDIVPELAEYIDSVSISLNAANAEEYNKVTRPTFDNAYEAMLDFAEECNRMIK
FT                   HTQLSIVDVLPEEDIKTCQQIADERGIHLKIRHFSN"
FT   gene            complement(294809..295354)
FT                   /locus_tag="EUBREC_0322"
FT   CDS_pept        complement(294809..295354)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0322"
FT                   /product="Hypothetical protein"
FT                   /note="CytoplasmicMembrane, score:9.99; COG4720 Predicted
FT                   membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74125"
FT                   /db_xref="GOA:C4ZB50"
FT                   /db_xref="InterPro:IPR009825"
FT                   /db_xref="InterPro:IPR023812"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZB50"
FT                   /protein_id="ACR74125.1"
FT                   /translation="MNSQVKKLTFTALMAAMITIFTAYICHIPVGQNGGYIHFGDSLIY
FT                   IAACLLPWPYAMTAAAIGGGMADLLTAPIWAPATIIIKALISIPFTNKSDKIVTVRNVV
FT                   STIIAFAISATGYAIAEAFITYGFTKQAFTGLIAIIPVSVPGSCIQSGGSAIIFVILGL
FT                   VLDKIGFKRRFFTLEETK"
FT   gene            complement(295454..296353)
FT                   /locus_tag="EUBREC_0323"
FT   CDS_pept        complement(295454..296353)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0323"
FT                   /product="putative pyridoxine kinase"
FT                   /note="Unknown cell location; COG2240
FT                   Pyridoxal/pyridoxine/pyridoxamine kinase; KEGG:K00868
FT                   putative pyridoxine kinase HMMPfam:IPR013749"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74126"
FT                   /db_xref="GOA:C4ZB51"
FT                   /db_xref="InterPro:IPR004625"
FT                   /db_xref="InterPro:IPR013749"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZB51"
FT                   /protein_id="ACR74126.1"
FT                   /translation="MSPQMNIKNSAKKFGGYMKKAAVFNDLSGFGKCSLTAAIPVLSAQ
FT                   GVQCCPMASAVLTNQTGYEYHKCTDLTAMIKDYIDNWQKNNAHFDGIYSGFMTGSKQIE
FT                   LFMDFLDVFYEKNTMLLVDPVMGDDGRTYGIYSAALLDGMKALSRKADVITPNLTEACL
FT                   LADYDIEKVYSDTRKDVLLPIAAEISEKLRCLSGKNQDVIITGIKCRDDKSPFIYNLVT
FT                   TANGTTTHRSHFFDVSFSGTGDLFASVICGSRLNGFSTEEAAERAGKFLYDSIADTMND
FT                   DTAPNDGVNFEKFLRELM"
FT   gene            296571..296861
FT                   /locus_tag="EUBREC_0324"
FT   CDS_pept        296571..296861
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0324"
FT                   /product="Hypothetical protein"
FT                   /note="Unknown cell location"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74127"
FT                   /db_xref="InterPro:IPR003711"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZB52"
FT                   /protein_id="ACR74127.1"
FT                   /translation="MFQKKQIIYSETLGVCVVDNIVSLAASKREKAVPYYVLKPVFEDK
FT                   VSYIPVEHHRVVLRDMFTREEALKLKETEQYKNDKHLRQAVDYVLDKVAIK"
FT   gene            296888..297172
FT                   /locus_tag="EUBREC_0325"
FT   CDS_pept        296888..297172
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0325"
FT                   /product="Hypothetical protein"
FT                   /note="Unknown cell location"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74128"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZB53"
FT                   /protein_id="ACR74128.1"
FT                   /translation="MGQQHAIHKFVLGTKDFDDKQSEFMYDKGWYSITDIVGEEKNIIY
FT                   KSRNAQEAYLKWNIYIGRKKERLTPEERKRQREERYEKKREQNREHHRI"
FT   gene            297182..297832
FT                   /locus_tag="EUBREC_0326"
FT   CDS_pept        297182..297832
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0326"
FT                   /product="Hypothetical protein"
FT                   /note="CytoplasmicMembrane, score:9.99; NOG22617 non
FT                   supervised orthologous group"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74129"
FT                   /db_xref="GOA:C4ZB54"
FT                   /db_xref="InterPro:IPR006938"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZB54"
FT                   /protein_id="ACR74129.1"
FT                   /translation="MGIFNIDNKFFRALNKLVDMVILSFCWIISCIPVFTIGAASTALY
FT                   DTSRRVIHHDEGYVWRGYWHAFKVNFKQATKAWLVQLIILIVLLGDIYITWSGLKTGNQ
FT                   WGTFSIVFIIMALIAAAWAIYTSAYISRFEQVTKITLKNTILILIANLPWTLLVIVILV
FT                   VSLILAWIIIPLIFILPVGAALTYEFIFERIFRKLMNEEDRLREEEKDKEYRD"
FT   gene            297856..298950
FT                   /locus_tag="EUBREC_0327"
FT   CDS_pept        297856..298950
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0327"
FT                   /product="6-phosphofructokinase"
FT                   /note="Cytoplasmic, score:8.87; COG0205
FT                   6-phosphofructokinase; KEGG:K00850 6-phosphofructokinase
FT                   HMMPfam:IPR000023; BlastProDom:IPR015913; HMMPIR:IPR012003;
FT                   HMMPanther:IPR000023; ScanRegExp:IPR015912"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74130"
FT                   /db_xref="GOA:C4ZB55"
FT                   /db_xref="InterPro:IPR000023"
FT                   /db_xref="InterPro:IPR012003"
FT                   /db_xref="InterPro:IPR012829"
FT                   /db_xref="InterPro:IPR015912"
FT                   /db_xref="InterPro:IPR022953"
FT                   /db_xref="InterPro:IPR035966"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZB55"
FT                   /protein_id="ACR74130.1"
FT                   /translation="MHKEEAAMKKIGMLTSGGDCQALNAAMRGVVKALAHNIDELEIYG
FT                   FENGYKGLIYENYRILTSKDFSGILTKGGTILGSSRQPFKLMRVPDENGLDKVAAMKNT
FT                   YKKLGLDCLVILGGNGTQKTANLLREEGLNIIHLPKTIDNDIYGTDVTFGFQSAINIAT
FT                   DAIDCIHTTAASHNRVFIVEVMGHKVGWLTLYAGVAGGADIILLPEIPYDIDKVVDAIH
FT                   KRTKEGKGFTILAVAEGAISKEDAALSKKEYRKKLAKSKYPSVSYEVADRISERLGLEV
FT                   RVAVPGHTQRGGSPCPYDRVLCTRLGSAAAKAIMDEDYGCMIAMVNGQTKRVPLADVAG
FT                   KLKTVDPKSQMIKEAKRTGICFGD"
FT   gene            298985..300556
FT                   /locus_tag="EUBREC_0328"
FT   CDS_pept        298985..300556
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0328"
FT                   /product="DNA polymerase III, subunits gamma and tau"
FT                   /note="Cytoplasmic, score:8.87; COG2812 DNA polymerase III,
FT                   gamma/tau subunits; KEGG:K00961 DNA polymerase III,
FT                   subunits gamma and tau HMMPfam:IPR003959;
FT                   HMMSmart:IPR003593; HMMTigr:IPR012763;
FT                   superfamily:IPR008921"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74131"
FT                   /db_xref="GOA:C4ZB56"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR012763"
FT                   /db_xref="InterPro:IPR022754"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZB56"
FT                   /protein_id="ACR74131.1"
FT                   /translation="MSYQALYRKFRPQEFEDVKGQEHIVTTLKNQIKADRIGHAYLFCG
FT                   TRGTGKTTVAKIFAKAVNCEHPVDGSPCGECPSCRAITEGSSMNVIEIDAASNNGVDNI
FT                   RQIREEVTYRPTEGRYKVYIIDEVHMLSAGAFNALLKTLEEPPSYVIFILATTEAHKIP
FT                   ITILSRCQRYDFHRISIDTIASRLSDLMEQEHVEVEERAIRYVAKAGDGSMRDALSLLD
FT                   QCIAFHLGEKLTYENVLEVLGAVDTEVFSRLLRRILDEDVTGAIRILGELIDEGRELSQ
FT                   LVNDFTWYMRNLLLLQSSDDMEEVLDISKDNLEALKEEAALVKPETLIRYIRVFSELSS
FT                   QVKFASQKRIMVEIAIIKLCRPQMEKSYDSVLDRINSIEKKLEKGIPIAAQAAQTQDMQ
FT                   QAAASEPIVKKELPKAIPQDISELMKHWKSILSEMGATSKVYLNKAVTSLGNSSDLILM
FT                   FDDENAYEYLSENRAGCMDTLASLIEKRIGKKVEVTVKKNNSAVSAKEAVVDLTDMINF
FT                   DIEEEN"
FT   gene            300607..300948
FT                   /locus_tag="EUBREC_0329"
FT   CDS_pept        300607..300948
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0329"
FT                   /product="uncharacterized conserved protein, YbaB family"
FT                   /note="Unknown cell location; COG0718 Uncharacterized
FT                   protein conserved in bacteria; KEGG:K09747 uncharacterized
FT                   conserved protein, YbaB family; HMMPfam:IPR004401;
FT                   Gene3D:IPR004401; HMMTigr:IPR004401"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74132"
FT                   /db_xref="GOA:C4ZB57"
FT                   /db_xref="InterPro:IPR004401"
FT                   /db_xref="InterPro:IPR036894"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4ZB57"
FT                   /protein_id="ACR74132.1"
FT                   /translation="MARRGGFPGGMPGNMNNLMKQAQKMQRQMEEAQKQLEDAEVTAKA
FT                   GGGAVEVTVSGKKEITKVKLSEEVVDPDDIEMLEDLIMAATNEALRQIDEQSQASMSKI
FT                   TGGLGGGLF"
FT   gene            300948..301544
FT                   /locus_tag="EUBREC_0330"
FT   CDS_pept        300948..301544
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0330"
FT                   /product="recombinational DNA repair protein"
FT                   /note="Cytoplasmic, score:8.87; COG0353 Recombinational DNA
FT                   repair protein (RecF pathway); KEGG:K06187 recombinational
FT                   DNA repair protein; HMMPfam:IPR006171; HMMPfam:IPR015967;
FT                   HMMSmart:IPR003583; HMMSmart:IPR006154; HMMTigr:IPR000093;
FT                   ScanRegExp:IPR015967; superfamily:IPR000093"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74133"
FT                   /db_xref="GOA:C4ZB58"
FT                   /db_xref="InterPro:IPR000093"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR015967"
FT                   /db_xref="InterPro:IPR023627"
FT                   /db_xref="InterPro:IPR023628"
FT                   /db_xref="InterPro:IPR034137"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZB58"
FT                   /protein_id="ACR74133.1"
FT                   /translation="MDFYSSEISKLIEELSQLPGIGAKTAQRLAFHIINMPKEQAKSLS
FT                   DAIIDAKEHVRYCKCCYTLTDDELCPICKDAARDHKTIMVVENTRDLVAYEKTGKYEGV
FT                   YHVLGGAISPMLGIGPADIRLKELMVRLEKDVDEVIIATNSSLEGETTAMYISKLIKPT
FT                   GIKVTRIASGVPVGGDLEYIDEVTLLRALQGRTEI"
FT   gene            301545..302399
FT                   /locus_tag="EUBREC_0331"
FT   CDS_pept        301545..302399
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0331"
FT                   /product="transketolase domain protein"
FT                   /note="Cytoplasmic, score:8.87; COG3959 Transketolase,
FT                   N-terminal subunit; KEGG:K00615 transketolase domain
FT                   protein HMMPfam:IPR005474; ScanRegExp:IPR005474"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74134"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZB59"
FT                   /protein_id="ACR74134.1"
FT                   /translation="MIEGDIMNNLELEKMANEIRKDIVTAVHSAKSGHPGGSLSSADIF
FT                   TYLYFEEMNVDPANPKWEDRDRFVLSKGHVAPGLYSTLAEKGYFPKEDLKTLRHTGSYL
FT                   QGHPDMKHIPGIDMSSGSLGQGVSVAVGMAAAGKYDKKDYRVYTLTGDGEIQEGQIWEA
FT                   AMWAGHRKLDNLVVIVDNNNLQIDGSVEDVCSPYPIDKKFEAFNFHVINIDGNDFDQIR
FT                   AAFKEARETKGMPTAIIAKTVKGKGVSFMENAAGWHGKAPNDEEYEIAMADLEKAGEAL
FT                   CQK"
FT   gene            302387..303328
FT                   /locus_tag="EUBREC_0332"
FT   CDS_pept        302387..303328
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0332"
FT                   /product="transketolase, C-terminal subunit"
FT                   /note="Cytoplasmic, score:8.87; COG3958 Transketolase,
FT                   C-terminal subunit; KEGG:K00615 transketolase, C-terminal
FT                   subunit HMMPfam:IPR005475; HMMPfam:IPR005476;
FT                   Gene3D:IPR015941; superfamily:IPR009014"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74135"
FT                   /db_xref="GOA:C4ZB60"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZB60"
FT                   /protein_id="ACR74135.1"
FT                   /translation="MSEVKKIATRDSYGNALVELGKAHDDLIVLDADLAGATKTCIFQK
FT                   EFPERHWDCGIAECNMTGIAAGLATCGKVPFISSFAMFAAGRNYDQVRNSIGYPHLNVK
FT                   IGATHAGISVGEDGATHQCLEDLSLMREIPGMVVINPSDDVEARAAVKAAYDHVGPVYL
FT                   RFGRLAVPVINDTPDYKFEIGKGIVLKEGKDVSIFATGLEVSETLEAAKMLAADGIDAE
FT                   VINIHTIKPIDRELIVKSVSKTGKAVTVEEHSINGGLGSAVAEVLCEEQPAKLLRIGVE
FT                   DRFGESGPAVELIHKYGLDAEGIYNKVKNYMK"
FT   gene            303337..303471
FT                   /locus_tag="EUBREC_0333"
FT   CDS_pept        303337..303471
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0333"
FT                   /product="Hypothetical protein"
FT                   /note="Extracellular, score:8.82"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74136"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZB61"
FT                   /protein_id="ACR74136.1"
FT                   /translation="MCFALGGCVHRCSIQYIPQKNMKSAAGFRVDSVWNEFSHSCYFT"
FT   gene            303569..303709
FT                   /locus_tag="EUBREC_0334"
FT   CDS_pept        303569..303709
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0334"
FT                   /product="Hypothetical protein"
FT                   /note="Unknown cell location"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74137"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZB62"
FT                   /protein_id="ACR74137.1"
FT                   /translation="MCEKSGAWVHAPFFRWGLTAKYLYNRTILHKFTFCKCYADRKRRL
FT                   A"
FT   gene            303706..304680
FT                   /locus_tag="EUBREC_0335"
FT   CDS_pept        303706..304680
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0335"
FT                   /product="Hypothetical protein"
FT                   /note="Unknown cell location; COG3210 Large exoproteins
FT                   involved in heme utilization or adhesion"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74138"
FT                   /db_xref="GOA:C4ZB63"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZB63"
FT                   /protein_id="ACR74138.1"
FT                   /translation="MIDIVTNNVRQIGTPADEGRVYISEKAYKRIKTEGFKDKEVFVLM
FT                   GHTESSGGRYATFVEAAIAVYDMEFDKNAPLWTNKVWSRVFAEIKKSYEELIIVGWAFR
FT                   QEDFPAEPTPMLENIHREHFGGAHQLMFLLNRTEQEENFFIKKNNHLKKKTGFFVYYRM
FT                   NEHCDSADSYNETDTCNKTYSYSNANNNNKIDSYSNADDNNKSSNRYEDTDTAAKSSYS
FT                   RIHRRASADDRINVSFPEEFGSISKERGRYRKAMEAGKEERKGSFASVVMIAAIAVLIV
FT                   LIGLKAGAGMSGTIDKKETLPAMSTEEDLIPVEKISGEWYTDK"
FT   gene            304658..305902
FT                   /locus_tag="EUBREC_0336"
FT   CDS_pept        304658..305902
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0336"
FT                   /product="Hypothetical protein"
FT                   /note="CytoplasmicMembrane, score:9.75"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74139"
FT                   /db_xref="GOA:C4ZB64"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZB64"
FT                   /protein_id="ACR74139.1"
FT                   /translation="MNGILTSNKYFGSRQKDKIMARKSDFKTVETDLDELEEKIRKHRR
FT                   KIAKRIIIVVAAVVALFLIVWLWMALRTYKSFDVKNSVEQKDKSAVSFVDFCGAVVEYS
FT                   NDGVLYTDSDGNRIWNQAFEMSSPQVVTCESFMTIYDRGGTDLYIMDKKGVKKEIGTSW
FT                   PIIKACIASQGTVAVLVSENENYYVKLYDVNGKELASGEFFGEQKNIPVDIALSYDAKK
FT                   LAVDMIDVSGGKTDSVISFYNFGSVGQNEIDNNVGTYKYENQLIPEIAYVSDSRMIAVS
FT                   DQNIMVFDGSQKPKLKQTIKLEKLIDSVFYNNKYIGVAYSNNDKNCTSHIKLYDFNGKM
FT                   LMENDTAIAYNSIEFDSNNEVCVTGDTACEIYTIHGVKKFYHTFDNKLYKVMYKSGMNN
FT                   YIFIYDGAMDEVRLK"
FT   gene            305899..306513
FT                   /locus_tag="EUBREC_0337"
FT   CDS_pept        305899..306513
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0337"
FT                   /product="Hypothetical protein"
FT                   /note="CytoplasmicMembrane, score:9.99; COG1286
FT                   Uncharacterized membrane protein, required for colicin V
FT                   production; HMMPfam:IPR003825"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74140"
FT                   /db_xref="GOA:C4ZB65"
FT                   /db_xref="InterPro:IPR003825"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZB65"
FT                   /protein_id="ACR74140.1"
FT                   /translation="MNWLLIAVICIIAWNVVRGYTRGVLRMVYSLAAWIVMLAASTMAA
FT                   PYVRDQILSQTGIEPVILNGIEKQIAAQGQKATGDFDMANILLQQSGAYDTISAQLTNA
FT                   IMTGLSFFIVFFLLGIVAYIVRHIIRKIERVPVIGTVNRIAGFAVGFIKGMVIVWLLLA
FT                   LTSLFAASEIGQTMTAYINDSMMLKYLYENNPVIKLIENIL"
FT   gene            307101..308621
FT                   /locus_tag="EUBREC_0338"
FT   rRNA            307101..308621
FT                   /locus_tag="EUBREC_0338"
FT                   /product="16S ribosomal RNA"
FT   gene            308688..308804
FT                   /locus_tag="EUBREC_0339"
FT   rRNA            308688..308804
FT                   /locus_tag="EUBREC_0339"
FT                   /product="5S ribosomal RNA"
FT   gene            308808..308881
FT                   /locus_tag="EUBREC_0340"
FT   tRNA            308808..308881
FT                   /locus_tag="EUBREC_0340"
FT                   /product="tRNA-Ile"
FT   gene            308923..308995
FT                   /locus_tag="EUBREC_0341"
FT   tRNA            308923..308995
FT                   /locus_tag="EUBREC_0341"
FT                   /product="tRNA-Ala"
FT   gene            309183..312065
FT                   /locus_tag="EUBREC_0342"
FT   rRNA            309183..312065
FT                   /locus_tag="EUBREC_0342"
FT                   /product="23S ribosomal RNA"
FT   gene            312127..312200
FT                   /locus_tag="EUBREC_0343"
FT   tRNA            312127..312200
FT                   /locus_tag="EUBREC_0343"
FT                   /product="tRNA-Asp"
FT   gene            312279..312351
FT                   /locus_tag="EUBREC_0344"
FT   tRNA            312279..312351
FT                   /locus_tag="EUBREC_0344"
FT                   /product="tRNA-Val"
FT   gene            312377..312449
FT                   /locus_tag="EUBREC_0345"
FT   tRNA            312377..312449
FT                   /locus_tag="EUBREC_0345"
FT                   /product="tRNA-Thr"
FT   gene            312479..312560
FT                   /locus_tag="EUBREC_0346"
FT   tRNA            312479..312560
FT                   /locus_tag="EUBREC_0346"
FT                   /product="tRNA-Tyr"
FT   gene            312590..312663
FT                   /locus_tag="EUBREC_0347"
FT   tRNA            312590..312663
FT                   /locus_tag="EUBREC_0347"
FT                   /product="tRNA-Met"
FT   gene            312683..312755
FT                   /locus_tag="EUBREC_0348"
FT   tRNA            312683..312755
FT                   /locus_tag="EUBREC_0348"
FT                   /product="tRNA-Phe"
FT   gene            312770..312842
FT                   /locus_tag="EUBREC_0349"
FT   tRNA            312770..312842
FT                   /locus_tag="EUBREC_0349"
FT                   /product="tRNA-Lys"
FT   gene            complement(313209..313718)
FT                   /locus_tag="EUBREC_0350"
FT   CDS_pept        complement(313209..313718)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0350"
FT                   /product="Hypothetical protein"
FT                   /note="Unknown cell location"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74141"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZB66"
FT                   /protein_id="ACR74141.1"
FT                   /translation="MRNFYSNNRDAMKSSKRKEYSITELAYDDSTALHRAAKKLKNYKY
FT                   SDDENTDNIRGTVMALVDTYNNSIDSASNSSSSSMKRYAKQLKKLAGKYTDELEDIGIT
FT                   INKDGTLKANEELVKKADADTLNSLFGNDNDFTSSLYRVSRQMSSSSHDDYYTSLRTGS
FT                   NINLTV"
FT   gene            314089..315132
FT                   /locus_tag="EUBREC_0351"
FT   CDS_pept        314089..315132
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0351"
FT                   /product="aldose 1-epimerase"
FT                   /note="Cytoplasmic, score:8.87; COG2017 Galactose
FT                   mutarotase and related enzymes; KEGG:K01785 aldose
FT                   1-epimerase HMMPfam:IPR008183; Gene3D:IPR014718;
FT                   HMMPanther:IPR015443; ScanRegExp:IPR008183;
FT                   superfamily:IPR011013"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74142"
FT                   /db_xref="GOA:C4ZB67"
FT                   /db_xref="InterPro:IPR008183"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR014718"
FT                   /db_xref="InterPro:IPR015443"
FT                   /db_xref="InterPro:IPR018052"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZB67"
FT                   /protein_id="ACR74142.1"
FT                   /translation="MSKKAFGTTSKGVEASLYEISNGGGLRVLLTDYGASVVSIFVKDK
FT                   DGNERDVILGYDNVKSYEKEYSYFGATVGRYANRISDAKINIDGVEYKLEANDNENSLH
FT                   SGSNGFSKRFWTVKEQKADEITFEIEDADLEQGFPGNAVVDVTFKVTEENALAIIYNAK
FT                   ADKTTTFNMTNHSYFNLNGHASGSVYTHTLQINAEHYTPVKDSKAIPTGEIAPVEGTPF
FT                   DFTEAKPIGRDIEANDTQLHYGSGYDHNFAIDKTAPGVEKVATAYSPESGIQMEVYTDC
FT                   VGIQLYTANFIVGQEGKGGVKYNNRDAFCLETQFYPNSINETNFSTPVTKAGDTYHTET
FT                   DYKFSVK"
FT   gene            315465..315629
FT                   /locus_tag="EUBREC_0352"
FT   CDS_pept        315465..315629
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0352"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74143"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZB68"
FT                   /protein_id="ACR74143.1"
FT                   /translation="MTSHTQTCITAGIWCVPKKYMNCHKVPLTFGDDKKQTDKTDYPDA
FT                   FFVADFIYF"
FT   gene            315732..316667
FT                   /locus_tag="EUBREC_0353"
FT   CDS_pept        315732..316667
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0353"
FT                   /product="2-hydroxyacid dehydrogenase"
FT                   /note="Cytoplasmic, score:9.98; COG1052 Lactate
FT                   dehydrogenase and related dehydrogenases; KEGG:K05884
FT                   2-hydroxyacid dehydrogenase HMMPfam:IPR006139;
FT                   HMMPfam:IPR006140; ScanRegExp:IPR006140"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74144"
FT                   /db_xref="GOA:C4ZB69"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR029753"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZB69"
FT                   /protein_id="ACR74144.1"
FT                   /translation="MKIVFLDSKTIGDDIDLSEYDKLGEVVKYDFSTTEEAAERTRDAD
FT                   VIVLNKVEVNEKSIGQAKNLKLVCVTATGTNNLDKEYLVKRGIEWRNVAGYSTETVAQH
FT                   TFALLFYLLEKLRYYDDYVKSEKYVGDTSFTHFSNVFHQISGMTWGIVGLGNIGRRVAD
FT                   IAKAFGCHVVYYSTSGRNSQPGYERVDFDTLLATSDIVSVHAPLTDDTLGLMDKAAFEK
FT                   MKKSAIFLNLGRGPIVNEADLAQALMDGELAAAGLDVLAQEPMSEDNPLRAIKDSNKLI
FT                   ITPHIAWASVEARTNLMHIIYSQIEDFFAN"
FT   gene            316762..318699
FT                   /locus_tag="EUBREC_0354"
FT   CDS_pept        316762..318699
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0354"
FT                   /product="sulfatase"
FT                   /note="CytoplasmicMembrane, score:9.99; COG1368
FT                   Phosphoglycerol transferase and related proteins, alkaline
FT                   phosphatase superfamily; KEGG:0sulfatase HMMPfam:IPR000917;
FT                   Gene3D:IPR001952"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74145"
FT                   /db_xref="GOA:C4ZB70"
FT                   /db_xref="InterPro:IPR000917"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZB70"
FT                   /protein_id="ACR74145.1"
FT                   /translation="MSIKFEITKQNNIHFGIAAVAAALVGYFTSASWWVILLFAAVYFG
FT                   LVNVKLELPVKLSWLWAAILLVIGAILSVFSVQYVLLTDEDFVKTTDMVCVVNVVLALA
FT                   IYLVILFITNNTRLTCTIASIAILAFGFIDYFVYEFRGNEFTYADLKSAGTGLSVVTKY
FT                   KFVIDYKFLYVILAAVLYLMLVRRIEVQFESAIHMRIISILLTIICVLYVIMNSMSLNT
FT                   ETWEKKGTYRNGYLLNFVLGIRDSFVKAPDGYSKAAVDKIAGNFKETDSSYSQSDAKNP
FT                   TIIVIMNESFADLSVVGDFETNTQVTPFMDSLSENTLKGYALSSVYGAKTPNSEWEFET
FT                   GNSMAFLPDGSVVYQQYINDDPTSIVSNLKNIGYTTVAMHPYYATGWSRNKIYPHLGYD
FT                   ETYFIDDFDQTKILREYITDQELYDKIIDRYEKKSDDEKLYIMGVTMQNHGGYGERYDN
FT                   FNQEVYKVGASYTDANQYLSLLNESDKALENLITYFKGVDDPVEIVFFGDHQPGLCNDF
FT                   IKLLNGKGNSGLTEQELENLYKVPFLIWTNYETDAQKVDVTSLNYLSTLTLERANIDLP
FT                   AYNRFLAELMEKIPAINSRGYYSKKNECFMHVEDATGDEAKWIKAYNILQYNSMFDEKD
FT                   RSSLLFPYLK"
FT   gene            318772..320994
FT                   /locus_tag="EUBREC_0355"
FT   CDS_pept        318772..320994
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0355"
FT                   /product="predicted phosphatase"
FT                   /note="Cytoplasmic, score:8.87; COG0546 Predicted
FT                   phosphatases; KEGG:K01091 predicted phosphatase
FT                   HMMPfam:IPR001667; HMMPfam:IPR003156; HMMPfam:IPR005834;
FT                   HMMTigr:IPR006402; HMMTigr:IPR006439"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74146"
FT                   /db_xref="GOA:C4ZB71"
FT                   /db_xref="InterPro:IPR001667"
FT                   /db_xref="InterPro:IPR003156"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR006549"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR038763"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZB71"
FT                   /protein_id="ACR74146.1"
FT                   /translation="MKLSDLLQFDNIIVQCHDNPDADALASGFGVYEYLRMNGKSPRLV
FT                   YGGRNIIHKSNLVLMVDSLGIPIEHVDFLDNPQLLVTVDCQYGGGNVTFFKAENVAVID
FT                   HHRVSGELPAMNRVMSYMGSCATIVWDMLREEGVEINRNLATALYYGLYTDTGEFTEIT
FT                   HSLDRDLRDEADFDNTIVAKFRNANMSLEELDIAATALLGRDYIEEYRLAIVKAGACDP
FT                   NVLGIISDFVLEVDAIDICMVFSVIKNGVKLSFRSCIKEVSASEMAQEVCRDIGSGGGH
FT                   YYKAGGFIPMDLLIDSYNVYCKEKDVTPRFQYSSDGTHKRPSDSAIKSLLEERIFDYLN
FT                   DTKIIYGEDFDTSGFKKVDYKKRPIPMGCIIAKDILPVGCCMGVRTAKGDISTPVSEDT
FT                   VVIIGEDGSVRILNLDRLNKSFRIYKDWRFTVKQTDYVPKFKNKDTETIVDGMAHARVC
FT                   IPVEEDFSRAFVLKHKVKLFKNKDDSSYISGRPGDIMVLPNDDRNEAYMISKTEFEKTH
FT                   IAKGEEENRKKAVVFDLDGTLLYTLEDLKNATNYALKQNGMPERTLDEVRRFVGNGVKL
FT                   LMERAVPQGADNPKFEKTFSDFKEYYEAHCNDNTAPYDGIMELLKELKLNGIKLAIVSN
FT                   KLDPAVKELNQLYFKEYMTSAVGEMEEEGIRKKPAPDMVQKALKELQVSADEAIYVGDS
FT                   DVDIATAKNSGLECVSVTWGFRDVEFLKEHGATNLIDEPVELLNYV"
FT   gene            321013..323034
FT                   /locus_tag="EUBREC_0356"
FT   CDS_pept        321013..323034
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0356"
FT                   /product="PRD/PTS system IIA 2 domain protein"
FT                   /note="CytoplasmicMembrane, score:9.76; COG3711
FT                   Transcriptional antiterminator; KEGG:K02538 PRD/PTS system
FT                   IIA 2 domain protein; HMMPfam:IPR002178;
FT                   BlastProDom:IPR002178; Gene3D:IPR002178;
FT                   ScanRegExp:IPR002178; ScanRegExp:IPR005829"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74147"
FT                   /db_xref="GOA:C4ZB72"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR011608"
FT                   /db_xref="InterPro:IPR013011"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036634"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZB72"
FT                   /protein_id="ACR74147.1"
FT                   /translation="MLSEKGLLIIEKLAEHNNELVTSKALAASTGMSERSVKTYLKEVA
FT                   DFCEQNSMTLDRKPGKGMKPCFSDAQIGKILDVAGRKSAAVSQKKRQNYISYILLSGWD
FT                   TYTYALFSEELNVSKNVIMDDINELDAELLLFGIKVHRTAGYGIYATGSELDIRKAMRH
FT                   FCRYPISDKQVIKTDDHRLSRRAAEVIANNFRSVNLSMAVDMIHHVERRFDIIFTDYTF
FT                   QMLAEYIAIALFRVDVEKELKTDELDLSNRICDAASDGDAGTETEQQVQKNGFVMIEHE
FT                   NMAKEAAGFLERHHGISLSQPEIMYLAMLFSCAEGQNRVVMSCEEALSIEDEMIVYLSN
FT                   LLAANLIENELLRESMRSFLPGSIARTHFGIEIDNPFLSDITQSYASLFTVCFTVSRYY
FT                   EKYTGAMPSENEIAFIALQVGGALHRNPMTVRAVLIGAAGYATGSIIAGKIENRVPDVR
FT                   IVSILSSDRIEHIDEYDCDLILSTIDTRADIHKDMRFLYVSPLISAQDEKNIRNKCFEL
FT                   MTGQSAEVSEFSQMLSEEFIIFEKKAKNRKDVLKRACQLLINKGIVQSEFARDVLEREK
FT                   VEATAVGCNIAIPHGKPEHVNRCQILVIRLDKPIEWGERMADMIFLLAINFDSVNTTKA
FT                   FFHDFTKLLNENGATDRLREAASPHELCAAIRKELGWN"
FT   gene            323245..323508
FT                   /locus_tag="EUBREC_0357"
FT   CDS_pept        323245..323508
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0357"
FT                   /product="Hypothetical protein"
FT                   /note="Cytoplasmic, score:9.98; COG1925 Phosphotransferase
FT                   system, HPr-related proteins; HMMPfam:IPR000032;
FT                   BlastProDom:IPR000032; Gene3D:IPR000032; HMMTigr:IPR005698;
FT                   superfamily:IPR000032"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74148"
FT                   /db_xref="InterPro:IPR000032"
FT                   /db_xref="InterPro:IPR035895"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZB73"
FT                   /protein_id="ACR74148.1"
FT                   /translation="MVSKTMVVKAAEGLHMRPAGVIAREAGKFDSDVTIVFGDKRINAK
FT                   SLVNIIAACIKKDAEITFECEGADEEAALAKMEELEADNFGD"
FT   gene            323539..325239
FT                   /locus_tag="EUBREC_0358"
FT   CDS_pept        323539..325239
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0358"
FT                   /product="phosphoenolpyruvate-protein phosphotransferase"
FT                   /note="Cytoplasmic, score:9.98; COG1080
FT                   Phosphoenolpyruvate-protein kinase (PTS system EI component
FT                   in bacteria); KEGG:0phosphoenolpyruvate-protein
FT                   phosphotransferase HMMPfam:IPR000121; HMMPfam:IPR008279;
FT                   HMMPfam:IPR008731; BlastProDom:IPR000121; Gene3D:IPR008279;
FT                   Gene3D:IPR008731; Gene3D:IPR015813; HMMTigr:IPR006318;
FT                   ScanRegExp:IPR008279; superfamily:IPR008279;
FT                   superfamily:IPR008731"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74149"
FT                   /db_xref="GOA:C4ZB74"
FT                   /db_xref="InterPro:IPR000121"
FT                   /db_xref="InterPro:IPR006318"
FT                   /db_xref="InterPro:IPR008279"
FT                   /db_xref="InterPro:IPR008731"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018274"
FT                   /db_xref="InterPro:IPR024692"
FT                   /db_xref="InterPro:IPR036618"
FT                   /db_xref="InterPro:IPR036637"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZB74"
FT                   /protein_id="ACR74149.1"
FT                   /translation="MYKGIAGSEGIGIGNVVIIEEHEIVIENKKITDTDAEIARLQGAI
FT                   EKFVNDTNAMADRMEKTVGAKDADILRGHIQMLQDPTIEEQITALIVSEKITAEKALDQ
FT                   VLEQTAEIFAQIPDELLQQRATDFRDIKARILKILLGIEDYDISAAPAGTVLVAHDLTP
FT                   SMTAGIVAENIAGILTEVGGRTSHSAILARAMEIPAVLSIDGICTAVKNGDRVVLNGTS
FT                   GEAIVNPDAETEQKFAGLLEEYKKEKELLKKFAGVPTVSADGTKVELVCNIGKPEDAKK
FT                   AVECDGEGIGLFRTEFLFMDRDTIPTEEEQFEAYKSVAETMKGKPVIIRTLDIGGDKEI
FT                   PYLGLEKEDNPFLGYRAIRFCLQRTDIYNTQLRALVRASAFGRIKIMVPLVTCVDELRS
FT                   VKAMVADIMKELDAEGIAYNKNLEIGIMMETPAACMMADVLAKEAAFFSIGTNDLTGYT
FT                   MAVDRGNSKVAYLYSAFNPAVLRAIKRIIECGKKEGIMVGMCGEAAADPKLIPLLLAFG
FT                   LDEFSVSATSVLKTRKTIADSSMAECKALADKVMACATEAEVQAVLAQQ"
FT   gene            325496..326911
FT                   /locus_tag="EUBREC_0359"
FT   CDS_pept        325496..326911
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0359"
FT                   /product="ATPase"
FT                   /note="Cytoplasmic, score:8.87; COG1672 Predicted ATPase
FT                   (AAA+ superfamily); KEGG:0ATPase; HMMPfam:IPR004256;
FT                   HMMPfam:IPR011579; ScanRegExp:IPR000223"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74150"
FT                   /db_xref="GOA:C4ZB75"
FT                   /db_xref="InterPro:IPR004256"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR011579"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZB75"
FT                   /protein_id="ACR74150.1"
FT                   /translation="MFIGREKELATLNGLYNSDKFEFAVIYGRRRVGKTALISHFIQDK
FT                   KAIYFMGVESNEKQNLENFSQAIMEYASGIMPGTSFVSFQAAIEYVFKLCENERLVLVI
FT                   DEYPYVAKASKSMASTLQMLIDKNKDNSKMMLILCGSSMSYMEDNVLAYKAPLYGRRTA
FT                   QMKILPFDFEDSCKYFNGFSAEDMALIYGIVGGTPQYLLQMNDSMSVEDNIKNVFLNPA
FT                   SAIFEEPENLLKQEVREPAVYNAIITAVATGSSRMSEIATKIGETTSVCSQYMKNLINL
FT                   GLIRKETPYGEKESRKSIYAIADNMFRFWYRFIPDNNSIISRGATELAYKRIAPNLSDY
FT                   MGRIFEEICMQYMWKLLLDGESPVEFSNLGRWWGTDPQERIQTEIDIMGDQDKSTVLFG
FT                   ECKWINENVDVKVLEKLKKRSRLFRYENVHLFLFAKKGFTQGCIEEAGKMGNVSLVTYD
FT                   QIYRYLNNIDLSQ"
FT   gene            326989..327294
FT                   /locus_tag="EUBREC_0360"
FT   CDS_pept        326989..327294
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0360"
FT                   /product="Hypothetical protein"
FT                   /note="Unknown cell location"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74151"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZB76"
FT                   /protein_id="ACR74151.1"
FT                   /translation="MLYYSESGGSTYSLSVGVAYGIGSVSLGIPLGKITTGTFGAAVKA
FT                   TGKGYYKLALNKQVKPTVMLIQYRTKQNGKWSSWGKASVYSKSYETVRIKPTLIKQ"
FT   gene            327309..327710
FT                   /locus_tag="EUBREC_0361"
FT   CDS_pept        327309..327710
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0361"
FT                   /product="Hypothetical protein"
FT                   /note="Unknown cell location"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74152"
FT                   /db_xref="GOA:C4ZB77"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZB77"
FT                   /protein_id="ACR74152.1"
FT                   /translation="MRKRVITYVVFAVCICAMSVLITYSIMQQKNNVTVGLYYGTFDFS
FT                   KYQNVDSTKKLAIIHDNDEKQGEYEMEIEHTDKVETGTWSWNDDGYITLYQDNDAIANL
FT                   VYVDGKYLFSDADIEIQKLKRISETAIVK"
FT   gene            327867..328283
FT                   /locus_tag="EUBREC_0362"
FT   CDS_pept        327867..328283
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0362"
FT                   /product="Hypothetical protein"
FT                   /note="Unknown cell location"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74153"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZB78"
FT                   /protein_id="ACR74153.1"
FT                   /translation="MKKFRFILVLAMAVVISGGVISTSRVVNAATDINFGSRTVDAGCA
FT                   RRWFPKGQTGYTLTNGQNQTISVTVSTRGNNIGIGFMKYSTKTNYSYYSGVLSGTSVTK
FT                   KKALSGATASYQPYVENYNDTVQLRINSGYAKMQ"
FT   gene            328364..329689
FT                   /locus_tag="EUBREC_0363"
FT   CDS_pept        328364..329689
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0363"
FT                   /product="Hypothetical protein"
FT                   /note="CytoplasmicMembrane, score:9.39; COG0577 ABC-type
FT                   antimicrobial peptide transport system, permease component;
FT                   HMMPfam:IPR003838"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74154"
FT                   /db_xref="GOA:C4ZB79"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZB79"
FT                   /protein_id="ACR74154.1"
FT                   /translation="MIETALIYIKRNKIKSLIIILIIATIILGEIIGLLLNNASEKSER
FT                   DAYLYNGAALVIEDDNGGFTKSDYDEIRKVKYVTGLGAWRELIADPVDTENVKEHKGID
FT                   PENKDVRNRADKMVIVANMDVQQYSLFSWEKNVSLIEGEFPTYENKGIIVEQRYAKKNN
FT                   LKVGDEVKYTIGDQSEATSLQICGIYKVDSDFEIYDSNEEGTSVYIHSPYNSIYVDYDY
FT                   IVELLGLEYTASTGSEVYIDKIEHIDAVKKQLKKMYGDNVEIYDNTSNYLDSECKVVGL
FT                   MGKTSKIICWMIIIMGEIILLIVFSFYTIQYQKDTGLFMVLGRSRKWCIGRFAFIGMIY
FT                   AISGLLLGALLYCVLGDLICSIISGIGKNVIINSTDRAIGGYDIPGIFQGFEVRIEMSA
FT                   FFTLKNIIILLIISLVNWIAFMVLPVVTTVEENAKKLLNSKG"
FT   gene            329689..330360
FT                   /locus_tag="EUBREC_0364"
FT   CDS_pept        329689..330360
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0364"
FT                   /product="ABC transporter ATP-binding protein-Pep export"
FT                   /note="CytoplasmicMembrane, score:9.49; COG1136 ABC-type
FT                   antimicrobial peptide transport system, ATPase component;
FT                   KEGG:0ABC transporter ATP-binding protein - Pep export;
FT                   HMMPfam:IPR003439; BlastProDom:IPR003439;
FT                   HMMSmart:IPR003593; ScanRegExp:IPR003439"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74155"
FT                   /db_xref="GOA:C4ZB80"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZB80"
FT                   /protein_id="ACR74155.1"
FT                   /translation="MVNMLEMINVSYAYKSKKEIVHVLDKVTYRFEIGEMYGIFGPSGS
FT                   GKTTCLSLLAGLEKPDEGEILLDGENIQNIGGRKLRQNSISLVFQDYQLFDYMTSLENV
FT                   MVAAQISLPDVPKKELIKMCRDSLVMVGLDDSQITRKVTELSGGQQQRVAIARALITDA
FT                   KYILADEPTGNLDKENRRKIVELLQQIAHEQDRCVIVVTHSDYVKKKCDICYDMGDDDE
FT                   E"
FT   gene            330332..331618
FT                   /locus_tag="EUBREC_0365"
FT   CDS_pept        330332..331618
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0365"
FT                   /product="transmembrane protein Vexp3"
FT                   /note="CytoplasmicMembrane, score:9.99; COG0577 ABC-type
FT                   antimicrobial peptide transport system, permease component;
FT                   KEGG:0transmembrane protein Vexp3; HMMPfam:IPR003838"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74156"
FT                   /db_xref="GOA:C4ZB81"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZB81"
FT                   /protein_id="ACR74156.1"
FT                   /translation="MIWEMTMRNKWWQACKELLGRPGRNILIAICIFVLTLFCGIATFL
FT                   DSAIESFYKSFADMAGCCVLVESDDFSTLDDWKDILEYADNNKNVVGYNNAFTSDIICE
FT                   AADFENVPYTEKQSDFEKNKIYVSGNINTSYNEYFSSGIFKISKGKYPMSGDKGAMISD
FT                   KLASENNLSIGSNVSIQYENNTISIKVIGIYTAINTPKTQVSDGYYKEVANSIVFTDYN
FT                   SYVELNNEASCYGINFFSSDYKSTSLLYDDMSKMFQNVPNSAVVNQVLNEELQMTDVIS
FT                   MLKSMTSVTLSVMYIVCVVVMSLLTVLWLKGHSKMIAIYNTLGQRKFKTIQILLYEILM
FT                   ITVPALVGAGILTLGLLNRFSVNIFKYFVEFCEISNFQKSFSLDIWNFEMNIWQFVYRI
FT                   GLLEISVILITMIGSCIYANKGLRTLRNN"
FT   gene            331682..332377
FT                   /locus_tag="EUBREC_0366"
FT   CDS_pept        331682..332377
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0366"
FT                   /product="hypothetical protein"
FT                   /note="Cytoplasmic, score:9.98; COG0745 Response regulators
FT                   consisting of a CheY-like receiver domain and a
FT                   winged-helix DNA-binding domain; KEGG:K02483 hypothetical
FT                   protein; HMMPfam:IPR001789; HMMPfam:IPR001867;
FT                   BlastProDom:IPR001789; BlastProDom:IPR001867;
FT                   HMMSmart:IPR001789; superfamily:IPR011006"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74157"
FT                   /db_xref="GOA:C4ZB82"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZB82"
FT                   /protein_id="ACR74157.1"
FT                   /translation="MDKILVVEDDKTVYSGIKKLLELQHYSVVIAQNGMEALEKIDESF
FT                   SLVIMDIMMPQLDGIETCRRMRERHSVPILFLSAKSEELDKLEGLEVGGDDYMTKPFSN
FT                   MELISKVKALIRRYLVYDSGSANRTNKDETIETDGLKLFTNRNKVEFNDNEIKLTGKEY
FT                   EILKLLMKNPDRIYTIEMIYEMVWDEAFTYNAKNTVMVHIKNLRNKLIKACGDACIHTE
FT                   WGRGYRFER"
FT   gene            332328..333563
FT                   /locus_tag="EUBREC_0367"
FT   CDS_pept        332328..333563
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0367"
FT                   /product="hypothetical protein"
FT                   /note="Cytoplasmic, score:8.87; COG0642 Signal transduction
FT                   histidine kinase; KEGG:K02484 hypothetical protein
FT                   HMMPfam:IPR003594; HMMPfam:IPR003661; HMMSmart:IPR003661;
FT                   superfamily:IPR003594; superfamily:IPR009082"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74158"
FT                   /db_xref="GOA:C4ZB83"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR032834"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZB83"
FT                   /protein_id="ACR74158.1"
FT                   /translation="MHVYTQNGEEDTVLRDDLKRVKQKLSLTFAIAIIGTCVVFGLLYY
FT                   LGIDLLSYYIEAGSCMIYYNEKPYIDEFQQYVSDNDISTTDVEQYDEWMSEHDVAFYSV
FT                   QEMGKVIYNKSNVDKLISPAKNMYDYRFTGSYELPVQFSDIEAEVFIYTGFTEKYYIAF
FT                   MIFDVGFSLMLGIVFVYLRIRKIIAGYQTELEASQEQEKKARQEKDELMRNMAHDLRTP
FT                   LTGVMTYVDVMKLENEAYAENMKNLNFISEKVLDIRTQVDNLLDFSIAGSQRPVELDAS
FT                   MDVEYIFGDYLSDVCAQLMKSNYEVDAEGISFKQVKVAVNMAFLTRIFSNLTDNIYKYA
FT                   DNKKPVVMKTAFTKKTFSVEIGNGVCDNKTLLKSAGIGLKSVDAMMQRMNGSMSFKREH
FT                   GKFWVKLEFPIV"
FT   gene            333609..334067
FT                   /locus_tag="EUBREC_0368"
FT   CDS_pept        333609..334067
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0368"
FT                   /product="Hypothetical protein"
FT                   /note="Cytoplasmic, score:8.87"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74159"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZB84"
FT                   /protein_id="ACR74159.1"
FT                   /translation="MEVFMSRNIENHDSVLLLQDCIAGCKMALESMDDIREHTDDKQLR
FT                   ELIDKYYDEHTGLSVDCRDMLDKAGADIKEPGVFAKMAAKLQTAMKMAVNDDQSQAAKL
FT                   LTEGCNMGIETISGSLNEYRDADSKSVAIAERLRTLEEKMVGDLQPLL"
FT   gene            complement(334114..335433)
FT                   /locus_tag="EUBREC_0369"
FT   CDS_pept        complement(334114..335433)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0369"
FT                   /product="Hypothetical protein"
FT                   /note="Extracellular, score:9.55; COG1345 Flagellar capping
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74160"
FT                   /db_xref="GOA:C4ZB85"
FT                   /db_xref="InterPro:IPR010809"
FT                   /db_xref="InterPro:IPR040026"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZB85"
FT                   /protein_id="ACR74160.1"
FT                   /translation="MKGGVFMAKIDSAYAYYASTYANKEVSRYDSHKKSDLRKIYNRII
FT                   KTNKESPLYKISNMSEAKKYAIDIKESSKAILNAVDSLSDKYAGSSDSFQKKVAESSNE
FT                   DAVGVRYVGDGSENKGADGFDIEVRQLAAPQVNTGSYLDSKALSFIPGSYSFDINTNAS
FT                   SYEFQFGVSTGETNGEVQDKLKRLINASGLGIEADIVHDDSGKAALQLTSMQTGLSETE
FT                   DSLFSVAPSANAESISMMKQLGIDKVSSPAHNSDFSLNGTAHSSLSNTFTINNTFELTL
FT                   KKPTTDTGAAAIGFKANSDAVADNVQTLVDAYNKMIDVADDYSVNDSADATRLLRDISS
FT                   ITKGSQSKLSYIGLMTDDDGKLTIDRDILAGALSPDRADDTFNTLTALKDAIGDKANSV
FT                   TVNPMNYVQKVVVAYKNPGHNFNTPYISSIYSGMMLDSYA"
FT   gene            335609..335737
FT                   /locus_tag="EUBREC_0370"
FT   CDS_pept        335609..335737
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0370"
FT                   /product="Hypothetical protein"
FT                   /note="Extracellular, score:8.82"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74161"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZB86"
FT                   /protein_id="ACR74161.1"
FT                   /translation="MKNSDKCTIFSYVSVRFIKINCCRTYKKVQTAALFKRICNKF"
FT   gene            335858..336007
FT                   /locus_tag="EUBREC_0371"
FT   CDS_pept        335858..336007
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0371"
FT                   /product="Hypothetical protein"
FT                   /note="Extracellular, score:8.82; COG0267 Ribosomal protein
FT                   L33; HMMPfam:IPR001705; BlastProDom:IPR001705;
FT                   HMMTigr:IPR001705"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74162"
FT                   /db_xref="GOA:C4ZB87"
FT                   /db_xref="InterPro:IPR001705"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="InterPro:IPR038584"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZB87"
FT                   /protein_id="ACR74162.1"
FT                   /translation="MRTKITLACTECQRRNYNMTKDKKTHPDRMETKKYCRFCRTHTMH
FT                   KETK"
FT   gene            336035..336250
FT                   /locus_tag="EUBREC_0372"
FT   CDS_pept        336035..336250
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0372"
FT                   /product="Hypothetical protein"
FT                   /note="Unknown cell location; HMMPfam:IPR001901;
FT                   HMMTigr:IPR005807"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74163"
FT                   /db_xref="GOA:C4ZB88"
FT                   /db_xref="InterPro:IPR001901"
FT                   /db_xref="InterPro:IPR005807"
FT                   /db_xref="InterPro:IPR038379"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZB88"
FT                   /protein_id="ACR74163.1"
FT                   /translation="MGQNEKVEKAPKTSWFSGLKAEFQKIIWPEKQSVIRQTIAVLAVS
FT                   VVTGLIIALLDWGIQQGVDFLIGLHF"
FT   gene            336269..336787
FT                   /locus_tag="EUBREC_0373"
FT   CDS_pept        336269..336787
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0373"
FT                   /product="transcription antitermination protein NusG"
FT                   /note="Unknown cell location; COG0250 Transcription
FT                   antiterminator; KEGG:K02601 transcription antitermination
FT                   protein NusG; HMMPfam:IPR006645; BlastProDom:IPR003257;
FT                   HMMSmart:IPR006645; HMMTigr:IPR001062;
FT                   ScanRegExp:IPR015869; superfamily:IPR008991"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74164"
FT                   /db_xref="GOA:C4ZB89"
FT                   /db_xref="InterPro:IPR001062"
FT                   /db_xref="InterPro:IPR006645"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR015869"
FT                   /db_xref="InterPro:IPR036735"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZB89"
FT                   /protein_id="ACR74164.1"
FT                   /translation="MTEANWYVVHTYSGYENKVKANIDKTIENRHLEDQILEVRVPLED
FT                   VTEVKNGVRKQVSKKMFPGYVLIHMIMNDDTWYVVRNTRGVTGFVGPGSKPVPLTEAEM
FT                   RPLGIKTENVVVDFAEGDMIVVIGGVWKDTVGVITAMNYHKQTVTINVELFGRETPVEV
FT                   SFADVKKTN"
FT   gene            336802..337227
FT                   /locus_tag="EUBREC_0374"
FT   CDS_pept        336802..337227
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0374"
FT                   /product="ribosomal protein L11"
FT                   /note="Unknown cell location; COG0080 Ribosomal protein
FT                   L11; KEGG:K02867 ribosomal protein L11; HMMPfam:IPR000911;
FT                   BlastProDom:IPR000911; Gene3D:IPR000911;
FT                   HMMPanther:IPR000911; HMMPanther:IPR006519;
FT                   HMMSmart:IPR000911; HMMTigr:IPR006519;
FT                   superfamily:IPR000911"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74165"
FT                   /db_xref="GOA:C4ZB90"
FT                   /db_xref="InterPro:IPR000911"
FT                   /db_xref="InterPro:IPR006519"
FT                   /db_xref="InterPro:IPR020783"
FT                   /db_xref="InterPro:IPR020784"
FT                   /db_xref="InterPro:IPR036769"
FT                   /db_xref="InterPro:IPR036796"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4ZB90"
FT                   /protein_id="ACR74165.1"
FT                   /translation="MAKKVEGYIKLQIPAGKATPAPPVGPALGQHGVNIVEFTKQFNAK
FT                   TADQGDLIIPVVITVYADRSFSFITKTPPAPVLIKKACKIQSGSGEPNKKKVAKITKAQ
FT                   VQEIAELKMPDLNAASLESAMSMIAGTARSMGVEVTE"
FT   gene            337407..338150
FT                   /locus_tag="EUBREC_0375"
FT   CDS_pept        337407..338150
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0375"
FT                   /product="50S ribosomal protein L1"
FT                   /note="Unknown cell location; COG0081 Ribosomal protein L1;
FT                   KEGG:K02863 50S ribosomal protein L1; HMMPfam:IPR002143;
FT                   BlastProDom:IPR002143; HMMPanther:IPR005878;
FT                   HMMTigr:IPR005878; ScanRegExp:IPR002143"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74166"
FT                   /db_xref="GOA:C4ZB91"
FT                   /db_xref="InterPro:IPR002143"
FT                   /db_xref="InterPro:IPR005878"
FT                   /db_xref="InterPro:IPR016095"
FT                   /db_xref="InterPro:IPR023673"
FT                   /db_xref="InterPro:IPR023674"
FT                   /db_xref="InterPro:IPR028364"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZB91"
FT                   /protein_id="ACR74166.1"
FT                   /translation="MWEGPLPILPPGGYFFMKRGKKYQDAVKAFDKKEQYDVADAISIV
FT                   KKNATAKFDETIELHLRTGCDGRHAEQQIRGAVVLPHGTGKTVKVLVFAKGTKVDEAQA
FT                   AGADFVGGEELIPKIQNEGWLDFDVVVATPDMMGVVGRLGRVLGPKGLMPNPKAGTVTM
FT                   DVTKAVNDIKAGKIEYRLDKTNIIHVPVGKASFTDEQLNDNFQSLMGAINKAKPASLKG
FT                   QYIKSATLTSTMGPGVKLNVVKITQ"
FT   gene            338441..338992
FT                   /locus_tag="EUBREC_0376"
FT   CDS_pept        338441..338992
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0376"
FT                   /product="50S ribosomal protein L10"
FT                   /note="Cytoplasmic, score:8.87; COG0244 Ribosomal protein
FT                   L10; KEGG:K02864 50S ribosomal protein L10;
FT                   HMMPfam:IPR001790; ScanRegExp:IPR002363"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74167"
FT                   /db_xref="GOA:C4ZB92"
FT                   /db_xref="InterPro:IPR001790"
FT                   /db_xref="InterPro:IPR002363"
FT                   /db_xref="InterPro:IPR022973"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZB92"
FT                   /protein_id="ACR74167.1"
FT                   /translation="MAKVELKQPIVDEISGVINGAQSVVVVDYLGLTVAEDTQLRKQLR
FT                   EAGVTYKVYKNTLVNRAIQGTEFEGLKDVLEGPSAFAVSTEDATAPARILAKFAKTAPA
FT                   LEIKAGVVEGTFYDAEGMKAIAAVPSRDELLGKLLGSIQSPITNLARVLNQIAEQGGAA
FT                   DAAVEAAPAEDAAEEAPAAE"
FT   gene            339038..339427
FT                   /locus_tag="EUBREC_0377"
FT   CDS_pept        339038..339427
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0377"
FT                   /product="50S ribosomal protein L7/L12"
FT                   /note="Cytoplasmic, score:8.87; COG0222 Ribosomal protein
FT                   L7/L12; KEGG:K02935 50S ribosomal protein L7/L12;
FT                   HMMPfam:IPR013823; BlastProDom:IPR013823; Gene3D:IPR014719;
FT                   HMMTigr:IPR000206; superfamily:IPR008932"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74168"
FT                   /db_xref="GOA:C4ZB93"
FT                   /db_xref="InterPro:IPR000206"
FT                   /db_xref="InterPro:IPR008932"
FT                   /db_xref="InterPro:IPR013823"
FT                   /db_xref="InterPro:IPR014719"
FT                   /db_xref="InterPro:IPR036235"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZB93"
FT                   /protein_id="ACR74168.1"
FT                   /translation="MEEIIMAKLTTAEFIDAIKELSVLELNDLVKACEEEFGVSAAAGV
FT                   VVAAAGADGAAAEEKTEFDVELTEVGPNKVKVIKVVREITGLGLKEAKDAVDGAPKVIK
FT                   EQLDKASAEDAKAKLEAEGAKVTLK"
FT   gene            339841..343782
FT                   /locus_tag="EUBREC_0378"
FT   CDS_pept        339841..343782
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0378"
FT                   /product="DNA-directed RNA polymerase subunit beta"
FT                   /note="Cytoplasmic, score:9.98; COG0085 DNA-directed RNA
FT                   polymerase, beta subunit/140 kD subunit; KEGG:K03043
FT                   DNA-directed RNA polymerase subunit beta HMMPfam:IPR007120;
FT                   HMMPfam:IPR007641; HMMPfam:IPR007642; HMMPfam:IPR007644;
FT                   HMMPfam:IPR007645; HMMPanther:IPR015712; HMMTigr:IPR010243;
FT                   ScanRegExp:IPR007121; superfamily:IPR011055"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74169"
FT                   /db_xref="GOA:C4ZB94"
FT                   /db_xref="InterPro:IPR007120"
FT                   /db_xref="InterPro:IPR007121"
FT                   /db_xref="InterPro:IPR007641"
FT                   /db_xref="InterPro:IPR007642"
FT                   /db_xref="InterPro:IPR007644"
FT                   /db_xref="InterPro:IPR007645"
FT                   /db_xref="InterPro:IPR010243"
FT                   /db_xref="InterPro:IPR014724"
FT                   /db_xref="InterPro:IPR015712"
FT                   /db_xref="InterPro:IPR019462"
FT                   /db_xref="InterPro:IPR037033"
FT                   /db_xref="InterPro:IPR037034"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZB94"
FT                   /protein_id="ACR74169.1"
FT                   /translation="MEKNRIRPVTSGKSMRMSYSRQKEVLQMPNLIEVQKDSYQWFLDE
FT                   GLKEAFADISPITDYSGKLSLDFVDFTLCEDDVKYTIPECKERDATYAAPLKVKVRLHN
FT                   KETDEINEHEIFMGDLPLMTETGTFVINGAERVIVSQLVRSPGIYYGIAHDKLGKTLYS
FT                   CTVIPNRGAWLEYETDSNDVFYVRVDRTRKVPITVLLRALGVGTNQAILDMFGDEPKIQ
FT                   ASFSKDPAITEREPQGSYEAGLLELYKKIRPGEPLSVESAESLITAMFFDPRRYDLAKV
FT                   GRYKFNKKLALKNRISGQVLAEDVVDPSTGEVIAEAGTVVDRALATQIQNAAVPALWIQ
FT                   TETRNVKILSSMMVDIRSWIPELEDPKSIGVTELVYYPVLAQILEEYDSLEDRIEAIKR
FT                   DISDLIPKHITKEDIFATINYNMHLEWGAGTDDDIDHLGNRRIRAVGELLQNQYRIGLS
FT                   RLERVVRERMTTQDLEGISPQSLINIKPVTAAVKEFFGSSQLSQFMDQNNPLGELTHKR
FT                   RLSALGPGGLSRDRAGFEVRDVHYTHYGRMCPVETPEGPNIGLINSLACYARINEYGFV
FT                   EAPYRKIDKTDPKNPVVTEEVVYMTADEEDNYHVAQANEKLDAEGHFVRNSVSGRYREE
FT                   TQEYDKSAFDYMDVSPKMVFSVATALIPFLQNDDPTRALMGSNMQRQAVPLLTTEAPVV
FT                   GTGIETKAAVDSGVCVVAKADGEVLSSESNRIIIKETDGNKREYILTKFSRSNQSNCYN
FT                   QRPIVFKGDKVKAGDVIADGPSTSQGELALGKNPLIGFMTWEGYNYEDAVLLSERLVEY
FT                   DVYTSVHIEEYEVESRDTKLGPEEITRDVPGVGDDALKDLDERGIIRVGAEVRAGDILV
FT                   GKVTPKGETELTAEERLLRAIFGEKAREVRDTSLKVPHGAYGIIVDAKVFTRENGDELS
FT                   PGVNQSVRIYIAQKRKISVGDKMAGRHGNKGVVSRVLPVEDMPFLPNGRPLDIVLNPLG
FT                   VPSRMNIGQVLEIHLSLAAKALGFNISTPVFDGANEVDIEDTLELANDYVNLPFDKEEL
FT                   EKDLQAEHPYWSADAEIFYDKYVDTLREDVMEYLSTNRAHRSLWKGVPISKDGKVQLRD
FT                   GRTGECFDGKTTIGHMHYLKLHHLVDDKIHARSTGPYSLVTQQPLGGKAQFGGQRFGEM
FT                   EVWALEAYGAAYTLQEILTMKSDDVVGRVKTYEAIIKGENIPEPGIPESFKVLLKELQA
FT                   LGLDVKVLDENREEVELIETSEYGNTDINSIIGNDKDYAFEDSESFAEHGFSKKEFDDN
FT                   EELVDIEEEESPETADDDIFADEVLDDEE"
FT   gene            343801..347649
FT                   /locus_tag="EUBREC_0379"
FT   CDS_pept        343801..347649
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0379"
FT                   /product="DNA-directed RNA polymerase subunit beta"
FT                   /note="Cytoplasmic, score:9.98; COG0086 DNA-directed RNA
FT                   polymerase, beta subunit/160 kD subunit; KEGG:K03046
FT                   DNA-directed RNA polymerase subunit beta HMMPfam:IPR000722;
FT                   HMMPfam:IPR007066; HMMPfam:IPR007080; HMMPfam:IPR007081;
FT                   HMMPfam:IPR007083; Gene3D:IPR000722; Gene3D:IPR007080;
FT                   HMMSmart:IPR006592; HMMTigr:IPR012754;
FT                   ScanRegExp:IPR001865"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74170"
FT                   /db_xref="GOA:C4ZB95"
FT                   /db_xref="InterPro:IPR000722"
FT                   /db_xref="InterPro:IPR006592"
FT                   /db_xref="InterPro:IPR007066"
FT                   /db_xref="InterPro:IPR007080"
FT                   /db_xref="InterPro:IPR007081"
FT                   /db_xref="InterPro:IPR007083"
FT                   /db_xref="InterPro:IPR012754"
FT                   /db_xref="InterPro:IPR038120"
FT                   /db_xref="InterPro:IPR042102"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZB95"
FT                   /protein_id="ACR74170.1"
FT                   /translation="MPETNNIENNQAMQFDAIQIGLASPEKIREWSHGEVKKPETINYR
FT                   TLKPEKDGLFCEKIFGPTKDWECHCGKYKKIRYKGVVCDRCGVEITKSSVRRERMGHIE
FT                   LAAPVSHIWYFKGIPSRMGLILDLSPRVLERVLYFASYIVLDPGETKLAYKQILNESEY
FT                   QEACDTYGRSAFRVGMGAESIRELLAAIDLEKDSAELKAELENATGQKRARIIKRLEVV
FT                   EAFRESGNKPEWMIMTVIPVIPPDLRPMVQLDGGRFATSDLNDLYRRIINRNNRLRRLL
FT                   DLGAPDIIVRNEKRMLQEAVDALIDNGRRGRPVTGPGNRALKSLSDMLKGKGGRFRQNL
FT                   LGKRVDYSGRSVICVEPKLKIYQCGLPKEMAIELFKPFVMKELAANGTAHNIKSAKKMV
FT                   ERLQPEVWDVLEDVIKEHPVMLNRAPTLHRLGIQAFEPILVEGKAIKLHPLVCTAFNAD
FT                   FDGDQMAVHLPLTAEAQAECRFMLLSPNNLLKPSDGGLVAVPSQDMILGVYYLTMRKLA
FT                   DYKDDPKMVAQVSSDTVYNDVDELRKLTTPDENTGKAELGLYDLIWFEDVTDGNRRVLC
FT                   RPIDLLGRYYGSVNLAMLAYENKEITLHQNIFVHRTVKLADGTEVSGFTETTVGLLIFN
FT                   ENIPQDLGFIDRSKAENALKFEVEFHVGKKQIKQILEKVINTHGATTTAEVLDNVKAMG
FT                   YKYSTQAAMTVSISDMTVPPQKPQMIADAQDTVDKITRQYKRGLITDEERYKEVIETWK
FT                   DTDDALTKALLTGLDKYNNIFMMADSGARGSDKQIKQLAGMRGLMADTTGRTIELPIKS
FT                   CFREGLDVLEYFMSAHGARKGLSDTALRTADSGYLTRRLVDVSQHMIVRETDCCAGTGR
FT                   EIPGMVVKAFMEGREEIESLQERITGRFSCNTICDKDGNVIVKANHMITPKRAAKVMAE
FT                   GVDENGNPITQVKIRTVLTCRSHMGVCAKCYGSNLATGQAVQVGEAIGIIAAQSIGEPG
FT                   TQLTMRTFHTGGVAGGDITQGLPRVEEIFEARKPKGLAIITEFGGTATIKDTKKKREVI
FT                   VTNNETGETKAYLIPYGSRIKVVDGQELEAGDELTEGSVNPHDILKIKGVRAVQDYMLR
FT                   EVQRVYRLQGVEINDKHVEVIVRQCLQKIRVEEPGDSDLLPGSMVDALDFLELNEKLEE
FT                   EGKELAVGSQVLLGITKASLATNSFLSAASFQETTKVLTEAAIKGKVDPLIGMKENVII
FT                   GKLIPAGTGMKIYRNIKLDSDVNDDDTLDFDDDDFADFAEEEAVGVIDTDAESVDEE"
FT   gene            347792..348256
FT                   /locus_tag="EUBREC_0380"
FT   CDS_pept        347792..348256
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0380"
FT                   /product="30S ribosomal protein S12"
FT                   /note="Unknown cell location; COG0048 Ribosomal protein
FT                   S12; KEGG:K02950 30S ribosomal protein S12;
FT                   HMMPfam:IPR006032; Gene3D:IPR012340; HMMPanther:IPR005679;
FT                   HMMPanther:IPR006032; HMMTigr:IPR005679;
FT                   ScanRegExp:IPR006032"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74171"
FT                   /db_xref="GOA:C4ZB96"
FT                   /db_xref="InterPro:IPR005679"
FT                   /db_xref="InterPro:IPR006032"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZB96"
FT                   /protein_id="ACR74171.1"
FT                   /translation="MHKIALLKIKQEVKIMPTFNQLVRKGRQTSVKKSTAPALQRSFNS
FT                   LQKKPINTSSPQKRGVCTAVKTATPKKPNSALRKIARVRLSNGIEVTSYIPGEGHNLQE
FT                   HSVVLIRGGRVKDLPGTRYHIIRGTLDTAGVANRKQARSKYGAKRPKAAK"
FT   gene            348407..348898
FT                   /locus_tag="EUBREC_0381"
FT   CDS_pept        348407..348898
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0381"
FT                   /product="ribosomal protein S7"
FT                   /note="Cytoplasmic, score:8.87; COG0049 Ribosomal protein
FT                   S7; KEGG:K02992 ribosomal protein S7; HMMPfam:IPR000235;
FT                   BlastProDom:IPR000235; Gene3D:IPR000235;
FT                   HMMPanther:IPR000235; HMMTigr:IPR005717;
FT                   ScanRegExp:IPR000235; superfamily:IPR000235"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74172"
FT                   /db_xref="GOA:C4ZB97"
FT                   /db_xref="InterPro:IPR000235"
FT                   /db_xref="InterPro:IPR005717"
FT                   /db_xref="InterPro:IPR020606"
FT                   /db_xref="InterPro:IPR023798"
FT                   /db_xref="InterPro:IPR036823"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZB97"
FT                   /protein_id="ACR74172.1"
FT                   /translation="MIKEGSNVPRKGHTQKRDVLADPMYNSKVVTKLVNSIMLDGKKGV
FT                   AQKIVYGAFATVEEKTGRPALEVFEEAMNNVMPALEVKARRIGGATYQVPIEVRPDRRQ
FT                   ALGLRWLTAFSRARGEKTQAERLANEIMDAANNTGASVKRKEDMHKMAEANKAFAHYRF
FT                   "
FT   gene            349050..351119
FT                   /locus_tag="EUBREC_0382"
FT   CDS_pept        349050..351119
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0382"
FT                   /product="translation elongation factor G"
FT                   /note="Cytoplasmic, score:9.98; COG0480 Translation
FT                   elongation factors (GTPases); KEGG:K02355 translation
FT                   elongation factor G HMMPfam:IPR000640; HMMPfam:IPR000795;
FT                   HMMPfam:IPR004161; HMMPfam:IPR005517; Gene3D:IPR000640;
FT                   Gene3D:IPR014721; HMMTigr:IPR004540; HMMTigr:IPR005225;
FT                   ScanRegExp:IPR000795; superfamily:IPR009000;
FT                   superfamily:IPR009022"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74173"
FT                   /db_xref="GOA:C4ZB98"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004540"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005517"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009022"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035649"
FT                   /db_xref="InterPro:IPR041095"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZB98"
FT                   /protein_id="ACR74173.1"
FT                   /translation="MAHIDAGKTTLTERILYYTGINYKIGDTHEGTATMDWMEQEQERG
FT                   ITITSAATTCHWTLEEFTKPKPGALEHRINIIDTPGHVDFTVEVERSLRVLDGAVGVFC
FT                   AKGGVEPQSENVWRQADTYNVPRMAFINKMDILGANFYGAVDQIRTRLGKNAIVLQLPI
FT                   GKEDDFKGIIDLFEMKAYIYNDEKGDDITVTDDLGDMADQAAEYRTELIEKICELDDDL
FT                   MMQYLEGEEPSVEDMKKVLRKATCECTAVPVCCGSAYRNKGVQKLLDAIVEYMPAPTDI
FT                   PSIKGTDLEGNEIERHSSDDEPFSALAFKIMADPFVGKLAFFRVYSGKCKAGSYVLNAT
FT                   KDKKERIGRILQMHANKRQELDEVYSGDIAAAVGFKFTTTGDTICDEQHPVILESMEFP
FT                   EPVIELAIEPKTKAGQGKLGEALAKLAEEDPTFRAHTDQETGQTIIAGMGELHLEIIVD
FT                   RLLREFKVEANVGAPQVAYKETFTKAVDQEYKYAKQSGGRGQYGHCKVRFEPMDANGEE
FT                   LFKFDSEVVGGAIPKEYIPSIGEGIEEATKAGSLGGFPVVGIHATVYDGSYHEVDSSEM
FT                   AFHIAGSMCFKEAMAKAAPVLLEPIMKVEVTMPEEYMGDVIGDVNSRRGRIEGMDDLGG
FT                   GKIVHAYVPLAEMFGYSTDLRSKTQGRGNYSMFFDRYEPVPKNVQDKVLANHAK"
FT   gene            351330..352517
FT                   /locus_tag="EUBREC_0383"
FT   CDS_pept        351330..352517
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0383"
FT                   /product="elongation factor Tu"
FT                   /note="Cytoplasmic, score:9.98; COG0050 GTPases -
FT                   translation elongation factors; KEGG:0elongation factor Tu
FT                   HMMPfam:IPR000795; HMMPfam:IPR004160; HMMPfam:IPR004161;
FT                   HMMPanther:IPR004541; HMMTigr:IPR004541; HMMTigr:IPR005225;
FT                   ScanRegExp:IPR000795; superfamily:IPR009000;
FT                   superfamily:IPR009001"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74174"
FT                   /db_xref="GOA:C4ZB99"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004160"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004541"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR033720"
FT                   /db_xref="InterPro:IPR041709"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4ZB99"
FT                   /protein_id="ACR74174.1"
FT                   /translation="MAKAKFERTKPHCNIGTIGHVDHGKTTLTAAITAVLAARVAGNTA
FT                   TDFANIDKAPEERERGITISTAHVEYETEKRHYAHVDCPGHADYVKNMITGAAQMDGAI
FT                   LVVAATDGVMAQTKEHILLSRQVGVPYIIVFLNKCDMVDDPELIELVEMEVTEQLEEYG
FT                   FNDCPIIQGSALKALEDPNGPWGDKIMELMDTVDSYIPDPQRDTDKPFLMPVEDVFTIT
FT                   GRGTVATGRVERGTLHLNDELEILGVKEDVQKTVVTGIEMFRKQLDEAQAGDNIGALLR
FT                   GINRDQIVRGQVLAKPGTVTCHHKFTAQVYVLTKDEGGRHTPFFNNYRPQFYFRTTDVT
FT                   GVCELPAGTEMCMPGDNVEMTIELIHPVAMEQGLTFAIREGGRTVGSGRVATVIE"
FT   gene            complement(352527..352655)
FT                   /locus_tag="EUBREC_0384"
FT   CDS_pept        complement(352527..352655)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0384"
FT                   /product="Hypothetical protein"
FT                   /note="Extracellular, score:8.82"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74175"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZBA0"
FT                   /protein_id="ACR74175.1"
FT                   /translation="MINDIYLLHIIFRAKLEPFKLYHIFEFIKRLPRKTLEALNLL"
FT   gene            352642..353706
FT                   /locus_tag="EUBREC_0385"
FT   CDS_pept        352642..353706
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0385"
FT                   /product="Hypothetical protein"
FT                   /note="Unknown cell location; NOG11920 non supervised
FT                   orthologous group"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74176"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZBA1"
FT                   /protein_id="ACR74176.1"
FT                   /translation="MSLINSYALWNNKGGVGKSTISFHLSMRYAETHPDAKVLVIDLCP
FT                   QANSSMMLLGGGALGDERVVELCSREIPKSVVGYVSTVITNGRGANLPNPYDFLIHVSD
FT                   YNKGAPDNLYLLCGDGNMEPMAPAINEAASAKALTPNAQPWKWIIEIFKNFILNIADSQ
FT                   DDWMFFVDTNPSFSIYTQMAIAAVERLLTPINADDSSKTAASAMIALLHGTNPPHPIYG
FT                   SWTFAEVAKQRNVKIPQIHLLIGNRLTQFEGPAAAFAALSDATTTALYDIYQKNPSYFV
FT                   SAAEPISTKEQFKNYYSVPLRDFNTVGVVCAHLGRLMSSMKQGYYPVYGVNVKVNMEKI
FT                   QECLKAIDMIIDKL"
FT   gene            complement(353934..354572)
FT                   /locus_tag="EUBREC_0386"
FT   CDS_pept        complement(353934..354572)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0386"
FT                   /product="putative DNA-binding protein, PemK family"
FT                   /note="Unknown cell location; COG2337 Growth inhibitor;
FT                   KEGG:0putative DNA-binding protein, PemK family;
FT                   HMMPfam:IPR003477; Gene3D:IPR011067; superfamily:IPR011067"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74177"
FT                   /db_xref="GOA:C4ZBA2"
FT                   /db_xref="InterPro:IPR003477"
FT                   /db_xref="InterPro:IPR011067"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZBA2"
FT                   /protein_id="ACR74177.1"
FT                   /translation="MNIDLTKTQQYLEWFKNKLYLNAIAPAAKNRIIYRGQVYRCNLGI
FT                   GVGSEECKERPCVILQYNSANRTSPNTVVAPITHTTSALPIVVPIAEKKDSSGKLILDG
FT                   NVLLGNITCVSKARLGDYITDLTADEMRAVDKAIFISLDTNHYYQTLQNMYNDKLQYIE
FT                   KLKSNRSSLQADLATKQQYIDDFEKMLNTYDFSDIQSLEKFLEENRKEK"
FT   gene            complement(354631..355140)
FT                   /locus_tag="EUBREC_0387"
FT   CDS_pept        complement(354631..355140)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0387"
FT                   /product="Hypothetical protein"
FT                   /note="Cytoplasmic, score:8.87; COG1396 Predicted
FT                   transcriptional regulators; HMMPfam:IPR001387;
FT                   HMMSmart:IPR001387; superfamily:IPR010982"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74178"
FT                   /db_xref="GOA:C4ZBA3"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZBA3"
FT                   /protein_id="ACR74178.1"
FT                   /translation="MRLGEYFEIGKRMKQARTNAGINQREMSAKLSLSNSSYSNYENGY
FT                   SEPPVETILKFCDILGITLNDLLDLKIVSNRSFSVKTFADFLAILIDLDRRGLQIKGNT
FT                   TYSQQDNQLTAHLTLDIPNAQIATFIPDWNKTNQELASGKIDKEEYDIWLEDTLKLFNV
FT                   PIDEYL"
FT   gene            355304..355504
FT                   /locus_tag="EUBREC_0388"
FT   CDS_pept        355304..355504
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0388"
FT                   /product="Hypothetical protein"
FT                   /note="Unknown cell location"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74179"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZBA4"
FT                   /protein_id="ACR74179.1"
FT                   /translation="MKKENYLLTAAEVAETLGISKGHAYKLIRELNEELQSKGYLVVAG
FT                   KVPKAFWETKFYGYNQTNQTA"
FT   gene            355501..356592
FT                   /locus_tag="EUBREC_0389"
FT   CDS_pept        355501..356592
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0389"
FT                   /product="phage integrase family protein"
FT                   /note="Cytoplasmic, score:8.87; COG0582 Integrase;
FT                   KEGG:K03733 phage integrase family protein;
FT                   HMMPfam:IPR002104; Gene3D:IPR013762; superfamily:IPR010998;
FT                   superfamily:IPR011010"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74180"
FT                   /db_xref="GOA:C4ZBA5"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR028259"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZBA5"
FT                   /protein_id="ACR74180.1"
FT                   /translation="MKGGYVMSASRDEKTGKWTVQCYYENWKGEKKHKKKRGFATKKEA
FT                   LEWEREFLKSTSANMEMMLGAFVDVYFQDKAGELKERTIKNKQYMIEAHVLPYFANKRM
FT                   NEITPSDIIQWQNEMRAKGYSQTYLRMVQNQITALFTHACNIYNLGNNPCKKVKKMGKA
FT                   DADKLNFWTKAEYDSFIRGIDKESRYFVIFEILFWTGCREGEMLALTKSDIDFENNQIS
FT                   ITKTYYRTERRDIITTPKTEQSIRVIDIPEFLKKEIEAYVNRCYGLPDNERLFPIVAEA
FT                   VQHKLKRECAKSGVKQIRVHDLRHSHVAYLINQGVQPLIIKERLGHRDIKITLNTYGHL
FT                   YPNQQKKVADMLNATRNENAPAD"
FT   gene            356699..357667
FT                   /locus_tag="EUBREC_0390"
FT   CDS_pept        356699..357667
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0390"
FT                   /product="Hypothetical protein"
FT                   /note="Cytoplasmic, score:8.87; NOG19743 non supervised
FT                   orthologous group; HMMSmart:IPR003593"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74181"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZBA6"
FT                   /protein_id="ACR74181.1"
FT                   /translation="MEEKREKNYRLINMEDVQAREVSWLWYPYIPYGKLTIVQGDPGEG
FT                   KTTFILHLAALLTKGEPLPNEEVDVQREPVNVIYQNAEDSLEDTIKPRLLEAGADCNRV
FT                   LVIDESVDCLSMTDERLVRAIRETGAKMVVLDPIQAYLGADVDMHRANEIRPVLKQLGN
FT                   IAEEYGCAIILIGHMNKASSSKSTYRGLGSIDFQATARSVLVVGRIKDDTTLRVIAHDK
FT                   SSLAPEGTSIAFRMDKEKGFTWEGVYDITVEELLSGESRGQKTKDAKSFLAEILAEGQM
FT                   SCNEITEAARERGIKKKTLWNAKKEMSIDSVKVGSQWYWTL"
FT   gene            357793..357933
FT                   /locus_tag="EUBREC_0391"
FT   CDS_pept        357793..357933
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0391"
FT                   /product="Hypothetical protein"
FT                   /note="Unknown cell location"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74182"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZBA7"
FT                   /protein_id="ACR74182.1"
FT                   /translation="MQVCIFVGVADKSAFALLLTKVTKLMCLFGIIMIDKRGGVFIGEN
FT                   D"
FT   gene            357938..359287
FT                   /locus_tag="EUBREC_0392"
FT   CDS_pept        357938..359287
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0392"
FT                   /product="Hypothetical protein"
FT                   /note="Cytoplasmic, score:8.87; KOG4725 Uncharacterized
FT                   conserved protein; HMMPfam:IPR001668"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74183"
FT                   /db_xref="GOA:C4ZBA8"
FT                   /db_xref="InterPro:IPR001668"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZBA8"
FT                   /protein_id="ACR74183.1"
FT                   /translation="MMGKGAINHNTRAFNAKNVDPERSIYNVQFCNTSIKKVYHELFDE
FT                   ALERYNAKQKRSNRKIDNYYEKIRQSKQEKLFHEVILQIGNKDDMNSKSKEGELAKEIL
FT                   IDYMQDFQKRNPNLYVFSAHLHMDEETPHIHIDFVPFIRNSKRGLDTRVSLKGALAEQG
FT                   FKGGTRGATEWNQWMESEKQELSKVMERYDVQWKHLGTHNKHLSVLDFEKQERQKEVAQ
FT                   LEQTLSDNKVELNNILYQQIMAEEKTEQIRKEGEVIRQEVSELSAESDWLKEQTEILSE
FT                   DKEKLLSENENLESQQKKLQREINKMVQSKETMERNIHTYDEDEKWQLPEPGTLMSAKA
FT                   YRDKKALPLVQKLKELVKNLTLKCIQLTEQVKKLTVKVDRQQNQISRLTDKAMEQNDMI
FT                   ERLQEKVSDLGHLERYFGKERVQAIVEQSKTIEQAERAEKRPKRAYDMGR"
FT   gene            359308..359622
FT                   /locus_tag="EUBREC_0393"
FT   CDS_pept        359308..359622
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0393"
FT                   /product="Hypothetical protein"
FT                   /note="Cytoplasmic, score:8.87"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74184"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZBA9"
FT                   /protein_id="ACR74184.1"
FT                   /translation="MTDMEKKVMVRLCAKILTETDLYDTDKEVQNLIDWVLVSEQMKEN
FT                   NNVIRNLTGEYKQIEPDCRARVKEKLERMKELCKERNSLYEKQNDLKGQKWKLEKALER
FT                   "
FT   gene            359744..360691
FT                   /locus_tag="EUBREC_0394"
FT   CDS_pept        359744..360691
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0394"
FT                   /product="adenosine deaminase"
FT                   /note="Cytoplasmic, score:8.87; COG1816 Adenosine
FT                   deaminase; KEGG:K01488 adenosine deaminase
FT                   HMMPfam:IPR001365; HMMPanther:IPR001365"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74185"
FT                   /db_xref="GOA:C4ZBB0"
FT                   /db_xref="InterPro:IPR001365"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZBB0"
FT                   /protein_id="ACR74185.1"
FT                   /translation="MNGFTDALEQRNLEELRKYPKADLHNHFVLGGNRRFIYQETRKKI
FT                   EPLANPLSSMDEMNQWSQKYISQDFNSTAMRKFLIRATFQQAREDGVTVLEIGEDVWGL
FT                   NEFFNNDIDELVNAFTSAQKEIAPDIELRLQIGLSRHCSISYLEDCLSYFWGNKNFYSI
FT                   DLYGDELAQPIENFKGIYRRAKKEGLRLKAHVGEWGTAKDVRTAVEELELDEVQHGIAA
FT                   VSDESVIRFLADNKIRLNITPTSNILLGRVADMSMHPIGKLYRSGVDVTINSDDVLIFD
FT                   SDVSKEYLRLYEFQCLTAEELENIRKNGLKPIII"
FT   gene            complement(360763..360888)
FT                   /locus_tag="EUBREC_0395"
FT   CDS_pept        complement(360763..360888)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0395"
FT                   /product="Hypothetical protein"
FT                   /note="Extracellular, score:8.82"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74186"
FT                   /db_xref="GOA:C4ZBB1"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZBB1"
FT                   /protein_id="ACR74186.1"
FT                   /translation="MFFVDFTAYFYSHSPFFLFIFVITKNFRAKIEPLQKYRFSP"
FT   gene            complement(361223..361546)
FT                   /locus_tag="EUBREC_0396"
FT   CDS_pept        complement(361223..361546)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0396"
FT                   /product="Hypothetical protein"
FT                   /note="Unknown cell location"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74187"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZBB2"
FT                   /protein_id="ACR74187.1"
FT                   /translation="MQIDVNEICSASPFSDTIKEEEIYPTLPDGLNGALDASRVKTYLK
FT                   NSMYPLMYLFGKNSMPDVDNLLTSFYQLDDEARQEVVETIRLKLQYHRDPKRAEQIKQI
FT                   KGW"
FT   gene            361725..361931
FT                   /locus_tag="EUBREC_0397"
FT   CDS_pept        361725..361931
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0397"
FT                   /product="Hypothetical protein"
FT                   /note="Unknown cell location"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74188"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZBB3"
FT                   /protein_id="ACR74188.1"
FT                   /translation="MNSKFGKNNENNLTFENKRCILKINSINGRWIKMFNLEELSLEFV
FT                   EISELKTSKNLFGPVMYGTGVRM"
FT   gene            362013..363023
FT                   /locus_tag="EUBREC_0398"
FT   CDS_pept        362013..363023
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0398"
FT                   /product="pyrroloquinoline quinone biosynthesis protein
FT                   PqqE"
FT                   /note="Cytoplasmic, score:8.87; COG0535 Predicted Fe-S
FT                   oxidoreductases; KEGG:K06139 pyrroloquinoline quinone
FT                   biosynthesis protein PqqE; HMMPfam:IPR007197;
FT                   HMMSmart:IPR006638"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74189"
FT                   /db_xref="GOA:C4ZBB4"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017200"
FT                   /db_xref="InterPro:IPR023885"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZBB4"
FT                   /protein_id="ACR74189.1"
FT                   /translation="MNKLTTAVWEITMGCNMRCKHCGSSCAEALPDELNTSEALEVCDQ
FT                   LKDLGLKVITLSGGEPTTRSDWHIIAKRLVDNGIITSIITNGWLIDENFIHNAITSGIR
FT                   SVCLSIDGLEKTHDFIRRSGSFNKSIKALKELRKNNISTSVITSINKENICELEELYQL
FT                   LIVLADCIGYYSNKDIKVNENFLNDNWSWTGCGAGKHVIGILHNGDIVACTSIRDKTLV
FT                   AGNIREKSLKSIWESPDSFKWNRNFDSSKLKGFCRECRYTERCLGGCSNSRYCINGSFE
FT                   SENRYCAYNVEMKKWKKYLESLNDISEIDNVIEKAAALKHQDLYKIACEIKQSKL"
FT   gene            363020..364300
FT                   /locus_tag="EUBREC_0399"
FT   CDS_pept        363020..364300
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0399"
FT                   /product="Hypothetical protein"
FT                   /note="CytoplasmicMembrane, score:9.99; COG0477 Permeases
FT                   of the major facilitator superfamily; HMMPfam:IPR011701"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74190"
FT                   /db_xref="GOA:C4ZBB5"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR022324"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZBB5"
FT                   /protein_id="ACR74190.1"
FT                   /translation="MIREVTNMNKHELYHNHNYVYLLTSNIINRCGDSLDTILFTWLVY
FT                   LLTNSAGWSAIIFGINQATSVIIQPFIGPLVENMNKKKVLVLSDIARVLLVLYILYVYT
FT                   QNMLSPLILVFMTISISLIEAFHMPAGVAVIQHVLPNEHYDKGVSVNVSCTKIAVLVGT
FT                   GLSGIVISSFGIGISLAIDALIFLISALLIVKIEFSVQEEKKTNRIIGREYLISLRDGF
FT                   SYVFDHKKLLKLCFLCILINSAVVPFDALLAPIAREMFSGDAKIVSLLSVSVTIGTILG
FT                   SLTFAKMKEEKKNNTLVTFCGIVLGVYYVFIAFVSKYIANPITQKLLLLIGSIIIGAAL
FT                   GLMITYVQVKFVKEVTKEYIGRVSAIRFSLTYACAPVVSFVISIIYKVTVVDTSSLFVG
FT                   FGIVIIILFLLANKITFSPLKKGDKSY"
FT   gene            364720..365241
FT                   /locus_tag="EUBREC_0400"
FT   CDS_pept        364720..365241
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0400"
FT                   /product="ribosomal-protein-alanine acetyltransferase"
FT                   /note="Cytoplasmic, score:8.87; COG1670 Acetyltransferases,
FT                   including N-acetylases of ribosomal proteins; KEGG:K00676
FT                   ribosomal-protein-alanine acetyltransferase
FT                   HMMPfam:IPR000182"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74191"
FT                   /db_xref="GOA:C4ZBB6"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZBB6"
FT                   /protein_id="ACR74191.1"
FT                   /translation="MMKIETERLYIRHFVNEDASICFEGWGTDEHLGDFIMGYPMNMDQ
FT                   MNSFVNAMVKNTNAWVIVEKESGACIGYISFDIPYQELRIGEIGYVIGEKWHGKGYGTE
FT                   AVKKMISEYLSKDRLYLIEAKCNIDNKPSLNLLEKVGFIKDGVLRKRRIDKNTGEYRDL
FT                   VVYSITTNDK"
FT   gene            365275..365799
FT                   /locus_tag="EUBREC_0401"
FT   CDS_pept        365275..365799
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0401"
FT                   /product="Hypothetical protein"
FT                   /note="Unknown cell location; NOG23334 non supervised
FT                   orthologous group"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74192"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZBB7"
FT                   /protein_id="ACR74192.1"
FT                   /translation="MKNEFLEALGSNNANNNTDLSLYSRFVGNWSFTMTTYDEEGKIED
FT                   TKEGEWLFSYVMDGYGIQDVFICPKRGEWTEEDTLYGDYGTTIRVPMIDNSKKWNIVYV
FT                   SKWSVDRLIAEELENDIIQTGINKDANDTTIWQWNFKNIEKDTFSWESIYSKDCGKTWK
FT                   YATKVEAKREM"
FT   gene            366056..366358
FT                   /locus_tag="EUBREC_0402"
FT   CDS_pept        366056..366358
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0402"
FT                   /product="Hypothetical protein"
FT                   /note="Unknown cell location; NOG39284 non supervised
FT                   orthologous group; HMMPfam:IPR013097;
FT                   superfamily:IPR011008"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74193"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR013097"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZBB8"
FT                   /protein_id="ACR74193.1"
FT                   /translation="MVKHIILWTLKDEYTEAQKKEIRAGIKEGLEGLKGQIPGMIDISV
FT                   RTDYLPTSTVDVMLDTTFEDADALAAYAKNPKHVAVADTRVRPFTANRACMDFEV"
FT   gene            366500..367843
FT                   /locus_tag="EUBREC_0403"
FT   CDS_pept        366500..367843
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0403"
FT                   /product="methyl-accepting chemotaxis protein (MCP)"
FT                   /note="CytoplasmicMembrane, score:9.49; COG0840
FT                   Methyl-accepting chemotaxis protein; KEGG:K03406
FT                   methyl-accepting chemotaxis protein (MCP);
FT                   HMMPfam:IPR003660; HMMPfam:IPR004089; HMMSmart:IPR003660;
FT                   HMMSmart:IPR004089"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74194"
FT                   /db_xref="GOA:C4ZBB9"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZBB9"
FT                   /protein_id="ACR74194.1"
FT                   /translation="MRKGELHMGEEAKSKIMEMPLQQRLKYGYKKVLDMLLVSGGISIV
FT                   AVLLVYFGAKANIFGAESGTVATFFLVIGLANVIIVGIVATMIAKKISDQVIDSVLEPL
FT                   QQIEVVAGELVNGNLHSNLEYHSDDEVGKLAHDLRKSIRTLGTYIDDIDQTMRQFADGN
FT                   FNFKPQVEWKGDFVGIKESIVAFEESMSDTVSGIQRAANEVSNGAGQVAASSSDLAQGA
FT                   TDQAAVVEELTATLASVADQVAENAEHAKEISQKVDGLGTEIMDSNGQMHEMVTSMNEI
FT                   NEASQEIGKIIATINEIASQTNLLALNASIEAARAGEAGKGFAVVADQVTVLAEQSANA
FT                   AKESAALIESSVKAVEKGMVIAGKTASQLEEVAGNSKTITDEVNGIAETLETQTDAIKQ
FT                   INNGVEQINDVVQTNSASSQECAAASQEMSSEAESLNELIRHLRVAEQ"
FT   gene            367964..369499
FT                   /locus_tag="EUBREC_0404"
FT   CDS_pept        367964..369499
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0404"
FT                   /product="Hypothetical protein"
FT                   /note="Unknown cell location"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74195"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZBC0"
FT                   /protein_id="ACR74195.1"
FT                   /translation="MYMAKNVGICYYMSMTLKDRIPKEFYSLFRTKNMDAYMQIVVALY
FT                   EENNEVYASLGLTREECQIIIADTISKTGIVWQTDYNEDESDKDSGSMDNHDDYNPDSE
FT                   IDVIYDQATFAYTLTPSAILGRLINWGWIRSDFDEKLNTYVIAFPQYSQMYAELFKKLL
FT                   VDDDSRERESILAVYSALFTYFSDPEKNNDILKNALYTSKNLGQLLSNMQDGMRAYFDE
FT                   LSRMKDFIGIQKVLIKEINNSDSRRYAILTTTDSFYRYKEAVKELISKILNQNDDRRAE
FT                   LEGILSQTTPGTFERKRYEYSVEYCDKASELVYKVEHEFDLIERKYNKLIEQKTIFAKR
FT                   ALARIHYILQEGADDEDNIVKLINLIDKSDKTDEILGALRNRMKFTRQFYNVTDDSFPG
FT                   RRERGRSEFVPFVIDDASAGEDDMADFVPKPLYTKKELQSFRDKNMRDGMFVTDEQTVE
FT                   SMEDLEKLLFLWQEETNERMGEDTVSLDGEITKSDGVSYSRLVISKSDSKREA"
FT   gene            369515..370240
FT                   /locus_tag="EUBREC_0405"
FT   CDS_pept        369515..370240
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0405"
FT                   /product="Hypothetical protein"
FT                   /note="Cytoplasmic, score:8.87"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74196"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZBC1"
FT                   /protein_id="ACR74196.1"
FT                   /translation="MFEYMENVSPNEAENIRKTIQDLLRQTCILQMKCDPVTLIQRDNP
FT                   RYQVCLRNREFISDYLAVLDCELVHDQQEHLFRITGDGVMLEKMTLLTARIVIIMKIIY
FT                   RDKIMGEGLNATTTNLAEIREYGRNTNLITRKLTNQEWSDALLLMKTHQMIELPGAIAN
FT                   LEDNTPIYIYGTVNIFCSAMDINELVRMYSDEVELIKYDNESAATLEAAGLNTEGSSVN
FT                   HTHEFAKNSEMEELPIESV"
FT   gene            370257..373592
FT                   /locus_tag="EUBREC_0406"
FT   CDS_pept        370257..373592
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0406"
FT                   /product="Hypothetical protein"
FT                   /note="Cytoplasmic, score:8.87; COG4913 Uncharacterized
FT                   protein conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74197"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038729"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZBC2"
FT                   /protein_id="ACR74197.1"
FT                   /translation="MCLNNWGGINHKVLQFNEYVNLFSGKSGSGKSTVMDAIQVILYGS
FT                   FSPTFLNKAADDAKNRRSVLSYLRGEQKDGSANRGDCDFCSVIALEIEDTGSHTFTCIG
FT                   IAFEVRKNDSEIKRFVYFSHSGRMPEPSYVTADGFCYSNNDIKKLVNTRSQSADRRARG
FT                   DVNRIYASKEAYLGTLYDVILGYIDPNRFITMEKSAIALRMTNGTGQFIRDYMFPKSDS
FT                   GTIETISEQLDAYRQIREKIEDMRKRIELLKEIKESGQELVNIQSDIVMAETMIRCIDI
FT                   EDMRARIQAAEDDKKRIEEEQDRLSEKADDIAGQQADLQQEYIQVCADLKSSDLGSKKD
FT                   QLRELEKRSLMLTDNSRQWIKITNGLKAWDEDEVITDYVSNAVLNLIEEIVDGDVTEAK
FT                   CQELHLKLESIKKDIEDELEDNTSQKNEITKELKEKKRLVDDMKNNRKSYSESLRSARA
FT                   ALQRDLSDRFGEPVKVQVFADMFDVQDEEWKNAIEGRMGRLKFSLITEPRYAHTAAVIF
FT                   RDMKQFEDVDLINSKAIMDSEPKAMDGSLYEAVDTKEKYVDVCLKRYLGHIIKCRSVDE
FT                   LEQVRDGVTPDCYSYSNFIFRHLKKRDYTTNACIGGRVSKARLAEYEADVERLEKDQIQ
FT                   LMGIISSLKAQRDFECLKGEPEYFVGLSEASDELKAVNSQKNELEEIIRTMENGQYKEL
FT                   KEKKRLLEKNIDALKSAFSLNQQQINEKISQHEKIIGANEQRRAQLEDMLQGYVAREEL
FT                   EKQVQDMLQHSSGASVKSKQREKLIELQGADGNGGRQQSCVETLQTARYRYIKEFPSGQ
FT                   FSGAEKSNKAYEELLEKYEKDYEPEYESEFEEQCKVIYKSLRENVIGTIHGDIKAAKRH
FT                   AYEINRLLRETNFSDSTYQIKIEPAKNENGQFYDMLMAEELDSKNPDNGGIAGQISFGE
FT                   DDFYKKYEQKIKLLTDKFMPPRDEDEHLRMQKRKEMGQYADYRNYLSFSMYEQVTDENG
FT                   RVIRENFVDDMAGRDSGGEGQNPKYVALLAGFAMLYMQQSNRDSKIKLVLLDEAFSKMD
FT                   QERSAVCLKYARKMDLQLIVCVPDERLQSLIRNVDCVYGFRRHNNQISMMHIDKGDYLK
FT                   LMEG"
FT   gene            373595..374059
FT                   /locus_tag="EUBREC_0407"
FT   CDS_pept        373595..374059
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0407"
FT                   /product="putative acetyltransferase protein"
FT                   /note="Cytoplasmic, score:8.87; COG0663 Carbonic
FT                   anhydrases/acetyltransferases, isoleucine patch
FT                   superfamily; KEGG:0putative acetyltransferase protein
FT                   superfamily:IPR011004"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74198"
FT                   /db_xref="GOA:C4ZBC3"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZBC3"
FT                   /protein_id="ACR74198.1"
FT                   /translation="MAYYIAEGAVVKGQVTMADGASVWYNATVRGDSEPIEIGRNSNIQ
FT                   DNAVVHVDLSHSVRIGDNVTIGHSAIVHGCTIGDNTLIGMGAIVLNGARIGKNCIIGAG
FT                   ALVTQGTDIPDGSLAFGSPAKVIRALTADEIEENHRNAMHYVEIARESLI"
FT   gene            374167..375561
FT                   /locus_tag="EUBREC_0408"
FT   CDS_pept        374167..375561
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0408"
FT                   /product="hypothetical protein"
FT                   /note="CytoplasmicMembrane, score:9.99; COG2270 Permeases
FT                   of the major facilitator superfamily; KEGG:K06902
FT                   hypothetical protein; HMMPfam:IPR011701"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74199"
FT                   /db_xref="GOA:C4ZBC4"
FT                   /db_xref="InterPro:IPR024671"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZBC4"
FT                   /protein_id="ACR74199.1"
FT                   /translation="MKSKEDNTQKKTKKLSSKELSWVLYDVGNSAYTLLACALIPIWYK
FT                   SLAVGDGAGQISSDRATAYYAVAIAVMTVVSALIGPVCGAIADHMRIKKAIFSTTVVVG
FT                   VSACILNGFTPTWVLFLVIYVLTKIFYNASLVFYDSMLVDVTTKDRMDEVSSYGYAWGY
FT                   LGSCVPFLVSLAAYICGPDMLGYISNRLSMIIGFAVTGIWWFVVTIPLFKSYKQVNYVS
FT                   DAADKDIHKNFENDAFIRDNIKEKNKTNKNPGVLRLIADAFAQIFGTIKKIATKDKKVG
FT                   LFLVAFFLYIDGVGTIIDNCINIGTDLKLDSVGQVVFLLFTQIVACIGSLVFGRLSQTY
FT                   KTTTLLYVCIAGYFAVCLYALTLHDMIGFGIMAFGVGCFQGSLQALSRSYFSKIIPPEN
FT                   SGEYFGIYDIFAKGASFLGSLVIAAVKLAGGTINVAVATMAIFFAVGFVFLRLADRYDA
FT                   PRHENN"
FT   gene            375592..376335
FT                   /locus_tag="EUBREC_0409"
FT   CDS_pept        375592..376335
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0409"
FT                   /product="glycerophosphoryl diester phosphodiesterase"
FT                   /note="Cytoplasmic, score:9.98; COG0584 Glycerophosphoryl
FT                   diester phosphodiesterase; KEGG:K01126 glycerophosphoryl
FT                   diester phosphodiesterase HMMPfam:IPR004129;
FT                   HMMPanther:IPR004129"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74200"
FT                   /db_xref="GOA:C4ZBC5"
FT                   /db_xref="InterPro:IPR017946"
FT                   /db_xref="InterPro:IPR030395"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZBC5"
FT                   /protein_id="ACR74200.1"
FT                   /translation="MINTEGTKVWAHRGASGYAPENTLEAFKKAEKMKADGVELDVQLT
FT                   KDGELVVIHDETVDRVSGEKGFVKDYTLKELKRLNVSKHMPSYDKKTRIPTLDEVFDLL
FT                   KNTEMTINIELKNGIVQYKNLEKKVLALVEEYDMLDRIWCSSFNHESIVRMKKLCPDMR
FT                   CGLLFSDIIVNPAEYASELHVDALHPATYHMQDENYIDKAHGRGLRAHVWTVNEKHEMK
FT                   ALVKAEADAIITNYPDIAVEIVKNA"
FT   gene            376492..376650
FT                   /locus_tag="EUBREC_0410"
FT   CDS_pept        376492..376650
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0410"
FT                   /product="Hypothetical protein"
FT                   /note="Unknown cell location"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74201"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZBC6"
FT                   /protein_id="ACR74201.1"
FT                   /translation="MLMERLIMLKKKLLKKAVVIGMMATMITGCSQEVQTTNVDGLNSY
FT                   KNASKRW"
FT   gene            376650..376859
FT                   /locus_tag="EUBREC_0411"
FT   CDS_pept        376650..376859
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0411"
FT                   /product="Hypothetical protein"
FT                   /note="Cytoplasmic, score:8.87"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74202"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZBC7"
FT                   /protein_id="ACR74202.1"
FT                   /translation="MQLAAKETLRCADIVEEMFVNLHECIDKKDKNIENELKSARTLQK
FT                   HYVLCGIARIGILSDDINGEVNIA"
FT   gene            376852..379137
FT                   /locus_tag="EUBREC_0412"
FT   CDS_pept        376852..379137
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0412"
FT                   /product="polyphosphate kinase"
FT                   /note="Cytoplasmic, score:8.87; COG0855 Polyphosphate
FT                   kinase; KEGG:K00937 polyphosphate kinase HMMPfam:IPR003414"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74203"
FT                   /db_xref="GOA:C4ZBC8"
FT                   /db_xref="InterPro:IPR003414"
FT                   /db_xref="InterPro:IPR024953"
FT                   /db_xref="InterPro:IPR025198"
FT                   /db_xref="InterPro:IPR025200"
FT                   /db_xref="InterPro:IPR036830"
FT                   /db_xref="InterPro:IPR036832"
FT                   /db_xref="InterPro:IPR041108"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZBC8"
FT                   /protein_id="ACR74203.1"
FT                   /translation="MHRERVLKALAQLLVGVENKLHLADRRRRREDKLIERARLLEIQR
FT                   AQNKTNLKDADANGKISYRIGAYMQMKKLEEVYTNRELSWLQFNERVLNEAGNPRVPLA
FT                   ERLTFASIYQTNLDEFFMVRVGSLMMQMNSKEKIFENKTKMSSEEQVSAILDRVCELEK
FT                   KKARIYEQLMGELEPKGVRIINFNKLSKDEGDLLEAYFDAHIAPFLSPMIIGKQQPFPF
FT                   LANKQLYAVVLLTTQKGKKKTGIVPCSNSVFKRLIEIPTRPGTFMLSEELILHFVSKLY
FT                   PKYVIREKSIMRVTRNADIDAQSMYDEDMDYRNMMEELIKRRVRLDPVRVELSRKINRK
FT                   AIDELSSFLEIGKKHFISVKTPLDMSFVFQLQHYLRDKQELFFEKRTPRDTPELSLKES
FT                   ILGQVEKKDVLLSYPFESMKPFIKMLNDAAEDPDVVSIKMTLYRVADKSQIIDALIEAA
FT                   ENGKEVIVLVELRARFDEANNIEMSHRLEDAGCQILYGLGDYKVHSKLCLITKKKGDGF
FT                   EYITQIGTGNYNEKTSRLYTDLSLITANQEIGADASRVFMALQRGETVSDGDVKHLLVA
FT                   PKCLQNKIVDMIDEQIANKNAGKPAYIGVKINSLTDKVLIDKLIDASQAGVKVELIVRG
FT                   ICCVKPQVEDVTENITVISVVGRYLEHSRIYRFGVGDDEKIYIASADFMTRNTVRRVEV
FT                   ATPVYDAHAKDKIRHIFDTIMTDDEKGKELCADGEYVDRKINSTPIDSQEQFFEEAYKN
FT                   ADKSADNQ"
FT   gene            379200..379679
FT                   /locus_tag="EUBREC_0413"
FT   CDS_pept        379200..379679
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0413"
FT                   /product="YbaK/EbsC protein"
FT                   /note="Cytoplasmic, score:8.87; COG2606 Uncharacterized
FT                   conserved protein; KEGG:K03976 YbaK/EbsC protein;
FT                   HMMPfam:IPR007214; HMMTigr:IPR004369"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74204"
FT                   /db_xref="GOA:C4ZBC9"
FT                   /db_xref="InterPro:IPR004369"
FT                   /db_xref="InterPro:IPR007214"
FT                   /db_xref="InterPro:IPR036754"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZBC9"
FT                   /protein_id="ACR74204.1"
FT                   /translation="MGKKEAKTNAIRILETMKIPYEARTYECDDFVDAAQIADKLGLDH
FT                   AGMYKTITTVGKSGGYYVFVVPIDDEIDFKKAAKAAGEKSIEMLHLKDLTKVTGYIRGG
FT                   CTSIGMKKQYPTFIHEAAKEQDKITVSGGRLGLQITLSPDDLCRAAKAEYVDIIK"
FT   gene            379823..380911
FT                   /locus_tag="EUBREC_0414"
FT   CDS_pept        379823..380911
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0414"
FT                   /product="tryptophanyl-tRNA synthetase II"
FT                   /note="Cytoplasmic, score:9.98; COG0180 Tryptophanyl-tRNA
FT                   synthetase; KEGG:K01867 tryptophanyl-tRNA synthetase II
FT                   HMMPfam:IPR002305; Gene3D:IPR014729; HMMPanther:IPR002306;
FT                   HMMTigr:IPR002306; ScanRegExp:IPR001412"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74205"
FT                   /db_xref="GOA:C4ZBD0"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002305"
FT                   /db_xref="InterPro:IPR002306"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZBD0"
FT                   /protein_id="ACR74205.1"
FT                   /translation="MEKIILTGDRPTGRLHIGHYVGSLRRRVELQNSGEYDKIFIMIAD
FT                   AQALTDNFDNPEKIRQNIIEVALDYLSAGLDPAKSTLFVQSQIPELTELTFFYSNLVTV
FT                   SRLQRNPTVKNEIKLRNFEASIPVGFFNYPISQAADITAFKATTVPVGEDQLPMIEQTR
FT                   EIVRKFNSIYDEVLVEPDVLLPENEACCRLPGTDGGQKMSKSLGNCIYLADTEADVKKK
FT                   IMSMYTDPTHIQISDPGHVEGNTVFTYLDAFSKPGHFEEYLPEYANLQELKDHYTRGGL
FT                   GDVKIKKFLNNIMQEELSPIRARRAEYEKDIPAVYEILRKGSETAREAAAQTMAEVKRA
FT                   MRINYFEDAELIKSQSQKYAEK"
FT   gene            380997..381938
FT                   /locus_tag="EUBREC_0415"
FT   CDS_pept        380997..381938
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0415"
FT                   /product="Mg2+ and Co2+ transporter"
FT                   /note="Cytoplasmic, score:8.87; COG0598 Mg2+ and Co2+
FT                   transporters; KEGG:K03284 Mg2+ and Co2+ transporter;
FT                   HMMPfam:IPR002523; HMMPanther:IPR002523"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74206"
FT                   /db_xref="GOA:C4ZBD1"
FT                   /db_xref="InterPro:IPR002523"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZBD1"
FT                   /protein_id="ACR74206.1"
FT                   /translation="MVKFYRTDDKLIHELDTLQGGTWIQMVNPSVAEGQMVADDLNVDI
FT                   EDVLAALDEEESSRIELQDGYTLILVDIPSIETRHDKESYTTIPLGIILTDDEIVTVCT
FT                   EDTPVLQVFLNNRVKEFSTKKKMRFVYQILYRISVLYQNDLRIIDKMRTEIEERVGEDT
FT                   EEDDLIALHELESTLVYFATSLRANGVVLERLTRYKRLEQYPEDKELLGDVIVENKQAI
FT                   EMTGIYRDIINGTRELMSTVIDNRLNNVMKSLTIITLIMAIPTVISGIYGMNVSSKWVP
FT                   LATTAHGFMIIIGVMVVICVLILILLKKKRIL"
FT   gene            complement(382019..382906)
FT                   /locus_tag="EUBREC_0416"
FT   CDS_pept        complement(382019..382906)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0416"
FT                   /product="hypothetical protein"
FT                   /note="Unknown cell location; COG1092 Predicted
FT                   SAM-dependent methyltransferases; KEGG:K06969 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74207"
FT                   /db_xref="GOA:C4ZBD2"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR019614"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZBD2"
FT                   /protein_id="ACR74207.1"
FT                   /translation="MWLADRWKDYEVIDCSCGEKLERWSKYILLRPDPQVIWDTPKTNK
FT                   NWKKLNGHYHRSKKGGGEWEFFDLPQEWTINYSLPINKELTFHLKPFSFKHTGLFPEQA
FT                   ANWDWFSKKIYDAKKSGRDVKVLNLFAYTGGATLAAAAAGAAVTHVDASKGMVTWAKEN
FT                   AVSSGLGDAPIRWLVDDCVKFVEREIRRGNHYDAIIMDPPSYGRGPKGEIWKIEESVYP
FT                   LVQLCAKLLTDKPLFFLINSYTTGLQPAVLTYMISTALKKFDGKVTASEIGLPVSSNGL
FT                   VLPCGASGRFESIF"
FT   gene            383322..383639
FT                   /locus_tag="EUBREC_0417"
FT   CDS_pept        383322..383639
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0417"
FT                   /product="30S ribosomal protein S10"
FT                   /note="Unknown cell location; COG0051 Ribosomal protein
FT                   S10; KEGG:K02946 30S ribosomal protein S10;
FT                   HMMPfam:IPR001848; BlastProDom:IPR001848; Gene3D:IPR001848;
FT                   HMMPanther:IPR001848; HMMPanther:IPR005731;
FT                   HMMTigr:IPR005731; ScanRegExp:IPR001848;
FT                   superfamily:IPR001848"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74208"
FT                   /db_xref="GOA:C4ZBD3"
FT                   /db_xref="InterPro:IPR001848"
FT                   /db_xref="InterPro:IPR018268"
FT                   /db_xref="InterPro:IPR027486"
FT                   /db_xref="InterPro:IPR036838"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4ZBD3"
FT                   /protein_id="ACR74208.1"
FT                   /translation="MASQVMRITLKAYDHELVDSSAKKIIETVKKNGSQVSGPVPLPTK
FT                   KEVVTILRATHKYKDSREQFEQRTHKRLIDIINPTQKTTESLSRIEMPAGVYIDIKMKQ
FT                   K"
FT   gene            383818..384501
FT                   /locus_tag="EUBREC_0418"
FT   CDS_pept        383818..384501
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0418"
FT                   /product="50S ribosomal protein L3"
FT                   /note="Cytoplasmic, score:8.87; COG0087 Ribosomal protein
FT                   L3; KEGG:K02906 50S ribosomal protein L3;
FT                   HMMPfam:IPR000597; BlastProDom:IPR000597;
FT                   ScanRegExp:IPR000597; superfamily:IPR009000"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74209"
FT                   /db_xref="GOA:C4ZBD4"
FT                   /db_xref="InterPro:IPR000597"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR019926"
FT                   /db_xref="InterPro:IPR019927"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4ZBD4"
FT                   /protein_id="ACR74209.1"
FT                   /translation="MKKAILATKIGMTQIFNADGVLVPVTVLEAGPCVVTQIKTVENDG
FT                   YSAVQVGFGDKKEKVVEKDANGKKSVAHRHGVNKAQMGHFKKAGVSGKRFVREFKFENA
FT                   DEYNLADEIKADIFAEGDKVDVTAISKGKGFQGAIKRLGQHRGPMAHGSKFHRHQGSNG
FT                   ACSSPSKVFKGKGMPGHMGSVKVTTQNLEVVRVDADKNLLLIKGAVPGAKKALITVKET
FT                   TKSGK"
FT   gene            384530..385150
FT                   /locus_tag="EUBREC_0419"
FT   CDS_pept        384530..385150
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0419"
FT                   /product="ribosomal protein L4/L1e"
FT                   /note="Unknown cell location; COG0088 Ribosomal protein L4;
FT                   KEGG:K02926 ribosomal protein L4/L1e; HMMPfam:IPR002136;
FT                   HMMPanther:IPR013005; HMMPanther:IPR015498;
FT                   superfamily:IPR002136"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74210"
FT                   /db_xref="GOA:C4ZBD5"
FT                   /db_xref="InterPro:IPR002136"
FT                   /db_xref="InterPro:IPR013005"
FT                   /db_xref="InterPro:IPR023574"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4ZBD5"
FT                   /protein_id="ACR74210.1"
FT                   /translation="MANVAVYNMEGKEVDKIELNDSIFGVEINEHLVHMAVLQQLANKR
FT                   QGTQKAKTRSEVRGGGRKPWRQKGTGHARQGSTRSPQWTGGGVVFAPTPRDYSFKLNKK
FT                   EKRAALKSALTSRVVENKFVVVDELKLDEIKTKKFVEVLKNLNVEKALVVLNDMDEKVI
FT                   ASAANIPTVKTTQTNELNVFDVLKYDTVVVTKAAVATIEEVYA"
FT   gene            385150..385449
FT                   /locus_tag="EUBREC_0420"
FT   CDS_pept        385150..385449
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0420"
FT                   /product="50S ribosomal protein L23"
FT                   /note="Unknown cell location; COG0089 Ribosomal protein
FT                   L23; KEGG:K02892 50S ribosomal protein L23;
FT                   HMMPfam:IPR013025; BlastProDom:IPR013025; Gene3D:IPR012677;
FT                   superfamily:IPR012678"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74211"
FT                   /db_xref="GOA:C4ZBS1"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR012678"
FT                   /db_xref="InterPro:IPR013025"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4ZBS1"
FT                   /protein_id="ACR74211.1"
FT                   /translation="MANVQYYDVILKPVVTEKSMNAMAEKKYTFLVHPDANKTMIKEAV
FT                   ERMFEGTKVAKVNTMNCEGKNKRRGMVTGKTAKTKKAIVQLTADSKDIEIFAGL"
FT   gene            385574..386374
FT                   /locus_tag="EUBREC_0421"
FT   CDS_pept        385574..386374
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0421"
FT                   /product="50S ribosomal protein L2"
FT                   /note="Unknown cell location; COG0090 Ribosomal protein L2;
FT                   KEGG:K02886 50S ribosomal protein L2; HMMPfam:IPR002171;
FT                   Gene3D:IPR012340; Gene3D:IPR014722; HMMPanther:IPR002171;
FT                   HMMPanther:IPR005880; HMMTigr:IPR005880;
FT                   ScanRegExp:IPR002171; superfamily:IPR008991"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74212"
FT                   /db_xref="GOA:C4ZBS2"
FT                   /db_xref="InterPro:IPR002171"
FT                   /db_xref="InterPro:IPR005880"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR014726"
FT                   /db_xref="InterPro:IPR022666"
FT                   /db_xref="InterPro:IPR022669"
FT                   /db_xref="InterPro:IPR022671"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZBS2"
FT                   /protein_id="ACR74212.1"
FT                   /translation="MTGSDFSEITKTTPEKSLVTSLKKNAGRNNQGKITVRHQGGGNRR
FT                   KYRLIDFKRNKKDGIPATVIGIEYDPNRTANIALICYADGEKSYILAPAGLTDGMKVMS
FT                   GAQAEVRVGNCLPLENIPVGTQIHNIELLPGKGGQLVRSAGLSAQLMAKEGKYATLRLP
FT                   SGEMRMVPIQCRATIGVIGNGDHNLVNIGKAGRKRHMGVRPTVRGSVMNPNDHPHGGGE
FT                   GKAPVGRPGPCTPWGKPALGLKTRKKNKQSNKMIVRRRDGRAIK"
FT   gene            386391..386672
FT                   /locus_tag="EUBREC_0422"
FT   CDS_pept        386391..386672
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0422"
FT                   /product="30S ribosomal protein S19"
FT                   /note="Unknown cell location; COG0185 Ribosomal protein
FT                   S19; KEGG:K02965 30S ribosomal protein S19;
FT                   HMMPfam:IPR002222; BlastProDom:IPR002222; Gene3D:IPR002222;
FT                   HMMPanther:IPR002222; HMMTigr:IPR005732;
FT                   ScanRegExp:IPR002222; superfamily:IPR002222"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74213"
FT                   /db_xref="GOA:C4ZBS3"
FT                   /db_xref="InterPro:IPR002222"
FT                   /db_xref="InterPro:IPR005732"
FT                   /db_xref="InterPro:IPR020934"
FT                   /db_xref="InterPro:IPR023575"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4ZBS3"
FT                   /protein_id="ACR74213.1"
FT                   /translation="MARSLKKGPFADESLLKKVDAMNASGDKSVIKTWSRRSTIFPSFV
FT                   GHTIAVHDGRKHVPVYVTEDMVGHKLGEFVATRTYRGHGKDEKKSGVR"
FT   gene            386698..387093
FT                   /locus_tag="EUBREC_0423"
FT   CDS_pept        386698..387093
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0423"
FT                   /product="50S ribosomal protein L22"
FT                   /note="Cytoplasmic, score:8.87; COG0091 Ribosomal protein
FT                   L22; KEGG:K02890 50S ribosomal protein L22;
FT                   HMMPfam:IPR001063; BlastProDom:IPR001063; Gene3D:IPR001063;
FT                   HMMPanther:IPR005727; HMMTigr:IPR005727;
FT                   ScanRegExp:IPR001063; superfamily:IPR001063"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74214"
FT                   /db_xref="GOA:C4ZBS4"
FT                   /db_xref="InterPro:IPR001063"
FT                   /db_xref="InterPro:IPR005727"
FT                   /db_xref="InterPro:IPR018260"
FT                   /db_xref="InterPro:IPR036394"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4ZBS4"
FT                   /protein_id="ACR74214.1"
FT                   /translation="MAKGHRSKIKRERNEVRDTRPSAKLSYARVSVQKACFVLDAIRGK
FT                   SVNEALAIVTYNPRYASSLVKKLLESAIANAENNYPEKNYKAENLYVAECFANKGPTMK
FT                   RIHPRAQGRAYRIEKRMSHITIVLDER"
FT   gene            387103..387759
FT                   /locus_tag="EUBREC_0424"
FT   CDS_pept        387103..387759
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0424"
FT                   /product="SSU ribosomal protein S3P"
FT                   /note="Cytoplasmic, score:8.87; COG0092 Ribosomal protein
FT                   S3; KEGG:K02982 SSU ribosomal protein S3P;
FT                   HMMPfam:IPR001351; HMMPfam:IPR004044; HMMPfam:IPR008282;
FT                   Gene3D:IPR001351; Gene3D:IPR015946; HMMSmart:IPR004087;
FT                   HMMTigr:IPR005704; ScanRegExp:IPR001351;
FT                   superfamily:IPR001351; superfamily:IPR009019"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74215"
FT                   /db_xref="GOA:C4ZBS5"
FT                   /db_xref="InterPro:IPR001351"
FT                   /db_xref="InterPro:IPR004044"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR005704"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR018280"
FT                   /db_xref="InterPro:IPR036419"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4ZBS5"
FT                   /protein_id="ACR74215.1"
FT                   /translation="MGQKVNPHGLRVGVIKDWDSKWYAEGDFADYLVEDYNIRTFLKKK
FT                   LYAAGVSKIEIERASDRVKVIIYTAKPGVVIGKGGAEIEKIKAEVQKLTDKKLVVDIKE
FT                   VKRPDKDAQLVAENIALQLENRVSFRRAMKSCMGRAMKAGVKGIKTTCSGRLGGADMAR
FT                   TETYNDGTTPLQTIRADIDYGFAEADTTYGKVGVKVWIYKGEVLPTKANKEGGAK"
FT   gene            387762..388199
FT                   /locus_tag="EUBREC_0425"
FT   CDS_pept        387762..388199
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0425"
FT                   /product="50S ribosomal protein L16"
FT                   /note="Cytoplasmic, score:8.87; COG0197 Ribosomal protein
FT                   L16/L10E; KEGG:K02878 50S ribosomal protein L16;
FT                   HMMPfam:IPR000114; HMMPanther:IPR000114; HMMTigr:IPR000114;
FT                   ScanRegExp:IPR000114"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74216"
FT                   /db_xref="GOA:C4ZBS6"
FT                   /db_xref="InterPro:IPR000114"
FT                   /db_xref="InterPro:IPR016180"
FT                   /db_xref="InterPro:IPR020798"
FT                   /db_xref="InterPro:IPR036920"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4ZBS6"
FT                   /protein_id="ACR74216.1"
FT                   /translation="MLMPKRVKHRKQFRGSMAGKATRGNKITNGEYGIVALEPCWIKAN
FT                   QIEAARVAMTRYIKRGGKVWIKIFPEKPVTHKPMGVRMGKGKGALEYWVAVVKPGRVLF
FT                   EISGVPEDVAKEALRLATHKLPCKCKVVSRADLEGGESNEN"
FT   gene            388189..388392
FT                   /locus_tag="EUBREC_0426"
FT   CDS_pept        388189..388392
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0426"
FT                   /product="Hypothetical protein"
FT                   /note="Extracellular, score:8.82; COG0255 Ribosomal protein
FT                   L29; HMMPfam:IPR001854; Gene3D:IPR001854;
FT                   HMMTigr:IPR001854; ScanRegExp:IPR001854;
FT                   superfamily:IPR001854"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74217"
FT                   /db_xref="GOA:C4ZBS7"
FT                   /db_xref="InterPro:IPR001854"
FT                   /db_xref="InterPro:IPR018254"
FT                   /db_xref="InterPro:IPR036049"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4ZBS7"
FT                   /protein_id="ACR74217.1"
FT                   /translation="MKTSAYVKELQAQSVEQLQAQLVDAKKELFNLRFQNATNQLDNTA
FT                   RIKEVRKNIARIQTVITAKAAE"
FT   gene            388423..388680
FT                   /locus_tag="EUBREC_0427"
FT   CDS_pept        388423..388680
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0427"
FT                   /product="ribosomal protein S17"
FT                   /note="Cytoplasmic, score:8.87; COG0186 Ribosomal protein
FT                   S17; KEGG:K02961 ribosomal protein S17; HMMPfam:IPR000266;
FT                   BlastProDom:IPR000266; Gene3D:IPR012340;
FT                   HMMPanther:IPR000266; ScanRegExp:IPR000266"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74218"
FT                   /db_xref="GOA:C4ZBS8"
FT                   /db_xref="InterPro:IPR000266"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019979"
FT                   /db_xref="InterPro:IPR019984"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4ZBS8"
FT                   /protein_id="ACR74218.1"
FT                   /translation="MEERNLRKTRVGVVVSDKMDKTIVVAVRDNVRHPLYNKIVKKTYK
FT                   LKAHDEKNDAKIGDTVRVMETRPLSKDKRWRLVEIMERAK"
FT   gene            388699..389067
FT                   /locus_tag="EUBREC_0428"
FT   CDS_pept        388699..389067
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0428"
FT                   /product="50S ribosomal protein L14"
FT                   /note="Unknown cell location; COG0093 Ribosomal protein
FT                   L14; KEGG:K02874 50S ribosomal protein L14;
FT                   HMMPfam:IPR000218; BlastProDom:IPR000218; Gene3D:IPR000218;
FT                   HMMPanther:IPR000218; HMMPanther:IPR005745;
FT                   HMMTigr:IPR005745; ScanRegExp:IPR000218;
FT                   superfamily:IPR000218"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74219"
FT                   /db_xref="GOA:C4ZBS9"
FT                   /db_xref="InterPro:IPR000218"
FT                   /db_xref="InterPro:IPR005745"
FT                   /db_xref="InterPro:IPR019972"
FT                   /db_xref="InterPro:IPR036853"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4ZBS9"
FT                   /protein_id="ACR74219.1"
FT                   /translation="MVQQESRLKVADNTGAKELLVIRVMGGSTRRYANIGDVIVATVKD
FT                   ATPGGVVKKGDVVKAVVVRSVKGARRKDGSYIKFDENAAVIIKDDKTPKGTRIFGPVAR
FT                   ELREKQFMKIVSLAPEVL"
FT   gene            389079..389390
FT                   /locus_tag="EUBREC_0429"
FT   CDS_pept        389079..389390
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0429"
FT                   /product="50S ribosomal protein L24"
FT                   /note="Unknown cell location; COG0198 Ribosomal protein
FT                   L24; KEGG:K02895 50S ribosomal protein L24;
FT                   HMMPfam:IPR005824; BlastProDom:IPR003256;
FT                   HMMPanther:IPR003256; HMMSmart:IPR005824;
FT                   HMMTigr:IPR003256; superfamily:IPR008991"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74220"
FT                   /db_xref="GOA:C4ZBT0"
FT                   /db_xref="InterPro:IPR003256"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR041988"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4ZBT0"
FT                   /protein_id="ACR74220.1"
FT                   /translation="MATMKIKKGDLVKVIAGKDINNEGKVIAVNAKNNTLLVEGINMVT
FT                   KHTKPSMSNQQGGIVHQEAPIDASNVMLIHDGKPTRVGFKMDGDKKVRFAKSTGKVID"
FT   gene            389414..389953
FT                   /locus_tag="EUBREC_0430"
FT   CDS_pept        389414..389953
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0430"
FT                   /product="50S ribosomal protein L5"
FT                   /note="Cytoplasmic, score:8.87; COG0094 Ribosomal protein
FT                   L5; KEGG:K02931 50S ribosomal protein L5;
FT                   HMMPfam:IPR002132; BlastProDom:IPR002132; Gene3D:IPR002132;
FT                   HMMPanther:IPR002132; ScanRegExp:IPR002132;
FT                   superfamily:IPR002132"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74221"
FT                   /db_xref="GOA:C4ZBT1"
FT                   /db_xref="InterPro:IPR002132"
FT                   /db_xref="InterPro:IPR020929"
FT                   /db_xref="InterPro:IPR020930"
FT                   /db_xref="InterPro:IPR022803"
FT                   /db_xref="InterPro:IPR031309"
FT                   /db_xref="InterPro:IPR031310"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4ZBT1"
FT                   /protein_id="ACR74221.1"
FT                   /translation="MSRLREQYENEIKDAMIKKFGYKNAMEIPKLDKIVVNMGVGEAKE
FT                   NAKVLEAAVKDMEAITGQKAVTTKAKNAIANFKIREGMPIGCKVTLRGEKMYEFADRLI
FT                   NLALPRVRDFRGVNPNAFDGRGNYALGIKEQIIFPEIEYDKVDKVRGMDIIFVTTAKTD
FT                   EEARELLAQFNMPFAK"
FT   gene            390288..390692
FT                   /locus_tag="EUBREC_0431"
FT   CDS_pept        390288..390692
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0431"
FT                   /product="ribosomal protein S8"
FT                   /note="Cytoplasmic, score:8.87; COG0096 Ribosomal protein
FT                   S8; KEGG:K02994 ribosomal protein S8; HMMPfam:IPR000630;
FT                   BlastProDom:IPR000630; HMMPanther:IPR000630;
FT                   ScanRegExp:IPR000630; superfamily:IPR000630"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74222"
FT                   /db_xref="GOA:C4ZBT2"
FT                   /db_xref="InterPro:IPR000630"
FT                   /db_xref="InterPro:IPR035987"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZBT2"
FT                   /protein_id="ACR74222.1"
FT                   /translation="MMMTSDPIADMLTRIRNANTAKHDTVDIPASKIKVAIAGILVDEG
FT                   FIEKYDIVEDGKIKTIHVTLKYGADKNEKVITGIKRISKPGLRVYAGKDEIPSVLGGLG
FT                   IAILSTNQGIVTDKEARKLQVGGEVLAFVW"
FT   gene            390882..391403
FT                   /locus_tag="EUBREC_0432"
FT   CDS_pept        390882..391403
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0432"
FT                   /product="50S ribosomal protein L6"
FT                   /note="Cytoplasmic, score:8.87; COG0097 Ribosomal protein
FT                   L6P/L9E; KEGG:K02933 50S ribosomal protein L6;
FT                   HMMPfam:IPR000702; BlastProDom:IPR000702; Gene3D:IPR000702;
FT                   HMMPanther:IPR000702; ScanRegExp:IPR002358"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74223"
FT                   /db_xref="GOA:C4ZBT3"
FT                   /db_xref="InterPro:IPR000702"
FT                   /db_xref="InterPro:IPR002358"
FT                   /db_xref="InterPro:IPR019906"
FT                   /db_xref="InterPro:IPR020040"
FT                   /db_xref="InterPro:IPR036789"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZBT3"
FT                   /protein_id="ACR74223.1"
FT                   /translation="MPIAVPAGVTVEIAENNHVTVKGPKGTLERTLPSEMDIKLEGEEV
FT                   VVTRPNDLKKMKSLHGLTRTLIHNMVVGVTEGYTKTLEVNGVGYRASKAGKKLTLNLGY
FT                   SHPVEMEDPEGLESEVQDNKIIIKGIDKEKVGQYAAEIRDKRRPEPYKGKGIKYADEVI
FT                   RRKVGKTGKK"
FT   gene            391423..391791
FT                   /locus_tag="EUBREC_0433"
FT   CDS_pept        391423..391791
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0433"
FT                   /product="50S ribosomal protein L18"
FT                   /note="Cytoplasmic, score:8.87; COG0256 Ribosomal protein
FT                   L18; KEGG:K02881 50S ribosomal protein L18;
FT                   HMMPfam:IPR005484; BlastProDom:IPR005484;
FT                   HMMTigr:IPR004389"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74224"
FT                   /db_xref="GOA:C4ZBT4"
FT                   /db_xref="InterPro:IPR004389"
FT                   /db_xref="InterPro:IPR005484"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4ZBT4"
FT                   /protein_id="ACR74224.1"
FT                   /translation="MVSKKSRTEVRVKKHNRMRNHLAGTAQRPRLAVFRSNNHMYAQII
FT                   DDTVGNTLVSASTLDKDIKAELEKTNNVDAAAKLGTVIAKKALDKGISTVVFDRGGFIY
FT                   AGKVKALAEAAREAGLDF"
FT   gene            391804..392313
FT                   /locus_tag="EUBREC_0434"
FT   CDS_pept        391804..392313
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0434"
FT                   /product="ribosomal protein S5"
FT                   /note="Unknown cell location; COG0098 Ribosomal protein S5;
FT                   KEGG:K02988 ribosomal protein S5; HMMPfam:IPR005324;
FT                   HMMPfam:IPR013810; Gene3D:IPR014720; Gene3D:IPR014721;
FT                   HMMPanther:IPR000851; HMMTigr:IPR005712;
FT                   ScanRegExp:IPR013810"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74225"
FT                   /db_xref="GOA:C4ZBT5"
FT                   /db_xref="InterPro:IPR000851"
FT                   /db_xref="InterPro:IPR005324"
FT                   /db_xref="InterPro:IPR005712"
FT                   /db_xref="InterPro:IPR013810"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018192"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZBT5"
FT                   /protein_id="ACR74225.1"
FT                   /translation="MKREIIDASQLELVDQVVDIKRVTKVVKGGRNMRFTALVVVGDKN
FT                   GHVGAGLGKAAEIPEAIRKGKEDAIKSMVNVKLDENNSITHDVTGKYTGASVLLKKSPE
FT                   GTGIIAGGPARSVCEIAGIQNIRTKSLGSNNKQNVVLATIEALKQLRSPEDVAKLRGKS
FT                   VEEILG"
FT   gene            392327..392509
FT                   /locus_tag="EUBREC_0435"
FT   CDS_pept        392327..392509
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0435"
FT                   /product="Hypothetical protein"
FT                   /note="Unknown cell location; COG1841 Ribosomal protein
FT                   L30/L7E; HMMPfam:IPR000517; HMMTigr:IPR005996"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74226"
FT                   /db_xref="GOA:C4ZBT6"
FT                   /db_xref="InterPro:IPR005996"
FT                   /db_xref="InterPro:IPR016082"
FT                   /db_xref="InterPro:IPR036919"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4ZBT6"
FT                   /protein_id="ACR74226.1"
FT                   /translation="MADRVKVTLIKSTIGAVPKNKKTIEALGLTKLGKTVELPNNAATQ
FT                   GAVRKVAPYVKVEEV"
FT   gene            392533..392973
FT                   /locus_tag="EUBREC_0436"
FT   CDS_pept        392533..392973
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0436"
FT                   /product="50S ribosomal protein L15"
FT                   /note="Cytoplasmic, score:8.87; COG0200 Ribosomal protein
FT                   L15; KEGG:K02876 50S ribosomal protein L15;
FT                   HMMPfam:IPR001196; HMMPanther:IPR005749; HMMTigr:IPR005749;
FT                   ScanRegExp:IPR001196"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74227"
FT                   /db_xref="GOA:C4ZBT7"
FT                   /db_xref="InterPro:IPR001196"
FT                   /db_xref="InterPro:IPR005749"
FT                   /db_xref="InterPro:IPR021131"
FT                   /db_xref="InterPro:IPR030878"
FT                   /db_xref="InterPro:IPR036227"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4ZBT7"
FT                   /protein_id="ACR74227.1"
FT                   /translation="MDLSNLKAAEGSVHSDNFRRGRGHGSGNGKTAGKGHKGQKARSGA
FT                   PRPGFEGGQMPLYRRLPKRGFKNRNTLTIVPINLSALERFDNDAVVSVETLIEAGIVKN
FT                   PRDGVKILGNGELTKKLTVQANAFSASAKEKIEALGGKAEVI"
FT   gene            392973..394292
FT                   /locus_tag="EUBREC_0437"
FT   CDS_pept        392973..394292
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0437"
FT                   /product="preprotein translocase subunit SecY"
FT                   /note="CytoplasmicMembrane, score:10.00; COG0201 Preprotein
FT                   translocase subunit SecY; KEGG:K03076 preprotein
FT                   translocase subunit SecY; HMMPfam:IPR002208;
FT                   HMMPIR:IPR002208; HMMPanther:IPR002208; HMMTigr:IPR002208;
FT                   ScanRegExp:IPR002208; superfamily:IPR002208"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74228"
FT                   /db_xref="GOA:C4ZBT8"
FT                   /db_xref="InterPro:IPR002208"
FT                   /db_xref="InterPro:IPR023201"
FT                   /db_xref="InterPro:IPR026593"
FT                   /db_xref="InterPro:IPR030659"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZBT8"
FT                   /protein_id="ACR74228.1"
FT                   /translation="MLKTLRNAFKIKDVRNRILFTFMMLIVIRIGSELPIPGVKGSVFQ
FT                   SWLNSKSADGLGFVDAITGGSFSQMSVFALNITPYITSSIIMQLLTIAIPKLEEMQRDG
FT                   EDGRKKIVEITRYLTIALGLLESVMMVIGFYRQNYLTEKTPLTVIMVVTSLTAGSAVLM
FT                   WIGERITEKGVGNGISIVLTINIISRIPEDLSTLWSQFIASAANIPKAIVAGLIIVAII
FT                   AAMVVFVVLLQDAQRKIPVQYSSKIRGNKQMGGQQTCIPLKVNTSGVIPVIFAQSLMQT
FT                   PVIIASFLGKGNGNGIGSKILKGLSQSNWCDPKEPVYSIGLIVYIVLIIAFAYFYTNIT
FT                   FNPLEIANNMKRSGGFIPGIRPGKPTSDYLNQILNYIVFIGAIGLAFIAFVPIFFNGVF
FT                   NADVSFGGTSIIIIVGVVIETLKQIESQMRVRYYKGFLDD"
FT   gene            394369..395013
FT                   /locus_tag="EUBREC_0438"
FT   CDS_pept        394369..395013
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0438"
FT                   /product="nucleoside-triphosphate--adenylate kinase"
FT                   /note="Cytoplasmic, score:9.98; COG0563 Adenylate kinase
FT                   and related kinases; KEGG:K00944
FT                   nucleoside-triphosphate--adenylate kinase
FT                   HMMPfam:IPR000850; HMMPfam:IPR007862;
FT                   BlastProDom:IPR011769; HMMPanther:IPR000850;
FT                   HMMTigr:IPR006259; ScanRegExp:IPR000850"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74229"
FT                   /db_xref="GOA:C4ZBT9"
FT                   /db_xref="InterPro:IPR000850"
FT                   /db_xref="InterPro:IPR006259"
FT                   /db_xref="InterPro:IPR007862"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033690"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4ZBT9"
FT                   /protein_id="ACR74229.1"
FT                   /translation="MKIIMLGAPGAGKGTQAKQIAAKYSIPHISTGDIFRANIKNGTEL
FT                   GKKAKTYMDQGALVPDELTCDLVMDRIQQDDCKNGFVLDGFPRTIPQAKALDDALTKIG
FT                   EKMDYAIDVDVPDENIVNRMGGRRACLNCGATYHIVFNPTKVEGKCDACGADTVLRDDD
FT                   KPETVQKRLAVYHEQTQPLIEYYDKQGILKSVDGTKPMDEVFSAIVGILGE"
FT   gene            395016..395810
FT                   /locus_tag="EUBREC_0439"
FT   CDS_pept        395016..395810
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0439"
FT                   /product="methionine aminopeptidase"
FT                   /note="Cytoplasmic, score:8.87; COG0024 Methionine
FT                   aminopeptidase; KEGG:K01265 methionine aminopeptidase
FT                   HMMPfam:IPR000994; Gene3D:IPR000994; HMMPanther:IPR000994;
FT                   HMMPanther:IPR002467; HMMTigr:IPR002467"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74230"
FT                   /db_xref="GOA:C4ZBU0"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001714"
FT                   /db_xref="InterPro:IPR002467"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZBU0"
FT                   /protein_id="ACR74230.1"
FT                   /translation="MSVTIKSEHEIELMREAGRILAAVHQQLGKEIKPGMSTKDVDRLG
FT                   EEMIRSYGCEPSFLGYCGYPASICVSVNEEVVHGIPTDERILQEGDIVSLDAGVIYKGY
FT                   HSDAARTVGVGEISEEARLLIERTRLSFFAGIKNAVAGNRLYDISGAIQQLAESFGYGV
FT                   VYDLVGHGIGSHLHEDPEVPNFRPQGFRKGLRLKPGMTLAVEPMINAGSPHVVWMDDEW
FT                   TVVTEDLSLSAHYENTILITKGKPEILSLTEDEKAAGFLELI"
FT   gene            395858..396076
FT                   /locus_tag="EUBREC_0440"
FT   CDS_pept        395858..396076
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0440"
FT                   /product="translation initiation factor IF-1"
FT                   /note="Cytoplasmic, score:9.98; COG0361 Translation
FT                   initiation factor 1 (IF-1); KEGG:K02518 translation
FT                   initiation factor IF-1; HMMPfam:IPR006196;
FT                   Gene3D:IPR012340; HMMSmart:IPR003029; HMMTigr:IPR004368"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74231"
FT                   /db_xref="GOA:C4ZBU1"
FT                   /db_xref="InterPro:IPR004368"
FT                   /db_xref="InterPro:IPR006196"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZBU1"
FT                   /protein_id="ACR74231.1"
FT                   /translation="MSKADVIEVEGVVVEKLPNAFFKVELENGHQILATISGKLRMNFI
FT                   RILPGDKVTIEMSPYDLTKGRIIWRDK"
FT   gene            396127..396312
FT                   /locus_tag="EUBREC_0441"
FT   CDS_pept        396127..396312
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0441"
FT                   /product="Hypothetical protein"
FT                   /note="Unknown cell location; COG0257 Ribosomal protein
FT                   L36; HMMPfam:IPR000473; BlastProDom:IPR000473;
FT                   HMMPanther:IPR000473; HMMTigr:IPR000473;
FT                   ScanRegExp:IPR000473; superfamily:IPR000473"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74232"
FT                   /db_xref="GOA:C4ZBU2"
FT                   /db_xref="InterPro:IPR000473"
FT                   /db_xref="InterPro:IPR035977"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZBU2"
FT                   /protein_id="ACR74232.1"
FT                   /translation="MYNAIWTLLEKYLKRTFIEKGGFAVKVRSSVKPICEKCKVIKRKG
FT                   SIRIICENPKHKQRQG"
FT   gene            396619..396987
FT                   /locus_tag="EUBREC_0442"
FT   CDS_pept        396619..396987
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0442"
FT                   /product="ribosomal protein S13p/S18e"
FT                   /note="Cytoplasmic, score:8.87; COG0099 Ribosomal protein
FT                   S13; KEGG:K02952 ribosomal protein S13p/S18e;
FT                   HMMPfam:IPR001892; BlastProDom:IPR001892;
FT                   BlastProDom:IPR015886; HMMPanther:IPR001892;
FT                   ScanRegExp:IPR001892; superfamily:IPR010979"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74233"
FT                   /db_xref="GOA:C4ZBU3"
FT                   /db_xref="InterPro:IPR001892"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR018269"
FT                   /db_xref="InterPro:IPR019980"
FT                   /db_xref="InterPro:IPR027437"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4ZBU3"
FT                   /protein_id="ACR74233.1"
FT                   /translation="MARIAGVDLPREKRVEIGLTYIYGIGRVSADRILEAANVDPSTRV
FT                   RDLTDDEVKRISAVIDETMTVEGDLRREIALNIKRLQEIGCYRGIRHRKGLPVRGQKTK
FT                   TNARTRKGPKRTVANKKK"
FT   gene            397112..397507
FT                   /locus_tag="EUBREC_0443"
FT   CDS_pept        397112..397507
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0443"
FT                   /product="30S ribosomal protein S11"
FT                   /note="Unknown cell location; COG0100 Ribosomal protein
FT                   S11; KEGG:K02948 30S ribosomal protein S11;
FT                   HMMPfam:IPR001971; BlastProDom:IPR001971; Gene3D:IPR001971;
FT                   HMMPanther:IPR001971; ScanRegExp:IPR001971"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74234"
FT                   /db_xref="GOA:C4ZBU4"
FT                   /db_xref="InterPro:IPR001971"
FT                   /db_xref="InterPro:IPR018102"
FT                   /db_xref="InterPro:IPR019981"
FT                   /db_xref="InterPro:IPR036967"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZBU4"
FT                   /protein_id="ACR74234.1"
FT                   /translation="MAKNVAKKTTKKRVKKNVERGQAHIQASFNNTIVTLTDAEGNALS
FT                   WASAGGLGFRGSKKSTPYAAQMAAETATKAALIHGLKTVDVFVKGPGSGREAAIRALSA
FT                   CGLEVTSIRDVTPVPHNGCRPPKRRRV"
FT   gene            397527..398120
FT                   /locus_tag="EUBREC_0444"
FT   CDS_pept        397527..398120
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0444"
FT                   /product="30S ribosomal protein S4"
FT                   /note="Cytoplasmic, score:8.87; COG0522 Ribosomal protein
FT                   S4 and related proteins; KEGG:K02986 30S ribosomal protein
FT                   S4; HMMPfam:IPR001912; HMMPfam:IPR002942;
FT                   HMMPanther:IPR001912; HMMSmart:IPR002942;
FT                   HMMTigr:IPR005709; ScanRegExp:IPR001912"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74235"
FT                   /db_xref="GOA:C4ZBU5"
FT                   /db_xref="InterPro:IPR001912"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR005709"
FT                   /db_xref="InterPro:IPR018079"
FT                   /db_xref="InterPro:IPR022801"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4ZBU5"
FT                   /protein_id="ACR74235.1"
FT                   /translation="MAVNKVPVLKRCRSLGLEPSYLGYDKKSRRNLTRANRKVSEYGLQ
FT                   LREKQKAKFIYGVLEKPFRNYYKKADQMKGLTGLNLMTILESRIDNVIFRLGFARTRKE
FT                   ARQIVDHKFVTVNGKVVNIPSYLVKAGDVIEIKESKKNTQRMKDIVEVAGGRIVPEWLD
FT                   VDAEKLQGTVKDLPTREQIDVPVDEMLIVELYSK"
FT   gene            398211..399170
FT                   /locus_tag="EUBREC_0445"
FT   CDS_pept        398211..399170
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0445"
FT                   /product="DNA-directed RNA polymerase, alpha subunit"
FT                   /note="Cytoplasmic, score:9.98; COG0202 DNA-directed RNA
FT                   polymerase, alpha subunit/40 kD subunit; KEGG:K03040
FT                   DNA-directed RNA polymerase, alpha subunit
FT                   HMMPfam:IPR011260; HMMPfam:IPR011261; HMMPfam:IPR011262;
FT                   BlastProDom:IPR011260; Gene3D:IPR011262;
FT                   HMMSmart:IPR011263; HMMTigr:IPR011773;
FT                   superfamily:IPR009025; superfamily:IPR011262"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74236"
FT                   /db_xref="GOA:C4ZBU6"
FT                   /db_xref="InterPro:IPR011260"
FT                   /db_xref="InterPro:IPR011262"
FT                   /db_xref="InterPro:IPR011263"
FT                   /db_xref="InterPro:IPR011773"
FT                   /db_xref="InterPro:IPR036603"
FT                   /db_xref="InterPro:IPR036643"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZBU6"
FT                   /protein_id="ACR74236.1"
FT                   /translation="MFDFEKPKIEIAEISEDKTYGRFVVEPLERGYGTTLGNSLRRIML
FT                   SSLPGAAVSQVKIDGVLHEFSSIPGVKEDVTEIIMNIKNLAIRNNSSTNEPKVAYIEFE
FT                   GEGVVTAADIQVDSDIEILNPELEIAHLNGGADSKLYMELTITNGRGYVGAEKNKNEDT
FT                   PIGVLAVDSIYTPVERVNLTVENTRVGQVTDYDKLTLDVFTNGTLEPDEAVSLAAKVLS
FT                   EHLNLFIDLSEAAQQVDVMVEKENDAQEKVLEMNIDELELSVRSYNCLKRAGINTVAEL
FT                   INRTPEDMMKVRNLGRKSLEEVLAKLKELGLELNQTEE"
FT   gene            399422..399961
FT                   /locus_tag="EUBREC_0446"
FT   CDS_pept        399422..399961
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0446"
FT                   /product="LSU ribosomal protein L17P"
FT                   /note="Cytoplasmic, score:8.87; COG0203 Ribosomal protein
FT                   L17; KEGG:K02879 LSU ribosomal protein L17P;
FT                   HMMPfam:IPR000456; BlastProDom:IPR000456; Gene3D:IPR000456;
FT                   HMMPanther:IPR000456; HMMTigr:IPR000456;
FT                   superfamily:IPR000456"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74237"
FT                   /db_xref="GOA:C4ZBU7"
FT                   /db_xref="InterPro:IPR000456"
FT                   /db_xref="InterPro:IPR036373"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZBU7"
FT                   /protein_id="ACR74237.1"
FT                   /translation="MEEIKMAKYRKLSRTSSQRKALLRGQVTQLLVNGKIVTTEAKAKE
FT                   VRKIAEGLIALAVKEKDNFEEVTVTAKVARKDKDGKRVKEVVDGKKVTVYDEVEKKIKK
FT                   DSASRLHARRQMLKVLYTAKESDGTKKGTKTIDVTNKLFDEIAPKYADRNGGYTRIVKI
FT                   GQRKGDGALEVLLELV"
FT   gene            complement(400216..401409)
FT                   /locus_tag="EUBREC_0447"
FT   CDS_pept        complement(400216..401409)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0447"
FT                   /product="ribose-phosphate pyrophosphokinase"
FT                   /note="Cytoplasmic, score:8.87; COG0462
FT                   Phosphoribosylpyrophosphate synthetase; KEGG:K00948
FT                   ribose-phosphate pyrophosphokinase HMMPfam:IPR000836;
FT                   HMMTigr:IPR005946; ScanRegExp:IPR002375"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74238"
FT                   /db_xref="GOA:C4ZBU8"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005946"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR029099"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZBU8"
FT                   /protein_id="ACR74238.1"
FT                   /translation="MPNDERILETMPTGTLGLVATDSCIGLAQKVDAYLQGWREHREHQ
FT                   HANESAFKDYYKNSYIIKPSTPRFGSGEAKCVINQSVRGYDLYIMVDVTNYSLTYTVCG
FT                   QTNHMSPDDHYADLKRVIAAAGGKARRITVIMPFLYESRQHRRTGRESLDCPLALQELI
FT                   NMGVDNIITFDAHDPRVVNAIPLNGFENVMPSYQFIKGILKNVKDITIDADHLMIISPD
FT                   EGATNRAIYLANVLGVDMGMFYKRRDYSRIVDGRNPIVAHEFLGTNVEGKDVLIIDDMI
FT                   SSGESMIDTARELKKRKANRIFVVSTFGLFTNGFASFDKAYEEGLIYRVVTTNLIYQSP
FT                   ELLSKEYYISCDMSKYIAYLIDTLNHDCSISDLLSPYDRIKKCVQKYNDEQAAAKNK"
FT   gene            complement(401467..402450)
FT                   /locus_tag="EUBREC_0448"
FT   CDS_pept        complement(401467..402450)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0448"
FT                   /product="hypothetical protein"
FT                   /note="Cytoplasmic, score:8.87; COG1484 DNA replication
FT                   protein; KEGG:K02315 hypothetical protein;
FT                   HMMPfam:IPR002611; HMMSmart:IPR003593"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74239"
FT                   /db_xref="GOA:C4ZBU9"
FT                   /db_xref="InterPro:IPR002611"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZBU9"
FT                   /protein_id="ACR74239.1"
FT                   /translation="MALTNAQYDEIMRGYDKRQLQNKYIHDKRIEEAYRKAPRLREIDS
FT                   EIASASVRQAYRLMDGDENALAALRLAIEDYKEERAALLSTLGYPLDYFEPIYTCPDCH
FT                   DTGYIDGQKCHCFKQAIINTVYSQSNIREILSRENFSTLSFDYYSDEQKNPATGLSALA
FT                   TAKLAVTNCHEFIDNFENKPKNIFFYGNTGVGKTFLSNCIAKELLDAGYSVIYFTAFQL
FT                   FDILSKGVFEKDADAIAAHQNIFDCDLLIIDDLGTELSNSFTTSQLFLCVNERILRQKS
FT                   TIISTNLNLEQIADIYSERTLSRISSNYSFIKLFGDDIRIKKRLSK"
FT   gene            complement(402488..403729)
FT                   /locus_tag="EUBREC_0449"
FT   CDS_pept        complement(402488..403729)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0449"
FT                   /product="Hypothetical protein"
FT                   /note="Unknown cell location; COG3935 Putative primosome
FT                   component and related proteins; HMMPfam:IPR006343;
FT                   HMMTigr:IPR006343"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74240"
FT                   /db_xref="InterPro:IPR006343"
FT                   /db_xref="InterPro:IPR034829"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZBV0"
FT                   /protein_id="ACR74240.1"
FT                   /translation="MTAINISSDIATSFTTLSDIFIDQYMPKANGEFVKVYLYLLRATG
FT                   SGAGIATISEIADHFSNTEADIIRALNYWASEGILQVQTGADGQIMGINLCSLSVSGMQ
FT                   AAQSNIQSAVADNAAQNNLQNGVVNNATQNNLQNGVVNNAAQNISTANIRMQDSVVEKL
FT                   KNQATDKPAPSQKEYTLDEIKEFRKNPDISELFFIIETYLKHTLSSTDTNMVLYWLDEL
FT                   HFSTDLVEYLVEYCITKGHSSLRYMNKVALGWADAGIKTVDQAKDDAAAHSQIYYSVMK
FT                   ALGITGRNLVDSEVSLINKWVGEYGFDIELVKAACSKTISAIQKPSFEYTDSILANWRK
FT                   KDVHTLKDVEVLDANFAKANKASATGSSQSTNAANGSSKPKSNNSSSKNKFNNFNQRNN
FT                   DYDKLEKLFLNSTV"
FT   gene            complement(403987..405366)
FT                   /locus_tag="EUBREC_0450"
FT   CDS_pept        complement(403987..405366)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0450"
FT                   /product="UDP-N-acetylmuramate--L-alanine ligase"
FT                   /note="Cytoplasmic, score:9.98; COG0773
FT                   UDP-N-acetylmuramate-alanine ligase; KEGG:K01924
FT                   UDP-N-acetylmuramate--L-alanine ligase HMMPfam:IPR000713;
FT                   HMMPfam:IPR004101; HMMPfam:IPR013221; HMMTigr:IPR005758"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74241"
FT                   /db_xref="GOA:C4ZBV1"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005758"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4ZBV1"
FT                   /protein_id="ACR74241.1"
FT                   /translation="MYKIDFSKPIHIHFIGIGGISMSGLAEILHEEGFTISGSDSKESD
FT                   LTKTLAAKGIKVIYGQSADNITTGIDLVVYTAAIHESNPEFAAAKAAGIPMLTRAELLG
FT                   QIMDNYDYSIAVAGTHGKTTTTSMISEILLAAQTDPTISVGGILSSIHGNLRVGDSEYF
FT                   ISEACEYTNSFLNFRPRYSIILNIEAEHLDFFKDINDIRHSFREYASNTLAGGATIING
FT                   EIDRYEEIVAGLPQKIITYGFDSKYDFYPENITYDDKACASFTAMRQGSPLFDVKLSVP
FT                   GAHNVSNALAAIALSTTLGLDEESILTGLDKFGGADRRFQYKGKVNGVTIIDDYAHHPT
FT                   EIRATLTAAQKYPHDRLVLCFQPHTYSRTKAFLNDFADVLSMADVVVLADIYAAREQNT
FT                   YGISSKDILDLLLEKGVNAHYFPSFEEIEKFLSENCVNGDLLITMGAGNVVEIGEDLLK
FT                   K"
FT   gene            405648..407171
FT                   /locus_tag="EUBREC_0451"
FT   CDS_pept        405648..407171
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0451"
FT                   /product="glucose-1-phosphate adenylyltransferase"
FT                   /note="Cytoplasmic, score:8.87; COG0448 ADP-glucose
FT                   pyrophosphorylase; KEGG:K00975 glucose-1-phosphate
FT                   adenylyltransferase HMMPfam:IPR001451; HMMPfam:IPR005835;
FT                   HMMTigr:IPR011831; ScanRegExp:IPR005836;
FT                   superfamily:IPR011004"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74242"
FT                   /db_xref="GOA:C4ZBV2"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR005836"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR011831"
FT                   /db_xref="InterPro:IPR023049"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZBV2"
FT                   /protein_id="ACR74242.1"
FT                   /translation="MKNVEVVMRLWYNFFYIKIIHPDHMNLMVLKYIAVTAIYAAATII
FT                   YMETIVIYYGSITDTVITETSGGNRMAQQKLGQTRSDNVIKKEMIAMLLAGGQGSRLGV
FT                   LTANVAKPAVSFGGKYRIIDFPLSNCINSGIDTVGVLTQYQPLRLNSHIGIGIPWDLDR
FT                   NNGGVAILPPYEKSGNSEWYTGTANAIYQNMRYIDSYNPDYVLILSGDHIYKMDYEVML
FT                   DFHKENNADVTIATMPVPIEEASRFGIVIADDDKRINAFEEKPVHPRSNLASMGIYIFS
FT                   WPVLKEALLALKDQENCDFGKHVIPYCFENDRRMFAYEFNGYWKDVGTLGSYWEANMEL
FT                   VDLIPEFNLYEEYWKIYTKNDAIEPLYIAKGGHVERSIMGEGCECYGHVEHSVIGANVK
FT                   IGRGAVIRDSIIMCDTEIGSNVTIDKSIIAENCKVGDNVTLGFGQEKPNVLNESIYSFG
FT                   LVTIGEDSVIPDGVKIGKNTAISGVTYEEDYKDGVLEGGEVIIKAGDGK"
FT   gene            407168..408286
FT                   /locus_tag="EUBREC_0452"
FT   CDS_pept        407168..408286
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0452"
FT                   /product="glucose-1-phosphate adenylyltransferase, GlgD
FT                   subunit"
FT                   /note="Cytoplasmic, score:8.87; COG0448 ADP-glucose
FT                   pyrophosphorylase; KEGG:K00975 glucose-1-phosphate
FT                   adenylyltransferase, GlgD subunit HMMPfam:IPR005835;
FT                   ScanRegExp:IPR005836; superfamily:IPR011004"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74243"
FT                   /db_xref="GOA:C4ZBV3"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR005836"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR011832"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZBV3"
FT                   /protein_id="ACR74243.1"
FT                   /translation="MKAIGIILAGGNNNRMKELTAKRAVPALPVAGSFRSIDFALSSMS
FT                   NSHIQTVAVLTQYNARSLNEHLSSSKWWNFGRKQGGLFLFTPTVTADNSDWYRGTADAM
FT                   YQNIDFLKRRHEPYVIISSGDCVYKLDFNRVLDFHIEKKSDITVVCKDMMYNDDVSRFG
FT                   VVRMDDESRITEFDEKPIEASSNTISTGIYVIRRRQLIELLEAAAEENRFDFVNDILVR
FT                   YKNVKKIYGYKINSYWNNIADIDAYFKTNMDFLRPDIRSYFFREEPTICSKVDDLPPAK
FT                   FNPGSDISNSLVSSGCIINGSVEDSVLFKQVFVGKNTTVKNCVLLNDVYIGDNVHLENC
FT                   IVESRGTINPNTCYCGEDGVMIVKEKNVRYVI"
FT   gene            408310..408573
FT                   /locus_tag="EUBREC_0453"
FT   CDS_pept        408310..408573
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0453"
FT                   /product="stage V sporulation protein G"
FT                   /note="Cytoplasmic, score:8.87; COG2088 Uncharacterized
FT                   protein, involved in the regulation of septum location;
FT                   KEGG:K06412 stage V sporulation protein G;
FT                   HMMPfam:IPR007170"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74244"
FT                   /db_xref="GOA:C4ZBV4"
FT                   /db_xref="InterPro:IPR007170"
FT                   /db_xref="InterPro:IPR036751"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4ZBV4"
FT                   /protein_id="ACR74244.1"
FT                   /translation="MQITDIRIRKVEKEGKMKAVVSITIDDEFVVHDIKVIEGEKGLFI
FT                   AMPSRKANDGEYRDIAHPINSATRENIQNMILEKYKTEIENV"
FT   gene            408753..408974
FT                   /locus_tag="EUBREC_0454"
FT   CDS_pept        408753..408974
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0454"
FT                   /product="Hypothetical protein"
FT                   /note="Cytoplasmic, score:8.87"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74245"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZBV5"
FT                   /protein_id="ACR74245.1"
FT                   /translation="MTNCPLCATINSKHYISVNTTPQHIFTGEYHFEEGRPLRIFRQRH
FT                   GNFQCFMLPVNSRKIEMSDVKTLREKRG"
FT   gene            409095..410063
FT                   /locus_tag="EUBREC_0455"
FT   CDS_pept        409095..410063
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0455"
FT                   /product="Hypothetical protein"
FT                   /note="Cytoplasmic, score:8.87"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74246"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZBV6"
FT                   /protein_id="ACR74246.1"
FT                   /translation="MGTKDSKAKEYLSDNTRFSEICNYVLFDGEKVIKPEDLKECDTTE
FT                   VLSVFGIDKKQIVKQKWRDLLKSVSVKHTGEMYVILIGAEAQTDIHYAMPVKTMIYDAL
FT                   NYGEQVNEAKKRHRKNKDYRSSDEFLSGFTLDDKLTPVITITLYLGTTQWDGPRSLAEM
FT                   MPQMDERILPFINDYRINLLNPLEITDFSKFETGLRPLFELLKNASDEEKLNDLITNDE
FT                   TFTRVDIETVAAINLFVGTDIKYDEKEEVVNMCKAWDDHKKSGIQEGMQRGMQQGRLFE
FT                   IYLSVQEGDYSAKRGAEKAEMSLDEFEKAMSKAGYKIPELV"
FT   gene            410171..410974
FT                   /locus_tag="EUBREC_0456"
FT   CDS_pept        410171..410974
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0456"
FT                   /product="8-oxoguanine DNA glycosylase domain protein"
FT                   /note="Cytoplasmic, score:8.87; COG0122 3-methyladenine DNA
FT                   glycosylase/8-oxoguanine DNA glycosylase; KEGG:K03660
FT                   8-oxoguanine DNA glycosylase domain protein
FT                   HMMPfam:IPR012904; HMMSmart:IPR003265;
FT                   superfamily:IPR011257; superfamily:IPR012294"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74247"
FT                   /db_xref="GOA:C4ZBV7"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="InterPro:IPR012904"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZBV7"
FT                   /protein_id="ACR74247.1"
FT                   /translation="MYKTKIDNLDLKQIADSGQCFRWKNTGENEYTVVAFDRALRIKQD
FT                   GNEFELDCDEADWNNIWKSYLDMDTDYAGIAKLIADGDDAHLKEAYAYGSGVRILRQDL
FT                   WEMIVTFMISQNNNIKRITNSVDLLCRRCGHKIDGSAEGGELYTFPKPLEVPDEVFDDR
FT                   SMGFGYRAPYLKEIYGYGANNPDWLDNLRKMSYDEAMESLLTRKGIGKKVANCICLFGL
FT                   HHVDAFPIDTHVKQLLDKYYSDGFDFERYKGVAGIIQQYLFYFEL"
FT   gene            411003..411563
FT                   /locus_tag="EUBREC_0457"
FT   CDS_pept        411003..411563
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0457"
FT                   /product="aminoacyl-tRNA hydrolase"
FT                   /note="Cytoplasmic, score:8.87; COG0193 Peptidyl-tRNA
FT                   hydrolase; KEGG:0aminoacyl-tRNA hydrolase
FT                   HMMPfam:IPR001328; BlastProDom:IPR001328; Gene3D:IPR001328;
FT                   HMMPanther:IPR001328; HMMTigr:IPR001328;
FT                   ScanRegExp:IPR001328; superfamily:IPR001328"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74248"
FT                   /db_xref="GOA:C4ZBV8"
FT                   /db_xref="InterPro:IPR001328"
FT                   /db_xref="InterPro:IPR018171"
FT                   /db_xref="InterPro:IPR036416"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4ZBV8"
FT                   /protein_id="ACR74248.1"
FT                   /translation="MYVIVGLGNPDKKYEHTRHNIGFDVIDALADKYNISVTDKKHKAL
FT                   CGSGVIEGMKVLLVKPQTYMNLSGESVAEVMNFYKLDPDEEMIVIFDDISLEPGRIRIR
FT                   KKGSAGGHNGIKSIIAMTGTQGFSRIKVGVGEKPQGWDLADHVLGRFSSEDRAKVEEAI
FT                   GHAMDAAVLMMQGETDKAMNIYN"
FT   gene            411613..415146
FT                   /locus_tag="EUBREC_0458"
FT   CDS_pept        411613..415146
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0458"
FT                   /product="transcription-repair coupling factor"
FT                   /note="Cytoplasmic, score:8.87; COG1197
FT                   Transcription-repair coupling factor (superfamily II
FT                   helicase); KEGG:K03723 transcription-repair coupling
FT                   factor; HMMPfam:IPR001650; HMMPfam:IPR003711;
FT                   HMMPfam:IPR005118; HMMPfam:IPR011545; HMMSmart:IPR001650;
FT                   HMMSmart:IPR014001; HMMTigr:IPR004576"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74249"
FT                   /db_xref="GOA:C4ZBV9"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR003711"
FT                   /db_xref="InterPro:IPR004576"
FT                   /db_xref="InterPro:IPR005118"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036101"
FT                   /db_xref="InterPro:IPR037235"
FT                   /db_xref="InterPro:IPR041471"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZBV9"
FT                   /protein_id="ACR74249.1"
FT                   /translation="MKAFTEPLLSLAGFEEMTKTAEKSSGLISVTGCIDAQKSQMIYAF
FT                   GGHRKNKLIVTFGEQKAKELYDEYSFFDKEVVYYPSKDVLFYQSDIRGNLLTAERIRAL
FT                   KAIREQERVTLVTTFDALMNTMAPIEKMWENVLTLEQGQLLDLKEIQAALIRMGYEKEY
FT                   QVQTMGQFSVRGGILDVFPLTEENPIRIELWGDEIDTIRYFDCESQKSIENIDRVSIYP
FT                   AAELVLSDEEKAGGIDKLKAEAKRVSDKLRKQMKTEEAHRVTVMADELTEEWGELSMYA
FT                   GMDAFLSYFFDERVGILDYFNPSDSLIFFDELTRCTEQGKLTETEFSESMKQRLAMGYI
FT                   LPGQMNGLFTEKEIVAKLGKYSCIALAALDNKANGLHQLGSYGIHCQSVSPYNNSFELL
FT                   IKDLKRYKKNGYRVILLSGSRTRAKRLSEDITDQGITCFYTENYDHELFEGQIMVCYGK
FT                   VRRGFEYPILKFAVITESDIFGAQQKKKKRHRTYEGEKIQSFTDLSVGDYVVHENHGLG
FT                   IYRGIEKLEVDKKVKDYIKIEYQGGSNLYILATQLDMIQKYAGKDARKPKLNKLGGQEW
FT                   TRTKNRVRGAVKQIAGDLVKLYAQREQQNGYAFGEDTVWQREFEELFPFDETEDQILAI
FT                   EATKTDMQSHKIMDRLICGDVGYGKTEVAIRAAFKAVQDSKQVAYLAPTTILAQQIYDT
FT                   FSQRMKDFPVNVDLMCRFRSAAEQKKTIEKLKKGEVDIIIGTHRILSKDVQFKDLGLLV
FT                   IDEEQRFGVTHKEKIKQMKVNVDVLTLTATPIPRTLHMSLIGIRDMSVLEEPPMDRVPI
FT                   QTYVMEYNDELVREAINRELARNGQVYYVYNKVRDIADITAKLQELVPDATVAFAHGQM
FT                   KETELERIMYRFINGEIDVLVSTTIIETGLDISNVNTMIIHDADNMGLSQLYQLRGRVG
FT                   RSNRTAYAFLMYRRNKMLKEVAEKRLAAIKEYSDLGSGFKIAMRDLEIRGAGNLLGAEQ
FT                   SGHMEAVGYDLYCKMLSEAVKEAKGIEDISDKFDTTVDIVTDAYIPAGYIANEFQKLDI
FT                   YKRIAGIETEEEKDEMLEELIDRFGEPPKSVLSLLRVARLKALAHAVYITEIKQTGSLI
FT                   KLTMFERARINPEKIPELIARYKSSLKFNMAENPYFTFDLKNGSVAKKRDVLDVVEELI
FT                   SQMRKELITAE"
FT   gene            415310..416263
FT                   /locus_tag="EUBREC_0459"
FT   CDS_pept        415310..416263
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0459"
FT                   /product="Hypothetical protein"
FT                   /note="Unknown cell location; KOG1793 Uncharacterized
FT                   conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74250"
FT                   /db_xref="GOA:C4ZBW0"
FT                   /db_xref="InterPro:IPR000297"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZBW0"
FT                   /protein_id="ACR74250.1"
FT                   /translation="MKAKKVIAMLLAATLSVTAFTGCAINKTATVATLDKEDIKLGLVN
FT                   FMIRYQEAGYDDMYIQYMGEGYWDKTVSGNNTVLETWKKNAIEEAHELYTLKAHQSDYD
FT                   IEVSDDEKKEIKKAAEKFMKANSDDVIDEMSATEEIVEEYLELRLIKSKMYAAIIKNAD
FT                   SSVTDEEANMAAYTIVKLDYKGAYDSNYQYQTYTDEQSAQIKAQADAVVEALAGGSSLE
FT                   DAAKAAGTTATTGTYATYVDPDAEKTDDSDKKSDDTESTESSESSDSKTKDSVYTTNNL
FT                   DQSVVDALNSLEEGQTSDLITTDSTYYIVRLDKKDR"
FT   gene            416515..417021
FT                   /locus_tag="EUBREC_0460"
FT   CDS_pept        416515..417021
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0460"
FT                   /product="shikimate kinase"
FT                   /note="Cytoplasmic, score:8.87; COG0703 Shikimate kinase;
FT                   KEGG:K00891 shikimate kinase HMMPfam:IPR000623"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74251"
FT                   /db_xref="GOA:C4ZBW1"
FT                   /db_xref="InterPro:IPR000623"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031322"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZBW1"
FT                   /protein_id="ACR74251.1"
FT                   /translation="MEQRTNIVLIGMPGVGKSTIGVILAKVLGYSFLDADLLIQEQEGK
FT                   LLREIIEEKGTDGFIEVENRVNASIRADRAIIATGGSVVYGKEAMEHLKEIGRVVYLKV
FT                   SYAILEKRLADIKGRGVVLKKGQTLETLFEERSKLYEQYADIEVSEEGLDVEQTVEKLV
FT                   EALEL"
FT   gene            417209..418501
FT                   /locus_tag="EUBREC_0461"
FT   CDS_pept        417209..418501
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0461"
FT                   /product="UDP-N-acetylglucosamine
FT                   1-carboxyvinyltransferase"
FT                   /note="Cytoplasmic, score:8.87; COG0766
FT                   UDP-N-acetylglucosamine enolpyruvyl transferase;
FT                   KEGG:K00790 UDP-N-acetylglucosamine
FT                   1-carboxyvinyltransferase HMMPfam:IPR001986;
FT                   BlastProDom:IPR001986; Gene3D:IPR001986;
FT                   HMMPanther:IPR005750; HMMTigr:IPR005750;
FT                   superfamily:IPR013792"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74252"
FT                   /db_xref="GOA:C4ZBW2"
FT                   /db_xref="InterPro:IPR001986"
FT                   /db_xref="InterPro:IPR005750"
FT                   /db_xref="InterPro:IPR013792"
FT                   /db_xref="InterPro:IPR036968"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZBW2"
FT                   /protein_id="ACR74252.1"
FT                   /translation="MEQYVIKGGNPLYGEVEIGGAKNAALAILAAAIMTDETVTIDNLP
FT                   NVRDINVLLQAIEEIGAHVERVDIHKVKINGSFIRGVNVDNEFIRRIRASYYLIGALLG
FT                   KYKHAEVALPGGCDIGSRPIDLHMKGFRSMGADIDIAHGLVIARAKELKGTHIYMDKVS
FT                   VGATINIMMAAAMADGKTVIENAAKEPHVVDVANFLNSMGANIRGAGTDVIRIVGVEKL
FT                   HATEYSVIPDQIEAGTFMFAVAAAGGNVLVKNVIPKHLEATTAKLLEVGCQVEEFDDSV
FT                   RVISDGHLKHTQVTTLPYPGFPTDMQPQMAVLLGIAEGTSTVTESIFENRFKYVDELTR
FT                   MGADIKVESNIAIISGVKRYTGARVNAPDLRAGAALVIAGLAAEGITVVDDIYYIQRGY
FT                   EALEEKLTKIGAKIARVEDEKELQKFILKVS"
FT   gene            complement(418660..419790)
FT                   /locus_tag="EUBREC_0462"
FT   CDS_pept        complement(418660..419790)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0462"
FT                   /product="probable response regulator"
FT                   /note="Cytoplasmic, score:8.87; COG2206 HD-GYP domain;
FT                   KEGG:K07814 probable response regulator; HMMPfam:IPR006674;
FT                   HMMSmart:IPR003607; HMMTigr:IPR006675"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74253"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR006675"
FT                   /db_xref="InterPro:IPR037522"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZBW3"
FT                   /protein_id="ACR74253.1"
FT                   /translation="MIKISIKDAQIGMVAAEPIKTPLGQILALPGTPLTRQLINKMKLY
FT                   KVGSISIQNPSYAVAPQAGENTAKRDKVKPVPKTRAHEMVTNIQRVQASEEFLGFQLKY
FT                   LTCINQIKDTFGKICAGEKSFDEAALLTAVIDLSSSCGTTIETFDMLYNMRTIADPLYS
FT                   HCLNVGLITRMIGRWLHMEKTDVNTLTIAGVLHDIGKCKIPDDVLNKPDKLTDEEFALI
FT                   KKHPQFGFDLIRDLQIDSRIKRTALMHHERCDGSGYPSQLDSSLIDDFAMITAIADVYD
FT                   AMTAARRYRAPLCPFAVISSFESEGFTKYNTKFLLLFLKKLATTYQSNRVMLNDSRFCN
FT                   IVMLNPHELSRPIVRFDDGSILDLSTNREFFIKSVM"
FT   gene            420240..421421
FT                   /locus_tag="EUBREC_0463"
FT   CDS_pept        420240..421421
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0463"
FT                   /product="methionine adenosyltransferase"
FT                   /note="Cytoplasmic, score:9.98; COG0192
FT                   S-adenosylmethionine synthetase; KEGG:K00789 methionine
FT                   adenosyltransferase HMMPfam:IPR002133; HMMPIR:IPR002133;
FT                   HMMPanther:IPR002133; HMMTigr:IPR002133;
FT                   ScanRegExp:IPR002133; superfamily:IPR002133"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74254"
FT                   /db_xref="GOA:C4ZBW4"
FT                   /db_xref="InterPro:IPR002133"
FT                   /db_xref="InterPro:IPR022628"
FT                   /db_xref="InterPro:IPR022629"
FT                   /db_xref="InterPro:IPR022630"
FT                   /db_xref="InterPro:IPR022631"
FT                   /db_xref="InterPro:IPR022636"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZBW4"
FT                   /protein_id="ACR74254.1"
FT                   /translation="MEKLLFTSESVTEGHPDKLCDAVSDAILDACIQQDPMSRVACETA
FT                   SCTGFILVTGEITTKAQLDIPAIVRKTALEIGYDDGKKGLDGNSCAVMVSIDKQSADIA
FT                   MGVDKALEAKEGDLTDNLDTGAGDQGMMFGYATNETEEYMPYPIALAHKLAFQLTKVRK
FT                   DGTLTYLRPDGKTQVSVEYDEAGKPVRLEAVVLSTQHDEDVTQEQIHEDIKKYVFDPIL
FT                   PKDMIDDETKFFINPTGRFVIGGPHGDAGLTGRKIIVDTYGGYARHGGGAFSGKDCTKV
FT                   DRSAAYAARYVAKNLVAAGFADRCEIQLSYAIGVAQPTSIMVDTFGTGKLADDRIVEIV
FT                   RENFDLRPAGIIKMLDLRRPIYRQTAAYGHFGRTDIKLPWEALDKVEDLKKYL"
FT   gene            421608..422297
FT                   /locus_tag="EUBREC_0464"
FT   CDS_pept        421608..422297
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0464"
FT                   /product="two-component system response regulator"
FT                   /note="Cytoplasmic, score:9.98; COG0745 Response regulators
FT                   consisting of a CheY-like receiver domain and a
FT                   winged-helix DNA-binding domain; KEGG:K07659 two-component
FT                   system response regulator; HMMPfam:IPR001789;
FT                   HMMPfam:IPR001867; BlastProDom:IPR001789;
FT                   BlastProDom:IPR001867; Gene3D:IPR011991;
FT                   HMMSmart:IPR001789; superfamily:IPR011006"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74255"
FT                   /db_xref="GOA:C4ZBW5"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZBW5"
FT                   /protein_id="ACR74255.1"
FT                   /translation="MSRILIVEDEVAIADLEKDYLELSGFEVEVENDGTSGLARALAED
FT                   FDLFILDLMLPGIDGFEICKRIREKKNTPILMVSAKKDDIDKIRGLGLGADDYVTKPFS
FT                   PSELVARVKAHLARYERLIGSATPENDIVEIRGIKIDKTARRVWVNGEEKQFTTKEFDL
FT                   LTFLAENPNHVFTKEELFKEIWNMDSVGDIATVTVHIKKIREKIEMNTAKPQYIETIWG
FT                   VGYRFKL"
FT   gene            422409..423920
FT                   /locus_tag="EUBREC_0465"
FT   CDS_pept        422409..423920
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0465"
FT                   /product="sensor histidine kinase"
FT                   /note="CytoplasmicMembrane, score:9.82; COG0642 Signal
FT                   transduction histidine kinase; KEGG:0sensor histidine
FT                   kinase HMMPfam:IPR003594; HMMPfam:IPR003660;
FT                   HMMPfam:IPR003661; Gene3D:IPR003594; HMMSmart:IPR003594;
FT                   HMMSmart:IPR003660; HMMSmart:IPR003661;
FT                   superfamily:IPR003594; superfamily:IPR009082"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74256"
FT                   /db_xref="GOA:C4ZBW6"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZBW6"
FT                   /protein_id="ACR74256.1"
FT                   /translation="MENTMKIKTKLAISFCIIIFVPVVLTSIVLVGFNKIQLKAINKTY
FT                   GMEDAGMLALTDTVQFLNKVTGRTYDELEKTSLIEPSRLLDSDYLTKINKKLEKKYSYL
FT                   IVKSEGELIFNGGIDNDDILRKLPRISNKQSSSDVSSYMDSDDKVLIKQLNFRDSDGDE
FT                   ASLYIVTSTACVIPEVRTVLMEGAFALVLILLTTAAMLIVWIYRSIITPIERLRIAAEN
FT                   IKDGNLDFELETSPSDGEIGELCTAFEQMRARLKKNAEEKVTNESENRVLISNIAHDLK
FT                   TPITAVKGYAEGILDGVANTPEKVDKYVRTIYNKANDMDKLINELTLYSKIDTNRIPYN
FT                   FAKINVTDYFNDCVEEIGLDLEAKNIRLSYENHVDSNVLIIADPEQIRRVINNIVGNSV
FT                   KYMNKTQSYIDIRINDVGDFIQVEIEDNGRGINQRDMPYIFDRFYRADASRNSATGGSG
FT                   IGLSIVKKIIEDHGGKIWATSKEGDGTTMFFVIRKYQETQDMNRQ"
FT   gene            424569..425954
FT                   /locus_tag="EUBREC_0466"
FT   CDS_pept        424569..425954
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0466"
FT                   /product="hypothetical protein"
FT                   /note="CytoplasmicMembrane, score:9.99; COG0534 Na+-driven
FT                   multidrug efflux pump; KEGG:K03327 hypothetical protein;
FT                   HMMPfam:IPR002528; HMMPanther:IPR002528; HMMTigr:IPR002528"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74257"
FT                   /db_xref="GOA:C4ZBW7"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZBW7"
FT                   /protein_id="ACR74257.1"
FT                   /translation="MHKFRQKYIGDKAFYKRYLMLAIPMIIQNAITNLVSFLDNIMVGQ
FT                   LGTEQMSGVAIVNQLIFVYNLAVFGAVSAASIFGAQYFGKGNHKGHMYSFRFKLYAALL
FT                   VTAIAMTLFITNGTGFISLYLTDTAGNGATEVALAYGKEYLEIVMIGLIPFAVTQAYAT
FT                   NIKETGQTFVPMVASFAAVGSNAVLDFLLIFGIGPIPKLGVAGAAIATVMSRYIETIIV
FT                   VLWAHKNRDKNRYLEGAYRGIGMPFGEFKTIFIKGLPLMLNELLWAAGMTTVTQCYSVR
FT                   GLSVIAGLNIATTITNLFNIVFIQLGACISIVVGQYLGAGELEKAKDADNKMIVFSVFC
FT                   CSVMAAVMLLVGGFFPQIYNTTDEIKSLATSFIAVSAIIMPFCAFTHSSYFTLRSGGKT
FT                   LVTFLFDSVFTWVIVVPVAFVLAKYTAIGIVAVYFLVQATELIKVVIGYFMVKSDVWLV
FT                   QMV"
FT   gene            426052..427101
FT                   /locus_tag="EUBREC_0467"
FT   CDS_pept        426052..427101
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0467"
FT                   /product="methyltransferase"
FT                   /note="Cytoplasmic, score:9.98; COG0275 Predicted
FT                   S-adenosylmethionine-dependent methyltransferase involved
FT                   in cell envelope biogenesis; KEGG:K03438 methyltransferase
FT                   HMMPfam:IPR002903; HMMPanther:IPR002903; HMMTigr:IPR002903"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74258"
FT                   /db_xref="GOA:C4ZBW8"
FT                   /db_xref="InterPro:IPR002903"
FT                   /db_xref="InterPro:IPR023397"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4ZBW8"
FT                   /protein_id="ACR74258.1"
FT                   /translation="MSEEKQHKRRVHYSGKYPKKFEEKYKELNPEKYKDTIEHVISKGN
FT                   TPAGMHISIMVKEIIDFLDIKPGQTGFDATLGYGGHTRAMLEKLEGQGHMFATDVDPIE
FT                   SEKTKKRLAEAGFGEDILTIKLQNFCTIDEIAKEVGGFDFILADLGVSSMQIDNPERGF
FT                   SFKVDGPLDLRLNPNAGISAAERLDNISREELSGMLYENSDEPYCEELAKAITDEIRKG
FT                   NRIGTTTKLRHIIEQTLDFLPEKDKKDIIKKTCQRTFQALRIDVNHEFEVLYEFMEKLP
FT                   GALKPGGRAAILTFHSGEDKLVKKALKAGYKAGIYSDYSKDVIRPSAQECAQNGRARST
FT                   KMRWAVRAE"
FT   gene            complement(427156..427278)
FT                   /locus_tag="EUBREC_0468"
FT   CDS_pept        complement(427156..427278)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0468"
FT                   /product="Hypothetical protein"
FT                   /note="Unknown cell location"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74259"
FT                   /db_xref="GOA:C4ZBW9"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZBW9"
FT                   /protein_id="ACR74259.1"
FT                   /translation="MADFIIKKSRLSGFIAQTVGSYLLYFMWLFHLSVSHITRS"
FT   gene            427422..429674
FT                   /locus_tag="EUBREC_0469"
FT   CDS_pept        427422..429674
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0469"
FT                   /product="hypothetical protein"
FT                   /note="Cytoplasmic, score:9.98; COG1882 Pyruvate-formate
FT                   lyase; KEGG:K00656 hypothetical protein HMMPfam:IPR001150;
FT                   HMMPfam:IPR004184; HMMPIR:IPR005949; HMMTigr:IPR005949;
FT                   ScanRegExp:IPR001150"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74260"
FT                   /db_xref="GOA:C4ZBX0"
FT                   /db_xref="InterPro:IPR001150"
FT                   /db_xref="InterPro:IPR004184"
FT                   /db_xref="InterPro:IPR005949"
FT                   /db_xref="InterPro:IPR019777"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZBX0"
FT                   /protein_id="ACR74260.1"
FT                   /translation="MIEMKEWDGFEGRLWKEEINVRQFIQDNYTPYDGDESFLADPTDA
FT                   TNKLWDALQKLQKEERAKGGVLDMETEVVTGITAYGPGYIDESLKDLEQIVGLQTDKPL
FT                   KRAFMPYGGIKMAVQAAETYGYNVSDKLKEIFTKYHKTHNTAVFDAYTPEMMKVRHAKI
FT                   LTGLPDTYGRGRIVGDYRRVALYGLDYLIEEKKKDKANCGCGQMTDDVIRLREEIAEQI
FT                   KCLEDMKKLAEIYGYDISRPATNAKEAVQWLYFGYLAAIKTQNGAAMSVGRVSTFLDIY
FT                   IKRDMDKGILTEQEAQELIDHFTMKLRMVKFARIPSYNQLFSGDPVWATLDVAGTGVDG
FT                   RSMVTKTDFRFLHTLENMGPAPEPNLTVFYSSKLPQTFKDYAARISIETSSIQYENDDA
FT                   MKPVWGDDYAICCCVSATQTGKEMQFFGARANLAKCLLYAINGGVDEKSGEQVGPNYAP
FT                   ITAEYLDYDEVMAKYDKMMDWLVDIYVNTLNLIQYMHDKYYYEAAELALMDTDLKRTFA
FT                   TGIAGFSHVIDSLSAIKYAKVKVVRDESGLAKDFEIEGEFPKYGNDDDRADEIGVWLLK
FT                   TFMDKLKKHHTYRDSEPTTSILTITSNVVYGKATGAMPDGRKAGEPLSPGANPSYGAEQ
FT                   NGLLASLNSLTKLPYEWALDGISNTQTINPGALGNNEGERIDNLVNVMDGYFDQGAHHL
FT                   NVNVFGKEKLIDAMEHPEKEEYANFTIRVSGYAVKFIDLTREQQLDVISRTCHERM"
FT   gene            complement(429892..430038)
FT                   /locus_tag="EUBREC_0470"
FT   CDS_pept        complement(429892..430038)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0470"
FT                   /product="Hypothetical protein"
FT                   /note="Unknown cell location"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74261"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZBX1"
FT                   /protein_id="ACR74261.1"
FT                   /translation="MNYDFGFLCLTRPAFTRLPKIPYAVVLFRKSEYAGTWPAHSGISI
FT                   IVY"
FT   gene            430154..430903
FT                   /locus_tag="EUBREC_0471"
FT   CDS_pept        430154..430903
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0471"
FT                   /product="pyruvate formate-lyase activating enzyme"
FT                   /note="Cytoplasmic, score:9.98; COG1180 Pyruvate-formate
FT                   lyase-activating enzyme; KEGG:K04069 pyruvate formate-lyase
FT                   activating enzyme HMMPfam:IPR007197; HMMTigr:IPR012838;
FT                   ScanRegExp:IPR001989"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74262"
FT                   /db_xref="GOA:C4ZBX2"
FT                   /db_xref="InterPro:IPR001989"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR012838"
FT                   /db_xref="InterPro:IPR012839"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR034457"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZBX2"
FT                   /protein_id="ACR74262.1"
FT                   /translation="MGETLGRVHSVESFGSADGPGVRYIVFLKGCNMRCKYCHNPDTWA
FT                   KCGENDGAKLMTPQEVLKTAMRYKAYWKQTGGITVSGGEALLQIDFVTELFKLAKEKGV
FT                   NTCLDTSGNPFTVEEPFFGKFNELMKYTDLFMLDIKHIDDEEHKKLTGQTNKNILDMAQ
FT                   YLSKNGKKMWIRHVLVPGITTDERYLNQLREFIDTLKTVDRVEVLPYHTLGVFKWKELG
FT                   IPYQLEGVEPPTKEQIECAKRILNCQN"
FT   gene            431084..431818
FT                   /locus_tag="EUBREC_0472"
FT   CDS_pept        431084..431818
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0472"
FT                   /product="probable 23S rRNA pseudouridine synthase"
FT                   /note="Cytoplasmic, score:8.87; COG0564 Pseudouridylate
FT                   synthases, 23S RNA-specific; KEGG:K01718 probable 23S rRNA
FT                   pseudouridine synthase HMMPfam:IPR006145;
FT                   BlastProDom:IPR006145"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74263"
FT                   /db_xref="GOA:C4ZBX3"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZBX3"
FT                   /protein_id="ACR74263.1"
FT                   /translation="MGKPDIIYEDNDIIICYKPAGIATQTRRIGQQDMESFIRNYRAAK
FT                   NEPPYVGIVHRLDQPVEGVMVFAKNQKAAASLSRQIKEHTTEKYYRAASRGQGVSGADK
FT                   EEDNHDSAWHTLTDYISFDKRTNTSKITSEKDRLAKKAVLQYRVISVTPDRDSSQNECI
FT                   RTEFDIKLLTGRHHQIRLQLAHIGYPLIGDTKYGKPASNNSGTGSKSGRTCGGVREQLA
FT                   LCSYKIVFDHPATGERMTFELP"
FT   gene            complement(432016..432192)
FT                   /locus_tag="EUBREC_0473"
FT   CDS_pept        complement(432016..432192)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0473"
FT                   /product="Hypothetical protein"
FT                   /note="Unknown cell location"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74264"
FT                   /db_xref="GOA:C4ZBX4"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZBX4"
FT                   /protein_id="ACR74264.1"
FT                   /translation="MLSSSLIIPLQNSYRFLIRSAHLFRNYLLVVLFIIVTIQNHHTHS
FT                   QNRTIFVLYLHSV"
FT   gene            432209..432364
FT                   /locus_tag="EUBREC_0474"
FT   CDS_pept        432209..432364
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0474"
FT                   /product="Hypothetical protein"
FT                   /note="Unknown cell location"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74265"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZBX5"
FT                   /protein_id="ACR74265.1"
FT                   /translation="MAVQGYATIQSKSSGNQLHTLMVFDGWNEYVRYLNLDFGNWTDLR
FT                   GTTFNG"
FT   gene            432357..432737
FT                   /locus_tag="EUBREC_0475"
FT   CDS_pept        432357..432737
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0475"
FT                   /product="Hypothetical protein"
FT                   /note="Unknown cell location"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74266"
FT                   /db_xref="GOA:C4ZBX6"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZBX6"
FT                   /protein_id="ACR74266.1"
FT                   /translation="MDKKKRLLILIFVLILSGIVVIFIHKNGSMKGDSIMEENAISGDD
FT                   NTHWFHSNGIITSIDNSQKKICVDISQKNNFFDGTNITLNCNKSSLDITHLEAGQEITF
FT                   YFFENNVLDTEVAIEKLNIVTP"
FT   gene            433010..433309
FT                   /locus_tag="EUBREC_0476"
FT   CDS_pept        433010..433309
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0476"
FT                   /product="Hypothetical protein"
FT                   /note="Cytoplasmic, score:8.87; COG1725 Predicted
FT                   transcriptional regulators; HMMPfam:IPR000524;
FT                   Gene3D:IPR011991; HMMSmart:IPR000524"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74267"
FT                   /db_xref="GOA:C4ZBX7"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZBX7"
FT                   /protein_id="ACR74267.1"
FT                   /translation="MYRKEAEHVNEILNQEKSIYIQISEMIENDILRDVLLEDERVPST
FT                   NELAKLYAINPSTAAKGINILVDAGILYKKRGIGMFVSDGAKEVIRTKRKARFC"
FT   gene            433474..434757
FT                   /locus_tag="EUBREC_0477"
FT   CDS_pept        433474..434757
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0477"
FT                   /product="galactose/glucose-binding lipoprotein"
FT                   /note="Unknown cell location; COG1879 ABC-type sugar
FT                   transport system, periplasmic component; KEGG:K10540
FT                   galactose/glucose-binding lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74268"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="InterPro:IPR040740"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZBX8"
FT                   /protein_id="ACR74268.1"
FT                   /translation="MKKKFVAIMMVAAMAASMAACGSDGGSSGTQKGGSSTSTSDVANK
FT                   DKPLVWFNRQPSNSSTGELDTTALNYNKDTYYVGFDANQGAELQGEMVKEYIEKNIDTI
FT                   DRNGDGVIGYVLAIGDIGHNDSIARTRGVRKALGTGVDKSGEIDSAPAGTNSDGKAAEV
FT                   QDGKITVNGKDYVVRELASQEMKNSAGATWDAATAGNAIGTWSSSFGESIDVVVSNNDG
FT                   MGMSMFNAWSKDNKVPTFGYDANSDAVAAIAEGYGGTISQHADVQAYLTLRVLRNALDG
FT                   VDIDTGIGTEDDAGNVLSDDVYVYKDDERSYYALNVAVTADNYKDFTDSTVVWAPVSTQ
FT                   LDSAKHPTKKVWLNIYNASDNFLSSTYQPLLQKYDDLLNLDVEYIGGDGQTESNITNRL
FT                   GNPSQYDAFAINMVKTDNAASYTALLNQ"
FT   gene            434777..436360
FT                   /locus_tag="EUBREC_0478"
FT   CDS_pept        434777..436360
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0478"
FT                   /product="galactoside ABC transporter, ATP-binding protein"
FT                   /note="CytoplasmicMembrane, score:9.49; COG1129 ABC-type
FT                   sugar transport system, ATPase component; KEGG:K10542
FT                   galactoside ABC transporter, ATP-binding protein
FT                   HMMPfam:IPR003439; BlastProDom:IPR003439;
FT                   HMMSmart:IPR003593; ScanRegExp:IPR003439"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74269"
FT                   /db_xref="GOA:C4ZBX9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR015862"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZBX9"
FT                   /protein_id="ACR74269.1"
FT                   /translation="MGREKSLPKIKCIQTTANIELGAGSMGDKNNENILSIRGMSKSFG
FT                   RNRVLDHINLDVKKGTVMGLMGENGAGKSTMMKCLFGTYQKDEGTIYLDGKEVSFSGPK
FT                   DALENGIAMVHQELNQCLERNVVDNLFLGRYPVNSFGMIDEGRMKKEASELFRKLGMTV
FT                   NLEQPMKNMSVSQRQMCEIAKAISYNSKVIVLDEPTSSLTVQEVEKLFQMMRMLRDQGI
FT                   SLIYISHKMDEIFEICDEISVLRDGNLVMTKSTKETNMNELIAAMVGRVLENRFPPVDN
FT                   KPKDVILSIQHLSTKYEPHLQDITFDVHEGEIFGLYGLVGAGRTELLETIFGIRTRAAG
FT                   RVYFKNQLMNFTCAKEAMDYGFALITEERKANGLFLKGNLTFNTTIANLGAYKNGPALS
FT                   DSKMTKATSDEIKIMHTKCMGPEDMISALSGGNQQKVIFGKWLERGPQIFMMDEPTRGI
FT                   DVGAKYEIYELIINMAKQGKTVIVVSSEMPEILGITNRIGVMSNGRLSGIVNTKETNQE
FT                   ELLRLSAKYL"
FT   gene            436379..438028
FT                   /locus_tag="EUBREC_0479"
FT   CDS_pept        436379..438028
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0479"
FT                   /product="galactoside ABC transporter, permease protein,
FT                   putative"
FT                   /note="CytoplasmicMembrane, score:10.00; COG4211 ABC-type
FT                   glucose/galactose transport system, permease component;
FT                   KEGG:K10541 galactoside ABC transporter, permease protein,
FT                   putative; HMMPfam:IPR001851"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74270"
FT                   /db_xref="GOA:C4ZBY0"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="InterPro:IPR030158"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZBY0"
FT                   /protein_id="ACR74270.1"
FT                   /translation="MANSKILTAEQERALRQPIDEYVGGIQKEIDALRKDGTTKVVECQ
FT                   SAIAGIKRDKTLSKGEKESEIAACEKELAKAKAVEAKNKDEISKLIAKAESYLKENFDS
FT                   KYYNAVKASCEAEKAEALAAHNERMAELDKKHKAALAKTSDSTEIKEENYVHKNRISNE
FT                   KLELEKEYQTIKDKKHEAYSYKYHLIDMLRLSKFTFMEKRAQKWENYKYTFNRRNFLLQ
FT                   NGLYIAIILIFIALCVITPIKKGTPLLTYNNILNILQQASPRMFLALGVAGLILLTGTD
FT                   LSVGRMVGMGMTTATIIMHQGINTGSVFGHIFDFTGVPTGARVVIALLACIVLCTFFTS
FT                   IAGFFTAKFKMHPFISTMANMLVIFGIVTYATKGVSFGAIEPVIPNMIIPKLNGFPTII
FT                   LWAVAAIAIVWFIWNKTTFGKNLYAVGGNPEAAAVSGISVFAVTLGAFVMAGILYGFGS
FT                   WLECARMVGSGSAAYGQGWDMDAIAACVVGGVSFTGGIGKISGVVTGVCIFTALTYSLT
FT                   ILGIDTNLQFVFSGIIILVAVTLDCLKYVQKK"
FT   gene            438076..438219
FT                   /locus_tag="EUBREC_0480"
FT   CDS_pept        438076..438219
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0480"
FT                   /product="Hypothetical protein"
FT                   /note="Unknown cell location"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74271"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZBY1"
FT                   /protein_id="ACR74271.1"
FT                   /translation="MSGWHLCFNFVVWTVILLELHFCLFKATKEDIIYDIILYRQILLS
FT                   GG"
FT   gene            438287..439891
FT                   /locus_tag="EUBREC_0481"
FT   CDS_pept        438287..439891
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0481"
FT                   /product="two-component response regulator"
FT                   /note="Cytoplasmic, score:9.98; COG4753 Response regulator
FT                   containing CheY-like receiver domain and AraC-type
FT                   DNA-binding domain; KEGG:K07720 two-component response
FT                   regulator; HMMPfam:IPR000005; HMMPfam:IPR001789;
FT                   BlastProDom:IPR001789; Gene3D:IPR012287;
FT                   HMMSmart:IPR000005; HMMSmart:IPR001789;
FT                   superfamily:IPR009057; superfamily:IPR011006"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74272"
FT                   /db_xref="GOA:C4ZBY2"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="InterPro:IPR041522"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZBY2"
FT                   /protein_id="ACR74272.1"
FT                   /translation="MYTLLLVDDEEDVIEVIERKVSWEQIGFHVVGHAGNGFKALEMME
FT                   DMQPDVVMTDIRMPYMDGLELCSNIRQRFPATKLLLFTGFDDFEYAKEAVHLEIEEYIL
FT                   KPLNLAEITEVFKKLKTKLDDELNEKKNTDILKQYYAASLPVLQSNFYTTLIEGRIPEN
FT                   ELGRYMRDYKIVLEGPYYCCIIIHTSASQMPQGMDIRLLAVSVERQAQADLKERWNGRI
FT                   FNYLGDTVMIAQLVQQEDISELTDECDRFCKYVNHVMGAKVTVGIGQVCENVQELVSSY
FT                   QSAREAVSYRVLYGSNRAINMTEVEPQRRISKDGDEGNELSNLFKMICIGKIEDVGQAV
FT                   EAYMQHNFMSQQSLENYHVAVMELISELYHFMSNNELNAQEISGSVGRLYNELSNFEPV
FT                   VLKQWLLDFSSRLHDDMADARYNSKKSLIDSAKDYVHRNYRSVDLGLDDTCKELGVSNS
FT                   YFSSLFKKETGSSFVEYLTDYRMDKAARMLVETDDKSYVIAQNVGYADPNYFSYVFKRK
FT                   YGVSPSRYRTEYEKNKV"
FT   gene            439872..441665
FT                   /locus_tag="EUBREC_0482"
FT   CDS_pept        439872..441665
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0482"
FT                   /product="hypothetical protein"
FT                   /note="Cytoplasmic, score:8.87; COG2972 Predicted signal
FT                   transduction protein with a C-terminal ATPase domain;
FT                   KEGG:K07718 hypothetical protein HMMPfam:IPR003594;
FT                   HMMPfam:IPR010559; Gene3D:IPR003594; HMMSmart:IPR003594;
FT                   superfamily:IPR003594"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74273"
FT                   /db_xref="GOA:C4ZBY3"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR010559"
FT                   /db_xref="InterPro:IPR033479"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZBY3"
FT                   /protein_id="ACR74273.1"
FT                   /translation="MRRIRYKSGNIQSIIMLSFSLLSFAIMLVTVVVMYIKFADASQDS
FT                   IIESNHKVMDQTIDSVESYLVNMRQVSDAAYYNVIKENDILKQSDSIHDGMSLLYESNK
FT                   EYLRSIALYNQYGSLIAAEPVVSQKEDPDVTKQDWFIEAMERMENIHFSTPHVQNLFDD
FT                   GSMRYHLVISSSRAVELTSGSESQMGVMLVDMDYSSVSRMLERINTSGKGQYYYLCDAK
FT                   GNIIYHPHQIQFDGDVPENSDVAAKSQNSIYDDYLNGVHRKIMVDTISYTGWKLVCVMP
FT                   YSIFTNKMADVKQFVFVIMIIMAMMFVWINRVIAIRISKPIMKLDDSVKRYENGNEADI
FT                   YVGGSSEIRHLGYSIRNSYKQNNELMKKIVWEQNERRKSELDVLQSQINPHFLYNTLDS
FT                   ITWMIEGGKNEEASFMITQLAKLFRISLSKGHTIIPVRDELLHAKSYMNIQKVRYKNKF
FT                   EVSFEVDEEIMDYCAVKLVLQPILENALNYGIRELDDFGEIVVGGQKVGEDIIITVSDN
FT                   GMGIPENEIPFLLTNTDRVHKKGSGVGLVNVNNRIKILFGERYGLHIESELDEGTVVTI
FT                   KIPAIVYSEENRLQFEEHHIV"
FT   gene            441662..442717
FT                   /locus_tag="EUBREC_0483"
FT   CDS_pept        441662..442717
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0483"
FT                   /product="Hypothetical protein"
FT                   /note="Unknown cell location; COG1879 ABC-type sugar
FT                   transport system, periplasmic component; HMMPfam:IPR001761"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74274"
FT                   /db_xref="GOA:C4ZBY4"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZBY4"
FT                   /protein_id="ACR74274.1"
FT                   /translation="MKQVQFPCCMGGVRVTVKNKWTNMSKNKRNFIITELLLGVLLVIG
FT                   IGFIAYNKLNEKPERIAVVMADVDESHSAAFKYGMKMAASEYGVDVVMISKENLNNMSD
FT                   EIDVIKQEINKKADAVVFKPTAEKMTEEKSLNTLIRINKKTPIMVVGDQAGSESFKSLN
FT                   TVEFDQYSMGTELAQKLLADNNGTLSGKKIGIYCENTESDACKKRIDGIKDTLAESGCV
FT                   VMWIVSGVSDTGEKINLQSQRKVDIVLAIDDASVVEAAKEASDNNLQGALVYGIGNSTE
FT                   AIYYLDSGWTEALITPDEFAAGYKSVVGLVDMLRGSRKYSVEEKPVSYQLLTRKNLFDE
FT                   ENKKLLYAISQ"
FT   gene            442756..443772
FT                   /locus_tag="EUBREC_0484"
FT   CDS_pept        442756..443772
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0484"
FT                   /product="D-galactose-binding periplasmic protein
FT                   precursor"
FT                   /note="Unknown cell location; COG1879 ABC-type sugar
FT                   transport system, periplasmic component; KEGG:K10540
FT                   D-galactose-binding periplasmic protein precursor"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74275"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZBY5"
FT                   /protein_id="ACR74275.1"
FT                   /translation="MMILCFALILSFVSCSNTRVDEKKQIYIGVTCYDQKDTFIGELIE
FT                   TFKKECASLDTDKYDISMTIMDAAGSQRAQDDQVQEMIEDGCNVLCINLADRTDLSHII
FT                   NAAMEKDIPIIFFNREPVDEDLNRWDKLYYVGAKAKQSGQMQGELIADYIKNNPGVDKN
FT                   GDGRIQYVILEGEMGHQDAIVRTESVTESMKNNGLQIEKLSCQIANWNRAQAQNRMTQL
FT                   IGQYKNSIELVIANNDAMALGAIDAYEKLGVTESNVPAFFGVDGTDDGLEAVQQSKLAA
FT                   TVYNDKEGQAMAMAQLAYLAATGGSMKNIKFEDKKYVYLPYEKVTPDNVNEFVKDEQ"
FT   gene            complement(443775..444617)
FT                   /locus_tag="EUBREC_0485"
FT   CDS_pept        complement(443775..444617)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0485"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="Cytoplasmic, score:9.98; COG2207 AraC-type
FT                   DNA-binding domain-containing proteins; KEGG:K02099
FT                   transcriptional regulator, AraC family; HMMPfam:IPR000005;
FT                   HMMPfam:IPR003313; Gene3D:IPR012287; HMMSmart:IPR000005;
FT                   ScanRegExp:IPR000005; superfamily:IPR003313;
FT                   superfamily:IPR009057"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74276"
FT                   /db_xref="GOA:C4ZBY6"
FT                   /db_xref="InterPro:IPR003313"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="InterPro:IPR037923"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZBY6"
FT                   /protein_id="ACR74276.1"
FT                   /translation="MDKLSFNIFPNVNFIDLCMYQFGHEQCEPGHSFGPATRNHYLFHY
FT                   VLSGTGTLMADNAKGITQTYNIKSGQGFLIFPGQINTYIADDKLPWEYIWIEFDGLRVK
FT                   EALTTTELTKNNPVYHTHSKDIREKLVEEMLYITRHPSESPYHLIGHMYLFLDYLMQSA
FT                   KSSKLVPGGKMSDFYIKEAMNYIEQNFQNDISIEDIAGVCGINRSYLGKIFKNSVGHSP
FT                   QEFLMNYRMIKATELLKLTSLSIADVGSAVGYENQLHFSRAFKNIYGVAPREWRNEHK"
FT   gene            444806..446107
FT                   /locus_tag="EUBREC_0486"
FT   CDS_pept        444806..446107
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0486"
FT                   /product="sugar ABC transporter substrate-binding protein"
FT                   /note="Unknown cell location; COG1653 ABC-type sugar
FT                   transport system, periplasmic component; KEGG:K10117 sugar
FT                   ABC transporter substrate-binding protein;
FT                   HMMPfam:IPR006059"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74277"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZBY7"
FT                   /protein_id="ACR74277.1"
FT                   /translation="MAKRKICQAMAVVLALGMCTTGLTGCGNEKRADGKTEIEVVSYKP
FT                   EAVKAFEKIEKQFNETHDDIHLTISSPNEAMTILKTRFIREDYPDIIAIGGDINYSNFL
FT                   DADLFEDISDLDAVDNVKEAYLDMDKELEFIPKDGTYALPYAANAAGVLYNKDMFAENG
FT                   WKVPTTWSEFTALCDEIKESGTLPLYLGFKDTWTCLAPWNALAVGLCDSDTCNQVNMGN
FT                   TTFEEAYSPVADKIRTLLDYAEDNPYAYSYNDACTAFARGESAMYTIGSYAIPQIKSVN
FT                   PDMNIGSFTFPANDNEADNVLNSGIDLQLSVMKACKNKEAAYEVLEYLYSDETIQTYLD
FT                   DQGGIACKEGDFAIPDTLEDMQEYIKDNRMSDYQDHHYPSEMSVDAMIQTYLLDTGDNA
FT                   KEKFLKKFDSDWERYNRDLIREVQDYQKEQEDAK"
FT   gene            446104..446979
FT                   /locus_tag="EUBREC_0487"
FT   CDS_pept        446104..446979
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0487"
FT                   /product="ABC-type sugar transport system, permease
FT                   component"
FT                   /note="CytoplasmicMembrane, score:10.00; COG1175 ABC-type
FT                   sugar transport systems, permease components; KEGG:K10118
FT                   ABC-type sugar transport system, permease component;
FT                   HMMPfam:IPR000515"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74278"
FT                   /db_xref="GOA:C4ZBY8"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZBY8"
FT                   /protein_id="ACR74278.1"
FT                   /translation="MKKKMSNRDKTFWAVVIPVVVLFFAFNTLPMIKGVIYSFTNYKGY
FT                   GSYDYVGLRNYTDLFTDARVGKSYLFTFKYAIAGTVLVNVLSLVMAVALNSNIRGKSAL
FT                   RGVYFVPNILGGLVIGYIFSFIFTYILPVVGNTFNIGFLQNSILASEKYAWIGVLIVGV
FT                   WQAVAMNTIIYISGLQTVPEDVYEASMLDGAGKWKQFWKVTFPLVMPFVTINLVLSTKN
FT                   FLMVFDQIMSLTKGGPAQSTESISYLIYRNGMDGGQFGFQSANAVIFFVVIVAISLFQM
FT                   GVMNKKEEQL"
FT   gene            446979..447815
FT                   /locus_tag="EUBREC_0488"
FT   CDS_pept        446979..447815
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0488"
FT                   /product="sugar ABC transporter permease"
FT                   /note="CytoplasmicMembrane, score:10.00; COG0395 ABC-type
FT                   sugar transport system, permease component; KEGG:K10119
FT                   sugar ABC transporter permease; HMMPfam:IPR000515"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74279"
FT                   /db_xref="GOA:C4ZBY9"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZBY9"
FT                   /protein_id="ACR74279.1"
FT                   /translation="MKKQKSNWVLTIVLILGTLTVFFPLYMAVIIAFKKPSEMTNDVAG
FT                   ALSFPSKWSFSNFTEAMKVTDFWHSLGNSLLITIVTIVLAILIHSIAGYVIGRGMARKK
FT                   SFRFIYLYIVSGMFVPFSILMMPLVKQTAQMGLGNRAGVIILYLVFYMPMNVLLYSGYL
FT                   KNIPMALEEAADIDGASTWTTYWRVVFPMMKPMHATVAILTALGTWNDVMTPLVIMSGT
FT                   GQNTLPLAQLNFQTQFGTNYNLAFASYILALIPILIFYIICQKQILNGVANGAIKG"
FT   gene            447837..450695
FT                   /locus_tag="EUBREC_0489"
FT   CDS_pept        447837..450695
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0489"
FT                   /product="alpha-galactosidase"
FT                   /note="Cytoplasmic, score:8.87; COG3345
FT                   Alpha-galactosidase; KEGG:K07407 alpha-galactosidase
FT                   HMMPfam:IPR000111; FPrintScan:IPR002252; Gene3D:IPR013785;
FT                   ScanRegExp:IPR000111"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74280"
FT                   /db_xref="GOA:C4ZBZ0"
FT                   /db_xref="InterPro:IPR000111"
FT                   /db_xref="InterPro:IPR002252"
FT                   /db_xref="InterPro:IPR006083"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031704"
FT                   /db_xref="InterPro:IPR031705"
FT                   /db_xref="InterPro:IPR038417"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZBZ0"
FT                   /protein_id="ACR74280.1"
FT                   /translation="MIWSDFMAIIFNPNKKIFTLQTAHTTYQMQVDRLGYLLHLYYGAK
FT                   STCDMDYVLTYADRGFSGNPYAAGMNRTYSLDTLPQEYPTLGTGDFRNIALDIKNEQGT
FT                   ESVELLYKSYEIRDGKYALKGLPAVWASDDEAQTLEIVLGDDIAGVEVHLLYGVLEACD
FT                   VITRSVLIKNTGSGNITIEKAHAACLDMVYGDYDVIRFYGKHAMERNLERTHLGHGTLS
FT                   FGSRRGTSSHQYNPAVILAQRDTTENAGDCYGMLFVYSGNFSCEAEKDQINQTRLLMGL
FT                   SDELFSYPLAAGETFTVPEVIMSYSADGFSQLSHQYHTCISEHVCRSRFAHEVRPVLIN
FT                   SWEAAYFDFTGDTIVDLAKEAASLGIDMVVMDDGWFGKRDDDNSSLGDWFVNEKKLGGT
FT                   LSELIDRVHAQGVKFGIWIEPEMVNEDSNLYREHPDWAIQIPGKLPVRSRNQLILDFSR
FT                   KEVRDNIFNQICAVFDQGKIDYVKWDMNRSMADVYAGNLAYDYVLGVYDFMERLVTRYP
FT                   DILLEGCSGGGGRFDAGMLYYSPQIWCSDNTDAINRTRIQYGTSFFYPVSSMGAHVSAV
FT                   PNHQTGRVTSLKTRGITAMAGTFGYELNPALLSDEEKEEIREQIKTFKKYEMLINEGTY
FT                   WRLTSPFEDEVAAWMSVSRTKDRALVSVVRLYAEANAAACYVKLKGLESDAVYIEENTG
FT                   RQYTGAALMNAGIPLPFAVKEYEAYQFSFIRLDEAKKLYDEIKKVCGNLKLNEADTADS
FT                   ASDNRIVISIYGGSGSGKTTIAAALQQYFLNDNTACYVLTGDNYPHRIPMRNDEERLNV
FT                   YNESGEDGLRGYLGTPKEIDFDRINKELSEFKAGKDIIEIKHMGREDGDISYDETDFTG
FT                   IKVLILEWTHGGSEYLKGVDIPVFLESSPEETKARRIKRGRDENAASPFICRVVELEQE
FT                   KLDLQGKNARIVVGKDGKVYEQ"
FT   gene            450673..452160
FT                   /locus_tag="EUBREC_0490"
FT   CDS_pept        450673..452160
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0490"
FT                   /product="glycosidase"
FT                   /note="Cytoplasmic, score:8.87; COG0366 Glycosidases;
FT                   KEGG:K00690 glycosidase Gene3D:IPR013781;
FT                   HMMSmart:IPR006589"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74281"
FT                   /db_xref="GOA:C4ZBZ1"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR022527"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZBZ1"
FT                   /protein_id="ACR74281.1"
FT                   /translation="MAKSMNNKPMLNAYPDSLGGKLSDIAALLKKKEMQDTFSSFYILP
FT                   SLYHSDLDRGFSVVDYNLNEELATIEDLSQLKELGIDLKLDFILNHASAQSPQFKDLVE
FT                   KGDESEYRDFFIDWNKFWEGHGVMTDEGYIQPDESCLKQMFFRKPGLPILMVEFPDGRR
FT                   VPYWNTFYQEVHGRDYLGQMDLNIKSEKVWDFYRETLKKIASYGAAIVRLDAFAYAPKA
FT                   PGKKNFLNDPETWEFLQQIHELAAPLGLTLLPEIHAAYEEKIYKTLADKGYATYDFFLP
FT                   GLVIDAIENRRADYLAKWAREVVEDKISTVNMLGCHDGIPLLDLKGLLPEDDIRSLIDL
FT                   IVSRGGMVKNLHGQKNIYYQVNATYYSALGESDSKMLLARAIQMFMPGKPQVWYLDLFA
FT                   GKNDHEAVRRAGESGHKEINRTNLSASDIEEALKKDVVAKQLELLRMRNTHKAFEKGAV
FT                   ITVAGEGPKLSIRYDNGEAYALLTVDFEAGAYEIELS"
FT   gene            452351..452473
FT                   /locus_tag="EUBREC_0491"
FT   CDS_pept        452351..452473
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0491"
FT                   /product="Hypothetical protein"
FT                   /note="Unknown cell location"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74282"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZBZ2"
FT                   /protein_id="ACR74282.1"
FT                   /translation="MHSSKRATAVAGRSKRSGWLIEDNKEREVHDVKCHGPLFL"
FT   gene            complement(452481..454331)
FT                   /locus_tag="EUBREC_0492"
FT   CDS_pept        complement(452481..454331)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0492"
FT                   /product="Hypothetical protein"
FT                   /note="Cytoplasmic, score:8.87"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74283"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041682"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZBZ3"
FT                   /protein_id="ACR74283.1"
FT                   /translation="MFHSKWVIIDCKKRGDIMDIYKRIYELENEIAALPQGSINMKKIY
FT                   GKEQPYLQWTENGKSKSKYIKKNEREEIFAGVERRKQLQEELKELKQHSSIDPSKSTDF
FT                   ETSVIIGERLLALTKGVKNWGKRDCFRQLQAYLNSEETDRVCLVFGLRRTGKTTMLRQA
FT                   VLGMTPSQSAKSAYIKAKGSDTMAAMNRDLGKLLDLGYEYVFIDEVTLMPDFIDSAALF
FT                   SDIYAAQGMKIVLSGTDSLGFWFALHQELYDRAVTIHTTFIPFREHSRLLGIDSIDEYI
FT                   RYGGTLRAGELDFDDKDVISEDASFRDDESTRRYIDTAICKNIQHSLSCCQDGGYFRHL
FT                   QSLYEAGELTGAINRIIEDMNHRFLIRILTDKFKSHDLGSAADVLRRDRNPKQRTDILD
FT                   KIDTEAVTKRLMDMLEIHNKEEQSIGITNAHIEEIKEYLKALDLIVDVPRETVIPSAEP
FT                   LENILFTQPGMRYCQAQALVHSLTKDELFSTLSEHEKMLVSERILEEVRGRMMEDIVLL
FT                   ETFKSAKRHQRVFKLQFAVGEYDMVIYDAKLNTCECYEIKHSSKIVPMQARFLVDEEKL
FT                   NQTSQRFGQITKRCVLYRGEDSVMENGVEYQNVENYLKHL"
FT   gene            454553..455047
FT                   /locus_tag="EUBREC_0493"
FT   CDS_pept        454553..455047
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0493"
FT                   /product="G:T/U mismatch-specific DNA glycosylase"
FT                   /note="Unknown cell location; COG3663 G:T/U
FT                   mismatch-specific DNA glycosylase; KEGG:K01249 G:T/U
FT                   mismatch-specific DNA glycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74284"
FT                   /db_xref="InterPro:IPR005122"
FT                   /db_xref="InterPro:IPR026353"
FT                   /db_xref="InterPro:IPR036895"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZBZ4"
FT                   /protein_id="ACR74284.1"
FT                   /translation="MEYEHITHSFEPVYDENSRILILGTLPSVASRENNFYYGHKQNRF
FT                   WKLLAYLLDEPVPETIDEKKYMLFKNHIAIWDVIQSCDIKGSSDSSIKNVEPTDIRKIL
FT                   ETADIKQVYANGNKAGALYKKYQLPLTGMEAVTLPSTSPANAAWSFERLCEAWTRILAN
FT                   L"
FT   gene            455077..456426
FT                   /locus_tag="EUBREC_0494"
FT   CDS_pept        455077..456426
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0494"
FT                   /product="hypothetical protein"
FT                   /note="CytoplasmicMembrane, score:9.99; COG0534 Na+-driven
FT                   multidrug efflux pump; KEGG:K03327 hypothetical protein;
FT                   HMMPfam:IPR002528; HMMPanther:IPR002528; HMMTigr:IPR002528"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74285"
FT                   /db_xref="GOA:C4ZBZ5"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZBZ5"
FT                   /protein_id="ACR74285.1"
FT                   /translation="MKTIEFDTHFYKKLWTLMVPIMVQNLMLALVAVADAFMLGGLDQN
FT                   YMSAVSLATQIQFIQNMFLSAATAGLAILGAQYWGKQDIKALDDIFALAIRICGIVSVL
FT                   FFVACAFFPRYLMLIFTNEPVLIDYGVSYLKIASFSYLLTGFSQCYIVMMKISEHAGTA
FT                   AAVSSITVLINIILNAIFIYGAFGIESMNVRGAALATLISRVVELMLSITFSYRPGYIR
FT                   LKIRELFARNKELSADFMKCSGPILGASLVWGIGFTSYSTFMGHMGTDAAAANSVAAVV
FT                   RDIICCLSAGISSAAGIMIGNELGAGNLKRGKAYGIRMAKLSFLCGAVMTVLMAVSAPV
FT                   ILHFVKLTPQAAEYLKQLFGVLAFYMIGRSVNEIIINGVFGSGGDTMFDMYSLAVTMWG
FT                   IAIPLAVAGTYFLNWPVVVVYACTCVDEVGKIPWTLIHFKKYKWVKDLTR"
FT   gene            complement(456479..457558)
FT                   /locus_tag="EUBREC_0495"
FT   CDS_pept        complement(456479..457558)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0495"
FT                   /product="transcriptional regulator, LacI family"
FT                   /note="Cytoplasmic, score:9.98; COG1609 Transcriptional
FT                   regulators; KEGG:K01775 transcriptional regulator, LacI
FT                   family HMMPfam:IPR000843; HMMPfam:IPR001761;
FT                   FPrintScan:IPR000843; HMMSmart:IPR000843;
FT                   ScanRegExp:IPR000843; superfamily:IPR010982"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74286"
FT                   /db_xref="GOA:C4ZBZ6"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZBZ6"
FT                   /protein_id="ACR74286.1"
FT                   /translation="MYKLYSKKIIILNRMEFNMTLKDIAEMAGVSTMTVSNVINGKTSR
FT                   VSQKTRDKINSIIEEYNYVPNMNARSLSNNSSHIIGVVTFLEEKEYASGYNYFENPYVS
FT                   TMIGTIETELHKNGYFTMLQSVSRSSDILSLVKNWNVDGMILVFPTSAQNLEKLMDAAN
FT                   CPIATFDSNYSHPNLINVISDDEKGLYLSTKYMINHGHTEIAFVADYEGNIVLTKRFNG
FT                   YKKALEDSHIPFRPEYIFSYPPSYEGGIEAGRAIAGSKSPITAVVTTADICAIGIMEGA
FT                   RLGGYRVPIDLSVIGYDNLNLCQYTVPKLTSVSQNVPKKARLATELLLKKIHDNESDSN
FT                   LGEIIDVEIVDRQSVISLY"
FT   gene            457874..459235
FT                   /locus_tag="EUBREC_0496"
FT   CDS_pept        457874..459235
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0496"
FT                   /product="secreted sugar binding protein"
FT                   /note="Unknown cell location; COG1653 ABC-type sugar
FT                   transport system, periplasmic component; KEGG:K02027
FT                   secreted sugar binding protein; HMMPfam:IPR006059"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74287"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZBZ7"
FT                   /protein_id="ACR74287.1"
FT                   /translation="MKKKLIATVMAATMAVTALTGCGSSSASSAKKDIKVPTKPFGDTV
FT                   KYDPSVEINDGKDISIDLWEWGSDELFQKVIDRYTAIHPNVTINLVDNPWEDYWTKLPL
FT                   ALDGEDGPALFDVHNSYHENLINYMAPLDIPVEDLEQDFNGVSAHVIDGKVYYIDYGMM
FT                   TGSVYYNKEMWKEAGLTDDDIPKTWDEMIEVAKKLTIKDGDKIVQAGLNFNNDFHQNYL
FT                   LGLNYQLGENLFKEDGKTPNVNSDAMKKVMQMLVDMYDKDQIGSKDFGENCADSFGQGQ
FT                   SAMVIQWGHYYNTLKTTWSDIDFGVFEIPTFDGNPYAYNRYNGESTFGVNKKAPKDQQA
FT                   VAQDFVKFFLCDDESQVDFNLAMSTFPAKKSLADNEEILKNPSLKVLAEHIDHYIWPGP
FT                   MPSCVEEDMKKAGEDIFYNGVDIDTALDKAQADIIKDMKSSSFQSVENLYEFAK"
FT   gene            459266..460144
FT                   /locus_tag="EUBREC_0497"
FT   CDS_pept        459266..460144
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0497"
FT                   /product="ABC-type sugar transport system, permease
FT                   component"
FT                   /note="CytoplasmicMembrane, score:10.00; COG1175 ABC-type
FT                   sugar transport systems, permease components; KEGG:K02025
FT                   ABC-type sugar transport systems, permease components;
FT                   HMMPfam:IPR000515"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74288"
FT                   /db_xref="GOA:C4ZBZ8"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZBZ8"
FT                   /protein_id="ACR74288.1"
FT                   /translation="MFKKSHPLQSKSEIILRNIVVVAMVAFFTIFLIIPIGIAFAGSFH
FT                   EWNPLSGTYKFLGLENYKQVFTSKLFGKSMFNTVIFSVVVIVFRVGLGLGIAYAIYSTL
FT                   IKHKSFFRAVYYMPVVTPMVAVAFVWKFMYNPQIGTINKIFGLDINWLMNPKTALIAVM
FT                   IMTIWKDFGYAVVMYMAGLYSLPADVMEAAQVDGASGWQKFRYITLPLLKPMTLFVVIT
FT                   SIISYIQAYVQILIMTEGGPGTSTYLASYIIYDEAFVKYNFGYASALSFVLFVITAVLT
FT                   VLSFKVSGKEE"
FT   gene            460157..460978
FT                   /locus_tag="EUBREC_0498"
FT   CDS_pept        460157..460978
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0498"
FT                   /product="sugar ABC transporter, permease-like protein"
FT                   /note="CytoplasmicMembrane, score:10.00; COG0395 ABC-type
FT                   sugar transport system, permease component; KEGG:K02026
FT                   similar to sugar ABC transporter, permease protein;
FT                   HMMPfam:IPR000515"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74289"
FT                   /db_xref="GOA:C4ZBZ9"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZBZ9"
FT                   /protein_id="ACR74289.1"
FT                   /translation="MRKKVSSIVLNVFLLLLGIVTVYPFIWMLCSSFKQNKEIMALQQH
FT                   LLPQEFTIDNYISMNSHFNFMRFFGNSLFITIVVTLLVVYTSTICGFVLSKYKFKGRNI
FT                   LFGFVLATMMIPWCVTIIPKYTMIQKFGWMDSYKALIIPAMFSGFGIFMMKQHIETIPD
FT                   EIIEAARMDGANEFYIFHRIIFPMAKNGISSIAIFQFLWTWEDYLWPYLVINTKEKQLL
FT                   AVGLKMFNGQYSTDYGALFAATAISIIPVLLIYLFFQKQFIAGIAASAVKG"
FT   gene            461006..463399
FT                   /locus_tag="EUBREC_0499"
FT   CDS_pept        461006..463399
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0499"
FT                   /product="alpha-xylosidase"
FT                   /note="Cytoplasmic, score:8.87; COG1501 Alpha-glucosidases,
FT                   family 31 of glycosyl hydrolases; KEGG:0alpha-xylosidase
FT                   HMMPfam:IPR000322; HMMPanther:IPR000322"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74290"
FT                   /db_xref="GOA:C4ZC00"
FT                   /db_xref="InterPro:IPR000322"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR033403"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZC00"
FT                   /protein_id="ACR74290.1"
FT                   /translation="MQEIYRVKTSPVALSDNMIIGEKYRITVLTEALVRLEYSEDGVFE
FT                   DRATQTVLFRDFPKTGYHVVRNADGIEVHTSMLHLIYNEKEFSSHGLSIQIKGNLSAYH
FT                   SIWHYGEKVHDLQGTARTLDDVNGEVELGHGVVSRFGYSILDDSKSQILLDDGWIEPRK
FT                   KGVSDLYFFGYGHDYKQALNDFYRLCGKTPMLPRYALGNWWSRYYKYSEESYMELMDKF
FT                   DEKNIPFTVAVIDMDWHQVDVDPKYGSGWTGYTWNKKLFPDPKRFLGKLHDRGMHTTLN
FT                   VHPADGVQGCEEMYVDMAKEMGVDYEKEDPVVCDPASPKFMDAYFKYLHHPREAEGVDF
FT                   WWIDWQQGSNCKVEGLDPLWIFNHFHYLDNKRDGRRPMTFSRYAGPGSHRYPIGFSGDT
FT                   HITWESLNFQPYFTTTATNIGYGWWSHDIGGHMLGYKDDELTARWTQYGIFSPIMRLHS
FT                   SCSEFNGKEPWRFKKETEEAMEAALRQRHCMIPYLYTMNYRSYAENMPLIEPMYYEYPE
FT                   NAEAYEVKNQYFFGSQLMVAPVTTPRIKGLNVAKTKVWFPEGIWYDIYTGMRYDGGRML
FT                   EVYRDLSSIPVFAKAGGILVCADADELDARSVIKNPDVLCVRVFPEADGEFELYEDDNE
FT                   SCGYVDGRCVTTAMKYSADKDMFVISPADGDTSLIPDNRTYKLVFERRTETAADKVKVS
FT                   VDGKEVLAKNKYDKENRKLIVTVNASTASKISVAISKDTVALDNQIEKRCFDFLNQAEI
FT                   GFVLKDEIYGLITSGKKTTVILSELKAKELDTELYGVLTEILTA"
FT   gene            463541..465787
FT                   /locus_tag="EUBREC_0500"
FT   CDS_pept        463541..465787
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0500"
FT                   /product="alpha-glucosidase"
FT                   /note="Cytoplasmic, score:8.87; COG1501 Alpha-glucosidases,
FT                   family 31 of glycosyl hydrolases; KEGG:K01187
FT                   alpha-glucosidase HMMPfam:IPR000322; HMMPanther:IPR000322;
FT                   ScanRegExp:IPR000322"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74291"
FT                   /db_xref="GOA:C4ZC01"
FT                   /db_xref="InterPro:IPR000322"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR025887"
FT                   /db_xref="InterPro:IPR030458"
FT                   /db_xref="InterPro:IPR033403"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZC01"
FT                   /protein_id="ACR74291.1"
FT                   /translation="MGNLYKNCKIQDNTAELIYENGSLFVTIFENNIVHVAQKHGIESV
FT                   AIEEDFIPKAATPDVTCKDTSDAKGTAAEAGVSDAAVKAVISARDITVNVKDNEKLDIY
FT                   YKGKLVLSDYETARKKSEKNPYEDLAIAELEGHTVGKDEEKTDAVTIIKKLGKDDAIYG
FT                   LGDKPGCLNKRGYSYVNWNTDDPAPHVDSFKSLYKSIPFFIVLGDEYCYGIFADNTYKT
FT                   TFDFGYENTDYYFVEHEKGELDYYFMPGNDMAEVVGLYTSLTGTTPLYQRWIYGSHQSR
FT                   WGYYTQDEVLDIADKFRELDIPCDVIHMDIDYMNGYRVFTFDDKKFPDVKGLSEKLADR
FT                   GVKLISIIDPGVKKDEDYFMYKEGMEMDAFAHDTDGSVYENAVWPGTSVFPDFTKQSVR
FT                   SWWGDKTKILLEHGISGIWNDMNEPASFNGPLPDDVQFEYGAHEKVHNIYGHFMAKATY
FT                   EGLAKNDGGKRPFVLTRAAYAGSQKYCGGWTGDNHSIWAHIALSLEQVCNLSVSGLAMC
FT                   GSDIGGFGSDTTPELLVRFYEAAVFVPFFRNHSAMGTRRQEPWQFDETTIDAVRKTVKL
FT                   RYRFIPYIYDLAHECEKTGAPIVRPLVYEYHADKHVRNISDEYMLGSFVLVAPVIAPGK
FT                   EAREVYLPDGDWYDYYTGEKYSGGRYILADAPLDKVPVFIKAGAIIPVADGEIRSTEDI
FT                   TEDKISILTYPGKGSFVHYQDDNETFAYRNGAYNAVEYTLDGDKLEKKVLHKGL"
FT   gene            complement(465806..466561)
FT                   /locus_tag="EUBREC_0501"
FT   CDS_pept        complement(465806..466561)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0501"
FT                   /product="exodeoxyribonuclease"
FT                   /note="Cytoplasmic, score:9.98; COG0708 Exonuclease III;
FT                   KEGG:K01142 exodeoxyribonuclease HMMPfam:IPR005135;
FT                   HMMPanther:IPR004808; HMMTigr:IPR000097; HMMTigr:IPR004808;
FT                   ScanRegExp:IPR000097"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74292"
FT                   /db_xref="GOA:C4ZC02"
FT                   /db_xref="InterPro:IPR004808"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR020847"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZC02"
FT                   /protein_id="ACR74292.1"
FT                   /translation="MKFISWNVNGLRACVQKGFLDFFNSIDADFFCIQESKLQAGQIDL
FT                   DLPGYHQYWNYAEKKGYSGTAIFAKNEPLSVSYGIGIEEHDKEGRVITLEYDNFYLVTC
FT                   YTPNSQNELKRLPYRMQWEDDFREYLKTLDAKKPVVLCGDLNVAHNEIDLKNPKTNRKN
FT                   AGFSDEERAKMTELLGSGFTDTFRYFYPDAEGIYSWWSYRFKAREKNAGWRIDYFITSK
FT                   RINDKLKKAAIHTDVLGSDHCPVEVDIEF"
FT   gene            complement(466618..467946)
FT                   /locus_tag="EUBREC_0502"
FT   CDS_pept        complement(466618..467946)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0502"
FT                   /product="hypothetical protein"
FT                   /note="Cytoplasmic, score:8.87; COG1373 Predicted ATPase
FT                   (AAA+ superfamily); KEGG:0hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74293"
FT                   /db_xref="InterPro:IPR025420"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041682"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZC03"
FT                   /protein_id="ACR74293.1"
FT                   /translation="MFKRKIYDKLLQWKKDSDGKTALLIEGARRIGKSTIVESFGRNEY
FT                   KSYIIIDFSIVSKNIRELFEDISDLNYLFLQLQLQYKVDLYERESLIIFDEVQLCPRAR
FT                   QAIKSLVKDHRYDYIETGSLISIKKNVQDILIPSEERKLNMYPMDYEEFLWALNDETTI
FT                   PLIHKLFDSQKPFGEEINRKLMRDFRLYMLVGGMPQAVDEYIKTNNFRKVDDVKRDILN
FT                   LYEDDFKKIDATGKISMLFDAIPAQLNKNASRYQVSSVLTNNRADNTLELIAELKDSKT
FT                   VLVSYHANDPSAGMSTNKDLTRFKLFLCDTGLFTTLMFKDKDFTENIIYEKLLNDKLGT
FT                   NLGYLYENVVAQLLTCNGNELFYYTFFNESSRHNYEIDFLIAKKNKVCPIEVKSSGYKT
FT                   HKSLDEFSIKFSNRILQKYLVYTKDFSKDKDILCLPAYMISFL"
FT   gene            467990..468121
FT                   /locus_tag="EUBREC_0503"
FT   CDS_pept        467990..468121
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0503"
FT                   /product="Hypothetical protein"
FT                   /note="Extracellular, score:8.82"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74294"
FT                   /db_xref="GOA:C4ZC04"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZC04"
FT                   /protein_id="ACR74294.1"
FT                   /translation="MFYYKIAFFISTIYHKIAFSFLLFYHKIAFFKRGLNLQITLFI"
FT   gene            complement(468383..469780)
FT                   /locus_tag="EUBREC_0504"
FT   CDS_pept        complement(468383..469780)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0504"
FT                   /product="hypothetical protein"
FT                   /note="CytoplasmicMembrane, score:10.00; COG0534 Na+-driven
FT                   multidrug efflux pump; KEGG:K03327 hypothetical protein;
FT                   HMMPfam:IPR002528; HMMPanther:IPR002528;
FT                   HMMPanther:IPR015522; HMMTigr:IPR002528;
FT                   ScanRegExp:IPR005829; superfamily:IPR000484"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74295"
FT                   /db_xref="GOA:C4ZC05"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZC05"
FT                   /protein_id="ACR74295.1"
FT                   /translation="MSQETNSAPVTENKMGTMPIGRLVFNMSLPMMISMLVQALYNIVD
FT                   SIFVAKLSENALTAVSLAFPLQTLIIAVATGTGVGVNALLSKSLGAHKYDEANKIGING
FT                   AVLYAFSYVIFLILGLTIVKPFYMSQIGNADIEIMDMGVSYLSTVMIFSFGIFAEIFFE
FT                   RVLTSTGRTIFSMTSQLCGAITNIILDPIMIFGLLGFPKLGATGAAVATVVGQCVAAVV
FT                   AFVCNHKFNHEISLSFKGYSPDFKIMGTIYAIGIPSIIMQSIGSIMTYAMNRILIGFSS
FT                   TAAAVFGVYFKLQSFFFMPVFGLNNGITPIIAFNYGAQNRKRMVKTIKVSLITAFCLLF
FT                   VGFACFEFIPHVLLGMFSASDDMLKIGVPALRIIGVHFLIAWFCIIVGTVFQALGKAVF
FT                   SMIVSIMRQLVVLIPAAYILSKLGGLHAVWWAFPIAEVISFTVSTLFLIRINRTIISKI
FT                   PDGSDVL"
FT   gene            complement(469957..470133)
FT                   /locus_tag="EUBREC_0505"
FT   CDS_pept        complement(469957..470133)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0505"
FT                   /product="Hypothetical protein"
FT                   /note="Unknown cell location"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74296"
FT                   /db_xref="GOA:C4ZC06"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZC06"
FT                   /protein_id="ACR74296.1"
FT                   /translation="MIFLLFFSYFAASLYIFELFIFELIIYLSVILSSGYRNLYPAMLY
FT                   FLRHFFINYYDMI"
FT   gene            470136..470576
FT                   /locus_tag="EUBREC_0506"
FT   CDS_pept        470136..470576
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0506"
FT                   /product="Hypothetical protein"
FT                   /note="Cytoplasmic, score:8.87; COG1846 Transcriptional
FT                   regulators; HMMPfam:IPR000835; FPrintScan:IPR000835;
FT                   Gene3D:IPR011991; HMMSmart:IPR000835; ScanRegExp:IPR000835"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74297"
FT                   /db_xref="GOA:C4ZC07"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR023187"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZC07"
FT                   /protein_id="ACR74297.1"
FT                   /translation="MKFNFEFAEKISRTYSDECRPLCHELKLPQTAFDILMFLANNPEY
FT                   KTARDIVEIRKIKANLVSVNVDKLVNEGYLERKPVENDRRKTELVCTKKAGTVIERGRR
FT                   IQQQFTANLFAGIDEEQKKQLTIVMEQLENNMDEIIRRKSHK"
FT   gene            470573..471349
FT                   /locus_tag="EUBREC_0507"
FT   CDS_pept        470573..471349
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0507"
FT                   /product="Hypothetical protein"
FT                   /note="CytoplasmicMembrane, score:9.99; COG0730 Predicted
FT                   permeases; HMMPfam:IPR002781"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74298"
FT                   /db_xref="GOA:C4ZC08"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZC08"
FT                   /protein_id="ACR74298.1"
FT                   /translation="MSTLITIIVTFFAGMGAGLGTGFAGLSAAAVISPMLITFLGMDPY
FT                   MAVGIALSSDVLASAVSAYTYGKNKNLDVKNGLIMMVTVLCFTVVGSYVSSLVPSATMG
FT                   NFSVFMTFLLGIKFIVRPVMTTKEAMQGVSAKKRAVQSIICGVIIGFICGFIGAGGGMM
FT                   MLLILTSVLGYELKTAVGTSVFIMAFTAFTGAASHFAIGGKPDWFVLLLCIAFTLLWAR
FT                   IAAVFANKASAKTLNRATGIVLVILGIVVFAFSLLS"
FT   gene            471411..471557
FT                   /locus_tag="EUBREC_0508"
FT   CDS_pept        471411..471557
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0508"
FT                   /product="Hypothetical protein"
FT                   /note="Cytoplasmic, score:8.87"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74299"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZC09"
FT                   /protein_id="ACR74299.1"
FT                   /translation="MRIAKLLRYCRNYAMKHRNAPAWTQGRGEPRHGRRVSTVSSGIEA
FT                   LQA"
FT   gene            471476..471772
FT                   /locus_tag="EUBREC_0509"
FT   CDS_pept        471476..471772
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0509"
FT                   /product="Hypothetical protein"
FT                   /note="Cytoplasmic, score:8.87"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74300"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZC10"
FT                   /protein_id="ACR74300.1"
FT                   /translation="MDAGARRTAPRTARFDGFVRHRSSSSIISYSILAAQRSTRGKLCV
FT                   PVGQPGLTSLHKTRKNHHMYFKGIAKKIYHFVQNHIFNRKIHIKIIENIVLLP"
FT   gene            471896..473608
FT                   /locus_tag="EUBREC_0510"
FT   CDS_pept        471896..473608
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0510"
FT                   /product="putative methyl-accepting chemotaxis protein
FT                   (MCP)"
FT                   /note="CytoplasmicMembrane, score:9.49; COG0840
FT                   Methyl-accepting chemotaxis protein; KEGG:K03406 putative
FT                   methyl-accepting chemotaxis protein (MCP);
FT                   HMMPfam:IPR003660; HMMPfam:IPR004089; HMMSmart:IPR003660;
FT                   HMMSmart:IPR004089"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74301"
FT                   /db_xref="GOA:C4ZC11"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR024478"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZC11"
FT                   /protein_id="ACR74301.1"
FT                   /translation="MSSKKDAMKKKLENMHLGERINYGYRMVITMMLISGLLSIAVIGV
FT                   LFFNMLNYVNKVNAADQAVKTCRINVNAAARNVREMALNPDKSTYDDYEQGAKEKLEDV
FT                   DVQLKTIKKSGIVPENQYNEYSKALSDWANIGYSIMDKIKAGQKDEAVDQIINECTPKL
FT                   NKTVELAKEINKLTDERSHQAVVRTYVCAAVGLIVIIICLICAWQLTKRTGKIVLDTIL
FT                   EPLHAIEEVAKELTEGNLHSTLDYRSEDEIGRLAHSMRKSIRILGSYVDDIDRSMKLFA
FT                   DGHFDAQPEVEWRGDFVGILHSFMEFEKSMAVTIKGIQNVSSEVSSAAEQVAASSNDLA
FT                   DGATNQAAVVEELTATVEGVSEQVEQNSKSAKEISGRVDELGGAIWESNGKMQEMVTSM
FT                   HEINEASKQIDQIISTINEIASQTNLLALNASIEAARAGEAGKGFAVVANQVNMLADQS
FT                   AQAAKESAALIETSVQAVEKGMNIAEQTASQLEEVAENSKVITKEVTNIADTLETQTSE
FT                   IKQINEGIEQINDVVQTNSATSQECAAASQQMSSESENLSEMIAKFKISDIEE"
FT   gene            473630..475306
FT                   /locus_tag="EUBREC_0511"
FT   CDS_pept        473630..475306
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0511"
FT                   /product="hypothetical protein"
FT                   /note="Cytoplasmic, score:8.87; COG5001 Predicted signal
FT                   transduction protein containing a membrane domain, an EAL
FT                   and a GGDEF domain; KEGG:K02488 hypothetical protein;
FT                   HMMPfam:IPR001633; HMMSmart:IPR001633"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74302"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZC12"
FT                   /protein_id="ACR74302.1"
FT                   /translation="MRAFDAYKILDEQEAGSLIDLIAPCMDDYLYIIDLKNDTLRISQS
FT                   AVERFMLPDKFMNDATKHLRTLVYEKDRKLLENHKRKIYDGKEKRYNVLCRLMNSKNLP
FT                   VWINCRGEVINDEAGKPRYIIGCMNETGTRQRADNISGLLGEKEMASYLYSQPKEKLSG
FT                   YFIQIGIDDFGIINNVQGQIYGNYILKRVAECIAECLSSGQRIYHLVTDKYMLVDMLSK
FT                   SQDDVVQLFKRIGEKIDEFIVDENYKSIFSISAGVTDISTLAEDAIECRKKSDFSLKCA
FT                   KKRGGGSLYFFEEEDYKVSLRKNTILSALRSATVNDFEGFEVYYQPILDSADRIIGAEA
FT                   LLRFFMHSDEGDEMISPVEFIPLLEKSRLIIPVGEFVLNEAAKMCREMQQYIADFRVNI
FT                   NVSYIQIMRGSMANKILTAIRANNLRPESICIEMTESGFMDMTPCFCSFRKKLDENNIQ
FT                   FIIDDFGTGYSNLRYISEMNPDYVKIDKDFTARAMSSEKDYELFRKIIEMVHSINIKIC
FT                   IEGIEKEEWACAMKEIHVDYMQGYLYGRPCEKGVFLNNYGI"
FT   gene            475296..475532
FT                   /locus_tag="EUBREC_0512"
FT   CDS_pept        475296..475532
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0512"
FT                   /product="Hypothetical protein"
FT                   /note="Extracellular, score:8.82"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74303"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZC13"
FT                   /protein_id="ACR74303.1"
FT                   /translation="MGYKEYFPGVTDKKNANEIFERIFKRTEKLNIKVLGNRRQITCKI
FT                   PKKKLFPKGLQRELSNTYWRKICSRVTSFRTKP"
FT   gene            475421..476101
FT                   /locus_tag="EUBREC_0513"
FT   CDS_pept        475421..476101
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0513"
FT                   /product="GntR-like protein"
FT                   /note="Cytoplasmic, score:8.87; COG2186 Transcriptional
FT                   regulators; KEGG:K05799 GntR-like; HMMPfam:IPR000524;
FT                   HMMPfam:IPR011711; FPrintScan:IPR000524; Gene3D:IPR011991;
FT                   HMMSmart:IPR000524"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74304"
FT                   /db_xref="GOA:C4ZC14"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZC14"
FT                   /protein_id="ACR74304.1"
FT                   /translation="MQNSKEKTLSQRIAERIIKYILEENLQPGDKLPNETVMCERLNVG
FT                   RSSLREAMRALASRNVITIRQGSGSYVSATPGMIDDPFGLTFVEDKQKMIKDLMEIRFL
FT                   IEPSIAAMAAIRADETDIKNILTACENTEKLLLANKNHAEKDIAFHTAIALSSKNIVVP
FT                   KLVPIINSSIPLIRESAKFTMRDETIEIHREIADAIAAHDAVRAHDAMYLHLIYNRKHI
FT                   KSIN"
FT   gene            476297..476698
FT                   /locus_tag="EUBREC_0514"
FT   CDS_pept        476297..476698
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0514"
FT                   /product="hypothetical protein"
FT                   /note="Cytoplasmic, score:8.87; COG2703 Hemerythrin;
FT                   KEGG:K07216 hypothetical protein; HMMPfam:IPR012312;
FT                   BlastProDom:IPR002063; Gene3D:IPR012827; HMMTigr:IPR012827"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74305"
FT                   /db_xref="GOA:C4ZC15"
FT                   /db_xref="InterPro:IPR012312"
FT                   /db_xref="InterPro:IPR012827"
FT                   /db_xref="InterPro:IPR035938"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZC15"
FT                   /protein_id="ACR74305.1"
FT                   /translation="MYEMKPEYYIGIDMIDEEHKQLFKYADEAYELLHDEFTPDKYDKM
FT                   DIILEKLRDYTVKHFADEEQYMESIHYKKMFTQKVQHMEFVQKLDEFIEHHSDEEIDQD
FT                   EQIMGILKYLTDWLINHILYVDCQIPKPQ"
FT   gene            476812..477000
FT                   /locus_tag="EUBREC_0515"
FT   CDS_pept        476812..477000
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0515"
FT                   /product="Hypothetical protein"
FT                   /note="Unknown cell location"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74306"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZC16"
FT                   /protein_id="ACR74306.1"
FT                   /translation="MKHRNAQPWTAGQGVMRHGRRIKAGFVKHRKTVSIISYRILAAQR
FT                   SLRGVCALPRQAVACGP"
FT   gene            477051..478481
FT                   /locus_tag="EUBREC_0516"
FT   CDS_pept        477051..478481
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0516"
FT                   /product="response regulator PleD"
FT                   /note="Unknown cell location; COG2199 FOG: GGDEF domain;
FT                   KEGG:0response regulator PleD HMMPfam:IPR000160;
FT                   HMMSmart:IPR000160; HMMTigr:IPR000160"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74307"
FT                   /db_xref="GOA:C4ZC17"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZC17"
FT                   /protein_id="ACR74307.1"
FT                   /translation="MKNKRRFAMVSVSVIVVALILEAGILKYVNDANAYKLSKVLLDRV
FT                   FTVLDKNDQSEEELIESLKDDYIVRAKAVSYIVDAKPQVENDVEELQKIAKLMSVDEIH
FT                   LFDETGCITSGSVPKYFGYSFDSGTQMSYFKPMLTDKSLTMCQDVTPNTSEGKAMMYAI
FT                   TWNEAGTMMVQVGLKPQRLLDELKQNEISTVVSDMPVYKGMELYVADADTELVKGATDC
FT                   DKIGKTFHDLGLPTDIKESDKPTVRQISVNDSGCRCVIRRGDKYIVAVTIDKSFYMTNS
FT                   VVALLVVGIYLILASCCIMYMFSKIMKEKYEKEKLLYISNTDALTGCLNRHAYETDINK
FT                   LDLKKEWIYISLDLNSLKHVNDTYGHAAGDEMICAAATCMMASFGEFGRVYRIGGDEFA
FT                   VIITQKPDELDAMTKHFDSSVAEWRGKIVDSMTISYGCVRSLEEDWEFVYDIAKEADRR
FT                   MYASKARYYSDSDIDRRK"
FT   gene            complement(478550..478858)
FT                   /locus_tag="EUBREC_0517"
FT   CDS_pept        complement(478550..478858)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0517"
FT                   /product="Hypothetical protein"
FT                   /note="CytoplasmicMembrane, score:9.99; COG4392 Predicted
FT                   membrane protein; HMMPfam:IPR008407"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74308"
FT                   /db_xref="GOA:C4ZC18"
FT                   /db_xref="InterPro:IPR008407"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZC18"
FT                   /protein_id="ACR74308.1"
FT                   /translation="MKNSVFFIYLLILAGSTYLIRVIPFIAIKEKINNSFVRSFLYYIP
FT                   YAVLTAMTIPAVFYATNWWVGAAAGLIAAVIFALKGKGLTTVAVASCVAVFIVELFH"
FT   gene            complement(478903..479604)
FT                   /locus_tag="EUBREC_0518"
FT   CDS_pept        complement(478903..479604)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0518"
FT                   /product="Hypothetical protein"
FT                   /note="CytoplasmicMembrane, score:9.99; COG1296 Predicted
FT                   branched-chain amino acid permease (azaleucine resistance);
FT                   HMMPfam:IPR011606"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74309"
FT                   /db_xref="GOA:C4ZC19"
FT                   /db_xref="InterPro:IPR011606"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZC19"
FT                   /protein_id="ACR74309.1"
FT                   /translation="MENYKRGLTAGIPIALGYLSVSFTFGIMAVSYGLSWWQAVLISMT
FT                   TVTSAGQFAGIGIMMHPGQYFQMLISQITINIRYSFMSISVGQKADSRFSGISRWILGF
FT                   MMTDEIFAVASQEDSVSRSFFAGLSTLPYIGWAVGTLIGAILGSILPDRLMSALSLAIY
FT                   GMFVAIVVPEMKKSRAVVFVVLLALVLSCMFYYIPFLSRISSGITITVVAIVAAVIGSL
FT                   LFPVADDTDKE"
FT   gene            479657..479779
FT                   /locus_tag="EUBREC_0519"
FT   CDS_pept        479657..479779
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0519"
FT                   /product="Hypothetical protein"
FT                   /note="Extracellular, score:8.82"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74310"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZC20"
FT                   /protein_id="ACR74310.1"
FT                   /translation="MKMHFQIVCTTLQSCSCASCNCIKTGNNNCNLPINPLYCS"
FT   gene            479909..480346
FT                   /locus_tag="EUBREC_0520"
FT   CDS_pept        479909..480346
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0520"
FT                   /product="Hypothetical protein"
FT                   /note="Unknown cell location"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74311"
FT                   /db_xref="InterPro:IPR032360"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZC21"
FT                   /protein_id="ACR74311.1"
FT                   /translation="MLNIFYGDMKEAVYNTAAYFKYDYEDNWITDPFVKKMIKDVDQSI
FT                   VLDSGVIDSPVLGKIPPTGLSGGVKTLILVKFEKNKIFNASTCGDNCAKWLLKIAETED
FT                   RTINLRHLMKFEVEPFDIRILNTNEIVHTMEELVSIAGEFV"
FT   gene            480362..481339
FT                   /locus_tag="EUBREC_0521"
FT   CDS_pept        480362..481339
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0521"
FT                   /product="Hypothetical protein"
FT                   /note="Cytoplasmic, score:8.87"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74312"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZC22"
FT                   /protein_id="ACR74312.1"
FT                   /translation="MKGKHKVIVSTKRLKYEFELRRNLTIIQGDSATGKTTLVDMIRDF
FT                   VNNPTGTPVEVICDKKCHVVEGSLWKEQLSGISDCIVFIDEGNEFITTVDFADKIQKTD
FT                   NYYVIVTREALPALPYSVEEIYGIRTSGRYGTLKQSYHEFYRIYGTDTYEDKVSPEIII
FT                   TEDSNSGYQFFEHVCIENGLKCESMNGKSNVFHYLNKHKGEKILVIADGAAFGSEIDRV
FT                   LQVIHGRKNVALYLPESFEWMIMDADILKNNTVRSILSNPSEYVESKLYFSWERFFTAI
FT                   LIEQTKDTYLAYAKRKLNPAYLSGAIKESILRKMNIIDLNKKDE"
FT   gene            481369..482514
FT                   /locus_tag="EUBREC_0522"
FT   CDS_pept        481369..482514
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0522"
FT                   /product="hypothetical protein"
FT                   /note="Unknown cell location; COG1929 Glycerate kinase;
FT                   KEGG:K00865 hypothetical protein HMMPfam:IPR004381;
FT                   Gene3D:IPR004381; HMMPanther:IPR004381; HMMTigr:IPR004381;
FT                   superfamily:IPR004381"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74313"
FT                   /db_xref="GOA:C4ZC23"
FT                   /db_xref="InterPro:IPR004381"
FT                   /db_xref="InterPro:IPR018193"
FT                   /db_xref="InterPro:IPR018197"
FT                   /db_xref="InterPro:IPR036129"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZC23"
FT                   /protein_id="ACR74313.1"
FT                   /translation="MKVVVAIDSFKGSMTSMQAGMACKEGILAAIPKADVVVRSLADGG
FT                   EGTVTALVEGMNGTYEHVDVTGPMGQKVHATYGVLEDDTAVMEMAEASGITLVEGKPDP
FT                   WKATSLGVGEMILDAVHKGCRNFIIGIGGSATTEGGIGMLMALGYEFYDEDDNILPPVF
FT                   GSLARVRKIKADKVPSELKQCHFKIACDVTNPLCTEQGCVYIFGKQKGVQEHEKAQMDK
FT                   MMRQYADCVEEYAGKRFSETPGAGAAGGLGFAFLFGLENVELKSGIDIVLNAIQLDKEL
FT                   KNADIVVTGEGRLDGQSAMGKVPVGVAKAGRKNGCKVIALAGSVTDDAVACNKEGIDAF
FT                   FPIIRGATTLNEAMDIKNAQKNMKNTAEQVFRLIDISSLME"
FT   gene            482609..484048
FT                   /locus_tag="EUBREC_0523"
FT   CDS_pept        482609..484048
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0523"
FT                   /product="prolyl-tRNA synthetase"
FT                   /note="Cytoplasmic, score:10.00; COG0442 Prolyl-tRNA
FT                   synthetase; KEGG:K01881 prolyl-tRNA synthetase
FT                   HMMPfam:IPR002314; HMMPfam:IPR004154; HMMPfam:IPR015263;
FT                   FPrintScan:IPR002316; Gene3D:IPR004154;
FT                   HMMPanther:IPR004499; HMMTigr:IPR004499;
FT                   superfamily:IPR004154"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74314"
FT                   /db_xref="GOA:C4ZC24"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002316"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR004499"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR016061"
FT                   /db_xref="InterPro:IPR017449"
FT                   /db_xref="InterPro:IPR033721"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4ZC24"
FT                   /protein_id="ACR74314.1"
FT                   /translation="MAKEKKLVEAITSMEEDFTQWYTDVVKKAELMDYSSVKGCMIFKP
FT                   NGYAIWENIQKNLDAMFKETGVENVYMPMFIPESLLQKEKDHVEGFAPEVAWVTQGGLE
FT                   TLQERLAVRPTSETLFCELFSKTVQSHRDLPKVYNQWCSVVRWEKTTRPFLRSSEFLWQ
FT                   EGHTVHATAEEAEARTVQMLNIYADFCEKYLAIPMVKGRKTDKEKFAGAEATYTIEALM
FT                   HDGKALQSGTSHNFGDGFPKAFGIQYTDKDNKLQYCHETSWGVSTRLIGAIIMVHGDDS
FT                   GLVLPPKIAPTQVMVIPIQQQKDGVLDKAYDLKDKLSKDFRVKIDATDKTPGWKFAAQE
FT                   VQGISTRIEIGPKDIEKNQCVIVRRDTREKIVVSLDEVNEKLAEVLETMQNDMLEKAKA
FT                   FLASHINDAHDYNEFKAIAETKPGFIRAMWCGDEACENKIKEDTTVTSRCMPFGDQEQI
FT                   SDVCVCCGKPAHKLVYWGKAY"
FT   gene            484396..485736
FT                   /locus_tag="EUBREC_0524"
FT   CDS_pept        484396..485736
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0524"
FT                   /product="tRNA nucleotidyltransferase (CCA-adding enzyme)"
FT                   /note="Cytoplasmic, score:8.87; COG0617 tRNA
FT                   nucleotidyltransferase/poly(A) polymerase; KEGG:K00974 tRNA
FT                   nucleotidyltransferase (CCA-adding enzyme)
FT                   HMMPfam:IPR002646; HMMPfam:IPR006674; HMMTigr:IPR006675"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0524"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74315"
FT                   /db_xref="GOA:C4ZC25"
FT                   /db_xref="InterPro:IPR002646"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR032810"
FT                   /db_xref="InterPro:IPR032828"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZC25"
FT                   /protein_id="ACR74315.1"
FT                   /translation="MRIDLPQNVNFIIDTLYEHGFEAYAVGGCVRDSLLGRVPQDWDIT
FT                   TSAKPAQVKAIFDHTIDTGIQHGTVTVMLEHVGYEVTTYRIDGEYEDARHPKEVTFTSN
FT                   LKLDLERRDFTINAMAYNHRAGLVDEFDGIADLKAHVIRCVGCAHDRFSEDALRMFRAV
FT                   RFAAQLGFDIEAQTKAAIKELAPALSKVSAERIQVELVKLLTSDHPQMMRDLYELGLTA
FT                   VFMPEFDVMMQTPQHNKHHMYSVGEHTLHTLEHVRADKILRLTMLLHDVAKPVCITTDE
FT                   EGQNHFKKHPVVGADMTRKILRRLKFDNRTTDCCCKLVKEHDDRPAITERNVRRAISRI
FT                   GTELFPLLFEVKRADTLGQSMYKRAEKLEYIAEYESVYRKILADHQCVSKKEMKINGSD
FT                   LIKMGVEPGPKLGDILDRLYEQVLDDPSLNEAQKLKELANKIITSLI"
FT   gene            485808..486758
FT                   /locus_tag="EUBREC_0525"
FT   CDS_pept        485808..486758
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0525"
FT                   /product="spore coat protein CotS related"
FT                   /note="Cytoplasmic, score:8.87; NOG09979 non supervised
FT                   orthologous group; KEGG:K06331 spore coat protein CotS
FT                   related; superfamily:IPR011009"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74316"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZC26"
FT                   /protein_id="ACR74316.1"
FT                   /translation="MALEKYELTVSRIIKGRGAYICDTGIGQKLLVPYRGHEQRACTLR
FT                   DTLAFIQRNGMDVEQISQTKEQCIISRDNCEDAYILKDYRAGRECSTDSIDDMRGGSRA
FT                   LAQLHNILEKYPLPSDIEVESLYEKAQRKCAQIVKLKNYILRRSKTNAFEHLFYECYER
FT                   FLEQGQKSAEILCELENSKTSVPIYCHGAFNQHNVVYTQSGRWLPVNFETMHPGYPETD
FT                   LAEYMRKMLEKNHWDTAVADAILDSYCSVRSLDDTSMRLLQALLLFPEKFCKLCNHYSN
FT                   SRKSWVCDRDVDKLAQLIQLSGEREEYLHALQAIV"
FT   gene            486899..488194
FT                   /locus_tag="EUBREC_0526"
FT   CDS_pept        486899..488194
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0526"
FT                   /product="Hypothetical protein"
FT                   /note="Unknown cell location; COG5295 Autotransporter
FT                   adhesin; HMMPfam:IPR013229"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74317"
FT                   /db_xref="InterPro:IPR013229"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZC27"
FT                   /protein_id="ACR74317.1"
FT                   /translation="MLVLLLAACGKQDTDDGVKKFYNSMNDTTEAVGESTQSGLKAAAE
FT                   ENGKSVKKSSDILIVSDINSANETIRVYNYSTGVQYQYYYGLTTGFFDKYGNHMSVSDI
FT                   HQGDVVDISGADSDGKAKRIQKSDKVWTNDAVTNFSVDKNNSVLEIGNSSYRLDERTMI
FT                   FSGSDVIDTDSLTAQDKLAVVGIDKDIVSISVTTGHGTLQLSNTSLFEGSFLQLGDRIF
FT                   AEITKDMSLDVPEGSYTLAVANNGWGGSTDIEIKRGETTKVNLNDLKGEGPKKSSILFE
FT                   VDVQGAKIYVDGSEIDYTSPVEITYGKHTLKVTADGYDTWTRTLYVNSKEATIQITIND
FT                   NKDSLGSDSSGTGTGSTDSSQATAQTPSETASQRADEKDNQSTSKSTTGSSKSTNSSRQ
FT                   TYNKSSDSSKNSLTNKDISDYLSTLTSLLSSK"
FT   gene            488321..488620
FT                   /locus_tag="EUBREC_0527"
FT   CDS_pept        488321..488620
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0527"
FT                   /product="DNA-binding protein HU"
FT                   /note="Unknown cell location; COG0776 Bacterial nucleoid
FT                   DNA-binding protein; KEGG:K03530 DNA-binding protein HU;
FT                   HMMPfam:IPR000119; BlastProDom:IPR000119;
FT                   FPrintScan:IPR000119; Gene3D:IPR000119; HMMSmart:IPR000119;
FT                   ScanRegExp:IPR000119; superfamily:IPR010992"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74318"
FT                   /db_xref="GOA:C4ZC28"
FT                   /db_xref="InterPro:IPR000119"
FT                   /db_xref="InterPro:IPR010992"
FT                   /db_xref="InterPro:IPR020816"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZC28"
FT                   /protein_id="ACR74318.1"
FT                   /translation="MKIQRRNFIMNKADLVAAMAEKAGVSKKDAEASLKAFTDVVAEEL
FT                   KKGEKIQLVGFGTFEVSERAARTGRNPQTGAEMTIAASKAPKFKAGKALKDSLN"
FT   gene            488750..488989
FT                   /locus_tag="EUBREC_0528"
FT   CDS_pept        488750..488989
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0528"
FT                   /product="Hypothetical protein"
FT                   /note="Unknown cell location; COG1188 Ribosome-associated
FT                   heat shock protein implicated in the recycling of the 50S
FT                   subunit (S4 paralog); HMMPfam:IPR002942;
FT                   HMMSmart:IPR002942"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74319"
FT                   /db_xref="GOA:C4ZC29"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR025490"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZC29"
FT                   /protein_id="ACR74319.1"
FT                   /translation="MRLDKFLKVSRLIKRRTVANEACDAGRVTVNGRPAKASVNVKVGD
FT                   IIEIAFGQKTVKVKVLNLLDTTKKEEAKDLFEYI"
FT   gene            489001..489141
FT                   /locus_tag="EUBREC_0529"
FT   CDS_pept        489001..489141
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0529"
FT                   /product="Hypothetical protein"
FT                   /note="Extracellular, score:8.82"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74320"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZC30"
FT                   /protein_id="ACR74320.1"
FT                   /translation="MNPGIYLHMRFHRWHVYVRLSMEHIKNYVRDRKWKKYQAQRVISL
FT                   S"
FT   gene            489099..489383
FT                   /locus_tag="EUBREC_0530"
FT   CDS_pept        489099..489383
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0530"
FT                   /product="Hypothetical protein"
FT                   /note="Cytoplasmic, score:8.87; NOG13819 non supervised
FT                   orthologous group; HMMPfam:IPR012504; HMMTigr:IPR012504"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74321"
FT                   /db_xref="InterPro:IPR012504"
FT                   /db_xref="InterPro:IPR022476"
FT                   /db_xref="InterPro:IPR038705"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZC31"
FT                   /protein_id="ACR74321.1"
FT                   /translation="MEEISGTKSHKLILNNRRTGSFTGILDVLSFDVGEILLETELGML
FT                   DLKGKDLHVNRLNLEKGEADIEGEIDMITYSKVPEVTGKKDKMFGRIFR"
FT   gene            489401..489694
FT                   /locus_tag="EUBREC_0531"
FT   CDS_pept        489401..489694
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0531"
FT                   /product="Hypothetical protein"
FT                   /note="Unknown cell location; HMMPfam:IPR007060"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74322"
FT                   /db_xref="GOA:C4ZC32"
FT                   /db_xref="InterPro:IPR007060"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZC32"
FT                   /protein_id="ACR74322.1"
FT                   /translation="MSKRRAKRRGGTLSVSIIVIAFLVVMVVQVVQLKQKESTYAAQKA
FT                   ELEKQYTKESERADEIESMQQYMQSDQYIEDIAKSKLGLAYDNEIIFKEKDK"
FT   gene            489755..491620
FT                   /locus_tag="EUBREC_0532"
FT   CDS_pept        489755..491620
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0532"
FT                   /product="phosphoprotein phosphatase"
FT                   /note="CytoplasmicMembrane, score:7.63; COG2208 Serine
FT                   phosphatase RsbU, regulator of sigma subunit; KEGG:K01090
FT                   phosphoprotein phosphatase HMMPfam:IPR010822;
FT                   HMMSmart:IPR001932; ScanRegExp:IPR002355;
FT                   ScanRegExp:IPR006162"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74323"
FT                   /db_xref="GOA:C4ZC33"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZC33"
FT                   /protein_id="ACR74323.1"
FT                   /translation="MKKDGGKKMRIANLKKAVWGLMAFASTLVCVMDCYPLIPAVYGVY
FT                   CLSSGHTIIFYIGLIIGMGYFISIPSICKYLFIIAVIYFGERLFVRKSSKNGCLTTAVV
FT                   AACATAVMNLSVTFLGKPYTDEIVLSVAESLVVFSMAFVLCRACEYLRALEHNENPVIA
FT                   GLLPDREEAFATAVSGLSGIISTANVMAVKCTADKIPDESEKIQLEVTGRLCACCEGCS
FT                   VCWTSGTSISDSIKMLADAVRKRMKTEEIVQNRYVDGCPHYTRMVEAATEAFARIELNE
FT                   AWYRRLTENRRVIATQLDAMAELMDSWCRAEKCIDKKRRLRLTRVYVYTKEAGIQVENA
FT                   HIYENARQQVCIKADVCTKIDGGIEISKYVQAVSRAMGVKLRQAHGTVSIISDERTSIV
FT                   LYEENQFYALSGVATKKKTGSQANGDSCSMFQLDDGMYHVCVSDGMGSGKQAQAESTLV
FT                   VDLLEKLLEAGFSRESALKLMNSAMVISAGEESYSTVDFATIDMYTGELELAKTGAAPS
FT                   FIKSGKQVSVIENESLPAGVDVWQESKHSKNTLQSGDFLVMVTDGVLEYLHVKDRQGKL
FT                   MDIIAGVKSDNAGVMAQEILDRVLLDTGGYAMDDMTVVAIGIWEK"
FT   gene            491620..493164
FT                   /locus_tag="EUBREC_0533"
FT   CDS_pept        491620..493164
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0533"
FT                   /product="cell cycle protein MesJ, putative"
FT                   /note="Cytoplasmic, score:8.87; COG0037 Predicted ATPase of
FT                   the PP-loop superfamily implicated in cell cycle control;
FT                   KEGG:K04075 cell cycle protein MesJ, putative;
FT                   HMMPfam:IPR011063; Gene3D:IPR014729; HMMPanther:IPR012094;
FT                   HMMTigr:IPR012795; HMMTigr:IPR012796"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74324"
FT                   /db_xref="GOA:C4ZC34"
FT                   /db_xref="InterPro:IPR011063"
FT                   /db_xref="InterPro:IPR012094"
FT                   /db_xref="InterPro:IPR012795"
FT                   /db_xref="InterPro:IPR012796"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZC34"
FT                   /protein_id="ACR74324.1"
FT                   /translation="MIRRTKDYILENKMINNHSTVLVALSGGADSVCLLLVLNEIKRQC
FT                   ADELDFALEAVHVEHGIRGAESREDARFASDICERLNIPCHVHSVDVPQYAASHGLGLE
FT                   EAARILRYEAFEKEVARILRYEAFEEGAGRYPCEPANASDQKQGNSRQVVVAVAHHMED
FT                   NAETVLFQMLRGSGAKGLSGMHPVSVKNGVTYIRPLLSATRAQIEEYLKENGQAFVTDA
FT                   TNTDTAYSRNKLRHDVFPLLLQINDRAIEHINESAGQLAVMNDFYEQQLKEACDSMVSK
FT                   KEGRVILEISRFECLHPALKSGVARECIHLASGRLKDITSTHIGALVKLAGQQSGRKIN
FT                   LPYGIIAEKSFGEVILFAERCDDEKEEIHITQKELEVLSDTGEQKNIKLSADGSYVTLC
FT                   IQDFNGKMDEIPKKPYTKWFDYDKMKKGFEIRTRKAGDYIIVDDEGHHKKLKQVFTGDK
FT                   IPAQQRAGLWLIAHESLVHAIIGYRSGCSALVTPQTGKVLKITFYGGKQNGFFKKI"
FT   gene            493142..493687
FT                   /locus_tag="EUBREC_0534"
FT   CDS_pept        493142..493687
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0534"
FT                   /product="hypoxanthine phosphoribosyltransferase"
FT                   /note="Cytoplasmic, score:9.98; COG0634
FT                   Hypoxanthine-guanine phosphoribosyltransferase; KEGG:K00760
FT                   hypoxanthine phosphoribosyltransferase HMMPfam:IPR000836;
FT                   HMMTigr:IPR005904; ScanRegExp:IPR002375"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74325"
FT                   /db_xref="GOA:C4ZC35"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005904"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZC35"
FT                   /protein_id="ACR74325.1"
FT                   /translation="MDFSKKYDISVYLTEEQLNKRIAEIGAQITEKYRGQSVYLICILK
FT                   GSIFFTTELAKRIDLPMTMDFMSVSSYGSGTESSGDVKIKKDLEHSIEGENVIIIEDII
FT                   DSGNTLSRLSKLLAKRNPKSLTICTLLDKPERRVVDDVNVDYVGFVIPDKFVVGYGLDY
FT                   DQRFRNLPYIGFVEGEIK"
FT   gene            493723..495552
FT                   /locus_tag="EUBREC_0535"
FT   CDS_pept        493723..495552
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0535"
FT                   /product="ATP-dependent metalloprotease FtsH"
FT                   /note="CytoplasmicMembrane, score:10.00; COG0465
FT                   ATP-dependent Zn proteases; KEGG:K07767 ATP-dependent
FT                   metalloprotease FtsH HMMPfam:IPR000642; HMMPfam:IPR003959;
FT                   HMMPfam:IPR011546; HMMSmart:IPR003593; HMMTigr:IPR005936;
FT                   ScanRegExp:IPR003960"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74326"
FT                   /db_xref="GOA:C4ZC36"
FT                   /db_xref="InterPro:IPR000642"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR005936"
FT                   /db_xref="InterPro:IPR011546"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037219"
FT                   /db_xref="InterPro:IPR041569"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZC36"
FT                   /protein_id="ACR74326.1"
FT                   /translation="MRGIGVYIIIVFAVICIWYWLSAGATSNSYTQSQFEKDLDKNQVK
FT                   SVKVVQNREIPTGSLEVKFKDGTSKVLYVSDVNNIEKTMTKAGYTDYTVADVPAESWIM
FT                   TLLPYLLVFGAMFILFAVMNNNAAAQGGGGKMMNFGKNRAKLTTQEENHIKFSDVAGLK
FT                   EEKEEIAEIVDFLRDPGKYTRLGARIPKGVLLVGPPGTGKTLLAKAVAGEAGVPFFTIS
FT                   GSDFVEMFVGVGASRVRDLFEDAKKNAPCIVFIDEIDAVARRRGTGMGGGHDEREQTLN
FT                   QMLVEMDGFGVNEGIIVMAATNRVDILDPAIMRPGRFDRKVVVGRPDVGGREEILGVHA
FT                   KKKPLAEDVDLKQIAQTTAGFTGADLENLMNEAAIRAAGENREYITQDDIRKSFVKVGI
FT                   GAEKKSRIISDKEKRITAYHEAGHAILFHLLPDVGPVYTVSIIPTGAGAAGYTMPLPEK
FT                   DEMFNTKGRMLQEIVVDLGGRVAEELVFDDITTGASQDIKQATKLAREMVTKYGMSDNI
FT                   GLICYADDEEEVFIGRDLAHAKNYSEGIASAIDVEVKRIIDESYDKAKSMIAEYREVLD
FT                   RCAALLLEKEKITRDEFEALFDEDSKTTVGHNI"
FT   gene            complement(495863..495997)
FT                   /locus_tag="EUBREC_0536"
FT   CDS_pept        complement(495863..495997)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0536"
FT                   /product="Hypothetical protein"
FT                   /note="Unknown cell location"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74327"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZC37"
FT                   /protein_id="ACR74327.1"
FT                   /translation="MTDETGFYAPSMAHNALPSRPWPGISAPLSIILTDSKQLLYALQ"
FT   gene            496193..496274
FT                   /locus_tag="EUBREC_0537"
FT   tRNA            496193..496274
FT                   /locus_tag="EUBREC_0537"
FT                   /product="tRNA-Tyr"
FT   gene            complement(496331..498517)
FT                   /locus_tag="EUBREC_0538"
FT   CDS_pept        complement(496331..498517)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0538"
FT                   /product="Hypothetical protein"
FT                   /note="Unknown cell location; ScanRegExp:IPR006025;
FT                   superfamily:IPR011044"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74328"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZC38"
FT                   /protein_id="ACR74328.1"
FT                   /translation="MLLRNSLHIHHLPKESKLFKRKHVTTLITYSLVFFSAISMTACSF
FT                   SDVSYLFKSPAQKQAILHKSPAFWEDTTSVKGSSNLSILHNVAFEGQPYNDTRQFGDNI
FT                   LMVGQGSYNNSIIETDDQSVQYSFDVYNPWSNEITASLTHDKTDCDDYMIKGDRLWLIN
FT                   SDAGRATIYDKDLKEIKTCKYNPEDYDGNCDTSDSDDGDVPNPGNYYDVSQIATSADGK
FT                   YALVSGVTPDTYKYAVSDIRIDDNTVLSTYEGQSFSMSCVDSKGFVIEADTANNIWNYH
FT                   SSDGENSFFSLPDVVDVTLAEDGDMLIRCQDLSSDNIISYYKYSPATGVSSSFSYNLAT
FT                   RNTGKMSDSSSDSAAADTKTYCSANSVYLPDANCVMMLLYTAQCNPEILIWSLDKGKND
FT                   SKAEITSYNDCDTLLQALRDDGSYVSPYSAIDPADSTDENQEATEEAGKDSEYNTYGDE
FT                   VTLIPDTASYDWGDLSDINARITALEQKYGFSIYFGPEVPKRIDYYDIHQFKNKDKLSV
FT                   ALDSLEEILGCFPDDFFTQLCYGDIRGMRIYLCGDISSGHSDMINEPSGFVNIINNHNV
FT                   MVLNCNYSWDFSYTVGHEISHLIDQRLTFIHTYDEKSEFSEGKWNSFNPDSFSYDDSYA
FT                   NYNPDDPSNHISGYFIDSYGMTFATEDRSEIFGTAIDDYINGIYDDARFTDDSPIRNKL
FT                   DYYSRCIRDGFDTKDWPDTMAWESVLTATGAQAD"
FT   gene            complement(498501..499514)
FT                   /locus_tag="EUBREC_0539"
FT   CDS_pept        complement(498501..499514)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0539"
FT                   /product="alanine racemase"
FT                   /note="Cytoplasmic, score:9.98; COG1609 Transcriptional
FT                   regulators; KEGG:K01775 alanine racemase HMMPfam:IPR000843;
FT                   HMMPfam:IPR001761; HMMSmart:IPR000843;
FT                   ScanRegExp:IPR001209; superfamily:IPR010982"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74329"
FT                   /db_xref="GOA:C4ZC39"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZC39"
FT                   /protein_id="ACR74329.1"
FT                   /translation="MATIKDIAARLGVSISTVSKGLNGASDISEELRQTVLDTAVEMGY
FT                   STKRSRKVENRKLALFIENMNYESIDEFGYDVVLGFKQNAFKHKWDVDIIPVTPQLQAE
FT                   EKYDTYILKNGYCGAFLVGFALHDEWMQQLKNTTMPTVLFDNYIENNPNVAYVGTDSYE
FT                   GIDMAVKHLHNLGHKKIAFINGSLFSLVSDQRQEAFENSMRDAGLEIYPELMGHGYYIP
FT                   ETAQYYVSNFIAAGATAILCGSDTIAKGVISECQLHGFNVPNDISVVGFDDVKFAAALT
FT                   PPLTTIRQERNDLGRCAYIILNSLIHHIPISRTQLRPMLIERESTARVSTAHAAEE"
FT   gene            499769..500374
FT                   /locus_tag="EUBREC_0540"
FT   CDS_pept        499769..500374
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0540"
FT                   /product="4-alpha-glucanotransferase"
FT                   /note="Cytoplasmic, score:9.65; COG1640
FT                   4-alpha-glucanotransferase; KEGG:K00705
FT                   4-alpha-glucanotransferase HMMPfam:IPR003385;
FT                   Gene3D:IPR013781"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74330"
FT                   /db_xref="GOA:C4ZC40"
FT                   /db_xref="InterPro:IPR003385"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZC40"
FT                   /protein_id="ACR74330.1"
FT                   /translation="MEARENLRGSGILLSISSLPSPYGIGTLGREAYNFVDLLGDLKQK
FT                   YWQVLPVGPTIFGDSPYQPSSGCAGNIYFIDLDKLVDEGLLEKEEILGYNWGTDESEID
FT                   YAALHQNRCRILQKAFERFDTNAQEFQDFVKKQSEWLEQYALFMTLKTDNLYKNWSEWP
FT                   SEYRNPQTVALEKYQKKNYNTITFWKFCQYKFFEQWED"
FT   gene            500450..501271
FT                   /locus_tag="EUBREC_0541"
FT   CDS_pept        500450..501271
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0541"
FT                   /product="4-alpha-glucanotransferase"
FT                   /note="Cytoplasmic, score:9.98; COG1640
FT                   4-alpha-glucanotransferase; KEGG:K00705
FT                   4-alpha-glucanotransferase HMMPfam:IPR003385;
FT                   Gene3D:IPR013781"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74331"
FT                   /db_xref="GOA:C4ZC41"
FT                   /db_xref="InterPro:IPR003385"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZC41"
FT                   /protein_id="ACR74331.1"
FT                   /translation="MWAERQLFMMSANDTPEYVAAAGPDKYSESGQVWGNPMYDWDAMK
FT                   EDNFSWWRKRMRVCRELFDIVRIDHFAGIVKAYAVPYGQDKSLSGKWFKGPGRRLVNAI
FT                   NEELEGVNVVADDYTSASLLPGVKKLLAKSGWMGTKVMMFAFDGDPTNEYLPHNYTDSH
FT                   VVAYIGTHDNETIVGSFSDKTDYELAYMYEYLNIENKSQVPNALIRELYHSTAELAIVQ
FT                   MQDILELGNEARMNYPSTVGHNWRWRMTSKPHRLDNEKIAWIRNIAVVYRR"
FT   gene            501287..502612
FT                   /locus_tag="EUBREC_0542"
FT   CDS_pept        501287..502612
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0542"
FT                   /product="putative sugar-binding secreted protein"
FT                   /note="Unknown cell location; COG2182 Maltose-binding
FT                   periplasmic proteins/domains; KEGG:K10108 putative
FT                   sugar-binding secreted protein; HMMPfam:IPR006059;
FT                   ScanRegExp:IPR010916"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74332"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZC42"
FT                   /protein_id="ACR74332.1"
FT                   /translation="MHGNLYIYFFTFYIQKGEEDMKKKVLASLLCASMVATMFAGCGSS
FT                   NGNGTEKADKKAGGKETITVMGPSEDLDDAKGAWLKTECEAFAKANPDFNIEFKYVTSS
FT                   ESDAKDVVTKDPKAAADVYMFANDQLEPLIKANAIAKLGGEAADYVKTSNSEAMAATVT
FT                   YDGDIYAVPYTSNTWFMYYDKRVFSEDDVKSLDTMLTKGKVSFPFDNGWYLNAFYAANG
FT                   CTIFGDGTDKAAGYDFSGDKAVAVTNYIVDLFANPNFVMDNNEGSLGLAGLKDGSVNAY
FT                   FNGNWNYDAVKEALGEENVGVAALPTINIGGKDCQLKAFLGSKAIGVNPNCKNQEVAVK
FT                   LAAFLGSEDAQLAHFKLRAQAPVNKDLVTNEEIAADPVAAAMAKVSSDCSVAQPIIDMA
FT                   GYWDAATPFGDAFQNGAEGQITKDNAAQKTEDFNTQLNDSLK"
FT   gene            502824..504095
FT                   /locus_tag="EUBREC_0543"
FT   CDS_pept        502824..504095
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0543"
FT                   /product="fructose-bisphosphate aldolase"
FT                   /note="CytoplasmicMembrane, score:10.00; COG1175 ABC-type
FT                   sugar transport systems, permease components; KEGG:K01622
FT                   fructose-bisphosphate aldolase HMMPfam:IPR000515"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74333"
FT                   /db_xref="GOA:C4ZC43"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZC43"
FT                   /protein_id="ACR74333.1"
FT                   /translation="MGLANMAHKQIIKGLIFLAIEIAYIAYMVSAGAYYISMLPSLGWR
FT                   KQEEVFNEQKQIYEYVAGDQSVLLLLYGVITIAITVLFIYMWCENLKSGYKAECLSKAG
FT                   KEINSFGKDVKDLFDKNLHKTLMFLPLMGIFIFTVLPLLFMIPMAFTNYSVKGDHLVLF
FT                   DWTGFASFGQVLGLGGKLGKIFWRVLGWTICWAVFATFLCNFLGLILAIVINRKETHCK
FT                   AFWRTCFVISIAVPQFVSLLVMRQMFQQQGAVNNLLLEWGWIDNPLPFWTNTMWARVSV
FT                   ILINCWVGIPYTMLQVTGVLQNVPSELYEAAKIDGANAAQIFFKITLPYIMFIMGPYII
FT                   TQFTGNINNFNVIYLLSAGKPTPVGDSAGKTDLLVTWLYKLTIDNQEYNIGAVIGILTF
FT                   IVLSIVALVTYRNTKSYKDEEGFM"
FT   gene            504095..504982
FT                   /locus_tag="EUBREC_0544"
FT   CDS_pept        504095..504982
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0544"
FT                   /product="putative sugar ABC transport system membrane
FT                   protein"
FT                   /note="CytoplasmicMembrane, score:10.00; COG3833 ABC-type
FT                   maltose transport systems, permease component; KEGG:K10110
FT                   putative sugar ABC transport system membrane protein;
FT                   HMMPfam:IPR000515"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74334"
FT                   /db_xref="GOA:C4ZC44"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZC44"
FT                   /protein_id="ACR74334.1"
FT                   /translation="MSSVAKAKKPMSAGRAKKVAKNSLVHIILGILAVVWLFPIFWIIM
FT                   TSFRAESGAYTKYFFPHGLTFSNYTRLFTETTLLNFPRAFFNTLFISVISCIISTVFVL
FT                   SVAYSMSRLRFKMRKPFMNLAMILGLFPAFMSMVAVYFILKAIGLTEGSMLRLSLILIY
FT                   SAGAGTGFYIAKGFFDTVPKSLTEAAILDGCTQFQVFYKVILPLSKPIVVYTVLTAFLA
FT                   PWLDFVFVRVIVGPNDKYWTVSLLLYNMLEKEFINGWFTRWAAAAVIVSIPISILFVIM
FT                   QRFYVDGLTGAVKG"
FT   gene            505061..505189
FT                   /locus_tag="EUBREC_0545"
FT   CDS_pept        505061..505189
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0545"
FT                   /product="Hypothetical protein"
FT                   /note="Extracellular, score:8.82"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74335"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZC45"
FT                   /protein_id="ACR74335.1"
FT                   /translation="MANLALSGCVVPVWHTVLSLLLLCERCENMCSDFVDTNLFRI"
FT   gene            505208..506902
FT                   /locus_tag="EUBREC_0546"
FT   CDS_pept        505208..506902
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0546"
FT                   /product="alpha-amylase"
FT                   /note="Unknown cell location; COG0366 Glycosidases;
FT                   KEGG:K01176 alpha-amylase HMMPfam:IPR006047;
FT                   Gene3D:IPR013781; HMMSmart:IPR006589"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74336"
FT                   /db_xref="GOA:C4ZC46"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR032091"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZC46"
FT                   /protein_id="ACR74336.1"
FT                   /translation="MINNKIGGHNMVGRAVNRLAGRLTAVALTAAMAVSMLAGCAAGGK
FT                   NTETAAKKEYKPSAMEQMNAKNDPNVIQDNYRTCYEVFVYSFFDSDGDGIGDLKGLTEK
FT                   LDYIEGLGCNEIWMMPIMPSPSYHKYDITDYMNIDKQYGTLDDFDALITECHKRNINVI
FT                   IDFVINHTSNEHPWFKAAADYIKSLPDGAEPDSSECPYVDYYNFSKTNTGGYNQLPGTN
FT                   WYYESQFVDSMPDLNLQSEAVRGEIDKVTSFWLDRGVDGFRLDAVIYYNNNNQTETIDD
FT                   LTWLVNNVKSKKADAYMVGEGWTTYREYAKYYKSGIDSMFNFDFSQQDGYIGKVLNGTA
FT                   NHGASTYGNALVDVENEIKKYTDSYIDAPFYTNHDMGRSAGYYNGDNAEEKTKMAQAMN
FT                   LLMPGNAFLYYGEEIGMRGTANDETKRLAMRWSGDSKAKGMCVGPQNAEETEQTYDTLD
FT                   KQMEDPYSIYNFVKQTISIRNAFPEIARGTNTFEKDLSNDNVCIFTREYNGEKAVLIFN
FT                   PSKDEASVDVSSLGVNDAVAMLQTTKKAPSYKDGTAKLPAYSVLVLK"
FT   gene            complement(506991..507722)
FT                   /locus_tag="EUBREC_0547"
FT   CDS_pept        complement(506991..507722)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0547"
FT                   /product="1-acyl-sn-glycerol-3-phosphate acyltransferase"
FT                   /note="CytoplasmicMembrane, score:7.80; COG0204
FT                   1-acyl-sn-glycerol-3-phosphate acyltransferase; KEGG:K00655
FT                   1-acyl-sn-glycerol-3-phosphate acyltransferase
FT                   HMMPfam:IPR002123; HMMSmart:IPR002123; HMMTigr:IPR004552"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74337"
FT                   /db_xref="GOA:C4ZC47"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="InterPro:IPR004552"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZC47"
FT                   /protein_id="ACR74337.1"
FT                   /translation="MRSVLIVIFVFFYLLLGLPVLGAMWIIHKFAPTWADMAQLRLVQW
FT                   AFRVIIFLSGADIEFIGEENVPKDEAVLYIGNHRSFFDIIITYSRCPRLTGYISKQSIA
FT                   KIPVLGLWMKRLHCLFLDRDDIKQGLKVVLAAIDQVKSGISICVFPEGTRCKNKDDLTE
FT                   VQSFKEGTFKIATKSKCKIVPMAIMGTNEIFEDHLPWVKKNHVVIRYGTPIDPAALSKE
FT                   EQKHLGAHCREVIVDMLHEMI"
FT   gene            507818..508246
FT                   /locus_tag="EUBREC_0548"
FT   CDS_pept        507818..508246
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0548"
FT                   /product="Hypothetical protein"
FT                   /note="Unknown cell location"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0548"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74338"
FT                   /db_xref="InterPro:IPR025748"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZC48"
FT                   /protein_id="ACR74338.1"
FT                   /translation="MSEKLRKILVMAAGVLVISAATVISGCRANISGTESDRMVEYTVI
FT                   CGDEIPEEFKKQINENKAKAMKLTYKDDEYLYIAEGFGTKETGGYSITVNQFYVKDKAM
FT                   YFDTRLIAPDKGEKVSNQASYPYIVIKTELSEMPVVFE"
FT   gene            508528..508770
FT                   /locus_tag="EUBREC_0549"
FT   CDS_pept        508528..508770
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0549"
FT                   /product="Hypothetical protein"
FT                   /note="Cytoplasmic, score:8.87; COG4466 Uncharacterized
FT                   protein conserved in bacteria; HMMPfam:IPR009366"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74339"
FT                   /db_xref="GOA:C4ZC49"
FT                   /db_xref="InterPro:IPR009366"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZC49"
FT                   /protein_id="ACR74339.1"
FT                   /translation="MEQTEIRKVRASIHQQCGNRVKIQQDLGRNKVDIQEGVIQQAYPS
FT                   VFTVLIDDEFEQNPPQLLSFTYTDVITKDIRMQLC"
FT   gene            508895..510469
FT                   /locus_tag="EUBREC_0550"
FT   CDS_pept        508895..510469
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0550"
FT                   /product="Hypothetical protein"
FT                   /note="Cytoplasmic, score:8.87; COG1388 FOG: LysM repeat;
FT                   HMMPfam:IPR002482; HMMSmart:IPR002482"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74340"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR024300"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZC50"
FT                   /protein_id="ACR74340.1"
FT                   /translation="MELITQKIRQCIEKVKDMSQVGFDRDYVIKDNKPDVSKVVCQNGQ
FT                   VKIDEIKASGENIWLSGSIEFEVLYTREEVFEGDEPEENIGGNRVEHIKDAIPFQEKLV
FT                   LQGVCEKDTVRVYTGLDELTVGVINSRKLSVRGIISVELYGEREENLEVAQRIDDKDVE
FT                   QLMGQMKVLKLDSVVRDIVRIKNVVTLPKTKPNICKLISSLVDMRNLEYTYERDHITLT
FT                   GECHACIVYLSEEQEICCFEVQEGFSNEIRCEGDNAGNIAWLRTQPAMHQVEAENDYDG
FT                   ELRQLSIEAALAVDGKVWSEETVEVLNDMYSVSCPVKPVFEKMKVCSLLMKNDTKCRIL
FT                   EQLYRENSKKRILRICGTKTQAAIAQIKNADTGIIVSGVLQVNCVNIVEDDGCPIEMHT
FT                   DSVPFEQFVEIPGMDANTCCEVNVQVDQVQVNLLDNSEYEIKGVVSINAIALQQDEVSV
FT                   ITSVEQEKIASDTEEEAALVGYIVQKDDKMWDIAKRYRTTVENIMEINALTSDSIKPDD
FT                   RLIIARM"
FT   gene            510522..510659
FT                   /locus_tag="EUBREC_0551"
FT   CDS_pept        510522..510659
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0551"
FT                   /product="Hypothetical protein"
FT                   /note="Extracellular, score:7.50"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74341"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZC51"
FT                   /protein_id="ACR74341.1"
FT                   /translation="MENPVNLQKDVEKRFILCNNISECILNVNCGRKGQSDRRITGGIK
FT                   "
FT   gene            510656..511927
FT                   /locus_tag="EUBREC_0552"
FT   CDS_pept        510656..511927
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0552"
FT                   /product="NLP/P60 family"
FT                   /note="Extracellular, score:9.73; COG0791 Cell
FT                   wall-associated hydrolases (invasion-associated proteins);
FT                   KEGG:K01446 NLP/P60 family HMMPfam:IPR000064;
FT                   superfamily:IPR009053"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74342"
FT                   /db_xref="InterPro:IPR000064"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZC52"
FT                   /protein_id="ACR74342.1"
FT                   /translation="MNQKWTRAICTVLTSALVFTGPAVEGTTFSGYINSGLEKVYAKTQ
FT                   KQKDAEKKKSQAEQDLKDKKNEINGLKDQQQTTADDIKNKSAKLDEILAAQKKLQKDIT
FT                   NKQAEIEQNQKDLAAAQEKQQEQYDAMKKRIQFMYENSAEDNIWTAIIESNGITDMLNR
FT                   IEYVSDVYDSDRALMDSYQAAVEQVKEIGTKLDNDMNELTAMQDDYEKQQADVEAAIVA
FT                   LENQKEQYASQIAQAQQQADNYQNIITAQGKIIQEQEAAAAAAAAAAARANSSSSNSSY
FT                   DGGGAGKGGSIASDYASGGGKNPSASTGVSGSSVVSYAMQFVGNPYVWGGNSLTNGVDC
FT                   SGFVHEVYAHFGISTPRYSQAFKSVGQAVSFDNIQPGDVVVYPGHVAIYAGGGVIVEAQ
FT                   STKAGITANRSVQCHTILAIRRLV"
FT   gene            512099..512236
FT                   /locus_tag="EUBREC_0553"
FT   CDS_pept        512099..512236
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0553"
FT                   /product="Hypothetical protein"
FT                   /note="Unknown cell location"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74343"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZC53"
FT                   /protein_id="ACR74343.1"
FT                   /translation="MHMEPRNVLPWTAGQGVMRHGRRIKAGFVEHRKPYRHNSYSLLTA
FT                   "
FT   gene            512443..512883
FT                   /locus_tag="EUBREC_0554"
FT   CDS_pept        512443..512883
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0554"
FT                   /product="hypothetical protein"
FT                   /note="Cytoplasmic, score:8.87; COG1610 Uncharacterized
FT                   conserved protein; KEGG:K09117 hypothetical protein;
FT                   HMMPfam:IPR003789; superfamily:IPR003789"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74344"
FT                   /db_xref="GOA:C4ZC54"
FT                   /db_xref="InterPro:IPR003789"
FT                   /db_xref="InterPro:IPR019004"
FT                   /db_xref="InterPro:IPR023168"
FT                   /db_xref="InterPro:IPR042184"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZC54"
FT                   /protein_id="ACR74344.1"
FT                   /translation="MQMEQLQKDMIAAMKARDKVRKDAISSLVSAAKKAAIDEGCRDNI
FT                   PEELVNKVILKEMKSVKEQIDTCPATRTDLLDEYNTRYAIFEEYAPAMMSAEEVEKELT
FT                   EQFSDVIATGNKGQIMKAVMPHFKGKADGKVINQVVAKLCAK"
FT   gene            512871..513533
FT                   /locus_tag="EUBREC_0555"
FT   CDS_pept        512871..513533
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0555"
FT                   /product="Hypothetical protein"
FT                   /note="Cytoplasmic, score:8.87"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0555"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74345"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZC55"
FT                   /protein_id="ACR74345.1"
FT                   /translation="MRKIRKHITTIILAVLAVIAGVYAYNYHDMKQNIVYNEHLEDVAV
FT                   NVNGKELTLRDMAFYVAYEEMNVEKQALVYDSDNPNKYWNIHTNGEFVRVAARKAAMSM
FT                   AIHDEIFYEMAKKESITLTDDEKAALKNSEKDFWYDLSDIDGAKKLGVEKKDIYSSMEK
FT                   SAIARKYQEIYAGLDNADITDYDFSGGRYEKLLEKNNYKIKEKVWKRVDMGNVTLDH"
FT   gene            513546..514421
FT                   /locus_tag="EUBREC_0556"
FT   CDS_pept        513546..514421
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0556"
FT                   /product="methionine aminopeptidase, type I"
FT                   /note="Cytoplasmic, score:8.87; COG0024 Methionine
FT                   aminopeptidase; KEGG:K01265 methionine aminopeptidase, type
FT                   I HMMPfam:IPR000994; HMMPfam:IPR004027;
FT                   FPrintScan:IPR001714; Gene3D:IPR000994;
FT                   HMMPanther:IPR000994; HMMPanther:IPR002467;
FT                   HMMTigr:IPR002467"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0556"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74346"
FT                   /db_xref="GOA:C4ZC56"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001714"
FT                   /db_xref="InterPro:IPR002467"
FT                   /db_xref="InterPro:IPR004027"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZC56"
FT                   /protein_id="ACR74346.1"
FT                   /translation="MSTKIGRNDPCWCGSGKKYKTCHAAFDMKLEKLAEAHHKIPSHSI
FT                   IKTPDQIAGIKESAKINVAVLDYIGEHIHEGMNTAEIDKIVYDMTTSMGGIPAPLNYEG
FT                   YPYSVCTSVNEQVCHGFPSKDVILKDGDIINVDCSTILNGYFSDSSRMYCIGNVSPEKK
FT                   KLVEVTKECVELGLKEVKPWGFLGDMGQAVHDHAFANGYTVVREIGGHGVGLEFHEDPW
FT                   VGYNTKRGTDMVMAPGMIFTIEPMVNMGKADIYVDDKNNWEVYTDDGLPSAQWEIMVLV
FT                   TEDGHEVLSW"
FT   gene            complement(514649..515977)
FT                   /locus_tag="EUBREC_0557"
FT   CDS_pept        complement(514649..515977)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0557"
FT                   /product="Hypothetical protein"
FT                   /note="Cytoplasmic, score:8.87; NOG16850 non supervised
FT                   orthologous group"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0557"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74347"
FT                   /db_xref="InterPro:IPR025466"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZCJ2"
FT                   /protein_id="ACR74347.1"
FT                   /translation="MNKKEVLELKRRLKKDQATFSRLVGCYVDCNHEKVCKFGGKFLTL
FT                   EEDEYYKYLEISNKVLSGTLGNNLLNLQFPLEEEEVGGRQQILMALRDSELNDETLLDT
FT                   YYDLVIDTYDEAGNYLILLYLDSYDVMTRTKDNINVDESEEVYKYMLCAICPVTLSKPG
FT                   LGYLEKEQRIGARIRDWVVGAPETGFLFPAFNDRSTDIHSTLFYTKNTKEPHSEFMTNG
FT                   LGCGVERTATEQKMAFHSIVRNVLGAEDESTDDKLLDIQQNLSEMADDYAETHDDDDDP
FT                   FILDNEAMNKVLSDCHVSEEKISRIEKSVNEAFGDKPPIAANVIDSKALAANEIRVEKL
FT                   ALESQVGDLTLELNEKNAQLEEKDSVIQEKNNQIEERTSQLLEKQEEIDNYTAQIKTYD
FT                   VVLHVKPEKASQIHAQVINGEKCLVIPMRENENATINGVNTNL"
FT   gene            516030..516152
FT                   /locus_tag="EUBREC_0558"
FT   CDS_pept        516030..516152
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0558"
FT                   /product="Hypothetical protein"
FT                   /note="Extracellular, score:8.82"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0558"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74348"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZCJ3"
FT                   /protein_id="ACR74348.1"
FT                   /translation="MYGINICQLSGAFYVPLSIKKKDDRATTKCYNLGNQRIMI"
FT   gene            516205..518997
FT                   /locus_tag="EUBREC_0559"
FT   CDS_pept        516205..518997
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0559"
FT                   /product="translation elongation factor G"
FT                   /note="Cytoplasmic, score:9.98; COG0480 Translation
FT                   elongation factors (GTPases); KEGG:K02355 translation
FT                   elongation factor G HMMPfam:IPR000640; HMMPfam:IPR000795;
FT                   HMMPfam:IPR005517; HMMPfam:IPR010298; FPrintScan:IPR000795;
FT                   Gene3D:IPR000640; Gene3D:IPR014721; HMMTigr:IPR005225;
FT                   ScanRegExp:IPR000795; superfamily:IPR009000;
FT                   superfamily:IPR009022"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0559"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74349"
FT                   /db_xref="GOA:C4ZCJ4"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005517"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR010298"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035650"
FT                   /db_xref="InterPro:IPR041095"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZCJ4"
FT                   /protein_id="ACR74349.1"
FT                   /translation="MEQKMTNNHITIGILAHVDAGKTTLSEAMLYSTGQIRSLGRVDHQ
FT                   DAYLDNDAQERERGITIFSKQARLDISRGTNAADTAHTADVARTADTARTWHVVMLDTP
FT                   GHVDFSAEMERTLQVLDYAILVISATDGVQGHTRTLWRLLKHYNVPTFIFVNKMDMQGT
FT                   DEEKVQAELKSELSDGCVDFSSQDLFEELAMCSEPLLDEFMESGELTDAHIAQAVAQRE
FT                   VFPCFYGSALKLDRVDTLIQGLSRFMCERNYPDEFSARVYKIGRDDRGSRLTFLKVTGG
FT                   CLRVRDKIEYKAHGGDEAKGLLIEKIDQIRKYSGEKYEIADVAEAGEIVAVTGLSSTFP
FT                   GQGLGFEQQSNMPILEPVLNYRMILPDDVNPAAFMEKLKQLEEEDPQLYIVWVEEFKEI
FT                   HVQLMGQVQMEVLVRLIKDRFGVVVTFGPGSIVYKETIARAVEGVGHFEPLRHYAEVHL
FT                   LLSPAERGSGITVTSTCSEDVLDKNWQRLIATHVEEKEHRGVLTGSALTDVKVTILTGR
FT                   AHVKHTEGGDFRQATYRAIRQGLKSTESVLLEPYYSFILQVPMEYVGRAMTDLEQRFAR
FT                   AGSPQFATTAAREMATITGKAPVATMQDYVSLVHAYTKGLGHLTLELWGYDECHNPAEV
FT                   IAQMHYDSEEDFRNPTGSVFCAHGSGYVVPWDEVPEHMHLPYVYHGDESEEALAASART
FT                   QNAFSAEDAQALAGNRRRTSFEKAVSGMSSVELDAQLADVYAREFGMGKNDIAEDQRRK
FT                   WSGKKKNEYGGLSGKPRTVKHDKHGNPIYPKKSPGEEYLIVDGYNIIFAWEDLKELSRI
FT                   NIDSARDALKDVLSDYQGYKGCHLLLVFDAYKVKGNAGKRETFHNIEVVYTKQDETADA
FT                   FIEKTVFGIRDRYKVTVATSDGLEQQTVMSLGALRMSARELKEHIDMTKRAGMEAFISG
FT                   "
FT   gene            519118..520311
FT                   /locus_tag="EUBREC_0560"
FT   CDS_pept        519118..520311
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0560"
FT                   /product="PLP-dependent aminotransferase"
FT                   /note="Cytoplasmic, score:8.87; COG0436
FT                   Aspartate/tyrosine/aromatic aminotransferase; KEGG:K00811
FT                   PLP-dependent aminotransferase HMMPfam:IPR004839;
FT                   FPrintScan:IPR001176; Gene3D:IPR015421; Gene3D:IPR015422;
FT                   ScanRegExp:IPR004838; superfamily:IPR015424"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0560"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74350"
FT                   /db_xref="GOA:C4ZCJ5"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZCJ5"
FT                   /protein_id="ACR74350.1"
FT                   /translation="MVVNESMYQLGSVRSAIRELFEYGKKRAAIVGKENVYDFSIGNPS
FT                   IPAPQIVNDTIKELVTDYDSVALHGYTSAQGDVETRAAIAEFLNNTHGTHFNADNLYMT
FT                   MGAAASLSICFRALTSDAYDEFITIAPYFPEYKVFVNAAGARLVEVPADTEHFQIDFDA
FT                   LEERINAHTRGVIINSPNNPSGTVYSEETIKKLSDLLEKKSKEIGRPIFIIADEPYREI
FT                   VYDGIKVPFVTKYYDNTLVCYSYSKSLSLPGERIGYVLVPDEVYDKAELYAAVCGAGRA
FT                   LGYVCAPSLFQKMIVKCQGATGDINAYKENRDLLYEGLTRIGYHCFKPDGAFYMFVKAL
FT                   EDDSNAFCEKAKEEDVLIVAADGFGCPGWVRISYCVDREMIKHSMPAFEKIYKKYNK"
FT   gene            520513..525696
FT                   /locus_tag="EUBREC_0561"
FT   CDS_pept        520513..525696
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0561"
FT                   /product="Hypothetical protein"
FT                   /note="Cellwall, score:9.26; NOG16062 non supervised
FT                   orthologous group"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0561"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74351"
FT                   /db_xref="GOA:C4ZCJ6"
FT                   /db_xref="InterPro:IPR022038"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZCJ6"
FT                   /protein_id="ACR74351.1"
FT                   /translation="MRVFNKKLNRLLAIMLASVMGATSLPATQVSADTPSSEYDISNDA
FT                   ASDDISDSKIPDEQDSDNNATEEKQPQQLTVEYTPADDIYVGNKVVPVVKSDRADAAVD
FT                   NLKYTVVEGKNLIEKDTDFASNGIWTAKDTGTVRIKVTKAEDDKYKSAEAEYTVTIKEY
FT                   DYSSMNNSLTGTMLQGTKFYVEAPTLSLASDNQAVYVVRKGDEWIEADKYQLMPQQGDN
FT                   RQTLVIARKDKESGAITDIGSLQLDYKYDTQPPKITLNPKEDDKPAFTKDAVDYYGNVR
FT                   KVDMNIHDVSLDDGSTQLWVKVDDREEFDVFDVDNAQKLIDAGIEYSEWIVTGVDYSSC
FT                   ITFGTKADEEHKYQIIGMYAKDQAEHECNDTSSIEQPFYVDRKAPSGTIGYDADLIDEQ
FT                   NMVSQQASNVYGQLEDISGIKQAFYYVNKSDESGSILNDEQVKALDDSAWKPLELIEDT
FT                   YDARYKYKINTSDLKDTSYNVYVKAQDNCNGETAFFSTSKLVVDTLPPELTVSQDTMTA
FT                   ADEKGWHKDDISYIVKADDSLSGIKSVEYTVFDGKRKIVSGQTVELDASGEGRITIPAA
FT                   EQFNGIDLMLSVKATDYAGLKTEVKGDSFKFSMDSQSPDVSIEPEAGKNRKYFNDDVRI
FT                   KTSVADSISGVVSAKYQIVTDDQSVSDDEGAWNELDESGIINVSAEAYLDKKTDVYVKA
FT                   VDEAGNVTVADLTASGSQPFYIHKAAPAITVTYGTPEQPDPQCISSVKGTEYYRENRIA
FT                   TISVKENELFFDPDETKINVKVDGNEQTQSDAWSEKSYWVKTGEGAEAVYSKQLVFNAG
FT                   HKYELSVSAKDLCGNSDNGFEIEGDKSAEFVIDVQSPTGNIRFDGLSTGMDTVWDLLLP
FT                   KDKYEISRFAAKKVNIAGQLGDEHGGIKSAEYFVSAEDAIIDVDSIQEADWKTLDSLNE
FT                   DGTFSEPIECENKNCVVYVRVTDLSGNVSYISTNGLVVDTCAPAISVITPETASGVYSA
FT                   DVPVSIEVSDENATGVASGIKSVNYTVTNMGQTTQDGTLYSYDKTAAGLKDLENHVTEQ
FT                   FDISAASNNSNEVRIDVTATDNAGTAYTVTKYIKIDTTAPTVQVSYDNNSADTSFGDTA
FT                   YFKAPRTATVKVTERNFDASKVAAEIKAAAGKAPALSNWSTEGGSGNGDDTVHVATIYY
FT                   GHDDDYTFGIGVKDIAGNAAAGVDYANSLAPTKFTIDTTAPVISVVYDNNSASNGNYYN
FT                   NKRTATVTITEHNFDTSRIALSMTAQDAGKSVAAPAFGSWSDNGDIHTATLSFDADATY
FT                   TWSLAYTDKAGNKAKDLAKQEFCIDTTKPVVTIKGVTPGSVNNNSGNMSFVIECTDTNL
FT                   EYFSPVLTVEVYENSRFVRKTITGNVISISNGQRVEFRNLNEDGVYSLTCHAQDKAGNS
FT                   YETVNIIDAGGKQVTETAGQGEKLMDFSINKGGSIFSLDDNTMKLVKDYYVQKVYHDVV
FT                   VREINPDEVTSCTVKVNGKALKQGTDFSVNNVSESDGWHKYEYVISNAVFEKEGQYNIV
FT                   VETKDKADSVAYSDVKSVNIEFIVDKTAPTYTLTGVDKNNENYIGSKNAVLMPKDDGGK
FT                   LGRVKITVVGKDDKEKKVIKEMSGDDMLDYLDKHDGKIEFEVPKEVLSAKDGDSRLMVE
FT                   CADCSVDEGGKTNKVKKIYGKDTEADTEIAEDDVPMESNSSDVKSVETNNDKAVYIIGA
FT                   ILLFVLIIAILIIVYYMRKKMKEKKDNDEQ"
FT   gene            525683..525826
FT                   /locus_tag="EUBREC_0562"
FT   CDS_pept        525683..525826
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0562"
FT                   /product="Hypothetical protein"
FT                   /note="Unknown cell location"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74352"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZCJ7"
FT                   /protein_id="ACR74352.1"
FT                   /translation="MMSNKIITYVFTLPCGGVGKTTMSVACAKAHALQGRLGNEDFEFW
FT                   EE"
FT   gene            525829..526605
FT                   /locus_tag="EUBREC_0563"
FT   CDS_pept        525829..526605
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0563"
FT                   /product="PrpC"
FT                   /note="Unknown cell location; COG0631 Serine/threonine
FT                   protein phosphatase; KEGG:K01090 PrpC HMMPfam:IPR014045;
FT                   HMMSmart:IPR001932"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0563"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74353"
FT                   /db_xref="GOA:C4ZCJ8"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR015655"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZCJ8"
FT                   /protein_id="ACR74353.1"
FT                   /translation="MRFEIAADTDRGIVKETNQDSLLVKCFSTCKGDMAFAVLCDGMGG
FT                   LSKGELASATVVRAFDRWSDEQLPELCKSSNPDIDSLILERQWDEVIQQQNEKIKAYGK
FT                   AHAVNMGTTVVALLVTQKAYYIINVGDSRIYSLSDHIERLTTDQTYVQREIMNGNMTQE
FT                   QAMRDPRRNVLLQCVGASAEVKPEYRTGAMKNGMSLLLCSDGFRHEVSEQEIYEMLKTA
FT                   ATVDGQNMHDRLEQLIRLSMQRGERDNITAALIKAQ"
FT   gene            526615..528312
FT                   /locus_tag="EUBREC_0564"
FT   CDS_pept        526615..528312
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0564"
FT                   /product="serine/threonine protein kinase fused to TPR
FT                   repeats domain"
FT                   /note="CytoplasmicMembrane, score:9.49; COG0515
FT                   Serine/threonine protein kinase; KEGG:K08884
FT                   serine/threonine protein kinase fused to TPR repeats domain
FT                   HMMPfam:IPR000719; BlastProDom:IPR000719;
FT                   HMMSmart:IPR001245; HMMSmart:IPR002290;
FT                   ScanRegExp:IPR000719; ScanRegExp:IPR008271;
FT                   superfamily:IPR011009"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0564"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74354"
FT                   /db_xref="GOA:C4ZCJ9"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZCJ9"
FT                   /protein_id="ACR74354.1"
FT                   /translation="MLEIGSLIDGKYKILNEVGHGGMSVVYLAMNERANKQWAIKEVRK
FT                   DGVKDFEVVKQSLVAETNMLKKLSHPSLPDIVDVIDEDDRFLIVMDYIEGNSLKTALQE
FT                   YGAQSQKNVIKWAKQLCDVLGYLHSQNPPIIYRDMKPANIMLKPDGNVVLIDFGTAREY
FT                   KENNIEDTTCLGTMGYAAPEQFGGMGQTDARTDIYCLGATMYHLVTGMNPCEPPYEIRP
FT                   IREIDPTLSGGLERIITKCTQPDPNNRYQSAAELMYDLEHYTEIDDMYRKNLKRKLAVF
FT                   ITTSVLTMLLGTSTVLSYCAAEHKKNENYNSILKEADTYDNYDNGYYTAIVTDPTRTEA
FT                   YLKLNDKLTDDFVLDRDEAQILNRLMVGIDCKDNNGRVHTYDVMAKLKEKNPKGYEDVC
FT                   YKIGESFLFYYEINVEKDRYSSAAQWFKEAKENHPEAGIYCEISDCLTLISQYDGAKIQ
FT                   QTEKTYEEYKKLWKQINELYAKSENFDSLDAKIQVWNEIDDIVDTNITSFIAVTDKDKV
FT                   MDLLQTIKDKTEKLDKSIMREQITGLQDNIDKTIEKAQSVKEENKDDL"
FT   gene            528302..528721
FT                   /locus_tag="EUBREC_0565"
FT   CDS_pept        528302..528721
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0565"
FT                   /product="Hypothetical protein"
FT                   /note="Cytoplasmic, score:8.87"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0565"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74355"
FT                   /db_xref="GOA:C4ZCK0"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZCK0"
FT                   /protein_id="ACR74355.1"
FT                   /translation="MTYNQYRMIFYVSFTAFAIMLIASIVILIVLEIPKVIGALTGKSA
FT                   RKGIAAIVQKQTAGHIDITSSGPIAPSYNLAGENKKKPGYTQNIDETTVLDAPTEVLQD
FT                   ETTVLEDITEKLQKTNIRFEVTKKIEFLHTTECIS"
FT   gene            528739..529752
FT                   /locus_tag="EUBREC_0566"
FT   CDS_pept        528739..529752
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0566"
FT                   /product="Hypothetical protein"
FT                   /note="Unknown cell location; COG1716 FOG: FHA domain;
FT                   HMMPfam:IPR000253; HMMSmart:IPR000253;
FT                   superfamily:IPR008984"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0566"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74356"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZCK1"
FT                   /protein_id="ACR74356.1"
FT                   /translation="MSKLKVSIKKSTVTAMMKAGRKERINETELSQLARIKPCGIMHVT
FT                   KTKKDSVIYTCPANINLTDRLKKAISKYDFFFMIEQIVIMVEDVYNNGLNVNSVRFNMD
FT                   DVYINEMTKEMYFIYFPIVGGQESADIVGFIENIIYTMTPVINEDTNYISRFMYYVRSF
FT                   HGFNGNAIEKYISREERAVVNVLKNKAVTMQQQIMQQQTMQQQIMQQVMQGSMDGTTVL
FT                   SDDGISVQQIQQMQPVNYHFASLTRQVTGEKIELGKPSFVLGKNPEKSDYAVADNTNIS
FT                   RVHAVITMRNGRYYVMDQNSTNGTFINGRIIKAGQETEILPGDCLMLANEEFIFNE"
FT   gene            529788..530216
FT                   /locus_tag="EUBREC_0567"
FT   CDS_pept        529788..530216
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0567"
FT                   /product="Hypothetical protein"
FT                   /note="Cytoplasmic, score:8.87; COG5022 Myosin heavy chain"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0567"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74357"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZCK2"
FT                   /protein_id="ACR74357.1"
FT                   /translation="MELKELSRRISRYRANVENLQLEKNRLLNEIDALDQEALKIKEYK
FT                   WQAQNRFKCRVDNIAGMDRYSSRNITNLKGRLKSINSLNDGKSYVANAMNAIDSMLRDV
FT                   ENAIRSRNDRIYEINQQLCTYEDNIEQLRIKKRRMESK"
FT   gene            530216..530527
FT                   /locus_tag="EUBREC_0568"
FT   CDS_pept        530216..530527
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0568"
FT                   /product="Hypothetical protein"
FT                   /note="Cytoplasmic, score:8.87"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0568"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74358"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZCK3"
FT                   /protein_id="ACR74358.1"
FT                   /translation="MGQYNLRFEQEEFTELVRLYSELAKIADRQMNEYQMILDIINTNA
FT                   VISGELHDKLEVYEDAVHTYQSILGESFREMSKKLNEFVRDVDEADGDIYGIGTYEAY"
FT   gene            530546..532267
FT                   /locus_tag="EUBREC_0569"
FT   CDS_pept        530546..532267
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0569"
FT                   /product="Hypothetical protein"
FT                   /note="Cytoplasmic, score:8.87; NOG35594 non supervised
FT                   orthologous group"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0569"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74359"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZCK4"
FT                   /protein_id="ACR74359.1"
FT                   /translation="MKFKDFTQEAYDDIQSYMGGEEQWEEINKTYGVVETKGIFQYDYE
FT                   SQLRNAATEYQRQNEEASNSVRRMFDNVNGVDDLYAARFRDEYMDLERFSTAIKELAAL
FT                   INVRSVENIYTMDCQTLKTKAGNIQAKVDSKITEYYKERFYSVDSNGKTVMNWDEINYE
FT                   MRKEFVPDAELQALVSVFPKLSTDDEEETIANIENMLRAGYGNAKDDEWIDNADLEDPK
FT                   YYSVSVTNTFKRAVDIYKTSMDIIDYYSEKCAYRNDEISDEALEEMKEQYRVSSLFKAM
FT                   VDSYPTIGVAYNGKNDGFTIHSDKEKNVTVSVCLKELPFDVSICNITDSNDREILDKYY
FT                   NVKVTNGTINEKVGKENEKVNQIDAYGMVDNQIVSHVLPHGMIENTKQNLENQKEEEKT
FT                   ECRVFFDVTSNTLKGKIIDEAIGLSAVIINETVGDKINKANAAINYLNDLNAAYDENNE
FT                   NVQNNAEIDEAKDRLTETDFTCQDMIEDANYFGMDMEITRVGDTYICDNITMDVEKVTK
FT                   MVDAYNAQAEPKQQVSIDDLEDYARGAGDKNQREDDEDYKALCNRVSNYIDYVIEN"
FT   gene            532289..533218
FT                   /locus_tag="EUBREC_0570"
FT   CDS_pept        532289..533218
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0570"
FT                   /product="Hypothetical protein"
FT                   /note="Unknown cell location"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0570"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74360"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZCK5"
FT                   /protein_id="ACR74360.1"
FT                   /translation="MQRIQKGKFIMKKAISVLMIAACMLCMVTACEKKDKKENDTSAAQ
FT                   ATETDCTAAERVTTEPEGEITISEMIDQRIKEEGKIMIYRMHFGPSKTPLEITEDLNVN
FT                   IISYDGKELIDYGNSSNRRGETRLGDIIHNKVDYSTYNIGAYGGNWKRHRYVSGGDEKY
FT                   VEEEGYVQREITTDDSGNNTQMETLYSYSKGTLYTREEGSEVWNQTEKEDSLDIVSFGT
FT                   FERIKLDGKTYMTFCVRDNLNLIKYYIIPDNKFTENKTVVYDTPGSEGTTVNTVDYLKK
FT                   YQAVPKEELEQMIIFPGSKKAESSQAAD"
FT   gene            533226..533573
FT                   /locus_tag="EUBREC_0571"
FT   CDS_pept        533226..533573
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0571"
FT                   /product="Hypothetical protein"
FT                   /note="Unknown cell location; COG4842 Uncharacterized
FT                   protein conserved in bacteria; HMMPfam:IPR010310"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0571"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74361"
FT                   /db_xref="InterPro:IPR010310"
FT                   /db_xref="InterPro:IPR036689"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZCK6"
FT                   /protein_id="ACR74361.1"
FT                   /translation="MIAYAIIYKNYFKEDMKMAAGQIRMTPDTMRERAGEYRTEADNVQ
FT                   SVIDKMDRLLETLLTEWEGSASEAYANKFAELRPSFVKGKELIDDIAAALDKTAEAVES
FT                   TDTQIANQFSM"
FT   gene            533717..534133
FT                   /locus_tag="EUBREC_0572"
FT   CDS_pept        533717..534133
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0572"
FT                   /product="Hypothetical protein"
FT                   /note="Unknown cell location"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0572"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74362"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZCK7"
FT                   /protein_id="ACR74362.1"
FT                   /translation="MIKSGDSKEIRLKEFSYALERMESLKSGNELTNKIVEIQGTQIHS
FT                   KGDSVPEIESINTFLTTISFAVEDLFNNTYEVLNNSLEQYIASDEAIGKLWEQIQNDND
FT                   EKDSSDPFKDVVINFQSGHDYRLNEILGDVKLKK"
FT   gene            534241..535170
FT                   /locus_tag="EUBREC_0573"
FT   CDS_pept        534241..535170
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0573"
FT                   /product="Hypothetical protein"
FT                   /note="Unknown cell location"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0573"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74363"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZCK8"
FT                   /protein_id="ACR74363.1"
FT                   /translation="MQRIQEGKFIMKKAISVLMVAACMLCMVTACEKKDKKENDTSAAQ
FT                   ATETDCTAAELVTTEPEAEITISEMIDQRIKEEGKIMMYRMHFGPSKTPLEITEDLNVN
FT                   IISYDGKELIDYGNSSNRRGETRLGDIIHNKVDYSTYDIGAYGGSWKRHRRVSGGDEKY
FT                   VEEEGYVQREITTDDSGNNTQMETLYLYSKGTLYTREEGSEVWNQTEKNDNLPVVAFGT
FT                   FERIKLDGKTYMTFCVRDDLNLIKYIIIPDNKFTENKTVVYDTPGTEGTTVNTVDYLKE
FT                   YQAVPKEELEQMIVFPGSKKAESSQAAD"
FT   gene            535178..535327
FT                   /locus_tag="EUBREC_0574"
FT   CDS_pept        535178..535327
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0574"
FT                   /product="Hypothetical protein"
FT                   /note="Unknown cell location"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0574"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74364"
FT                   /db_xref="InterPro:IPR036689"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZCK9"
FT                   /protein_id="ACR74364.1"
FT                   /translation="MIAYANKFAELRPSFVKGKELIDDIAAALDKTAEAVESTDTQIAN
FT                   QFSM"
FT   gene            535493..535657
FT                   /locus_tag="EUBREC_0575"
FT   CDS_pept        535493..535657
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0575"
FT                   /product="Hypothetical protein"
FT                   /note="Unknown cell location"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0575"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74365"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZCL0"
FT                   /protein_id="ACR74365.1"
FT                   /translation="MIKSGDSVPEIESINTFLTTISFAVEDLFNNTYEVLNNSLEQYIA
FT                   SDEVIGKLR"
FT   gene            535674..536603
FT                   /locus_tag="EUBREC_0576"
FT   CDS_pept        535674..536603
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0576"
FT                   /product="Hypothetical protein"
FT                   /note="Unknown cell location"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0576"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74366"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZCL1"
FT                   /protein_id="ACR74366.1"
FT                   /translation="MQRIQKGKFIMKKAISVLMVAACMLCMVTACEKKDKKENDTSAVQ
FT                   ATETDCTAAELVTTEPEGEITISEMIDQRIKEEGKIMIYRMCIAESNTPVEITEDLKVK
FT                   IISYDGDKLKGYKNPDDFLMETRLGDIIHNKVDYSTYNIGTYGGNWKRHRYVSGGDEKY
FT                   VEEEGYVQREITTDDSGNNAQLETLYSYSKGTLYSRDAGSKEWNQTEKEDSLDIVSFGT
FT                   FERIKLDGKTYMTFCVRDNLNLIEYDIIPDNKFTENKTVVYDTPGTEKTTVNTVDYLKE
FT                   YQAVPKEELEQMIVFPGSKKAESSQAAD"
FT   gene            536718..536897
FT                   /locus_tag="EUBREC_0577"
FT   CDS_pept        536718..536897
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0577"
FT                   /product="Hypothetical protein"
FT                   /note="Cytoplasmic, score:8.87"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0577"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74367"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZCL2"
FT                   /protein_id="ACR74367.1"
FT                   /translation="MTKMVDAYNAQAEPKKQVSIKDLEKYARGAGNKNQREDDESYKDL
FT                   CRRVSKYIDYVIEN"
FT   gene            536919..537845
FT                   /locus_tag="EUBREC_0578"
FT   CDS_pept        536919..537845
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0578"
FT                   /product="Hypothetical protein"
FT                   /note="Unknown cell location"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0578"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74368"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZCL3"
FT                   /protein_id="ACR74368.1"
FT                   /translation="MQRRRKGKFIMKKAISVLMVAACMLCMVTACEKKDKKENDTSAVQ
FT                   ATETDCTAAELVTTEPEGEITISEMIDQRIKEEGKIMIYRMRFGPSKTPLEITEDLNVN
FT                   IISYDGKELIGYRNSSNRRGETRLGDIIHNKVDYSTYNIGAYGGNWKRYDNEFGDEKYV
FT                   EEEGYVQREITTDDSGNNAQLETLYSYSKGTLYSRDAGSKEWNQTEKEDSLDIVSFGTF
FT                   ERIKLDGKTYMTFCVRDNLNLIEYDIIPDNKFTENKTVVYDTPGTEKTTVNTVDYLKEY
FT                   QAVPKEELEQMIVFPGSKKAESSQAAD"
FT   gene            537853..538398
FT                   /locus_tag="EUBREC_0579"
FT   CDS_pept        537853..538398
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0579"
FT                   /product="Hypothetical protein"
FT                   /note="Cytoplasmic, score:8.87"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0579"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74369"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZCL4"
FT                   /protein_id="ACR74369.1"
FT                   /translation="MIAYANKFAELRPLFVKVYQNKRRSNMASLLERLKYIIEDIFGKK
FT                   TYAESQRDKYKKVVRNLEKELKKTDNLSDVMDQLATDYNTMEMNPDSAQGKLSDTFVTK
FT                   ESENREAVEKLGADFKEIIAEVKSKLEFARDEYNYWCDEAKREDDEMKIYQQQYYEEEE
FT                   RLRREAAEEEARRKREAS"
FT   gene            538431..538751
FT                   /locus_tag="EUBREC_0580"
FT   CDS_pept        538431..538751
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0580"
FT                   /product="Hypothetical protein"
FT                   /note="Unknown cell location"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0580"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74370"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZCL5"
FT                   /protein_id="ACR74370.1"
FT                   /translation="MQDFKMSGSNMNELLTNMKAIKERIDDSYDELTRLMSRIESDKLW
FT                   KGKEETTFMAYMGLMQQYHKSFSKANGDNPVQQAIDALKSHGDRVDDFYDEFQEYKDME
FT                   DM"
FT   gene            538751..539392
FT                   /locus_tag="EUBREC_0581"
FT   CDS_pept        538751..539392
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0581"
FT                   /product="Hypothetical protein"
FT                   /note="Cytoplasmic, score:8.87"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0581"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74371"
FT                   /db_xref="InterPro:IPR031682"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZCL6"
FT                   /protein_id="ACR74371.1"
FT                   /translation="MRFTEHEMVFFNSITKGNDVFGIPLKFRPQKGHEEEVKKTINGLI
FT                   EKGVLASETELTKMGFFPARALECYKESRNHIIINYLHIALLEQREAIVIIPLKNREYE
FT                   MLRLPRVAVLYLLLKIYPVLQTGTVSEKELLQLQDIDSFLREVKDCKENIMIGEFQDNA
FT                   LTKEWLYYWKNNRIFEYDLNRQIKREVDAVQVRRELLRLLAIDEEVKNYA"
FT   gene            539385..539732
FT                   /locus_tag="EUBREC_0582"
FT   CDS_pept        539385..539732
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0582"
FT                   /product="Hypothetical protein"
FT                   /note="Unknown cell location"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0582"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74372"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZCL7"
FT                   /protein_id="ACR74372.1"
FT                   /translation="MRSSVDTACSGSSEEIKIGAGVLDYISELGNIQAKILEAYTYSEQ
FT                   CVQNIESEDTYQGEAREEMLAFFKSLASNMQKMTFLYQAAGTYIQNAYNTMYYNEQQVV
FT                   EWVIGQIGGNE"
FT   gene            539738..541534
FT                   /locus_tag="EUBREC_0583"
FT   CDS_pept        539738..541534
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0583"
FT                   /product="Hypothetical protein"
FT                   /note="Cytoplasmic, score:8.87; COG5444 Uncharacterized
FT                   conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0583"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74373"
FT                   /db_xref="InterPro:IPR025331"
FT                   /db_xref="InterPro:IPR027797"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZCL8"
FT                   /protein_id="ACR74373.1"
FT                   /translation="MEEEIKKAYMDWSEKGVSYLNCMYVYDTMMDVDEALQTCDTILDE
FT                   IDLGIDYTSREKDIDRLLEGHGTLHRYIDVLNCYVDDKLDQPLKKDFKKNATETISRIH
FT                   LEDFEVDNTLGLTENNYITGGMGYAGTMVEQEKAKLTFADFIGTSDGKADGNGLHISYT
FT                   NGSVEDFASIFAAQYEAMKASGALGEDNNLTQQEFLEQFYRQGEFTHDSSNPFLNFVSS
FT                   VLDITIIKPVIEACTGEDLITGEDLTDMERGLKVVFAMVDLVTLGGAIAATKFSEMGLK
FT                   EGLKAFGKTALIDFAGNTAACGVGALGETFDWPVPITMMLSLAAGITVSISGNKLLFKN
FT                   ADGIEIGSKTLSDAEVKKIGDVLDEGLDINFVSEDLNNILKNKGVTLEEFNALRLRDVS
FT                   TLSEEERVMLRKIGEQLTEDERLKLIGKSTWDKIVNSISSEDRKKIQGWKFTPSDELYI
FT                   KYKEIYDNPKYYNQKTGEIHWPPNDGFKEGSKCKKVIPADTLFKRYGANNGEFLGNSVD
FT                   SFESRALAPHSEGAEIHYYQLVEDYEFTTGKAAPWFGSEGGAQQYVVYKPDGSKYTIKE
FT                   LEETGIIEDVTELVNKGEIVIE"
FT   gene            541527..542096
FT                   /locus_tag="EUBREC_0584"
FT   CDS_pept        541527..542096
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0584"
FT                   /product="Hypothetical protein"
FT                   /note="Unknown cell location; COG5022 Myosin heavy chain"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0584"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74374"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZCL9"
FT                   /protein_id="ACR74374.1"
FT                   /translation="MSNAQHVLNKENLKIENKIITEMKGKVDLENYISIVNENDVYVVN
FT                   ENHRGSKKVKYTTDNYEKAVIFGIVSYKKLNDKIIDREKVRELRKAVNENDIKFVNQCF
FT                   DEFTNIFSEGFFQINKICIIKEDEKANVIFNDNKIVEKASLSRAFVAAFNYCKNYQKII
FT                   DFCNKYKEVLKLLSIDENDIVNAYMF"
FT   gene            542380..543009
FT                   /locus_tag="EUBREC_0585"
FT   CDS_pept        542380..543009
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0585"
FT                   /product="Hypothetical protein"
FT                   /note="Unknown cell location"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0585"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74375"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZCM0"
FT                   /protein_id="ACR74375.1"
FT                   /translation="MGALGETFDWPVPITMMLSLAAGITVSISGNKLLFKNADGIEIGS
FT                   KTLSDDEIKIVEKEIEKNTRTEILSSEEAEEIAFNAIQGADKADTVVLGKFDALKDANE
FT                   NFVYDANGNLIPTDKSYNKVAEQMGAQYFQLDNWDELAAKYDDNEIWKINEKFLDIQIA
FT                   SGREIYLSANPEEFIDGTSFYSKELQYLEKHGYHFVKEGDIWRAVQ"
FT   gene            542996..543409
FT                   /locus_tag="EUBREC_0586"
FT   CDS_pept        542996..543409
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0586"
FT                   /product="Hypothetical protein"
FT                   /note="Unknown cell location"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0586"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74376"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZCM1"
FT                   /protein_id="ACR74376.1"
FT                   /translation="MLFNSEFYELYVNTFEKSIKDMFGTDMKQRVKTCAFQHMGSFILS
FT                   YEYVPLNYIITIENEMRTFNVTIEDKEKASTPLSRIKKYESGLSQDNIHEVICLLKEVL
FT                   RENDFDLYIYKDDKVYIKNKQGVKRIKRVKRSQ"
FT   gene            543503..543910
FT                   /locus_tag="EUBREC_0587"
FT   CDS_pept        543503..543910
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0587"
FT                   /product="Hypothetical protein"
FT                   /note="Cytoplasmic, score:8.87"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0587"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74377"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZCM2"
FT                   /protein_id="ACR74377.1"
FT                   /translation="MNLSLDNDEQVYIAVFDIPLKSNIIGFQTQTLALVFGLNTHIYHG
FT                   SGNVMVDLEKNAEVMKAMQSVLISSHQVLGSMEKTENIEYYESKNVRVYLKTKKGIYFK
FT                   ELEGDSKEDRFLLMLMNHVLGAISQIKKGKL"
FT   gene            543907..544383
FT                   /locus_tag="EUBREC_0588"
FT   CDS_pept        543907..544383
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0588"
FT                   /product="Hypothetical protein"
FT                   /note="Cytoplasmic, score:8.87"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0588"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74378"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZCM3"
FT                   /protein_id="ACR74378.1"
FT                   /translation="MNYDVLINTAIEKNEVLQLLRGEKEYEVIVSEFSPDIFPTDITSV
FT                   LVECFYKQIKKIENIEKIFTTGLEKLLLGDAGDVYIAVLYFDACIFQEERNKATFTLDR
FT                   KIIAEKIRTALNEKKEQLQESVTYKNGMTKKNPWKNIENFNNYYCKKYDFNIIE"
FT   gene            544568..545074
FT                   /locus_tag="EUBREC_0589"
FT   CDS_pept        544568..545074
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0589"
FT                   /product="Hypothetical protein"
FT                   /note="Cytoplasmic, score:8.87"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0589"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74379"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZCM4"
FT                   /protein_id="ACR74379.1"
FT                   /translation="MVSAKEAEVYLHFLESGSTAGMIEAELRAVRKIEELIQSNKIDYN
FT                   GILRIRNKTVKSDVEVVRKTTEDSVEDVGRPAMDENVIEIKKQVRKVIELLEQRIILEP
FT                   NRPILKTLYDRYMKAEEIISSNEDISKIMISGGCRAYLDAFSDYMNPLLGEMDKAEKML
FT                   SNLKK"
FT   gene            545335..545469
FT                   /locus_tag="EUBREC_0590"
FT   CDS_pept        545335..545469
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0590"
FT                   /product="Hypothetical protein"
FT                   /note="Extracellular, score:8.82"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0590"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74380"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZCM5"
FT                   /protein_id="ACR74380.1"
FT                   /translation="MVRIFYKSQYYKRYFRHKKWSLKSGNPFTDFLRYTDNFKRCISV"
FT   gene            546195..546464
FT                   /locus_tag="EUBREC_0591"
FT   CDS_pept        546195..546464
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0591"
FT                   /product="Hypothetical protein"
FT                   /note="Unknown cell location"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0591"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74381"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZCM6"
FT                   /protein_id="ACR74381.1"
FT                   /translation="MYDPDTVSTPKKTQYGKAVNVGKLCEDTIMKLDEVIYNKDQNVMI
FT                   YKKEYLFNISTSDTPTGTHRVFIPLNTQGKKTIRMSQFPLVGGN"
FT   gene            546466..546837
FT                   /locus_tag="EUBREC_0592"
FT   CDS_pept        546466..546837
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0592"
FT                   /product="Hypothetical protein"
FT                   /note="Cytoplasmic, score:8.87"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0592"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74382"
FT                   /db_xref="InterPro:IPR037883"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZCM7"
FT                   /protein_id="ACR74382.1"
FT                   /translation="MKYAIEIALNRIIPKEIKSIIATQRILDILIDGVTENFVVIPMDE
FT                   MLEVYKEQENLFDYDVIPFAILDDDYLCLYYQNNGISIIYWSSERALESKNMAIFQLYS
FT                   SYEDFVKDCITTKPPHGQA"
FT   gene            547130..547555
FT                   /locus_tag="EUBREC_0593"
FT   CDS_pept        547130..547555
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0593"
FT                   /product="Hypothetical protein"
FT                   /note="Cytoplasmic, score:8.87; COG5444 Uncharacterized
FT                   conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0593"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74383"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZCM8"
FT                   /protein_id="ACR74383.1"
FT                   /translation="MCLAYQIGSKTPSEIARSWQGTGKYPGIDDYVDITVEKGTVLYRG
FT                   EPNGTEYFTTLDAIEQSGRDATKLFEGLQVEKNPIHGYRGEMQGYIFNEDVASAYGITN
FT                   ANPQFGKGGLPQYYVPDVQDLIDKGILPPVGNIKLNK"
FT   gene            547571..547954
FT                   /locus_tag="EUBREC_0594"
FT   CDS_pept        547571..547954
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0594"
FT                   /product="Hypothetical protein"
FT                   /note="Cytoplasmic, score:8.87; NOG28583 non supervised
FT                   orthologous group"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0594"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74384"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZCM9"
FT                   /protein_id="ACR74384.1"
FT                   /translation="MLDISNGFFKISDKLIIFPGFSFEQFKNTRFYKNQDGLRIFYLDE
FT                   QQIIDNRKYIVSLFFRNGKIYMMSLICCDKEFSEKDEDKRKILHDDILNELGINQQMEY
FT                   SWGKISSDYDARSNVSSIDIMYF"
FT   gene            548217..548369
FT                   /locus_tag="EUBREC_0595"
FT   CDS_pept        548217..548369
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0595"
FT                   /product="Hypothetical protein"
FT                   /note="Cytoplasmic, score:8.87"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0595"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74385"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZCN0"
FT                   /protein_id="ACR74385.1"
FT                   /translation="MDWSEKGVSYLNCMYVYDIMMDVDEALQTCDTILDEIDLGIDYTS
FT                   REKQS"
FT   gene            548426..548869
FT                   /locus_tag="EUBREC_0596"
FT   CDS_pept        548426..548869
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0596"
FT                   /product="Hypothetical protein"
FT                   /note="Unknown cell location"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0596"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74386"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZCN1"
FT                   /protein_id="ACR74386.1"
FT                   /translation="MAYTNGSVENFAMVDLVTLGGAIAATKFSEMGLKEGLKAFGKTAL
FT                   IDFAGNTAACGVGALGETFDWPVPITMMLSLAAGITVSISGNKLLFKNADGIEIGAKTL
FT                   SDAEVKKIGDVLDETTNSSFANKNLGEVLKQQGLTFCCCNIRW"
FT   gene            548901..549284
FT                   /locus_tag="EUBREC_0597"
FT   CDS_pept        548901..549284
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0597"
FT                   /product="Hypothetical protein"
FT                   /note="Cytoplasmic, score:8.87; NOG24072 non supervised
FT                   orthologous group"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0597"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74387"
FT                   /db_xref="InterPro:IPR017020"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZCN2"
FT                   /protein_id="ACR74387.1"
FT                   /translation="MIKNGEFCIYNDNEYELNEDSDGNLIIITTNRAIIDETFVDKYNS
FT                   GVYSKVILPNEIGKAYDCQTYGVIKGSRVNVEKENEEYYFVGTADCKVAEALGLQRCDK
FT                   YYYEGKFPKQDVEIIEKKEKIEL"
FT   gene            549432..549899
FT                   /locus_tag="EUBREC_0598"
FT   CDS_pept        549432..549899
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0598"
FT                   /product="Hypothetical protein"
FT                   /note="Unknown cell location; NOG24072 non supervised
FT                   orthologous group"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0598"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74388"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZCN3"
FT                   /protein_id="ACR74388.1"
FT                   /translation="MTDRLQHPVISDAAAFLYIKFYLKGGKMRNITFAIYKGIEYSAGI
FT                   KKDGRIVLRSEDDASKKEGFVEKEIGNNRIYIKYVQKDEIEEIYDKKTYAVYEGYKFIV
FT                   VDETEKQILILTMKGDYQEWIRLGMECIDKGMYQKWINKNEAEIEVLKEKI"
FT   gene            549916..550230
FT                   /locus_tag="EUBREC_0599"
FT   CDS_pept        549916..550230
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0599"
FT                   /product="Hypothetical protein"
FT                   /note="Cytoplasmic, score:8.87; NOG24072 non supervised
FT                   orthologous group"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0599"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74389"
FT                   /db_xref="InterPro:IPR017020"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZCN4"
FT                   /protein_id="ACR74389.1"
FT                   /translation="MGRTIKNGRFCIYNGNEFKVNKDSDGNTIILTKNDKIIDSTFIDK
FT                   YGSGVYSKKVSLEEIEELYRYATYAVINNYKVNVEKENQEYYFVGTADCKVAGALGLQR
FT                   "
FT   gene            550264..550815
FT                   /locus_tag="EUBREC_0600"
FT   CDS_pept        550264..550815
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0600"
FT                   /product="Hypothetical protein"
FT                   /note="Unknown cell location; COG5444 Uncharacterized
FT                   conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0600"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74390"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZCN5"
FT                   /protein_id="ACR74390.1"
FT                   /translation="MTDVKDLTKEQIAQMKAIREAVPKIDANTYIQKTIPASDIDKYIG
FT                   EDGWSTIGGYVARYDDVSHIKGYDNVVESSRLDYVTGDGVRPYPEGGDTYAYIKFKTTD
FT                   AEKIKTPYGEIFGGTNTDGPPCTLNGFTGARNGQIIPEWSLSGEYVKPKKGAELHKVVN
FT                   GKDTVVAIFDGKHFVEVKGK"
FT   gene            550819..551202
FT                   /locus_tag="EUBREC_0601"
FT   CDS_pept        550819..551202
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0601"
FT                   /product="Hypothetical protein"
FT                   /note="Cytoplasmic, score:8.87; NOG24072 non supervised
FT                   orthologous group"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0601"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74391"
FT                   /db_xref="InterPro:IPR017020"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZCN6"
FT                   /protein_id="ACR74391.1"
FT                   /translation="MIKNGEFCVYNGNEYELNEDNDGNLIIITTNREIIDATFVDEYNS
FT                   GVYSKIISPNEIQEAYECRTYGLINGYKVSIRKELKDTFFVGTGDRKIADILGLNRTDK
FT                   YLYEKEIAKDKIEVVQEKKKIEV"
FT   gene            551569..551871
FT                   /locus_tag="EUBREC_0602"
FT   CDS_pept        551569..551871
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0602"
FT                   /product="Hypothetical protein"
FT                   /note="Unknown cell location; COG4842 Uncharacterized
FT                   protein conserved in bacteria; HMMPfam:IPR010310"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0602"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74392"
FT                   /db_xref="InterPro:IPR010310"
FT                   /db_xref="InterPro:IPR036689"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZCN7"
FT                   /protein_id="ACR74392.1"
FT                   /translation="MKMASGQIRMTPDTMRGRAGEYRTEAENVQNVIDKMDRLLDTLLT
FT                   EWEGAASEAYANKFAELRPSFVKGKELIDDIAMALDKTAEAVESTDTQIANQFSM"
FT   gene            552043..552636
FT                   /locus_tag="EUBREC_0603"
FT   CDS_pept        552043..552636
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0603"
FT                   /product="Hypothetical protein"
FT                   /note="Cytoplasmic, score:8.87"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0603"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74393"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZCN8"
FT                   /protein_id="ACR74393.1"
FT                   /translation="MFNRDYLEKLKQYVGKDIQLVESDNEVHIYLDSEIQYFLRKKEQK
FT                   YILYVSERGKETEEKRYTSEVDMKRNFALWVKSNFSENIKYPFSGKFREVTSVEELRIL
FT                   MQQYADEKMYSINDPKEEKINILKSEDGQYSIFFLDKNGKKYILEQETENPFVFKRFYN
FT                   EVTYYGETMRQIREYEEVFEDKLEDDVKIQLLGY"
FT   gene            552651..553250
FT                   /locus_tag="EUBREC_0604"
FT   CDS_pept        552651..553250
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0604"
FT                   /product="Hypothetical protein"
FT                   /note="Cytoplasmic, score:8.87"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0604"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74394"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZCN9"
FT                   /protein_id="ACR74394.1"
FT                   /translation="MSINLEKAYFKKLEEYVGKKLNIVSNENEITIIYDVETSYVLQEE
FT                   KEIFYFYCIQRNERIKIAEYYSEKEMETNFAIAIKGFFSEGIDYSGLEKIEGVVKLSDV
FT                   NEIMKVHIGESYYSIMNPQKLKINLEEKGANKYNIYLLGPNGECEYIEENEEAPFGFER
FT                   FYNEALYLKVILERVRGYEAIFEETLSEKEIYDIIK"
FT   gene            553341..553586
FT                   /locus_tag="EUBREC_0605"
FT   CDS_pept        553341..553586
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0605"
FT                   /product="Hypothetical protein"
FT                   /note="Unknown cell location"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0605"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74395"
FT                   /db_xref="InterPro:IPR028954"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZCP0"
FT                   /protein_id="ACR74395.1"
FT                   /translation="MTVEEVKKIIDEESLKGGNLFEKRKNKENEMVIMNVAEQWLVYAT
FT                   DERASKITGSEKKFKTEEEALDNFITRLRALNVLKN"
FT   gene            553878..553997
FT                   /locus_tag="EUBREC_0606"
FT   CDS_pept        553878..553997
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0606"
FT                   /product="Hypothetical protein"
FT                   /note="Extracellular, score:8.82"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0606"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74396"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZCP1"
FT                   /protein_id="ACR74396.1"
FT                   /translation="MASYKGKAAVEGWGKGGAIQYELSSTVELERLGLLREIN"
FT   gene            554013..554261
FT                   /locus_tag="EUBREC_0607"
FT   CDS_pept        554013..554261
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0607"
FT                   /product="Hypothetical protein"
FT                   /note="Cytoplasmic, score:8.87"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0607"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74397"
FT                   /db_xref="InterPro:IPR028954"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZCP2"
FT                   /protein_id="ACR74397.1"
FT                   /translation="MKIEDARKIIQEESLQGYNLCEERENRENEVVLKKENEKWIVYVT
FT                   DERASKITNSVDKYNTETEAIEDFIERLRADKVLCEL"
FT   gene            554364..554624
FT                   /locus_tag="EUBREC_0608"
FT   CDS_pept        554364..554624
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0608"
FT                   /product="Hypothetical protein"
FT                   /note="Cytoplasmic, score:8.87"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0608"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74398"
FT                   /db_xref="InterPro:IPR024962"
FT                   /db_xref="InterPro:IPR029071"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZCP3"
FT                   /protein_id="ACR74398.1"
FT                   /translation="MEDSEKVIVNFVNENNGKRHELEIPLNITAKALVTALNKAYNLQI
FT                   DEANENECYMACEQPIAFLKGNRMLEDFGVRNGSTIIFGRK"
FT   gene            554621..558793
FT                   /locus_tag="EUBREC_0609"
FT   CDS_pept        554621..558793
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0609"
FT                   /product="FtsK/SpoIIIE family protein"
FT                   /note="Cytoplasmic, score:8.87; COG1716 FOG: FHA domain;
FT                   KEGG:K03466 FtsK/SpoIIIE family protein; HMMPfam:IPR002543;
FT                   superfamily:IPR008984"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0609"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74399"
FT                   /db_xref="GOA:C4ZCP4"
FT                   /db_xref="InterPro:IPR002543"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="InterPro:IPR023839"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZCP4"
FT                   /protein_id="ACR74399.1"
FT                   /translation="MKMENYGWSIELNPGYVLIIGNAPDAHIQLDSAYGRAVRVGLQVK
FT                   DDISCAMLSEYSSSYNTLVNGKSIQRIATVKNHDFISIGDFTAYYNNGKIFFDYGAIRT
FT                   NGVEVRPESLDIHTTYPVFIRNTRIQAKRDKTPIEILDPGTIPTKPELNLVTSLMPSII
FT                   MFALVVLLRGVMSKSNGAFVAFSICSMGVGVFTSIFGIINKQKKYKKDLVKRRDTYLEY
FT                   IAKKRNEIEAARREELDCLNAQYYSIEQDIEHIENFDPVLFDRISTDEDFLEVYLGRGN
FT                   VESLRQVDYKKQEKLEVGDDLSSLPEHVAGEYMDIEKAPVVMSLKDANAVGVVGDADSL
FT                   YSMMKNMIMDIISRQYYGDICIYALLDDNIGKYNWLRGIKALNSSNGNRNIVCDQESKN
FT                   RVFENLYKELSIRKDEKVHGRFNIIIVMQDYGIKSHPISKFIEHASELDTVFIFFESKL
FT                   SLLPLYCSRIIDIFDNESAMIYDSVNKTQKKYFEYENIPDWRVQKAVSILEPVECEEIS
FT                   LAGSLRKNISLFELLGINSVQALNLKERWNSSKIYETMAVPLGVNVKDEIVYLNLHEKF
FT                   HGPHGLVAGTTGSGKSEILQTFILGAATLFHPYEIGFVIIDFKGGGMVNQFRKLPHLIG
FT                   AITNIDGKAIDRSLRSIKAELLKRQNLFAQLNVNHIDKYIKAYKEGQAKVALPHLVIIV
FT                   DEFAELKAEQPEFMKELISAARIGRSLGVHLILATQKPAGQVNDQIWSNSKFKLCLKVQ
FT                   TQEDSNEVLKSPLAAEIKEPGRAYLQVGNNEIFELFQSGYSGSPESINGEDDTPFDIYE
FT                   LDFSGKKNLVYKHKLENSEQSRSQLEAVVEYVDKYCKADGVKKLPDICLPALEEVIVYD
FT                   AELAHNDTPLSMTAVIGIYDDPDRQRQGRTVIEIGNKNTIIIGASQFGKTNLLELIVRN
FT                   LAENYSPEELSIYIIDFASMVLKNFEKLAHVGGVVCPSDDERLKNLFKYLSEQIEERRE
FT                   RLLEAGVSSYTSYREAGFTDIPQIVVLIDNYTALKELYLQDSDILLNLCREGGSVGISF
FT                   IISNLQTTGLGYKYLANFSGRIAMFCNESSEYMTLYGSCKLRPDETAGRCLTEIDGEIY
FT                   ECQTFLAFEGTKEIERVNNMHAFVDQINAVYGDITADKIPEIPELLTPDYVDHTFRRKN
FT                   DENIIGIAYDTVAPVYTDHNKCNIITISGADNMGRTNFIKYFALQMLNSEIDTHIYIAD
FT                   DFRRKLSDIGQENVSYDLDPDEFIQKIIMIEVLLEEKYKRLIHQENPEKENTLIIINSQ
FT                   EVYTAISDSKDALNALKNIMGKYKVLNVYLLFGAVPNAQIAYGSPDIYKMMKETKSILF
FT                   FDNLDNCKIVDIPLAIKRKNQKKIEPGDAYYIFEDEVSKVRIPLVSD"
FT   gene            complement(558946..559068)
FT                   /locus_tag="EUBREC_0610"
FT   CDS_pept        complement(558946..559068)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0610"
FT                   /product="Hypothetical protein"
FT                   /note="Unknown cell location"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0610"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74400"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZCP5"
FT                   /protein_id="ACR74400.1"
FT                   /translation="MFVIINYYLLYFLYIFSKAGIERFIISHKIYQGCFGNFPS"
FT   gene            559424..559495
FT                   /locus_tag="EUBREC_0611"
FT   tRNA            559424..559495
FT                   /locus_tag="EUBREC_0611"
FT                   /product="tRNA-Glu"
FT   gene            complement(559519..559650)
FT                   /locus_tag="EUBREC_0612"
FT   CDS_pept        complement(559519..559650)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0612"
FT                   /product="Hypothetical protein"
FT                   /note="Unknown cell location"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0612"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74401"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZCP6"
FT                   /protein_id="ACR74401.1"
FT                   /translation="MLYHTFIVKACKLCPVPQLQLLINSSASYMNIYNEKAGTFMLP"
FT   gene            559765..560106
FT                   /locus_tag="EUBREC_0613"
FT   CDS_pept        559765..560106
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0613"
FT                   /product="Hypothetical protein"
FT                   /note="Cytoplasmic, score:8.87; COG1937 Uncharacterized
FT                   protein conserved in bacteria; HMMPfam:IPR003735"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0613"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74402"
FT                   /db_xref="GOA:C4ZCP7"
FT                   /db_xref="InterPro:IPR003735"
FT                   /db_xref="InterPro:IPR038390"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZCP7"
FT                   /protein_id="ACR74402.1"
FT                   /translation="MRNKEQMEVAMTEKETQCCCCNRKKERSEKEYKDLINRLSRIEGQ
FT                   IRGIKRMLDEDCYCPDIITQVAAANAALNSFNKVLLTNHIKTCVADDIRAGKDETIDEL
FT                   LNTLQKLMK"
FT   gene            560131..560508
FT                   /locus_tag="EUBREC_0614"
FT   CDS_pept        560131..560508
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0614"
FT                   /product="Hypothetical protein"
FT                   /note="Cytoplasmic, score:8.87; HMMPfam:IPR006121;
FT                   ScanRegExp:IPR006121; superfamily:IPR006121"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0614"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74403"
FT                   /db_xref="GOA:C4ZCP8"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR017969"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZCP8"
FT                   /protein_id="ACR74403.1"
FT                   /translation="MSTIITILIIAIIAALVIVGLKETIKHSKGEGACCGGGAMKEDEE
FT                   ATVQLTGEIVTRADVHIDGMHCMNCKNSVTRSLQKMSGVSAAVDLKHGVAHVEATRELS
FT                   DEEITFAIERLDFKVTGIERF"
FT   gene            560564..563146
FT                   /locus_tag="EUBREC_0615"
FT   CDS_pept        560564..563146
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0615"
FT                   /product="heavy-metal transporting P-type ATPase"
FT                   /note="CytoplasmicMembrane, score:9.32; COG2217 Cation
FT                   transport ATPase; KEGG:K01533 heavy-metal transporting
FT                   P-type ATPase HMMPfam:IPR005834; HMMPfam:IPR006121;
FT                   HMMPfam:IPR008250; FPrintScan:IPR001366;
FT                   FPrintScan:IPR001757; HMMPanther:IPR001757;
FT                   HMMTigr:IPR001757; HMMTigr:IPR006403; HMMTigr:IPR006416;
FT                   ScanRegExp:IPR001757; ScanRegExp:IPR006121;
FT                   superfamily:IPR006121"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0615"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74404"
FT                   /db_xref="GOA:C4ZCP9"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR017969"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZCP9"
FT                   /protein_id="ACR74404.1"
FT                   /translation="MKQYTVTGMSCAACSARVEKAVSKVDGVTSCSVSLLTNSMGVEGS
FT                   ATDAQIVEAVEQAGYGASPKGTATESENDKANNSLEQLKAAQDALVDRETPKLRNRLIA
FT                   SLIFLVVLMYFSMGHMMWGWPLPEFFNGNHVAMGLLQLLLTVAVMVINQKFFISGFKGL
FT                   IHGAPNMDTLVALGSAASFGYSVYALFAMTAAQVNGDMDAVMSYMHEFYFESAAMILAL
FT                   ITVGKMLEAHSKGKTTDALKSLMQLAPKTATVVRDGVEQEISVDAVKKGDIFVVRPGEN
FT                   IPVDGEIIDGTTAVNESALTGESIPVDKQPKDAVSAATVNQSGFIKCRATRVGEDTTLS
FT                   QIIQMVSDAAATKAPIAKIADRVSGVFVPAVITIAIITIIAWLIAGETVGFALARGISV
FT                   LVISCPCALGLATPVAIMVGNGKGAKSGILFKTAASLEATGRTQIVALDKTGTITSGEP
FT                   KVTDIVPDETFFEETGNNAGKLLAIAASVEAKSEHPLAKAIMERAKTDEIAVAEVTDFS
FT                   AVVGNGLTAILAGKMIKAGNLAFVSKFVKVSDDMRAKAVEFSKEGKTPLFFAADDRLCG
FT                   IIAVADTIKEDSPEAVRQLKNMGIRVVMLTGDNEQTANAIGKQAGVDEVIAGVLPDGKE
FT                   AVIRKLKKQGRVAMVGDGINDAPALTRADMGIAIGAGSDVAIDAADVVLMKSRLIDVPA
FT                   AVRLSRATLTNIHENLFWAFFYNVIGIPLAAGLWYPLLGWKLNPMFGAAAMSLSSFCVV
FT                   TNALRLNLCRVYDPKHDRKATSDRKNKTNKPNESEEKSMTKTMNIEGMMCGHCEARVKK
FT                   ALEALDAVSEAAVSHESGTAVVTLSSDISDEKLKETVEAEDYKVTSIQ"
FT   gene            563168..564334
FT                   /locus_tag="EUBREC_0616"
FT   CDS_pept        563168..564334
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0616"
FT                   /product="endo-1,4-beta-glucanase"
FT                   /note="Extracellular, score:9.73; COG2730 Endoglucanase;
FT                   KEGG:K01179 endo-1,4-beta-glucanase HMMPfam:IPR001547;
FT                   Gene3D:IPR013781"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0616"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74405"
FT                   /db_xref="GOA:C4ZCQ0"
FT                   /db_xref="InterPro:IPR001547"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZCQ0"
FT                   /protein_id="ACR74405.1"
FT                   /translation="MKKYIALVLAAVLVLGIFTGCGNKGNKETESQTDEKVTESVNSAE
FT                   NNTEDSTQNSTENQNVADTEQLTTENGQESSVLACPSVNGKLHVEGSKLVDQNNNEVQL
FT                   RGVSTHGLAWYPQYVTNDCFATLKSFGANVVRLAMYTYESGGYCTDGDRQQLETLVQNG
FT                   VQYALNNDMYVIIDWHVLNEGNPNRYSDVAKTFFAKMAQQYASYNNVIYEICNEPCKGA
FT                   TWGDVKFYASEVIPSIRSYDKDAVILIGTPNWSQDVDEAVKDPVTGYDNIMYTLHFYAA
FT                   THKEDLQNKLKSAADAGLPIFVSEFGICSADGNGQVDIDSANSWISLLDSYGISYVCWN
FT                   LSNKDEKSALLTPACDKTSGFIYEDLSDEGKWLYGVLTSHVTQETSGT"
FT   gene            564396..564731
FT                   /locus_tag="EUBREC_0617"
FT   CDS_pept        564396..564731
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0617"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0617"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74406"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZCQ1"
FT                   /protein_id="ACR74406.1"
FT                   /translation="MVKSLSCAKSCAPANAGIEASMHSAGMHMRQMQILLSGGKSAADM
FT                   TLGLVDIENVTRFCGKLRVYAKQPVSIRDILVHSGFADAKLLCSLTHRGIVFNYVVGDF
FT                   HRPCLNI"
FT   gene            complement(564465..564752)
FT                   /locus_tag="EUBREC_0618"
FT   CDS_pept        complement(564465..564752)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0618"
FT                   /product="stage III sporulation protein D"
FT                   /note="Cytoplasmic, score:8.87; NOG13855 non supervised
FT                   orthologous group; KEGG:K06283 stage III sporulation
FT                   protein D; HMMTigr:IPR014208; ScanRegExp:IPR001034;
FT                   superfamily:IPR009057"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0618"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74407"
FT                   /db_xref="GOA:C4ZCQ2"
FT                   /db_xref="InterPro:IPR014208"
FT                   /db_xref="InterPro:IPR018356"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZCQ2"
FT                   /protein_id="ACR74407.1"
FT                   /translation="MQEYFLKSYIETRAVEIANYIVENNATVRQAAKQFGISKSTVHKD
FT                   ITDADRLLRIDPELAAKARHILDINKSERHIRGGLATREKYLHLPHVHAG"
FT   gene            complement(564951..565577)
FT                   /locus_tag="EUBREC_0619"
FT   CDS_pept        complement(564951..565577)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0619"
FT                   /product="cytidylate kinase"
FT                   /note="Cytoplasmic, score:8.87; NOG14451 non supervised
FT                   orthologous group; KEGG:K00945 cytidylate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0619"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74408"
FT                   /db_xref="GOA:C4ZCQ3"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZCQ3"
FT                   /protein_id="ACR74408.1"
FT                   /translation="MSNKHFYRLGGFIMSFKIITISREFGSGGRFIGEQIAQKCGIEFY
FT                   DKKIIEHVAKELGISEQIVANQGEYAPAGNIFSYAFVGRDITGVSLSDQIFNIQQKLIK
FT                   DIAQKEPCVIVGRCADYILSDRDDVLNVFIEGNKPEKAARIKKLYQKSDDEVKKLLKDV
FT                   DKKRSVNYRYFTDKEWGNRKNYDLVLNSSVLGYDKCIELITAAYA"
FT   gene            565819..567393
FT                   /locus_tag="EUBREC_0620"
FT   CDS_pept        565819..567393
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0620"
FT                   /product="bifunctional GMP synthase/glutamine
FT                   amidotransferase protein"
FT                   /note="Cytoplasmic, score:8.87; COG0518 GMP synthase -
FT                   Glutamine amidotransferase domain; KEGG:K01951 bifunctional
FT                   GMP synthase/glutamine amidotransferase protein
FT                   HMMPfam:IPR000991; HMMPfam:IPR001674; HMMPfam:IPR011063;
FT                   FPrintScan:IPR001317; FPrintScan:IPR006220;
FT                   FPrintScan:IPR011702; Gene3D:IPR014729; HMMTigr:IPR001674;
FT                   HMMTigr:IPR004739; ScanRegExp:IPR012998"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0620"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74409"
FT                   /db_xref="GOA:C4ZCQ4"
FT                   /db_xref="InterPro:IPR001674"
FT                   /db_xref="InterPro:IPR004739"
FT                   /db_xref="InterPro:IPR011063"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR022955"
FT                   /db_xref="InterPro:IPR025777"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4ZCQ4"
FT                   /protein_id="ACR74409.1"
FT                   /translation="MDQEKVIVIDFGGQYNQLVARRVRECNVYCEIYSYKIDIEKIKEM
FT                   NPKGIILTGGPNSCYEENSPSYRKELFELGIPVLGICYGAQLMMHKLGGKVITPEVGEY
FT                   GKTEITYSANGVMFKDLPSESVCWMSHFDRIAEAAPGFEVVAHTADCPIAATQNVEKKL
FT                   YAVQFHPEVLHTKNGTQMIYNFVRGVCGCAGTWKMDSFVKNTIDEIREQVGDGKVLLAL
FT                   SGGVDSSVLAALLAKAIGKQLTCVFVDHGLLRKNEGDEVEGVFGKDGSFDINFVRVNAQ
FT                   ERYYSKLAGVTEPERKRKIIGEEFIRVFEEEAKKIGKVDFLAQGTIYPDVVESGLGGES
FT                   AVIKSHHNVGGLPEHVDFKDIVEPLRNLFKDEVRKVGLELGLPDYLVFRQPFPGPGLGI
FT                   RIIGEVTAEKVRIVQDADWIYRSEVEKAAKEYKEAHGEEPSWMPNQYFAALTNMRSVGV
FT                   MGDERTYDYAVAVRAVRTVDFMTAEAAEIPFEVLQTVMSRIINEVKGVNRVFYDLTSKP
FT                   PGTIEFE"
FT   gene            complement(567420..569114)
FT                   /locus_tag="EUBREC_0621"
FT   CDS_pept        complement(567420..569114)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0621"
FT                   /product="Hypothetical protein"
FT                   /note="Unknown cell location"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0621"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74410"
FT                   /db_xref="GOA:C4ZCQ5"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZCQ5"
FT                   /protein_id="ACR74410.1"
FT                   /translation="MIYKAVCNMSTQDSNTKKIAYGELHFYYPFKFDNKYSYTQIHKKI
FT                   EKSPLLFTDEYQQKVIDSLGYSLVETFNDIKKEFEASSSLNNPCILKMSDYQKYKSMKC
FT                   APMSINPDDILLEIESGESSIKFYIKDADLELLNQRIIRLQEEYDISLKFYGHNFTNRQ
FT                   DRFLLLPLKIELENGKFTWLYPLIYLFENNMGILKLELPIFDSCIEPLLENDYDRFLTK
FT                   IINKWNIKNYNSETTLSSIQNFYLSNLLDDIKIDMVSYSNELKNIILIDFDGRPQHINS
FT                   IPNDVKEDLFRIICAPVPSRNNTTYSKDADEYLKNHSWGGHGVKYIAKSTGGCLSFIDK
FT                   TISDYVSDDYKTETKTSVLTPFNDYYNLCNKLARDLCVNVEFALIIILLKKTNESNDYF
FT                   NKIASMKKLSDTRIEYNKNILFISELQENCYGSVSEQTALLEKMMPHYFKHEITSAKKI
FT                   AIDNILQQNEQEKNERFQNYISTGGLILTLIFGLPSLYETLTIFRKLFSFYPYNIPYLT
FT                   LENTSIILWLTLNGIIILKLYLRKYYPKIKKYCHLIVTRHRKSQESP"
FT   gene            complement(569104..569547)
FT                   /locus_tag="EUBREC_0622"
FT   CDS_pept        complement(569104..569547)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0622"
FT                   /product="Hypothetical protein"
FT                   /note="Cytoplasmic, score:8.87; COG2932 Predicted
FT                   transcriptional regulator; HMMPfam:IPR001387;
FT                   HMMSmart:IPR001387; superfamily:IPR010982"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0622"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74411"
FT                   /db_xref="GOA:C4ZCQ6"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZCQ6"
FT                   /protein_id="ACR74411.1"
FT                   /translation="MTVGEKIRKFRIDQGYTQKELAIMSGLSESAIRNYELGNRFPSSE
FT                   QLEKIANSLKISPYAMSDPNFDTYVSVMHALFALEDQYGLHAYRDESGVPQLMFKDKGH
FT                   DSSNMLDNIGTWADMYQKFRNEEITEKEYLDWKAKYPQNQNDI"
FT   gene            569724..569912
FT                   /locus_tag="EUBREC_0623"
FT   CDS_pept        569724..569912
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0623"
FT                   /product="Hypothetical protein"
FT                   /note="Unknown cell location"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0623"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74412"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZCQ7"
FT                   /protein_id="ACR74412.1"
FT                   /translation="MASKLFISAKEVAKELEVSDSYAYRLIRQLNAELEQKGFVVVKGK
FT                   ISRKYFEERVYGMNEMK"
FT   gene            569927..571012
FT                   /locus_tag="EUBREC_0624"
FT   CDS_pept        569927..571012
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0624"
FT                   /product="Hypothetical protein"
FT                   /note="Cytoplasmic, score:8.87; COG0582 Integrase;
FT                   HMMPfam:IPR002104; Gene3D:IPR013762; superfamily:IPR011010"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0624"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74413"
FT                   /db_xref="GOA:C4ZCQ8"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR028259"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZCQ8"
FT                   /protein_id="ACR74413.1"
FT                   /translation="MTVIKNQKSNTYEVRTYYKDWTGVRKQKTKRGFKRKCDAQEWERA
FT                   FKLKENLSLDMYFEDFVDLYLNDIKSRIKYNTWLTKKHIVEKKILPYFSKKKLQEIKPS
FT                   DIRQWQNTMMNYRNKQGEGYSQVYLKTIHNQLSAILNHAVNFYDLKSNAARKAGSMGKE
FT                   RTKEMLFWTKEEYMKFIEAVADKPISFYAFEILYWCGVRMGELLALTPADFDFQACTIR
FT                   INKSYQRLEGKDIITDPKTTKRNRMITMPEFLSEELESYIGMLYGLNENDRIFQISKSY
FT                   LHHEMDRGVKLSGVKRIRIHDLRHSHVSLLINMGYSAVAIGERVGHESVEITYRYAHLF
FT                   PTIQTEMAENLNQEREEYLDE"
FT   gene            571005..571208
FT                   /locus_tag="EUBREC_0625"
FT   CDS_pept        571005..571208
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0625"
FT                   /product="Hypothetical protein"
FT                   /note="Cytoplasmic, score:8.87"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0625"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74414"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZCQ9"
FT                   /protein_id="ACR74414.1"
FT                   /translation="MSEKNRDSKNRWRNVTIAFRMSPEEDAELDLRVKLCGYQTRQEYI
FT                   IESVLHQKVTAVGNPLMLGLLI"
FT   gene            571205..571600
FT                   /locus_tag="EUBREC_0626"
FT   CDS_pept        571205..571600
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0626"
FT                   /product="Hypothetical protein"
FT                   /note="Cytoplasmic, score:8.87"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0626"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74415"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZCR0"
FT                   /protein_id="ACR74415.1"
FT                   /translation="MIAADEDRLERVRDNIDAAENEYVKYADMITDKKNKLEMLTSKEN
FT                   ELVERTKIAENVYDMFRHGGDDDVREKLIDVMYENQRLQKENKSLKELLEKAYDFMKQF
FT                   VIDGVNLLEKFMESVRKVMERLSPKTK"
FT   gene            571650..571865
FT                   /locus_tag="EUBREC_0627"
FT   CDS_pept        571650..571865
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0627"
FT                   /product="Hypothetical protein"
FT                   /note="Cytoplasmic, score:8.87; HMMPfam:IPR014795;
FT                   superfamily:IPR010985"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0627"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74416"
FT                   /db_xref="GOA:C4ZCR1"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="InterPro:IPR014795"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZCR1"
FT                   /protein_id="ACR74416.1"
FT                   /translation="MIDNRNGGTDIMRKSISISIRVSEDELEKFKEAARLEAYASYSEF
FT                   VRRTALIEATRIIKENNEGENTYEHN"
FT   gene            571852..573870
FT                   /locus_tag="EUBREC_0628"
FT   CDS_pept        571852..573870
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0628"
FT                   /product="DcmB"
FT                   /note="Cytoplasmic, score:8.87; COG0270 Site-specific DNA
FT                   methylase; KEGG:K00558 DcmB HMMPfam:IPR001525;
FT                   FPrintScan:IPR001525; HMMPanther:IPR001525;
FT                   HMMTigr:IPR001525; ScanRegExp:IPR001525"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0628"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74417"
FT                   /db_xref="GOA:C4ZCR2"
FT                   /db_xref="InterPro:IPR001525"
FT                   /db_xref="InterPro:IPR018117"
FT                   /db_xref="InterPro:IPR019059"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR031303"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZCR2"
FT                   /protein_id="ACR74417.1"
FT                   /translation="MNIISLFSGCGGLDLGFESAGFNIPVANEFDKTIWATFKANHPNT
FT                   HLIEGDIRQVTKEDIEQYIDGEIDGIIGGPPCQSWSEAGSLKGIKDARGQLFFDYIRIL
FT                   KEFQPKFFLAENVSGMLANRHSEAVQNILNLFDGAGYDVSFTLVNAKDYGVAEERKRVF
FT                   YIGFRKDLNIDFGFPKGSTKEDDKKITLRDIIWDLQDTAVPSGEKNHHNPEAINNNEYY
FT                   TGAYSPIFMSRNRVKSWDEQAFTVQASGRQCQLHPQAPKMVKVGQNDCRFVEGKEHLYR
FT                   RMTIREVARVQGFPDNFKFIYEDTNTAYKMIGNAVPVNLAYEIAVAIKKYLEGNSADVV
FT                   VDDDVIDAKEVNEKKVSTKSNDQGRAYEYAWIKTLYKALCEMRKTKIVDNSSLHANEKA
FT                   WMLMDEEMQQTFMISAEAAINEVLEMEPRLSENDNDELTLEFQKDGAGVKGDVRDIVIR
FT                   RDDIEWEIGLSIKHNHDAVKHSRLSHKLDFGKEWFDIPCSNEYWGAVNPIFDMLKSEKE
FT                   NGSRWSEIVQKDENVYVPLLQAFMDEVNRAYKEDKNMPEKMIEYLIGKEDYYKIVSHDS
FT                   KRLTLIHTFNMHDTLNKSSKDKVSEIEVPVVELPTRLIDIGFKPKSNNTVEMILDNGWQ
FT                   LSFRIHSASTKVEPSLKFDVQFISMPVSVCTIKCVWK"
FT   gene            573857..574354
FT                   /locus_tag="EUBREC_0629"
FT   CDS_pept        573857..574354
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0629"
FT                   /product="Hypothetical protein"
FT                   /note="Cytoplasmic, score:8.87"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0629"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74418"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZCR3"
FT                   /protein_id="ACR74418.1"
FT                   /translation="MYGNKVVQVLRKMLLSFRPDVYEKIKSGLKIFEHRRNFPDEPIMA
FT                   YMYVSSPVKAITGIVYLDKRHCLSDWLEEYKEDSNAIARIKEYMKTYHYRYAMEIAKFQ
FT                   ETSKISLDDLRKNVPGFVAPQMYIYLDGTELLEYIESNLKMIDLQVEHSFERIEACQVC
FT                   VH"
FT   gene            574390..575229
FT                   /locus_tag="EUBREC_0630"
FT   CDS_pept        574390..575229
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0630"
FT                   /product="Hypothetical protein"
FT                   /note="Cytoplasmic, score:8.87; NOG18716 non supervised
FT                   orthologous group"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0630"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74419"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZCR4"
FT                   /protein_id="ACR74419.1"
FT                   /translation="MEFFSTRNKILSINPNGLRSTSIQLRERIWNVFYKEEYDYYDTLE
FT                   YTSYTTGIEDMMLEMGIKYEFPANKIYKNQNAEKLHKHVVQCEGMWYRIYDFIEKYLRV
FT                   TDSEKTQRLTIEFNRILEEEVAPYRILNGLVVPIIGKSELNSIGETIDLEYESVSKHMT
FT                   KALELYSDRKKPDYENSVKESISSVESMCSIITGLSGGAATLGNTLKKLKENGVNIHPA
FT                   LENAFKQLYGYTSDSGGIRHGSIEFVNVASEDAKYMLVSCSAFVNYLTEKWIKYNLK"
FT   gene            575269..576060
FT                   /locus_tag="EUBREC_0631"
FT   CDS_pept        575269..576060
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0631"
FT                   /product="Hypothetical protein"
FT                   /note="Unknown cell location"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0631"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74420"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZCR5"
FT                   /protein_id="ACR74420.1"
FT                   /translation="MRILFWNTHRNVDINSYILDIVNQNEIDVLVLAEYMAEINELNDN
FT                   LKQCKKRLFNWNTKGCERIHIWGNYIDVTPGEQNKYFSVQIVNKQYIMCGVHMYSNLNG
FT                   EHYDERVALAEEIMYSIKHIKQRLQTEHVIVIGDINESPYEKACLSAKGFHALPALQIL
FT                   DKGSRTVYGKEYEKMYNPMWNLFGDFKYPPGTYYRVESKLYNPCWFMLDQVIISQSMIP
FT                   LMVKEQLKIITKCGKGVLYTDNRYPNSNISDHFPIMCEFNI"
FT   gene            576044..576607
FT                   /locus_tag="EUBREC_0632"
FT   CDS_pept        576044..576607
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0632"
FT                   /product="Hypothetical protein"
FT                   /note="Unknown cell location"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0632"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74421"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZCR6"
FT                   /protein_id="ACR74421.1"
FT                   /translation="MNLIFDRRRLTMNKKTFNFELKDTMSPEEVIIESGKKIAECTNDM
FT                   VICNVDVYEGQTKSYVKKNNLWAATEAFNKVEETVDIQDVLGEQSGIDNKFEVFLSVKG
FT                   LEYYKYRIMFLRYGAIAYPVEVVLNEDIAEAYNGKKQYIYDVDSMEELKTMFETIINTD
FT                   FCTNLIQSLIYESMRQSRKDKSEN"
FT   gene            576873..577919
FT                   /locus_tag="EUBREC_0633"
FT   CDS_pept        576873..577919
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0633"
FT                   /product="hypothetical protein"
FT                   /note="Cytoplasmic, score:8.87; COG0494 NTP
FT                   pyrophosphohydrolases including oxidative damage repair
FT                   enzymes; KEGG:K07025 hypothetical protein;
FT                   HMMPfam:IPR000086; HMMPfam:IPR005834; FPrintScan:IPR000086;
FT                   Gene3D:IPR000086; HMMTigr:IPR006402; HMMTigr:IPR006439;
FT                   ScanRegExp:IPR000086; superfamily:IPR015797"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0633"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74422"
FT                   /db_xref="GOA:C4ZCR7"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZCR7"
FT                   /protein_id="ACR74422.1"
FT                   /translation="MTKVNFYDSIDDSKLKFAVIIAKHNGKWVFCKHRERSTWEVPGGH
FT                   REQGEDILETAKRELYEETGAINFEINPICIYSVTAPDNFDGKETFGKLFFAEIHTFEK
FT                   DLHSEIEKIAIMNELPLNWTYPEIQPRLLEEARQRGFLPKKDEIKWLFFDVGSTLVDES
FT                   RVYEDRMKKIAELSGITPQQIYENAISLYRRNKKGDLEIAKQLGIELPKWESQYEKLYT
FT                   DSEDCLKGLSRNYEIGIIANQPLGTSERLENLGVRKYIDLIIASAEEGVSKPDRRIFEI
FT                   ALERSRCRPENAVMIGDRIDNDIVPAKQLGMKTIWIKQGFGSLWTVMDESEKADIEVNN
FT                   LSDILNYL"
FT   gene            577932..578774
FT                   /locus_tag="EUBREC_0634"
FT   CDS_pept        577932..578774
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0634"
FT                   /product="amidohydrolase, putative"
FT                   /note="Cytoplasmic, score:8.87; COG0388 Predicted
FT                   amidohydrolase; KEGG:0amidohydrolase, putative
FT                   HMMPfam:IPR003010; Gene3D:IPR003010; superfamily:IPR003010"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0634"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74423"
FT                   /db_xref="GOA:C4ZCR8"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZCR8"
FT                   /protein_id="ACR74423.1"
FT                   /translation="MFKVAILQKRSINEQIDKNIETIIMAMEEASEKHADILLLPECFI
FT                   TGYDLPMSYEKSIADNDIRIAQICENAKKYKIGVVLTAFTKGSKQPQNSAFVINKSGNI
FT                   LMKYSKVHTCDFADERDVESGKEFKVCDFEGIQLGIMICYDREYPESARILMLKGAEVI
FT                   LVPNDCGSMQARIRALSTRAYENMVAVAMANPNGDNAGCSCAYSPICWDRNGKCVDNTV
FT                   LLADDKTEGIFYAEFDMEAIREYRNREMLGNTFRKVESYSRLLSKEIKEPFIRDGQNR"
FT   gene            578758..578907
FT                   /locus_tag="EUBREC_0635"
FT   CDS_pept        578758..578907
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0635"
FT                   /product="Hypothetical protein"
FT                   /note="Cytoplasmic, score:8.87"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0635"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74424"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZCR9"
FT                   /protein_id="ACR74424.1"
FT                   /translation="MARIDKSEVTRGIFYRGSDVECQLLYVMGDMEADIRTHHIHIVKW
FT                   NGTE"
FT   gene            579063..579563
FT                   /locus_tag="EUBREC_0636"
FT   CDS_pept        579063..579563
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0636"
FT                   /product="acetyltransferase, GNAT family"
FT                   /note="Cytoplasmic, score:8.87; COG1670 Acetyltransferases,
FT                   including N-acetylases of ribosomal proteins; KEGG:K00663
FT                   acetyltransferase, GNAT family HMMPfam:IPR000182"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0636"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74425"
FT                   /db_xref="GOA:C4ZCS0"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZCS0"
FT                   /protein_id="ACR74425.1"
FT                   /translation="MKKEASMLRLRPYNKNDAEIIMSWIKGENAFYKWTAGVLGEYPIS
FT                   AEQFNTVSNLMAFTAIDDNEIVGFFTMRRPNEFYEELRFGFVIVDSKKRGQGYGKNMLK
FT                   LGLKYAKEIFGANKVSLGVFENNESAYYCYKAIGFEDVSQDEIEKYTVMGEEWNCLELE
FT                   INL"
FT   gene            complement(579852..580481)
FT                   /locus_tag="EUBREC_0637"
FT   CDS_pept        complement(579852..580481)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0637"
FT                   /product="Hypothetical protein"
FT                   /note="Cytoplasmic, score:8.87"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0637"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74426"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZCS1"
FT                   /protein_id="ACR74426.1"
FT                   /translation="MNCHGHDTRVRIVENYNIKCTAHIRLLNEQIIRSDAERDITDTYY
FT                   IFECVNKNDDNDVDRIVCGTGAARDLLQLANITAPPIFNMLHEVGGEGGAGGAGGGNQH
FT                   QDEEWDAAAKQLYNAIMILITAWNLRPGPIYNYLEEARRYRRCVPYSYRVDRINQIVHR
FT                   HGTSLRDVLNQLAQNNNIRNYEFNLLEDILHNDGIVSYFEDANGRE"
FT   gene            complement(580510..580794)
FT                   /locus_tag="EUBREC_0638"
FT   CDS_pept        complement(580510..580794)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0638"
FT                   /product="Hypothetical protein"
FT                   /note="Cytoplasmic, score:8.87"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0638"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74427"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZCS2"
FT                   /protein_id="ACR74427.1"
FT                   /translation="MIELKIDSTKNELSLTHDVCCNEHLADELAIIIDIMIADYFIKNG
FT                   HKYDNFSLEEKEKIIIEKRKEILQLISDKPCTCKDYLKNSDIHIRKIDL"
FT   gene            580971..581405
FT                   /locus_tag="EUBREC_0639"
FT   CDS_pept        580971..581405
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0639"
FT                   /product="Hypothetical protein"
FT                   /note="Cytoplasmic, score:8.87; COG2826 Transposase and
FT                   inactivated derivatives, IS30 family;
FT                   superfamily:IPR009057"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0639"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74428"
FT                   /db_xref="InterPro:IPR025246"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZCS3"
FT                   /protein_id="ACR74428.1"
FT                   /translation="MSKYIPGNQKHLTLNDRIYIENELSKGATFKDIAAFLCKDPTTIS
FT                   KEVKSRCLSDWYHKGTFYNAKNFCIHRYHCKKTNACGKIMLCGIKCTSCPTCNQTCKDF
FT                   EKERCCRLDKAPYVCNGCPMKINHCTIAGRSISLVHKTRM"
FT   gene            complement(581118..581354)
FT                   /locus_tag="EUBREC_0640"
FT   CDS_pept        complement(581118..581354)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0640"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0640"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74429"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZCS4"
FT                   /protein_id="ACR74429.1"
FT                   /translation="MIDFHWTAITYIRRLIKSAAPFLFEILTGLVAGWTGCTFNTAEHD
FT                   FSTGICFFTVIAVYTKVFGIVESSFVVPVRKAS"
FT   gene            581578..582126
FT                   /locus_tag="EUBREC_0641"
FT   CDS_pept        581578..582126
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0641"
FT                   /product="acetyltransferase, GNAT family"
FT                   /note="Cytoplasmic, score:8.87; COG0454 Histone
FT                   acetyltransferase HPA2 and related acetyltransferases;
FT                   KEGG:0acetyltransferase, GNAT family HMMPfam:IPR000182"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0641"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74430"
FT                   /db_xref="GOA:C4ZCS5"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZCS5"
FT                   /protein_id="ACR74430.1"
FT                   /translation="MKEVHGMNDLIKLKLVTEDEAECLHRLQVEAFMPLYEKYQDDDTS
FT                   PAKESLKRVTEKIIEENSDFYFIVFHGEKVGGVRVRWHQGKKVHENVNWISPIFIIPKF
FT                   QNKGIASTVIEQLFGFYPNTIEWRLDTIKQETGNCHLYEKCGFVRVGEDIVVNEKMTLV
FT                   GYVKNCINVRRFDSCLFAI"
FT   gene            582241..583518
FT                   /locus_tag="EUBREC_0642"
FT   CDS_pept        582241..583518
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0642"
FT                   /product="hypothetical protein"
FT                   /note="Cytoplasmic, score:8.87; COG1106 Predicted ATPases;
FT                   KEGG:0hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0642"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74431"
FT                   /db_xref="GOA:C4ZCS6"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZCS6"
FT                   /protein_id="ACR74431.1"
FT                   /translation="MIIEVRAKNCYAFEDDITFSMKADMRNKKFGANVHKENNFNVLKT
FT                   VGIYGPNNAGKTCLIKCIRAIRNVLLNKKNGLMPNIFTDSDVCKLGVTFMASGRKFSYD
FT                   FKYDAEKEEYIYESFSEIFKDQYNNEKEVCWLKKDTVSEIYECIDESVQNMISVVSKNN
FT                   LLCYVVDTSKFEHINEMKQILVGFAEKIDIINMNNIPMQHTIELMKNKNQLQQKVVEFI
FT                   KNADLYMDNFEYVDMDKIQLKTGEGDEKPDEKVLDIPENIMDQIRLVSTYKGVHVPSMM
FT                   FDSTGTKKIAAIASYVIEALEQGRILVVDELDSSIHFKLTRAIVAMFNNELNTSAQMIF
FT                   TVHDINLMDCKRMFRKEQIWFVHKDEEGVYVYSLADFTAQQGVRDTTDVMEKYRKGALG
FT                   ALPDPELINSLLSIKSGVKGDDADAK"
FT   gene            583508..584137
FT                   /locus_tag="EUBREC_0643"
FT   CDS_pept        583508..584137
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0643"
FT                   /product="Hypothetical protein"
FT                   /note="Cytoplasmic, score:8.87; BlastProDom:IPR003444"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0643"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74432"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZCS7"
FT                   /protein_id="ACR74432.1"
FT                   /translation="MPNKLPKFLDNHKICIICEGNEEYEYLNRLKNLKIWNEQYDISLV
FT                   NAGGNGNIPARYQDRYQNGADELVLVFCDTEKKPHEQYEDIKRKINEFHGVDSAANEVI
FT                   IFGNPCTMQIISKHWTDENLKSPAKPVNAPLIKEYTGVENYKGRADQIQKVMEHVTVKN
FT                   YKDMSRRVKDLDSDDSVTGSSNFGKFIKLFESDDSGWIEEINEQIE"
FT   gene            584164..585057
FT                   /locus_tag="EUBREC_0644"
FT   CDS_pept        584164..585057
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0644"
FT                   /product="Hypothetical protein"
FT                   /note="CytoplasmicMembrane, score:9.75; NOG12915 non
FT                   supervised orthologous group"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0644"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74433"
FT                   /db_xref="GOA:C4ZCS8"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZCS8"
FT                   /protein_id="ACR74433.1"
FT                   /translation="MNKVNVIKQNLEFIGKTWMKCIGTFASILSLFFLFWTWDDIRITS
FT                   TQYKCVIIILLCVLALILAILWTCIFKRTKTIWESPSGKIKVCYSDIMKDGFDKRNKEE
FT                   KLFVIPVNSCFDTIVDEDISTCSKPLVSPNLLHGRWIKTMVNKGFTIEEIDNKIHNCLE
FT                   MQNLLPKSIIADEDKERGKREVYELGTVAMIRGNNNSTFLLLAISEYDKDNIAHTSVDD
FT                   LEMCIKSLLNFYDQHDQGHRLVIPLMGTNLSRAGLSHNDSLRVITSLFQLYGDKIHGEV
FT                   DVVIYKGDKDKVTLDI"
FT   gene            585075..585641
FT                   /locus_tag="EUBREC_0645"
FT   CDS_pept        585075..585641
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0645"
FT                   /product="Hypothetical protein"
FT                   /note="Unknown cell location; NOG16240 non supervised
FT                   orthologous group"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0645"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74434"
FT                   /db_xref="PDB:3HYN"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZCS9"
FT                   /protein_id="ACR74434.1"
FT                   /translation="MSYQNANYSAFYVSEPFSESNLGANSTHDFVYYNMLRMWKGEDNS
FT                   FPFNDAHDKTYNVRDGSDWEKTLKPRLHTRLDNSKNIILFLSSITANSRALREEMNYGI
FT                   GTKGLPVIVIYPDYDKKSDIVDSNGNFKKQIKDLWDKLPAFRDNMSSVATLHIPCTKSV
FT                   IISALNNEDFMVNTMADAEKYYYKP"
FT   gene            586561..587121
FT                   /locus_tag="EUBREC_0646"
FT   CDS_pept        586561..587121
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0646"
FT                   /product="Hypothetical protein"
FT                   /note="Cytoplasmic, score:8.87; COG0655 Multimeric
FT                   flavodoxin WrbA; HMMPfam:IPR005025"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0646"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74435"
FT                   /db_xref="GOA:C4ZCT0"
FT                   /db_xref="InterPro:IPR005025"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZCT0"
FT                   /protein_id="ACR74435.1"
FT                   /translation="MKAEVKMKVLVMNCSPVRNGATAEIVNIVTARLEKKHDVKNICID
FT                   DYDIKFCKGCRTCHNTAKCVQNDDVDRIIEQYEWADIVISVSPSYWADVPGQFKSFIDR
FT                   CTPWCNTHEPHAKISSGKKGYVIALRTGPGMRECERIIATIEHFYGHMEIECCDSLGLC
FT                   SVEYKEDLDCRKEEIIEFCNQIE"
FT   gene            587168..587626
FT                   /locus_tag="EUBREC_0647"
FT   CDS_pept        587168..587626
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0647"
FT                   /product="probable aminoglycoside N6-acetyltransferase"
FT                   /note="Cytoplasmic, score:8.87; COG0454 Histone
FT                   acetyltransferase HPA2 and related acetyltransferases;
FT                   KEGG:K00663 probable aminoglycoside N6-acetyltransferase
FT                   HMMPfam:IPR000182"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0647"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74436"
FT                   /db_xref="GOA:C4ZCT1"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR024170"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZCT1"
FT                   /protein_id="ACR74436.1"
FT                   /translation="MVKLIRKATLEDVPQLVSLAIQMWKSHTVEDLTKIFCEHIRKGKN
FT                   IIFLAISEEHIVGFAQCGLRFDYVEGTDSSPVGYLEGIFVLEEYKKRGYAKELLGECQN
FT                   WAKDQGCLEFASDCELDNEDSLKFHLKMGFAEANRIICFTKSLTDLEE"
FT   gene            587633..588103
FT                   /locus_tag="EUBREC_0648"
FT   CDS_pept        587633..588103
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0648"
FT                   /product="Hypothetical protein"
FT                   /note="Cytoplasmic, score:8.87; COG0454 Histone
FT                   acetyltransferase HPA2 and related acetyltransferases;
FT                   HMMPfam:IPR000182"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0648"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74437"
FT                   /db_xref="GOA:C4ZCT2"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZCT2"
FT                   /protein_id="ACR74437.1"
FT                   /translation="MAKNYKYKKATIADIDELVKTRIIVLRAANKLSNDVDMSLVEKES
FT                   YEYYKRALETGEHIAYLVYDNGAFVGAGGVSFYQVMPTYHNPTGKKAYIMNMYTASEYR
FT                   RQGIAFHTLDLLVKDVRKQGVSQIALEATEMGRPLYEKYGFVKMEDEMELIK"
FT   gene            588100..588717
FT                   /locus_tag="EUBREC_0649"
FT   CDS_pept        588100..588717
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0649"
FT                   /product="phosphoglycerate mutase family protein"
FT                   /note="Cytoplasmic, score:8.87; COG0406
FT                   Fructose-2,6-bisphosphatase; KEGG:K01834 phosphoglycerate
FT                   mutase family protein HMMPfam:IPR013078"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0649"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74438"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZCT3"
FT                   /protein_id="ACR74438.1"
FT                   /translation="MTRVYFVRHAQPEHDWEEDRTRPLTEEGKKDSAIVLEFLKDKKID
FT                   AFYCSPYKRSMDTIAEAADFFTKEIITDERLREREKGLDGNNHGMFRKRWADHNYHEEG
FT                   GESIAMVQKRNIEALNEILSDNTDKDIVIGTHGTALSTILNFYDNNFGCEDFLRIIDWM
FT                   PYIIELDFESSCNELEFECPSYSFKLIGKQEHCYIEKEFKGK"
FT   gene            588746..591472
FT                   /locus_tag="EUBREC_0650"
FT   CDS_pept        588746..591472
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0650"
FT                   /product="DNA helicase"
FT                   /note="Cytoplasmic, score:8.87; COG1112 Superfamily I DNA
FT                   and RNA helicases and helicase subunits; KEGG:0DNA
FT                   helicase"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0650"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74439"
FT                   /db_xref="GOA:C4ZCT4"
FT                   /db_xref="InterPro:IPR024402"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041677"
FT                   /db_xref="InterPro:IPR041679"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZCT4"
FT                   /protein_id="ACR74439.1"
FT                   /translation="MNTQYYMVIIKGEIKTSEIMSCGYNRNTQKWDVKFNNGKTYSYAY
FT                   LNVEKLTDPEVLNPNMYRISREGREFFDVNAIYVFRSGRESYWHICFGDGSERDYRRSD
FT                   LHIIESCLAQSQSSNVFEYIKQIAGLSNLKNEETGEKLLSKKFDKISFVGSDVALAKYL
FT                   NPSSLQGKRTEREYIPIFPFGCNNSQYKAVKNAMENQISVIQGPPGTGKTQTILNIIAN
FT                   ILMQGKTVQIVSNNNSATENVYEKLSSPKYNLGFIAATLGSSKNKKLFVEHQDAAYPDF
FT                   SSWKTGEDPSVLQKKIAEQSSQLKSVFAKQEKLACLRQELSQLVTEQEYFNQYVKESDV
FT                   HTDSIKFKKKLSSKQWMVLWQECQLISEEKTAIGFWFKIKALFKYGVTDWSIYKQDISK
FT                   IITTFQAMYYRAKQAELSAEIADIEKYSNSVNKNLLEDLCKQSMVVLKDKLARKYEGNS
FT                   SRKTFSEDNLWKEPYNVLAEYPVILSTTFSSRNSLNSDVVYDYLIMDEASQVDIATGAL
FT                   ALSCARNVVIVGDTKQLPNVVTDDIKAKAKAIFDRFNVSEGYQYTNSFLQSILDVMPNV
FT                   TQTLLREHYRCHPKIINFCNQKFYRGELIIMTTDKGEEDVLSVVKTVAGNHERNHYSQR
FT                   QIDVIKNEIIPKYVSNPEETGIIAPYKNQVEALSKEITDIDAATVHKFQGKEKENIIIS
FT                   TVDDEISDFADDPYLINVAVSRAKKKLMLVVTGNVQSKEHNITDLIDYIQYNNFEVTES
FT                   KIYSIFDYLYKQYTEERRVYLQKHKKVSEYDSENLMYSLIEDIISANKYSSLEVVCHFP
FT                   LNMLIKNPELLNEQECQYAMNPATHLDFLIYNRIGKKPVLAIEVDGYEYHKEDTIQASR
FT                   DLLKNHIMELYEIPLLRFKTNGSGEREKIVEMLDKLV"
FT   gene            591502..592209
FT                   /locus_tag="EUBREC_0651"
FT   CDS_pept        591502..592209
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0651"
FT                   /product="MutT/NUDIX family protein"
FT                   /note="Cytoplasmic, score:8.87; COG0494 NTP
FT                   pyrophosphohydrolases including oxidative damage repair
FT                   enzymes; KEGG:0MutT/NUDIX family protein HMMPfam:IPR000086;
FT                   BlastProDom:IPR002667; Gene3D:IPR000086;
FT                   ScanRegExp:IPR000086; superfamily:IPR010982;
FT                   superfamily:IPR015797"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0651"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74440"
FT                   /db_xref="GOA:C4ZCT5"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZCT5"
FT                   /protein_id="ACR74440.1"
FT                   /translation="MAVSYKRLWKLLVDKEMSKSDLRKKAEIAPNTMTKLRRDEEVSLT
FT                   ILSKICKTLHADFGDIVEYVPDAEIWDLYNENRELLGKDHIRGEQLPIDGYHLVVHVWI
FT                   RNSNGQYLISQRSANRPTHPLMWECVGGSVVKGEDSLSGVIREAKEEVGIDLMPENGQV
FT                   LFTKTRKIIDGKIYNDIMDVWLFDYDGEVDLGNATTDEVAQVAWMNGEQIKELFDANMF
FT                   VDTLEYFFTEVDK"
FT   gene            592233..593612
FT                   /locus_tag="EUBREC_0652"
FT   CDS_pept        592233..593612
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0652"
FT                   /product="ATP-dependent DNA helicase RecG-related protein"
FT                   /note="Cytoplasmic, score:8.87; COG2865 Predicted
FT                   transcriptional regulator containing an HTH domain and an
FT                   uncharacterized domain shared with the mammalian protein
FT                   Schlafen; KEGG:0ATP-dependent DNA helicase RecG-related
FT                   protein HMMPfam:IPR007421"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0652"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74441"
FT                   /db_xref="GOA:C4ZCT6"
FT                   /db_xref="InterPro:IPR007421"
FT                   /db_xref="InterPro:IPR025831"
FT                   /db_xref="InterPro:IPR038461"
FT                   /db_xref="InterPro:IPR038475"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZCT6"
FT                   /protein_id="ACR74441.1"
FT                   /translation="MKEKEHQSIEWKESWQDEYLKWICGYANAYGGTIYIGTDDDGNVV
FT                   GIDNARDLLERIPNKITDTMGIIVDVNLLYKGELEYLQIIVDKYPSLISFRGKYYYRSG
FT                   STMREITGKELERALLKTQGRTWDGVPLPKLTVADLKQDAIQLFKDKAVKRGRLTKEEV
FT                   SVEDTILMDNLHLIDEDGYLIRAAMLAFYKDPEKWVTGSYIKIGYFGKSDSDLVYQDEV
FT                   HGPLIEQVDKTVDLVYTKYMKALIDYEGVQRIEQFMFHKDAFREILLNAVVHKDYSSCN
FT                   PIQISVYEDKIYIWNDGEMPPNLDSTDKLFMKHSSKPYNPKLANVFFKSGMIEAWGRGF
FT                   EKIREACALYDGPLPEYEINEAGIMVLCKACDKYLGLLRNDGQHHGQCDQEGDHDEEQD
FT                   IMRQIIAFCMEPKTASEIMQKFNLERSYFRRHYLNKMLKTGKLQRTEPDKPKSKNQKYY
FT                   S"
FT   gene            594121..594582
FT                   /locus_tag="EUBREC_0653"
FT   CDS_pept        594121..594582
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0653"
FT                   /product="Hypothetical protein"
FT                   /note="Cytoplasmic, score:8.87"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0653"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74442"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZCT7"
FT                   /protein_id="ACR74442.1"
FT                   /translation="MCNELEQAGLKDPVYHTNAFMLQAVIYNSKVGKTIVEKTADSFKK
FT                   LAVAVNKSLIDYQRPAIGEEKSAIDDKKSAVDRIKSAIEQQKYNEPSKANILKVYDEIE
FT                   KNQIFGTKEIKEILDCSPSTARAVMTKLRDMKVVKAVNGKGKGKYVFIE"
FT   gene            595012..595335
FT                   /locus_tag="EUBREC_0654"
FT   CDS_pept        595012..595335
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0654"
FT                   /product="Hypothetical protein"
FT                   /note="Unknown cell location"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0654"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74443"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZCT8"
FT                   /protein_id="ACR74443.1"
FT                   /translation="MDISKKDWKLFREKLSGWQENYIEGLVKEYANFLNDDIKPASERF
FT                   WELEKRIKEDKRHPGVIMELKKSEVIWDIVRLIRLKVITYNDLSDFSDELQNEVKRILE
FT                   MYR"
FT   gene            595359..598328
FT                   /locus_tag="EUBREC_0655"
FT   CDS_pept        595359..598328
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0655"
FT                   /product="type III restriction enzyme, res subunit"
FT                   /note="CytoplasmicMembrane, score:7.80; COG4951
FT                   Uncharacterized protein conserved in bacteria; KEGG:K01156
FT                   type III restriction enzyme, res subunit HMMPfam:IPR001650;
FT                   HMMPfam:IPR006935; HMMSmart:IPR014001"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0655"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74444"
FT                   /db_xref="GOA:C4ZCT9"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZCT9"
FT                   /protein_id="ACR74444.1"
FT                   /translation="MRDPIENVTRLQKQLNNLQLENQVLKNILDKAGVSYQNELASIRE
FT                   TEKKEDFDPEQGKRIVYPKEITDRMAKLFFSFFWGRTDVYAKRNVNKNGEAAYYPQCDN
FT                   FWSDNCHRKLNTHIDCKDCKYCSYTRLDLSTILTHLRGNSYVAKDVIGVYPLFSDGTCR
FT                   FLVFDFDNHEKNAEKRDFANTDDTWIEEVEAMRDICTLNGIEPLVERSRSGKGAHIWIF
FT                   FDKPISAAVVRKFGLALLDKGAEQVNLKSFNYYDRMLPAQDSLENVAIGNLIALPLQGR
FT                   ALKDGNSAFVDGNWNAYPDQWNALLSKPKLSEEFLENKIREWTFTADDLEASSDEENRE
FT                   KPWDRMKNFAKSDVDGKMDITLSNGIYVDSTNLKPAMQNKIRRMAAFSNPVFYKNRAIG
FT                   TSNYDTSRWIYLGKDHLGGYIQIPRGLQDELIANIDKAGIEYTIDDERQQGRNINVEFN
FT                   GELRPEQNKALKELTKHDNGILHAATAFGKTVVCSAVIAEKKVNTLILLESSALIEQWK
FT                   DALNKFLIIDEELPQYKTKTGRLRTRKSLIGTLQGVHDSMTGIVDIAMVGSLCKKGEFH
FT                   NLLNDYGLVIIDECHHSASETIANVLKEVKARYVYGVTATPKRGDGLEKINYMLIGPIR
FT                   YSYTAKEKAMEQGIQHLVYPRFTRTVPPRGVLIGKMHPNEAYEIIHNNDIRDEQIVEDV
FT                   KNCVSAGRTPVVLSRYKDHSEKLYERLKDYADHVFLMTGNNSKKEHKKILEQMHQVYKA
FT                   ESLILIATGSLVGEGFDFPRLDTLFMATPVSFRGVVEQYAGRLNRDYAGKENVIIYDYV
FT                   DNHITMFNNMYMKRLKAYKQIGYEIAGGLHNDKQTANAIYDGDNYAENYHKDLLDANKN
FT                   IIISSPAISGTKVYELINLLKEKQLSGVQITIVTWAPDSYGFGDASYWMQLHEEMRKAG
FT                   FYIKTVEESCERFAVIDQEVVWYGNINLLAKDKVDDSIMRVLSKEIASELMEITFGDNG
FT                   "
FT   gene            598407..599423
FT                   /locus_tag="EUBREC_0656"
FT   CDS_pept        598407..599423
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0656"
FT                   /product="Hypothetical protein"
FT                   /note="Cytoplasmic, score:8.87; COG3943 Virulence protein;
FT                   HMMPIR:IPR011204"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0656"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74445"
FT                   /db_xref="InterPro:IPR003497"
FT                   /db_xref="InterPro:IPR011204"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZCU0"
FT                   /protein_id="ACR74445.1"
FT                   /translation="MSKGLQIRNSTVDFLVFTRDAGEDGIEVRVQNGDVWLTQKAISRL
FT                   FDVDRSVITKHLSNIFKEGELDENSVCAKFAQTADDGKTYNYKFYSLAAIIAVGYRINS
FT                   ERAMQFRTWATKVLDTFTKQGYVLDKSRLINGQIFDEDYFEHLIAEIQEIRASERRFYQ
FT                   KITDIYATAVDYDKNSQVTREFYATVQNKMHYAVHGNTAAEVIVARADHNKEHMGLKSW
FT                   KNAPDGKIVKTDVSIAKNYLEKEELAELNEIVTMYLDYATRQARRHIPMTMEDWKTKLD
FT                   AFLRFNDADVLQDKGKVTAAIAKEFAESEFEKYRIIQDSLYESDFDKLMNDMEKNDS"
FT   gene            complement(599819..600154)
FT                   /locus_tag="EUBREC_0657"
FT   CDS_pept        complement(599819..600154)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0657"
FT                   /product="Hypothetical protein"
FT                   /note="Cytoplasmic, score:8.87; COG1396 Predicted
FT                   transcriptional regulators; HMMPfam:IPR001387;
FT                   HMMSmart:IPR001387; superfamily:IPR010982"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0657"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74446"
FT                   /db_xref="GOA:C4ZCU1"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZCU1"
FT                   /protein_id="ACR74446.1"
FT                   /translation="MKFQPERLIQLRNTLNINKAEAARRLNISPMVYGRYENGQREPSY
FT                   PTVGFIAQTFNCNVDFLYGTSDKTDPDYIIVSSSNDPELYSLIKMIKQDSNVEGRILTY
FT                   ARKLLEK"
FT   gene            600322..601251
FT                   /locus_tag="EUBREC_0658"
FT   CDS_pept        600322..601251
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0658"
FT                   /product="Hypothetical protein"
FT                   /note="Cytoplasmic, score:8.87"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0658"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74447"
FT                   /db_xref="InterPro:IPR021122"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZCU2"
FT                   /protein_id="ACR74447.1"
FT                   /translation="MEHYIEIQRLRTQDVVVDDTLTLEKNTDAFIQGDIISITEKIDGA
FT                   NSSIYYDKKLDRLRCFSSKNELDFSNQLRGFLTYVESLDKEPFIKYPNYIFFGEWLVSH
FT                   TVIYDDSNYNKWYLFSVYDTVSGRWLSQDFVKKFAEKNDFCYPHELYYGPFISWSHCLS
FT                   FANAPAYGTQQEGIVIKNQTALEQERGPHILKYVNPEFKETQKKNHKKKLEDPNKLNEK
FT                   AEAEEYIRMIVTDARVMKCYHKLVDDGILPEKFELKHMKHVAQNLPKAVYEDCVKEELE
FT                   ILKKAGEFGGRLCSKVTMEIIKDKLKIG"
FT   gene            601424..601912
FT                   /locus_tag="EUBREC_0659"
FT   CDS_pept        601424..601912
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0659"
FT                   /product="Hypothetical protein"
FT                   /note="Cytoplasmic, score:8.87"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0659"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74448"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZCU3"
FT                   /protein_id="ACR74448.1"
FT                   /translation="MIRNGFYIIKDSFFSDMSDPYLKGNKKQNRPHYYCFEDSNYNGIY
FT                   WMIPLSSRIDKYKKIVSKRTGKGRTCDIIHIVKLDDSHESAFLIQDMFPISEKYIEREY
FT                   TIAGNHLRLTSEHAAKEIEQKARKVLGMLKRGIKFTPTQPDIQKIYERLQQDLPATHL"
FT   gene            602069..602905
FT                   /locus_tag="EUBREC_0660"
FT   CDS_pept        602069..602905
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0660"
FT                   /product="Hypothetical protein"
FT                   /note="Cytoplasmic, score:8.87; NOG11941 non supervised
FT                   orthologous group"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0660"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74449"
FT                   /db_xref="GOA:C4ZCU4"
FT                   /db_xref="InterPro:IPR009045"
FT                   /db_xref="InterPro:IPR039561"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZCU4"
FT                   /protein_id="ACR74449.1"
FT                   /translation="MKRHINIIITAVASLLIVTLAGREFIKNHKKESNDKSSTNVSENT
FT                   CEDIPDTSISDTSISDTCVADMNTSDTSTSETEILKQTYENNKEQFYISEIPDDIFEKM
FT                   QGKSYKADCTLPRENLRYIHVLHVGFDNQVHEGELVVNKDIADDVLEIFKELYESGYQI
FT                   EKVRLVDEYDADDEASMSDNNSSAFNFRFISHTTKISKHGMGMAVDINTLYNPYVKTVD
FT                   GELSIEPANGADYVDRSKDFSHKIDHDDLCYKLFTEHGFEWGGDWTHSKDYQHFEK"
FT   gene            complement(602918..603838)
FT                   /locus_tag="EUBREC_0661"
FT   CDS_pept        complement(602918..603838)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0661"
FT                   /product="putative aldo-keto reductase/oxidoreductase"
FT                   /note="Cytoplasmic, score:8.87; COG4989 Predicted
FT                   oxidoreductase; KEGG:0putative aldo-keto
FT                   reductase/oxidoreductase HMMPfam:IPR001395;
FT                   BlastProDom:IPR001395; FPrintScan:IPR001395;
FT                   Gene3D:IPR001395; HMMPanther:IPR001395;
FT                   superfamily:IPR001395"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0661"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74450"
FT                   /db_xref="GOA:C4ZCU5"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZCU5"
FT                   /protein_id="ACR74450.1"
FT                   /translation="MRETILGNHIRKVPSVAVGCMRFSEKSKDEMNHFIHAALEQGAYF
FT                   FDHADIYGGGMSESVFGEAIADDPSIKREDIYLQSKCGIRQGFYDLSKEHILKSVDGIL
FT                   KRLHTDYLDFLLLHRPDALVEPEEVAAAFDVLFESGKVRHFGVSNHKPMQIELLQKYVR
FT                   QPLVVNQVQFSIPVSNLVANGMEVNMETPGSIDHDGSLLDYCRLHNITLQAWSPFQMPA
FT                   WKGCFLGSDEYPELNKKLHVIAEKYNVSDTTIAAAWILRHPANMQIVTGTSSESRLKEI
FT                   IAACDITLTREEWYELYLAAGHLLP"
FT   gene            complement(603859..605070)
FT                   /locus_tag="EUBREC_0662"
FT   CDS_pept        complement(603859..605070)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0662"
FT                   /product="flagellin lysine-N-methylase"
FT                   /note="Unknown cell location; NOG18602 non supervised
FT                   orthologous group; KEGG:0flagellin lysine-N-methylase"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0662"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74451"
FT                   /db_xref="GOA:C4ZCU6"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZCU6"
FT                   /protein_id="ACR74451.1"
FT                   /translation="MKNYQPDYYNNFKCIADKCSITCCQEWKIAVDDATNRKWKKLSPP
FT                   DTLSTAPFSADKVSGISDNLSSYTCHKDGSLVIKLDEKHRCPFLSKDKLCHLVMTYSDE
FT                   VLSETCALFPREIHLFSTHEERTLMPCCPAVIDLWCEKPVTFPVISETRNNLSTAFLIR
FT                   DNLIKLISDQGLSVEQALLDGLYILLELYKNQPITNAHIQEYFSDQTLNELNTAMEDIH
FT                   IPDEDTFIECNELLQDLSVNYRKEGLYTAFLQPVLTEACKYSNIYSQSDNNSMSRTLQT
FT                   SRKQFCSMLTDYDIVFRNYLANELFSDLISPEAASTKKIIEHMIIKMQWIMIEYTAIRQ
FT                   SLFLWYSHNANSPLTYETIREHIVIISRMTGYDDDDIREYLENSFAKLIWDWGYAALIM
FT                   GIRK"
FT   gene            complement(605131..606519)
FT                   /locus_tag="EUBREC_0663"
FT   CDS_pept        complement(605131..606519)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0663"
FT                   /product="hypothetical protein"
FT                   /note="CytoplasmicMembrane, score:9.99; COG0534 Na+-driven
FT                   multidrug efflux pump; KEGG:K03327 hypothetical protein;
FT                   HMMPfam:IPR002528; HMMPanther:IPR002528; HMMTigr:IPR002528"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0663"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74452"
FT                   /db_xref="GOA:C4ZCU7"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZCU7"
FT                   /protein_id="ACR74452.1"
FT                   /translation="MTNLHSDKIKTANLHTTTNHIYTNTQLRKLLVPIIIEQLLASLMG
FT                   TVDTMMVSNVGSAAISAVSLVDSINILVIQALSALAAGGAILCSQYLGSHNTKGARHAA
FT                   RQVFFVMAFLSILLSAFCLITRKSLLRAIFGAVEADVMRNSQVYFFFTLLSFPFIGLYD
FT                   AGASIMRAQNNSRNPMVISVISNFMNIGGNAILIFGFGMGVEGAAISTLVSRIFCAIVV
FT                   IIQLRRENEPIFIKNYMSIRPEWGLIKKILLIGIPSGIENSMFQFGKLAIQSTVSTLGT
FT                   VAIAAQAMTNILENLNGIAAIGIGIGLMTVVGQCLGAGRKDEAIYYIKKLSLVSEVVII
FT                   ASCLIIFILTKPITMLAGMEPASARLCFEMIIFITIVKPICWVPSFIPPYGLRAAGDVK
FT                   FSMIVSCCTMWLCRVSLCIYLCRVWGFGPIAVWIGMGCDWMLRSIIFTARFHSRKWLNH
FT                   HVID"
FT   gene            606810..607178
FT                   /locus_tag="EUBREC_0664"
FT   CDS_pept        606810..607178
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0664"
FT                   /product="diacylglycerol kinase"
FT                   /note="CytoplasmicMembrane, score:9.99; COG0818
FT                   Diacylglycerol kinase; KEGG:K00901 diacylglycerol kinase
FT                   HMMPfam:IPR000829; BlastProDom:IPR000829;
FT                   ScanRegExp:IPR000829"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0664"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74453"
FT                   /db_xref="GOA:C4ZCU8"
FT                   /db_xref="InterPro:IPR000829"
FT                   /db_xref="InterPro:IPR033717"
FT                   /db_xref="InterPro:IPR036945"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZCU8"
FT                   /protein_id="ACR74453.1"
FT                   /translation="MKKAKKPPLYKSFGYAFEGIFTCIRNERNIKIHCTVAILVVIAGA
FT                   VLGITPTEWCICLTLFGLVIALELVNTAIESVVDLVTTERKPLAKTAKDTAAGAVLVAA
FT                   IMAAIVGLIIFVPRIVSL"
FT   gene            607203..607655
FT                   /locus_tag="EUBREC_0665"
FT   CDS_pept        607203..607655
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0665"
FT                   /product="Hypothetical protein"
FT                   /note="Cytoplasmic, score:8.87; COG3937 Uncharacterized
FT                   conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0665"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74454"
FT                   /db_xref="InterPro:IPR008769"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZCU9"
FT                   /protein_id="ACR74454.1"
FT                   /translation="MERLTDGLKKIILAGIGTVAVTAEKSKEVLDEMVKRGELTVEQGK
FT                   VLNQELKHNIKDTVKKNVNVSVKPQSPEELEELLDKMTPEQIQALKSKLAQMDEADVDQ
FT                   EADESVFEDEDIVTDTSADGKSASGGESQTVDIKIEAEDDKEESVN"
FT   gene            607657..609216
FT                   /locus_tag="EUBREC_0666"
FT   CDS_pept        607657..609216
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0666"
FT                   /product="hypothetical protein kinase in ABC1 family"
FT                   /note="Cytoplasmic, score:8.87; COG0661 Predicted unusual
FT                   protein kinase; KEGG:K03688 hypothetical protein kinase in
FT                   ABC1 family; HMMPfam:IPR004147; superfamily:IPR011009"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0666"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74455"
FT                   /db_xref="GOA:C4ZCV0"
FT                   /db_xref="InterPro:IPR004147"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZCV0"
FT                   /protein_id="ACR74455.1"
FT                   /translation="MDGRLKEMTAVLKKYKLTHGLTPEKFRLILQELGPTYIKLGQIMS
FT                   LHSDILPKEYCEELMKLCSDVEPMPFEQVEAVIDASFGYSWKDVFASIDKKPLGAASIA
FT                   QVHRATLKTGEQVVVKVQRKGIHEVMSKDMALLHKAVKLVPPISIKGIVDFDMVLDEMW
FT                   AVAQEEMNFLLEASNIEEFAGNNRDVAFVATPKLYRKYTTSHVLVMEYIKGFNIDDKEG
FT                   LLKDGYDLEEIGSKLIDNYIRQVIEDGFFHADPHPGNVKIRDGKIVWIDMGMMGRLSEH
FT                   DKKELSNAVYGIAMNDIGMIEDAVLAIGDFKGEPDRAKLYKDIKIIMNKYGSLDMGQVD
FT                   VAEFIQELLEVMKNNRIVMPHGFTMLARGITQIEGVLADIAPGINMVGIASARIKQEML
FT                   KNFDLKGELKKAGKTAYKSAHRMAELPDRLAQILEEYQRGQTSINFDMHASDELARLLH
FT                   RLVRNIVMGLWVMALLISSSIVCTTDMTPKILGIPALGVMGYVFACIIVLYTIVKHFIS
FT                   RR"
FT   gene            complement(609272..611056)
FT                   /locus_tag="EUBREC_0667"
FT   CDS_pept        complement(609272..611056)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EUBREC_0667"
FT                   /product="putative Na+/Pi-cotransporter"
FT                   /note="CytoplasmicMembrane, score:9.26; COG1283
FT                   Na+/phosphate symporter; KEGG:K03324 putative
FT                   Na+/Pi-cotransporter; HMMPfam:IPR003841; HMMPfam:IPR008170;
FT                   BlastProDom:IPR000425; HMMTigr:IPR004633"
FT                   /db_xref="EnsemblGenomes-Gn:EUBREC_0667"
FT                   /db_xref="EnsemblGenomes-Tr:ACR74456"
FT                   /db_xref="GOA:C4ZCV1"
FT                   /db_xref="InterPro:IPR003841"
FT                   /db_xref="InterPro:IPR026022"
FT                   /db_xref="InterPro:IPR038078"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZCV1"
FT                   /protein_id="ACR74456.1"
FT                   /translation="MNIYSILQLCGGLAFFLFGMHVMSGSLEKLAGGNLQKILKEVTSN
FT                   PIKSLFFGAIVTIAIQSSSALTVMLVGLVNSGIMELAQTVGVIMGSNIGTTLTAWILSL
FT                   SGIESDNLFISMLKPENFSPVIALIGVIMIMGSKKEKRKDVGIIMAGFAVLMYGMQLMS
FT                   GAVSPLADMPEFTGLLTTFNNPFLGVLVGAVFTGVIQSSAASVGVLQALAMTGAISYSM
FT                   AIPIIMGQNIGTCVTALLSSIGVNKNAKRVSIIHISFNLFGTAIGLVVYCIARYAVDLA
FT                   LFNDSISPVMIAVFHSIFNIATTIILLPFSNTLVKIAKKLVTTDNADGQVVLDERLLLS
FT                   PGLAVKECLEKTNEMAELARDSFKNALDLFDNYSDSKFDDIEVMEERLDYLEDQLDTFL
FT                   IHLSGKDVSEGGNNEISKMLHAINDFERIGDH