(data stored in ACNUC7421 zone)

EMBL: CP001110

ID   CP001110; SV 1; circular; genomic DNA; STD; PRO; 3018238 BP.
XX
AC   CP001110; AAIK01000000-AAIK01000073;
XX
PR   Project:PRJNA13011;
XX
DT   19-JUL-2008 (Rel. 96, Created)
DT   11-SEP-2019 (Rel. 142, Last updated, Version 5)
XX
DE   Pelodictyon phaeoclathratiforme BU-1 chromosome, complete genome.
XX
KW   .
XX
OS   Pelodictyon phaeoclathratiforme BU-1
OC   Bacteria; Chlorobi; Chlorobia; Chlorobiales; Chlorobiaceae;
OC   Chlorobium/Pelodictyon group; Pelodictyon.
XX
RN   [1]
RP   1-3018238
RG   US DOE Joint Genome Institute
RA   Lucas S., Copeland A., Lapidus A., Glavina del Rio T., Dalin E., Tice H.,
RA   Bruce D., Goodwin L., Pitluck S., Schmutz J., Larimer F., Land M.,
RA   Hauser L., Kyrpides N., Mikhailova N., Liu Z., Li T., Zhao F., Overmann J.,
RA   Bryant D.A., Richardson P.;
RT   "Complete sequence of Pelodictyon phaeoclathratiforme BU-1";
RL   Unpublished.
XX
RN   [2]
RP   1-3018238
RG   US DOE Joint Genome Institute
RA   Lucas S., Copeland A., Lapidus A., Glavina del Rio T., Dalin E., Tice H.,
RA   Bruce D., Goodwin L., Pitluck S., Schmutz J., Larimer F., Land M.,
RA   Hauser L., Kyrpides N., Mikhailova N., Liu Z., Li T., Zhao F., Overmann J.,
RA   Bryant D.A., Richardson P.;
RT   ;
RL   Submitted (25-JUN-2008) to the INSDC.
RL   US DOE Joint Genome Institute, 2800 Mitchell Drive B100, Walnut Creek, CA
RL   94598-1698, USA
XX
DR   MD5; 3066c90e76d8daf8a3d3ee7e284f61fa.
DR   BioSample; SAMN02598283.
DR   EnsemblGenomes-Gn; EBG00001037919.
DR   EnsemblGenomes-Gn; EBG00001037920.
DR   EnsemblGenomes-Gn; EBG00001037921.
DR   EnsemblGenomes-Gn; EBG00001037922.
DR   EnsemblGenomes-Gn; EBG00001037923.
DR   EnsemblGenomes-Gn; EBG00001037924.
DR   EnsemblGenomes-Gn; EBG00001037925.
DR   EnsemblGenomes-Gn; EBG00001037926.
DR   EnsemblGenomes-Gn; EBG00001037927.
DR   EnsemblGenomes-Gn; EBG00001037928.
DR   EnsemblGenomes-Gn; EBG00001037929.
DR   EnsemblGenomes-Gn; EBG00001037930.
DR   EnsemblGenomes-Gn; EBG00001037931.
DR   EnsemblGenomes-Gn; EBG00001037932.
DR   EnsemblGenomes-Gn; EBG00001037933.
DR   EnsemblGenomes-Gn; EBG00001037934.
DR   EnsemblGenomes-Gn; EBG00001037935.
DR   EnsemblGenomes-Gn; EBG00001037936.
DR   EnsemblGenomes-Gn; EBG00001037937.
DR   EnsemblGenomes-Gn; EBG00001037938.
DR   EnsemblGenomes-Gn; EBG00001037939.
DR   EnsemblGenomes-Gn; EBG00001037940.
DR   EnsemblGenomes-Gn; EBG00001037941.
DR   EnsemblGenomes-Gn; EBG00001037942.
DR   EnsemblGenomes-Gn; EBG00001037943.
DR   EnsemblGenomes-Gn; EBG00001037944.
DR   EnsemblGenomes-Gn; EBG00001037945.
DR   EnsemblGenomes-Gn; EBG00001037946.
DR   EnsemblGenomes-Gn; EBG00001037947.
DR   EnsemblGenomes-Gn; EBG00001037948.
DR   EnsemblGenomes-Gn; EBG00001037949.
DR   EnsemblGenomes-Gn; EBG00001037950.
DR   EnsemblGenomes-Gn; EBG00001037951.
DR   EnsemblGenomes-Gn; EBG00001037952.
DR   EnsemblGenomes-Gn; EBG00001037953.
DR   EnsemblGenomes-Gn; EBG00001037954.
DR   EnsemblGenomes-Gn; EBG00001037955.
DR   EnsemblGenomes-Gn; EBG00001037956.
DR   EnsemblGenomes-Gn; EBG00001037957.
DR   EnsemblGenomes-Gn; EBG00001037958.
DR   EnsemblGenomes-Gn; EBG00001037959.
DR   EnsemblGenomes-Gn; EBG00001037960.
DR   EnsemblGenomes-Gn; EBG00001037961.
DR   EnsemblGenomes-Gn; EBG00001037962.
DR   EnsemblGenomes-Gn; EBG00001037963.
DR   EnsemblGenomes-Gn; EBG00001037964.
DR   EnsemblGenomes-Gn; EBG00001037965.
DR   EnsemblGenomes-Gn; EBG00001037966.
DR   EnsemblGenomes-Gn; EBG00001037967.
DR   EnsemblGenomes-Gn; EBG00001037968.
DR   EnsemblGenomes-Gn; EBG00001037969.
DR   EnsemblGenomes-Gn; EBG00001037970.
DR   EnsemblGenomes-Gn; EBG00001037971.
DR   EnsemblGenomes-Gn; EBG00001037972.
DR   EnsemblGenomes-Gn; EBG00001037973.
DR   EnsemblGenomes-Gn; EBG00001037974.
DR   EnsemblGenomes-Gn; EBG00001037975.
DR   EnsemblGenomes-Gn; EBG00001037976.
DR   EnsemblGenomes-Gn; EBG00001037977.
DR   EnsemblGenomes-Gn; EBG00001037978.
DR   EnsemblGenomes-Gn; EBG00001037979.
DR   EnsemblGenomes-Gn; EBG00001037980.
DR   EnsemblGenomes-Gn; EBG00001037981.
DR   EnsemblGenomes-Gn; EBG00001037982.
DR   EnsemblGenomes-Gn; EBG00001037983.
DR   EnsemblGenomes-Gn; EBG00001037984.
DR   EnsemblGenomes-Gn; EBG00001037985.
DR   EnsemblGenomes-Gn; EBG00001037986.
DR   EnsemblGenomes-Gn; EBG00001037987.
DR   EnsemblGenomes-Gn; EBG00001037988.
DR   EnsemblGenomes-Gn; EBG00001037989.
DR   EnsemblGenomes-Gn; EBG00001037990.
DR   EnsemblGenomes-Gn; EBG00001037991.
DR   EnsemblGenomes-Gn; EBG00001037992.
DR   EnsemblGenomes-Gn; EBG00001037993.
DR   EnsemblGenomes-Gn; EBG00001037994.
DR   EnsemblGenomes-Gn; EBG00001037995.
DR   EnsemblGenomes-Gn; EBG00001037996.
DR   EnsemblGenomes-Gn; EBG00001037997.
DR   EnsemblGenomes-Gn; EBG00001037998.
DR   EnsemblGenomes-Gn; EBG00001037999.
DR   EnsemblGenomes-Gn; EBG00001038000.
DR   EnsemblGenomes-Gn; EBG00001038001.
DR   EnsemblGenomes-Gn; EBG00001038002.
DR   EnsemblGenomes-Gn; EBG00001038003.
DR   EnsemblGenomes-Gn; EBG00001038004.
DR   EnsemblGenomes-Gn; EBG00001038005.
DR   EnsemblGenomes-Gn; EBG00001038006.
DR   EnsemblGenomes-Gn; EBG00001038007.
DR   EnsemblGenomes-Gn; EBG00001038008.
DR   EnsemblGenomes-Gn; EBG00001038009.
DR   EnsemblGenomes-Gn; EBG00001038010.
DR   EnsemblGenomes-Gn; EBG00001038011.
DR   EnsemblGenomes-Gn; EBG00001038012.
DR   EnsemblGenomes-Gn; EBG00001038013.
DR   EnsemblGenomes-Gn; EBG00001038014.
DR   EnsemblGenomes-Gn; EBG00001038015.
DR   EnsemblGenomes-Gn; EBG00001038016.
DR   EnsemblGenomes-Gn; EBG00001038017.
DR   EnsemblGenomes-Gn; EBG00001038018.
DR   EnsemblGenomes-Gn; EBG00001038019.
DR   EnsemblGenomes-Gn; Ppha_R0001.
DR   EnsemblGenomes-Gn; Ppha_R0002.
DR   EnsemblGenomes-Gn; Ppha_R0003.
DR   EnsemblGenomes-Gn; Ppha_R0004.
DR   EnsemblGenomes-Gn; Ppha_R0005.
DR   EnsemblGenomes-Gn; Ppha_R0006.
DR   EnsemblGenomes-Gn; Ppha_R0007.
DR   EnsemblGenomes-Gn; Ppha_R0008.
DR   EnsemblGenomes-Gn; Ppha_R0009.
DR   EnsemblGenomes-Gn; Ppha_R0010.
DR   EnsemblGenomes-Gn; Ppha_R0011.
DR   EnsemblGenomes-Gn; Ppha_R0012.
DR   EnsemblGenomes-Gn; Ppha_R0013.
DR   EnsemblGenomes-Gn; Ppha_R0014.
DR   EnsemblGenomes-Gn; Ppha_R0015.
DR   EnsemblGenomes-Gn; Ppha_R0016.
DR   EnsemblGenomes-Gn; Ppha_R0017.
DR   EnsemblGenomes-Gn; Ppha_R0018.
DR   EnsemblGenomes-Gn; Ppha_R0019.
DR   EnsemblGenomes-Gn; Ppha_R0020.
DR   EnsemblGenomes-Gn; Ppha_R0021.
DR   EnsemblGenomes-Gn; Ppha_R0022.
DR   EnsemblGenomes-Gn; Ppha_R0023.
DR   EnsemblGenomes-Gn; Ppha_R0024.
DR   EnsemblGenomes-Gn; Ppha_R0025.
DR   EnsemblGenomes-Gn; Ppha_R0026.
DR   EnsemblGenomes-Gn; Ppha_R0027.
DR   EnsemblGenomes-Gn; Ppha_R0028.
DR   EnsemblGenomes-Gn; Ppha_R0029.
DR   EnsemblGenomes-Gn; Ppha_R0030.
DR   EnsemblGenomes-Gn; Ppha_R0031.
DR   EnsemblGenomes-Gn; Ppha_R0032.
DR   EnsemblGenomes-Gn; Ppha_R0033.
DR   EnsemblGenomes-Gn; Ppha_R0034.
DR   EnsemblGenomes-Gn; Ppha_R0035.
DR   EnsemblGenomes-Gn; Ppha_R0036.
DR   EnsemblGenomes-Gn; Ppha_R0037.
DR   EnsemblGenomes-Gn; Ppha_R0038.
DR   EnsemblGenomes-Gn; Ppha_R0039.
DR   EnsemblGenomes-Gn; Ppha_R0040.
DR   EnsemblGenomes-Gn; Ppha_R0041.
DR   EnsemblGenomes-Gn; Ppha_R0042.
DR   EnsemblGenomes-Gn; Ppha_R0043.
DR   EnsemblGenomes-Gn; Ppha_R0044.
DR   EnsemblGenomes-Gn; Ppha_R0045.
DR   EnsemblGenomes-Gn; Ppha_R0046.
DR   EnsemblGenomes-Gn; Ppha_R0047.
DR   EnsemblGenomes-Gn; Ppha_R0048.
DR   EnsemblGenomes-Gn; Ppha_R0049.
DR   EnsemblGenomes-Gn; Ppha_R0050.
DR   EnsemblGenomes-Gn; Ppha_R0051.
DR   EnsemblGenomes-Gn; Ppha_R0052.
DR   EnsemblGenomes-Gn; Ppha_R0053.
DR   EnsemblGenomes-Gn; Ppha_R0054.
DR   EnsemblGenomes-Gn; Ppha_R0055.
DR   EnsemblGenomes-Gn; Ppha_R0056.
DR   EnsemblGenomes-Gn; Ppha_R0057.
DR   EnsemblGenomes-Gn; Ppha_R0058.
DR   EnsemblGenomes-Gn; Ppha_R0059.
DR   EnsemblGenomes-Gn; Ppha_R0060.
DR   EnsemblGenomes-Tr; EBT00001641400.
DR   EnsemblGenomes-Tr; EBT00001641401.
DR   EnsemblGenomes-Tr; EBT00001641402.
DR   EnsemblGenomes-Tr; EBT00001641403.
DR   EnsemblGenomes-Tr; EBT00001641404.
DR   EnsemblGenomes-Tr; EBT00001641405.
DR   EnsemblGenomes-Tr; EBT00001641406.
DR   EnsemblGenomes-Tr; EBT00001641407.
DR   EnsemblGenomes-Tr; EBT00001641408.
DR   EnsemblGenomes-Tr; EBT00001641409.
DR   EnsemblGenomes-Tr; EBT00001641410.
DR   EnsemblGenomes-Tr; EBT00001641411.
DR   EnsemblGenomes-Tr; EBT00001641412.
DR   EnsemblGenomes-Tr; EBT00001641413.
DR   EnsemblGenomes-Tr; EBT00001641414.
DR   EnsemblGenomes-Tr; EBT00001641415.
DR   EnsemblGenomes-Tr; EBT00001641416.
DR   EnsemblGenomes-Tr; EBT00001641417.
DR   EnsemblGenomes-Tr; EBT00001641418.
DR   EnsemblGenomes-Tr; EBT00001641419.
DR   EnsemblGenomes-Tr; EBT00001641420.
DR   EnsemblGenomes-Tr; EBT00001641421.
DR   EnsemblGenomes-Tr; EBT00001641422.
DR   EnsemblGenomes-Tr; EBT00001641423.
DR   EnsemblGenomes-Tr; EBT00001641424.
DR   EnsemblGenomes-Tr; EBT00001641425.
DR   EnsemblGenomes-Tr; EBT00001641426.
DR   EnsemblGenomes-Tr; EBT00001641427.
DR   EnsemblGenomes-Tr; EBT00001641428.
DR   EnsemblGenomes-Tr; EBT00001641429.
DR   EnsemblGenomes-Tr; EBT00001641430.
DR   EnsemblGenomes-Tr; EBT00001641431.
DR   EnsemblGenomes-Tr; EBT00001641432.
DR   EnsemblGenomes-Tr; EBT00001641433.
DR   EnsemblGenomes-Tr; EBT00001641434.
DR   EnsemblGenomes-Tr; EBT00001641435.
DR   EnsemblGenomes-Tr; EBT00001641436.
DR   EnsemblGenomes-Tr; EBT00001641437.
DR   EnsemblGenomes-Tr; EBT00001641438.
DR   EnsemblGenomes-Tr; EBT00001641439.
DR   EnsemblGenomes-Tr; EBT00001641440.
DR   EnsemblGenomes-Tr; EBT00001641441.
DR   EnsemblGenomes-Tr; EBT00001641442.
DR   EnsemblGenomes-Tr; EBT00001641443.
DR   EnsemblGenomes-Tr; EBT00001641444.
DR   EnsemblGenomes-Tr; EBT00001641445.
DR   EnsemblGenomes-Tr; EBT00001641446.
DR   EnsemblGenomes-Tr; EBT00001641447.
DR   EnsemblGenomes-Tr; EBT00001641448.
DR   EnsemblGenomes-Tr; EBT00001641449.
DR   EnsemblGenomes-Tr; EBT00001641450.
DR   EnsemblGenomes-Tr; EBT00001641451.
DR   EnsemblGenomes-Tr; EBT00001641452.
DR   EnsemblGenomes-Tr; EBT00001641453.
DR   EnsemblGenomes-Tr; EBT00001641454.
DR   EnsemblGenomes-Tr; EBT00001641455.
DR   EnsemblGenomes-Tr; EBT00001641456.
DR   EnsemblGenomes-Tr; EBT00001641457.
DR   EnsemblGenomes-Tr; EBT00001641458.
DR   EnsemblGenomes-Tr; EBT00001641459.
DR   EnsemblGenomes-Tr; EBT00001641460.
DR   EnsemblGenomes-Tr; EBT00001641461.
DR   EnsemblGenomes-Tr; EBT00001641462.
DR   EnsemblGenomes-Tr; EBT00001641463.
DR   EnsemblGenomes-Tr; EBT00001641464.
DR   EnsemblGenomes-Tr; EBT00001641465.
DR   EnsemblGenomes-Tr; EBT00001641466.
DR   EnsemblGenomes-Tr; EBT00001641467.
DR   EnsemblGenomes-Tr; EBT00001641468.
DR   EnsemblGenomes-Tr; EBT00001641469.
DR   EnsemblGenomes-Tr; EBT00001641470.
DR   EnsemblGenomes-Tr; EBT00001641471.
DR   EnsemblGenomes-Tr; EBT00001641472.
DR   EnsemblGenomes-Tr; EBT00001641473.
DR   EnsemblGenomes-Tr; EBT00001641474.
DR   EnsemblGenomes-Tr; EBT00001641475.
DR   EnsemblGenomes-Tr; EBT00001641476.
DR   EnsemblGenomes-Tr; EBT00001641477.
DR   EnsemblGenomes-Tr; EBT00001641478.
DR   EnsemblGenomes-Tr; EBT00001641479.
DR   EnsemblGenomes-Tr; EBT00001641480.
DR   EnsemblGenomes-Tr; EBT00001641481.
DR   EnsemblGenomes-Tr; EBT00001641482.
DR   EnsemblGenomes-Tr; EBT00001641483.
DR   EnsemblGenomes-Tr; EBT00001641484.
DR   EnsemblGenomes-Tr; EBT00001641485.
DR   EnsemblGenomes-Tr; EBT00001641486.
DR   EnsemblGenomes-Tr; EBT00001641487.
DR   EnsemblGenomes-Tr; EBT00001641488.
DR   EnsemblGenomes-Tr; EBT00001641489.
DR   EnsemblGenomes-Tr; EBT00001641490.
DR   EnsemblGenomes-Tr; EBT00001641491.
DR   EnsemblGenomes-Tr; EBT00001641492.
DR   EnsemblGenomes-Tr; EBT00001641493.
DR   EnsemblGenomes-Tr; EBT00001641494.
DR   EnsemblGenomes-Tr; EBT00001641495.
DR   EnsemblGenomes-Tr; EBT00001641496.
DR   EnsemblGenomes-Tr; EBT00001641497.
DR   EnsemblGenomes-Tr; EBT00001641498.
DR   EnsemblGenomes-Tr; EBT00001641499.
DR   EnsemblGenomes-Tr; EBT00001641500.
DR   EnsemblGenomes-Tr; Ppha_R0001-1.
DR   EnsemblGenomes-Tr; Ppha_R0002-1.
DR   EnsemblGenomes-Tr; Ppha_R0003-1.
DR   EnsemblGenomes-Tr; Ppha_R0004-1.
DR   EnsemblGenomes-Tr; Ppha_R0005-1.
DR   EnsemblGenomes-Tr; Ppha_R0006-1.
DR   EnsemblGenomes-Tr; Ppha_R0007-1.
DR   EnsemblGenomes-Tr; Ppha_R0008-1.
DR   EnsemblGenomes-Tr; Ppha_R0009-1.
DR   EnsemblGenomes-Tr; Ppha_R0010-1.
DR   EnsemblGenomes-Tr; Ppha_R0011-1.
DR   EnsemblGenomes-Tr; Ppha_R0012-1.
DR   EnsemblGenomes-Tr; Ppha_R0013-1.
DR   EnsemblGenomes-Tr; Ppha_R0014-1.
DR   EnsemblGenomes-Tr; Ppha_R0015-1.
DR   EnsemblGenomes-Tr; Ppha_R0016-1.
DR   EnsemblGenomes-Tr; Ppha_R0017-1.
DR   EnsemblGenomes-Tr; Ppha_R0018-1.
DR   EnsemblGenomes-Tr; Ppha_R0019-1.
DR   EnsemblGenomes-Tr; Ppha_R0020-1.
DR   EnsemblGenomes-Tr; Ppha_R0021-1.
DR   EnsemblGenomes-Tr; Ppha_R0022-1.
DR   EnsemblGenomes-Tr; Ppha_R0023-1.
DR   EnsemblGenomes-Tr; Ppha_R0024-1.
DR   EnsemblGenomes-Tr; Ppha_R0025-1.
DR   EnsemblGenomes-Tr; Ppha_R0026-1.
DR   EnsemblGenomes-Tr; Ppha_R0027-1.
DR   EnsemblGenomes-Tr; Ppha_R0028-1.
DR   EnsemblGenomes-Tr; Ppha_R0029-1.
DR   EnsemblGenomes-Tr; Ppha_R0030-1.
DR   EnsemblGenomes-Tr; Ppha_R0031-1.
DR   EnsemblGenomes-Tr; Ppha_R0032-1.
DR   EnsemblGenomes-Tr; Ppha_R0033-1.
DR   EnsemblGenomes-Tr; Ppha_R0034-1.
DR   EnsemblGenomes-Tr; Ppha_R0035-1.
DR   EnsemblGenomes-Tr; Ppha_R0036-1.
DR   EnsemblGenomes-Tr; Ppha_R0037-1.
DR   EnsemblGenomes-Tr; Ppha_R0038-1.
DR   EnsemblGenomes-Tr; Ppha_R0039-1.
DR   EnsemblGenomes-Tr; Ppha_R0040-1.
DR   EnsemblGenomes-Tr; Ppha_R0041-1.
DR   EnsemblGenomes-Tr; Ppha_R0042-1.
DR   EnsemblGenomes-Tr; Ppha_R0043-1.
DR   EnsemblGenomes-Tr; Ppha_R0044-1.
DR   EnsemblGenomes-Tr; Ppha_R0045-1.
DR   EnsemblGenomes-Tr; Ppha_R0046-1.
DR   EnsemblGenomes-Tr; Ppha_R0047-1.
DR   EnsemblGenomes-Tr; Ppha_R0048-1.
DR   EnsemblGenomes-Tr; Ppha_R0049-1.
DR   EnsemblGenomes-Tr; Ppha_R0050-1.
DR   EnsemblGenomes-Tr; Ppha_R0051-1.
DR   EnsemblGenomes-Tr; Ppha_R0052-1.
DR   EnsemblGenomes-Tr; Ppha_R0053-1.
DR   EnsemblGenomes-Tr; Ppha_R0054-1.
DR   EnsemblGenomes-Tr; Ppha_R0055-1.
DR   EnsemblGenomes-Tr; Ppha_R0056-1.
DR   EnsemblGenomes-Tr; Ppha_R0057-1.
DR   EnsemblGenomes-Tr; Ppha_R0058-1.
DR   EnsemblGenomes-Tr; Ppha_R0059-1.
DR   EnsemblGenomes-Tr; Ppha_R0060-1.
DR   EuropePMC; PMC2897672; 20348258.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00029; Intron_gpII.
DR   RFAM; RF00162; SAM.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01348; CRISPR-DR38.
DR   RFAM; RF01697; Chlorobi-RRM.
DR   RFAM; RF01711; Lnt.
DR   RFAM; RF01724; SAM-Chlorobi.
DR   RFAM; RF01854; Bacteria_large_SRP.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   RFAM; RF01999; group-II-D1D4-2.
DR   RFAM; RF02005; group-II-D1D4-6.
DR   RFAM; RF02012; group-II-D1D4-7.
DR   SILVA-LSU; CP001110.
DR   SILVA-SSU; CP001110.
DR   StrainInfo; 303403; 1.
XX
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID: 3634475
CC   Source DNA available from Donald A. Bryant (dab14@psu.edu)
CC   Bacteria available from DSMZ: DSM 5477
CC   Contacts: Donald A. Bryant (dab14@psu.edu)
CC             David Bruce (microbe@cuba.jgi-psf.org)
CC   Annotation done by JGI-ORNL and JGI-PGF
CC   Finishing done by Pennsylvania State University
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. it is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3018238
FT                   /organism="Pelodictyon phaeoclathratiforme BU-1"
FT                   /strain="BU-1"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:324925"
FT                   /type_material="type strain of Pelodictyon
FT                   phaeoclathratiforme"
FT   gene            1..1464
FT                   /locus_tag="Ppha_0001"
FT   CDS_pept        1..1464
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0001"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /note="KEGG: cph:Cpha266_0001 chromosomal replication
FT                   initiator protein DnaA; TIGRFAM: chromosomal replication
FT                   initiator protein DnaA; PFAM: Chromosomal replication
FT                   initiator DnaA domain; Chromosomal replication initiator
FT                   DnaA; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42360"
FT                   /db_xref="GOA:B4SA94"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/TrEMBL:B4SA94"
FT                   /protein_id="ACF42360.1"
FT                   /translation="MLEVTSNTFQGKTKKNSSMEHQVWEACLNAIREKINPLAFKTWFF
FT                   PIKPLSFSGSELTIEVPSQFFYEWIEENYSSFLKLALKDVIGPEAKLMYSIVMDKSQGQ
FT                   PVTIELPHQNAMNGDFIAASRATEARAKNSEEFEKNLARFETHLNSKYTFDTLIRGDCN
FT                   SLAFAASKSVAQSPGQNAFNPLVIYGGVGLGKTHMMQAIGNSVRENRLSERVLYVSSEK
FT                   FAIDFVNAIQNGKIQEFSSFYRSIDVLIIDDIQFFSGKEKTQEEIFHIFNTLHQSNKQI
FT                   ILSADRPIKDIKGIEDRLISRFNWGLSADIQPPDYETRKAIILSKLHQSGVNLDETVIE
FT                   FIATNVTENVRELEGCIVKLLAAQSLDNREIDLQFTKSTLKDIIRHTTKRLTLDTIEKA
FT                   VCSYFSITPNDLKGKSKKKEIAVGRQVAMYLSKLLTDSSLKTIGLHFGGRDHSTVIHAV
FT                   NTTTKKVDTIGDERKKIEEIKKRIEILSM"
FT   gene            1746..2870
FT                   /locus_tag="Ppha_0002"
FT   CDS_pept        1746..2870
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0002"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="KEGG: plt:Plut_0001 DNA-directed DNA polymerase;
FT                   TIGRFAM: DNA polymerase III, beta subunit; PFAM: DNA
FT                   polymerase III beta chain"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42361"
FT                   /db_xref="GOA:B4SA95"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:B4SA95"
FT                   /protein_id="ACF42361.1"
FT                   /translation="MKLTSSIRQLQDAIGKVAQAIPAKTIDPRFENVHLSIESGSLTLF
FT                   ATDGELSITAKSDVETSDSGNIGVKARTLQDFLRSMYDTAVTFVIERQEISDHGTLHIT
FT                   TDKGKYKIPCQFESKQEKHEKTYDISLELETAEFLDLIQKTIFACSVDGMRPAMMGVLF
FT                   ELEGNTITAVSTDGHRLVRCRKNYNSAIGEKQKIVIPARVLSILQKLAQHEFITMSIDS
FT                   DRRFVRFIIGNIVLDASLIIEPYPNYDAVIPVEHDKHLIIDRSMIYDSVRRVGRFSSIG
FT                   DVKMVIEGQLLKVMAENTNEGEAAQEEMPCLYTGDDITIGFNSRFIEAALAHLDDNEIR
FT                   IELKSPTTAVIFKPHKTEEDDKLIVLVMPVRINN"
FT   gene            2883..3992
FT                   /locus_tag="Ppha_0003"
FT   CDS_pept        2883..3992
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0003"
FT                   /product="DNA replication and repair protein RecF"
FT                   /note="TIGRFAM: DNA replication and repair protein RecF;
FT                   KEGG: pvi:Cvib_0003 DNA replication and repair protein
FT                   RecF"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42362"
FT                   /db_xref="GOA:B4SA96"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038729"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/TrEMBL:B4SA96"
FT                   /protein_id="ACF42362.1"
FT                   /translation="MKLQCIHYENFRNHRLLNFEPSYGISILYGPNASGKTSILEGVHY
FT                   CALTRGFHNALDSECLYFSSDFFVLESSFLDATERATTVRVLYTKEKEKKIIVDKSEIK
FT                   PFSRHIGRIPCITFSPAELVIVNGAPAERRRFLDNAICQTNRRYLDDLLAYKRVLQQRN
FT                   ALIGQMYEKTGSQKEMLAIWTDSLSRLAASIVYTRMQFLSSFLPLFQTLYQLLSPDEHP
FT                   TIVYRCSLGKVFHDSSIDQLYSQFLVKFEETEREEILRGQTMTGPHRDDLLFLLHTREI
FT                   KKYASQGQMRIFLIALKLSQHRLFSDILGEKPICLLDDLFSELDASHSNAIFRLLETCG
FT                   QTIITSAENKPYSHVDSISIESLKGIKEM"
FT   gene            3995..4288
FT                   /locus_tag="Ppha_0004"
FT   CDS_pept        3995..4288
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0004"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: plt:Plut_0003 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42363"
FT                   /db_xref="InterPro:IPR007922"
FT                   /db_xref="UniProtKB/TrEMBL:B4SA97"
FT                   /protein_id="ACF42363.1"
FT                   /translation="MSRTKNPKQFSVVAGEMCQVLGLTEAYQQYKTLQVWKSVVGDTIS
FT                   ASTTIERFSNGVLFIRVKNSTWRMELNFRKQNILEKLNAALENSMVKEIIFK"
FT   gene            complement(4331..5554)
FT                   /locus_tag="Ppha_0005"
FT   CDS_pept        complement(4331..5554)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0005"
FT                   /product="beta-lactamase domain protein"
FT                   /note="PFAM: beta-lactamase domain protein;
FT                   flavodoxin/nitric oxide synthase; KEGG: pvi:Cvib_0005
FT                   beta-lactamase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42364"
FT                   /db_xref="GOA:B4SA98"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR016440"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:B4SA98"
FT                   /protein_id="ACF42364.1"
FT                   /translation="MTDSNILKITDDVSWIGVLDPGLITFDIVMETKYGTTYNSYFINA
FT                   EKKTVIETTKEKFWPAYLSKLKQVTDPAEIEYIVVDHTEPDHSGNVRNLLAIAPNATVV
FT                   GSGNAIKFLRDQTGHDFKSLVVKTGDTLSLGNKTLHFINAPNLHWPDTIYTWLEEDRIL
FT                   FTCDSFGSHFCDAGMFDDAVGDFDDSFTYYFNSILRPFSKYMLQAIEKIKPLDINIICP
FT                   GHGPILRSNWQKYVDLSMKYATTAIALPQEKNILIAYVSAYENTTLMAEKIAEGLSQSC
FT                   DFKIDICDIESVQASVLEEKIAHCSGIIVGSPTINQNILPQIYQIFATINPIRDKGKLA
FT                   AAFGSYGWSGEAVRMIESNFTMLKLKVFDQNVMVKFKPHEPEFEKCIAFGKSYAEKMIE
FT                   IYRLSCNL"
FT   gene            complement(5681..8116)
FT                   /locus_tag="Ppha_0006"
FT   CDS_pept        complement(5681..8116)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0006"
FT                   /product="DNA polymerase B region"
FT                   /note="PFAM: DNA polymerase B exonuclease; DNA polymerase B
FT                   region; SMART: DNA-directed DNA polymerase B; KEGG:
FT                   cph:Cpha266_0027 DNA polymerase B region"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42365"
FT                   /db_xref="GOA:B4SA99"
FT                   /db_xref="InterPro:IPR006133"
FT                   /db_xref="InterPro:IPR006134"
FT                   /db_xref="InterPro:IPR006172"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR023211"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR042087"
FT                   /db_xref="UniProtKB/TrEMBL:B4SA99"
FT                   /protein_id="ACF42365.1"
FT                   /translation="MKHNPVFPLSIKQAIMDSIISDIVTNDLLFGKDKEERIVGAYQLS
FT                   DTHIRLFNRDDNGVSYHDEPFFPFFFLSENSLLDGFIPEENEKFWLVTLAGTNYYKNLA
FT                   IFRNWKNHRRAIDFINRKRLNDTTENQDKNTQYDNNSLLYSKGDAVTQYFLQSGKTLFK
FT                   GMIFDDLYRMQLDIETHYDPMKRQNSGTALDDDEVIIISLSDSRGWEQVLHSKNRTEKE
FT                   LLEELVTLIVKMDPDVIEGHNIFSFDLSYLQRRCDRYGIPFAIGRNGLLAKTYPASIRF
FT                   AERSIDYPFFDIPGRHVIDTLFLVQSYDVSRRSMQSYGLKAVAKHFGFASKERTYIEYK
FT                   DIASLWQNNHEKLLAYALDDVRETRALSSLLSGSNFYLSQMLPYTYAMTSRIGQAAKIE
FT                   VLFVREYLRRKQSIPKPTSGQQHSGGYTEIFLKGILGPIVYADVESLYPSIMLSYDICP
FT                   KSDELKIFPLVLNDLKELRFKAKERARNENILGKSTLAANFDAMQSSFKILINAMYGYL
FT                   GFSGGIFNDFYEADKVTTTGQALAKKMIMEFEARGCKIIEVDTDGILFIPPPDVQSEMA
FT                   ERELVSEVSSLMPSGINIGFDGRFKKMISYMKKNYALLGYDNVMKLKGSSLTSRSGEKF
FT                   GRDFVRRGFETLLTEDINGLHNLFTEYRNKILNHELDISDFSRTESLKNSLEQYLEDVK
FT                   SGKRSKAITYEIVIKAGLNITKGERITFYIAGTGAGSSAYDKGKLASEWKREKPDENTH
FT                   FYLKRLDEHCQKFLPFFKPQDYSMIFSDDTLFSFSADGIELQREIRHTETDPFGGELT"
FT   gene            complement(8136..10001)
FT                   /locus_tag="Ppha_0007"
FT   CDS_pept        complement(8136..10001)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0007"
FT                   /product="glucose inhibited division protein A"
FT                   /note="TIGRFAM: glucose inhibited division protein A; PFAM:
FT                   glucose-inhibited division protein A; KEGG: cch:Cag_2006
FT                   tRNA uridine 5-carboxymethylaminomethyl modification enzyme
FT                   GidA"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42366"
FT                   /db_xref="GOA:B4SAA0"
FT                   /db_xref="InterPro:IPR002218"
FT                   /db_xref="InterPro:IPR004416"
FT                   /db_xref="InterPro:IPR020595"
FT                   /db_xref="InterPro:IPR026904"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B4SAA0"
FT                   /protein_id="ACF42366.1"
FT                   /translation="MYDIIVTGAGHAGCEAALSAARMGSSCLLISSDLTAIARMSCNPA
FT                   IGGVAKGQITREIDALGGEMAKAIDATGIQFRMLNRSKGPAMHSPRAQADRTLYSLYMR
FT                   NVIEKEANIDLLQDTVVGIECSGGAFSGVRLMSGRIINGRTAILSCGTFLNGLIHIGMN
FT                   HYAGGRTIAEPPVYGLTEDLVKYGFAAGRLKTGTPARIDARSVEYDLVEEQSGDPLPIS
FT                   FSFRNTPVINRHQISCFVTKTTKATHEILKKGFDRSPLFSGKVQGIGPRYCPSIEDKIC
FT                   RFPDKDSHHIFLEPEGFDTNEMYVNGFSTSLPEEIQLEALQSLPGLRNVKMIRPGYAIE
FT                   YDYFFPYQINRSLETKLVKNLFFAGQINGTSGYEEAAAQGLIAGINATLLLRGRAPLHL
FT                   KRSDAYIGVLIDDLVTKETNEPYRMFTSSAEHRLLLRHDNADIRLCHHAKSAGLIDADT
FT                   FSDCTNKKRLIDTLNQLCLDTKIKPDVANTLLAGLGHPPVTTTQSAVNLLKKPGVHFHM
FT                   LLESALSFKESVYAVTDDPLVFEQVEIDLKYEGYLKRDLLMAEKILRLDLHEIPASFRY
FT                   DHVTGLSNEGREKLMKLRPETIGQASRILGVSPSDISVLMIRLGR"
FT   gene            10049..10165
FT                   /locus_tag="Ppha_0008"
FT   CDS_pept        10049..10165
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0008"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42367"
FT                   /db_xref="UniProtKB/TrEMBL:B4SAA1"
FT                   /protein_id="ACF42367.1"
FT                   /translation="MAVIKDTNYRTFPFDIPLFKVVNRYMYYMCIVFFDFGY"
FT   gene            10466..10903
FT                   /locus_tag="Ppha_0009"
FT   CDS_pept        10466..10903
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0009"
FT                   /product="thiosulfate-binding protein SoxY"
FT                   /note="KEGG: cph:Cpha266_0029 thiosulfate-binding protein
FT                   SoxY"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42368"
FT                   /db_xref="InterPro:IPR032711"
FT                   /db_xref="InterPro:IPR038162"
FT                   /db_xref="UniProtKB/TrEMBL:B4SAA2"
FT                   /protein_id="ACF42368.1"
FT                   /translation="MKRRQFLASGAIISSFLSLFPEKLLAEWNSEFFRQSSLEQAFLNA
FT                   LGTKDLLRSNGVTIVAPPVASDGSAVPVEIHSSLKCDQLFLFVEKNLTPLVFKCDLHES
FT                   MQPYFSLNIKMKEGSALHAVVRESGKYYVTSVQVEVVAQAC"
FT   sig_peptide     10466..10546
FT                   /locus_tag="Ppha_0009"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.996 at
FT                   residue 27"
FT   gene            10928..11236
FT                   /locus_tag="Ppha_0010"
FT   CDS_pept        10928..11236
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0010"
FT                   /product="Sulphur oxidation protein SoxZ"
FT                   /note="PFAM: Sulphur oxidation protein SoxZ; KEGG:
FT                   cph:Cpha266_0030 sulfur oxidation protein SoxZ"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42369"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR014880"
FT                   /db_xref="InterPro:IPR030995"
FT                   /db_xref="UniProtKB/TrEMBL:B4SAA3"
FT                   /protein_id="ACF42369.1"
FT                   /translation="MSSSVRIFAREESGIVHVKIIIPHPNESGSRKDEQGNLVAAHFIK
FT                   EGAAFLNGNPLFDIQLGPSVSRDPFLQFRFSGKKGDIVKVSFIDNKDEHFVADTVVQ"
FT   gene            11297..11671
FT                   /locus_tag="Ppha_0011"
FT   CDS_pept        11297..11671
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0011"
FT                   /product="cytochrome c class I"
FT                   /note="PFAM: cytochrome c class I; KEGG: cph:Cpha266_0031
FT                   sulfide dehydrogenase (flavocytochrome), cytochrome c
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42370"
FT                   /db_xref="GOA:B4SAK1"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:B4SAK1"
FT                   /protein_id="ACF42370.1"
FT                   /translation="MAVKLRVWLTACAFSTLALATGSGAYAAGNAAGAKPVKQVQAKRA
FT                   EANPRGLVLSLSCSSCHGTDGKSVGIIPSISGKTTEYLETALKAFKSGARYSTVMSRHA
FT                   KGYTDEEIRLIAEYFGKNNK"
FT   sig_peptide     11297..11380
FT                   /locus_tag="Ppha_0011"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.980 at
FT                   residue 28"
FT   gene            11686..12978
FT                   /locus_tag="Ppha_0012"
FT   CDS_pept        11686..12978
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0012"
FT                   /product="Flavocytochrome c sulphide dehydrogenase
FT                   flavin-binding"
FT                   /note="PFAM: FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; Flavocytochrome c sulphide dehydrogenase
FT                   flavin-binding; KEGG: cph:Cpha266_0032 sulfide
FT                   dehydrogenase (flavocytochrome), flavoprotein subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42371"
FT                   /db_xref="GOA:B4SAK2"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR015323"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR037092"
FT                   /db_xref="UniProtKB/TrEMBL:B4SAK2"
FT                   /protein_id="ACF42371.1"
FT                   /translation="MTHKLSRRDFNKLLLSGVAGSAFGIFGSSNKAFAGSKRVVVIGGG
FT                   FGGAAAAKYLRKLDPSISVTLVEPKATFYTCPFSNWVLGDLKTMNDIAQTYTVLKNKYQ
FT                   INIIADYAVAVDASKSTVKLKNGQVLNYDRLIVSPGIDFRWDSIPGYSESVANSQMPHA
FT                   FQAGPQTILLHKQLHEMRNGGRVLICPPGNPFRCPPGPYERASLIAGYLKAKKPLSKIV
FT                   ILDPKDKFSKQALFKKGWERLYPGMIEWRSGTAGGKVTAVDAAAMTVTTEFGVEKGDVI
FT                   NVIPPQKAGKIAFDAGLTDATGWCPINPVSFESTIHPGIHVIGDASIAGAMPKSGFAAS
FT                   SQGKVAAAAIVRLFQGKVPAAPSLVNTCYSLLAPGYGISVAGVYKLTAEGIVDIKDAGG
FT                   VTPITADDDHLNEEAMFAEGWYSNIVHDTWG"
FT   sig_peptide     11686..11790
FT                   /locus_tag="Ppha_0012"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.989 at
FT                   residue 35"
FT   gene            13137..15011
FT                   /locus_tag="Ppha_0013"
FT   CDS_pept        13137..15011
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0013"
FT                   /product="protein-export membrane protein SecD"
FT                   /note="TIGRFAM: protein-export membrane protein, SecD/SecF
FT                   family; protein-export membrane protein SecD; PFAM:
FT                   SecD/SecF/SecDF export membrane protein; KEGG:
FT                   cph:Cpha266_0033 preprotein translocase subunit SecD"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42372"
FT                   /db_xref="GOA:B4SAK3"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR005791"
FT                   /db_xref="InterPro:IPR022645"
FT                   /db_xref="InterPro:IPR022646"
FT                   /db_xref="InterPro:IPR022813"
FT                   /db_xref="UniProtKB/TrEMBL:B4SAK3"
FT                   /protein_id="ACF42372.1"
FT                   /translation="MPSMKNKRFNLLLIAVVTLMALWSLWPTWSDYTLSKQLDSFASAQ
FT                   DSLKYVLNHREELENARKKSLKLGLDLKGGMHLVMEVDQVDLFEQKAWNKDGKFTAIMQ
FT                   NVRTKASQSDAKVIDLISSEFKSQNIRLSRYFYDIRNSDQEIVSKLEKESEDALNRAKE
FT                   IIRNRIDQYGVAEPVITTQGSRKIIIELPGVSDENRVRNLLKGTAKLEFRLLREPEVMV
FT                   RTLDRINSYLVQNQQNSAAVQVAPVPDSSSAALPAPVALSVPKPVAPVAPQSSATPLYD
FT                   VIGVFQNGTAFTTEQSKEYVVSLLHRSDIVALFPPDSELLLAAKPDVGKNGEKLYSIYL
FT                   VRKGPELTGGVITEAKATFGSEGVQPEVLMSMNSEGTSKWARITGANIGKRIAIVLDGA
FT                   VYSAPVVQSKIPNGNSVINGIESLEEAKDLEIVLKAGALPAPVRIIEERTVGPSLGADY
FT                   IRAGMQSIIWGFVAVAVFMVVYYRQAGIAADVAVVLNILIVLSVLAGFNASLSLPGIAG
FT                   IVLTMGMAVDANVLIYERIREELAEGKSVITAVTQGYERAFSSILDSHVTTLSAAFLLY
FT                   TYGIGPIQGFAVTLMIGTSASLFTAIVVTREIFHLLFIKNLMSDKSFG"
FT   sig_peptide     13137..13229
FT                   /locus_tag="Ppha_0013"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.976) with cleavage site probability 0.601 at
FT                   residue 31"
FT   gene            15033..15968
FT                   /locus_tag="Ppha_0014"
FT   CDS_pept        15033..15968
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0014"
FT                   /product="protein-export membrane protein SecF"
FT                   /note="TIGRFAM: protein-export membrane protein, SecD/SecF
FT                   family; protein-export membrane protein SecF; PFAM:
FT                   SecD/SecF/SecDF export membrane protein; KEGG:
FT                   plt:Plut_0008 preprotein translocase subunit SecF"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42373"
FT                   /db_xref="GOA:B4SAK4"
FT                   /db_xref="InterPro:IPR000731"
FT                   /db_xref="InterPro:IPR005665"
FT                   /db_xref="InterPro:IPR022645"
FT                   /db_xref="InterPro:IPR022646"
FT                   /db_xref="InterPro:IPR022813"
FT                   /db_xref="UniProtKB/TrEMBL:B4SAK4"
FT                   /protein_id="ACF42373.1"
FT                   /translation="MRIFHNTSFNFIRYRKIAYGFSLVLLVSGLVSLAVKGLNYGIDFR
FT                   GGSEVVIRFEKDADVGQIRSILDAAGVSGTLKQYGMDRSFLFSTVFQGDTGELKSLVSN
FT                   ALNDRIKDNRHEIVRIDAVGPSIASDLKWSAVKALVAALIAILIYVGIRFETKFAATGV
FT                   LAILHDVLTVLGIFSILGGLFAFMPLEMDQSIIAAFLTIAGYSITDTVVVYDRIRERIR
FT                   GQKPSEYERIFNESMNQTLNRTIITSGTTLISVFVLFIFAGPAIRGFAFAVFIGILIGT
FT                   YSSIFVAAPLVYDWLRITKSSVRLRGSKVS"
FT   sig_peptide     15033..15137
FT                   /locus_tag="Ppha_0014"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.992) with cleavage site probability 0.704 at
FT                   residue 35"
FT   gene            16068..17384
FT                   /locus_tag="Ppha_0015"
FT   CDS_pept        16068..17384
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0015"
FT                   /product="SurA domain"
FT                   /note="PFAM: PpiC-type peptidyl-prolyl cis-trans isomerase;
FT                   SurA domain; KEGG: pvi:Cvib_0012 PpiC-type peptidyl-prolyl
FT                   cis-trans isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42374"
FT                   /db_xref="GOA:B4SAK5"
FT                   /db_xref="InterPro:IPR000297"
FT                   /db_xref="InterPro:IPR015391"
FT                   /db_xref="InterPro:IPR027304"
FT                   /db_xref="UniProtKB/TrEMBL:B4SAK5"
FT                   /protein_id="ACF42374.1"
FT                   /translation="MKKVFGKAALLLFIGSSSLQAPAIADMADRIVAVVGNEVIFKSEI
FT                   DSRELMARMQYPELTKNNGLSRSILDGLIDQKIILAKAKIDSVSIDENSISSAASERFR
FT                   ELGTKFTSKADMESRLGKSSAGILEGIRQELRNQQLVDTLRRKKSAGVTVSYDEVMAFY
FT                   SANKEQIPQIPEEVSVSQILKYPPVSAEEKAQSLATMERIRTEIKGGADFAAMARQYSQ
FT                   DPGSAQSGGDLGFVAKGQLIPSFENAAYALNEGKISDIVETRYGYHLIQLLSKEPNSIH
FT                   VRHILIGFDRKSGDFSSVTRQLNAVRADVLGGKETFADMAKKYSEDPASAAQGGTILLS
FT                   GSSNPLFSPLALRPQLQQILSTLQKSGDISEVQKIDPPQGEPFYAIYRLNERIPAHKLN
FT                   TEKDYAYLEELALADKNQQIFIKWVEQLRKEVYVRTSDI"
FT   sig_peptide     16068..16145
FT                   /locus_tag="Ppha_0015"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.981 at
FT                   residue 26"
FT   gene            complement(17373..19322)
FT                   /locus_tag="Ppha_0016"
FT   CDS_pept        complement(17373..19322)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0016"
FT                   /product="DNA gyrase, B subunit"
FT                   /EC_number="5.6.2.3"
FT                   /note="KEGG: cch:Cag_0029 DNA gyrase, B subunit; TIGRFAM:
FT                   DNA gyrase, B subunit; PFAM: DNA gyrase subunit B domain
FT                   protein; ATP-binding region ATPase domain protein; TOPRIM
FT                   domain protein; DNA topoisomerase type IIA subunit B region
FT                   2 domain protein; SMART: DNA topoisomerase II"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42375"
FT                   /db_xref="GOA:B4SAK6"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR034160"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B4SAK6"
FT                   /protein_id="ACF42375.1"
FT                   /translation="MQEDDILSLPTPPTEASYGATNIQVLDGIEHVRMRPAMYIGDIYS
FT                   RGLHHLVYEIVDNSIDETLGGFNDYIFVSLNPDGSVTVIDHGRGIPVDIHPEKQKSALE
FT                   LVMTVIGAGGKFDKGAYKVSGGLHGVGASVVNALSEWCEVEVSRDGKLYFQRFERGVPQ
FT                   GDVKVIGSSDHRGTKTTFLPDHLIFKTTELRKDIIIDRMRELAFLNKELSITVQDTEGF
FT                   QEIFHYEGGIKEFVQFTDQNRLNLLKEPIYLYGERDSTIVEIALQYNDTYQENVFSYVN
FT                   NINTHEGGTHVTGFRKALTRTLNAYAQKNDLLKNLKLSLTGDDFKEGLTAVISVKVAEP
FT                   QFEGQTKTKLGNSETQSIVETVINEQLSEFAESNPNVLKMIIEKVKGAAMSREAARRAK
FT                   ELTRRKSVLESSGLPGKLADCSINDPEHCELYIVEGDSAGGSAKQGRDRSFQAILPLKG
FT                   KILNVEKARLHKMLENEEIKTIILALGTSFGEEEFSVEKLRYGKIIIMTDADVDGAHIR
FT                   TLLLTFFFRYMRALIEAGRVFIAQPPLYLVKSGKDQQYAWDDEERNSISDGMKKMQKGK
FT                   ANIHIQRYKGLGEMNPEQLWSTTMDPAHRSLLLVNVENAMEADQVFSTLMGDKVEPRRE
FT                   FIEKNARYVRRLDV"
FT   gene            complement(19407..19793)
FT                   /locus_tag="Ppha_0017"
FT   CDS_pept        complement(19407..19793)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0017"
FT                   /product="protein of unknown function UPF0102"
FT                   /note="PFAM: protein of unknown function UPF0102; KEGG:
FT                   cph:Cpha266_0037 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42376"
FT                   /db_xref="GOA:B4SAK7"
FT                   /db_xref="InterPro:IPR003509"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR011856"
FT                   /db_xref="UniProtKB/TrEMBL:B4SAK7"
FT                   /protein_id="ACF42376.1"
FT                   /translation="MTTGYDPHLLGQEGEQLAVNYLVQKGYRILERNYRFHRNEIDIIA
FT                   RQGKTLCFVEVKTRLSSAKGHPAEAVTLQKQHEIIKAARAYLALHSAGECDCRFDVLAI
FT                   RVQHMEEKRISSFIIEHFPDAFWA"
FT   gene            complement(19790..20410)
FT                   /locus_tag="Ppha_0018"
FT   CDS_pept        complement(19790..20410)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0018"
FT                   /product="Ribonuclease H"
FT                   /EC_number="3.1.26.4"
FT                   /note="PFAM: ribonuclease HII/HIII; KEGG: cch:Cag_1993
FT                   ribonuclease HII"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42377"
FT                   /db_xref="GOA:B4SAK8"
FT                   /db_xref="InterPro:IPR001352"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR022898"
FT                   /db_xref="InterPro:IPR024567"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4SAK8"
FT                   /protein_id="ACF42377.1"
FT                   /translation="MITDYEWPLWQTTALVCGIDEAGRGPLAGPVVAAAVIFPRWFRPV
FT                   GTILERVNDSKKLSAAERELLAPAIRNAAAFWAVAEVDPETIDQINILQATMLAMNQAV
FT                   AALPIQPELLLVDGNRFRTELPIPYETVVKGDSKVFSIAAASVLAKTHRDELMVAYASE
FT                   YPQYGFERHVGYPTRAHVEAIRQHGRCPIHRQSFRLRQLGEKP"
FT   gene            complement(20484..21158)
FT                   /locus_tag="Ppha_0019"
FT   CDS_pept        complement(20484..21158)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0019"
FT                   /product="conserved hypothetical protein"
FT                   /note="PFAM: conserved hypothetical protein; KEGG:
FT                   cph:Cpha266_1465 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42378"
FT                   /db_xref="InterPro:IPR012808"
FT                   /db_xref="InterPro:IPR015996"
FT                   /db_xref="UniProtKB/TrEMBL:B4SAK9"
FT                   /protein_id="ACF42378.1"
FT                   /translation="MITDTTLAFLRELKGNNERVWFTEHKSEYQQAYGEMLDTVLQLLV
FT                   AISAFDQGIALSGLDPKSCMMRINRDIRFSKDKSPYKTNFFAFISKGGRKGPLGGYYLH
FT                   IEPGATFAGGGIYMPEAAVLEELRREIDAHFAEWQSLIAQKEFSSHFPEGILPSGKLVR
FT                   PPKGYDSTNPAIEYLKFKGYYTQRFFTDDEVTNPGFVAELAKTFGVVSPLVQFLNGALS
FT                   RE"
FT   gene            complement(21238..21555)
FT                   /locus_tag="Ppha_0020"
FT   CDS_pept        complement(21238..21555)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0020"
FT                   /product="HicB family protein"
FT                   /note="PFAM: HicB family protein; KEGG: cph:Cpha266_2191
FT                   HicB family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42379"
FT                   /db_xref="GOA:B4SAL0"
FT                   /db_xref="InterPro:IPR008651"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="InterPro:IPR035069"
FT                   /db_xref="UniProtKB/TrEMBL:B4SAL0"
FT                   /protein_id="ACF42379.1"
FT                   /translation="MLNYKGYTGHIEFDDEAGLFHGEVVDTKDVVTFQGRSVDEIVQAF
FT                   RDSVDDYLEFCAERGEKPDKPFSGKFVLRMNPELHHAIHLKAIKAGKSLNKWVNDTLQS
FT                   A"
FT   gene            complement(21542..21808)
FT                   /locus_tag="Ppha_0021"
FT   CDS_pept        complement(21542..21808)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0021"
FT                   /product="HicA protein"
FT                   /note="KEGG: cph:Cpha266_2192 HicA protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42380"
FT                   /db_xref="GOA:B4SAL1"
FT                   /db_xref="InterPro:IPR012933"
FT                   /db_xref="UniProtKB/TrEMBL:B4SAL1"
FT                   /protein_id="ACF42380.1"
FT                   /translation="MHKKQQKILTRIFEDPVRSDVKWCDIETLIQGLGAEISEGNGSRV
FT                   RIFLNGVRAVFHRPHPEKECDKSALKSIRRFLQEAGVEYHAEL"
FT   gene            complement(22019..22111)
FT                   /pseudo
FT                   /locus_tag="Ppha_0022"
FT   gene            complement(22096..22194)
FT                   /pseudo
FT                   /locus_tag="Ppha_0023"
FT   gene            complement(22188..22418)
FT                   /locus_tag="Ppha_0024"
FT   CDS_pept        complement(22188..22418)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0024"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42381"
FT                   /db_xref="UniProtKB/TrEMBL:B4SAL2"
FT                   /protein_id="ACF42381.1"
FT                   /translation="MSRMACRLTIKIRNNRQETAKTGTEEAAHMRRYDQEPKPFLAAFY
FT                   LQDFFEVMYIERISFFVLRFTPFTLCRIKIL"
FT   gene            22598..24286
FT                   /locus_tag="Ppha_0025"
FT   CDS_pept        22598..24286
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0025"
FT                   /product="ribonuclease, Rne/Rng family"
FT                   /note="TIGRFAM: ribonuclease, Rne/Rng family; PFAM: RNA
FT                   binding S1 domain protein; KEGG: cph:Cpha266_0040
FT                   ribonuclease, Rne/Rng family"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42382"
FT                   /db_xref="GOA:B4SAL3"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR004659"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019307"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/TrEMBL:B4SAL3"
FT                   /protein_id="ACF42382.1"
FT                   /translation="MKKSSNKQLLMNKTGDEIQVALVEEGRLVELIIERPESRRSIGDI
FT                   YLGRVHKVVEGLKAAFVDIGQKSDGFLHFSDVGTTNEDYRALIEDDDDDENGGVDDGDD
FT                   APQGARSGDEPAAGANVKSAARSGSKAPSADDQDRAEKRQSYTQMIAGKLKPNDSILVQ
FT                   VIKEPISSKGSRLTSDITIAGRFMVLLPFGGGQVAVSRRVVARKERSRLKKLVRSMLPE
FT                   GFGAIIRTVAEDQEETLLKQDLEKLLAKWTQIEEKLQDAAPPQLIFKEDTIISSVLRDS
FT                   LTSDVTEIVANSQLIYKETLNYIQWAAPEMVKNVTFYQGKLPLFEGYGIAKDVESIFSR
FT                   KVWLKSGGYIIIEHTEAMVVVDVNSGRYAAKREQEENSLKTNLEAAREVVRQLRLRDIG
FT                   GIIVVDFIDMLDQKNAKKVYDSMKTELRNDRAKSNILPMSDFGIMQITRERIRPSLMQR
FT                   MGDQCPACGGTGVVQARFTTINQIERWLRKYALQHNMKFQQLDLYVSPTVVEPLQNSDM
FT                   KTELKWFLQHMLFVQVKPDESLRSDDFRFYSRKNNKDITAEYGDI"
FT   gene            24313..25176
FT                   /locus_tag="Ppha_0026"
FT   CDS_pept        24313..25176
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0026"
FT                   /product="2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
FT                   N-succinyltransferase"
FT                   /EC_number="2.3.1.117"
FT                   /note="KEGG: cph:Cpha266_0041
FT                   2,3,4,5-tetrahydropyridine-2-carboxylate
FT                   N-succinyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42383"
FT                   /db_xref="GOA:B4SAL4"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR023180"
FT                   /db_xref="InterPro:IPR037133"
FT                   /db_xref="UniProtKB/TrEMBL:B4SAL4"
FT                   /protein_id="ACF42383.1"
FT                   /translation="MGQYDSLKDAILGFSSLGASALWEIPEARRVFNQFKQLLNEGLVR
FT                   AAEKFEGEWRVNSWVKEGILLGMRLGRLQESYVALDEHETGFAFIDKDTYPLKKITLAN
FT                   NVRIVPGGSAVRDGSYLAPSVVMMPPAYVNVGAYVDEGTMIDSHALVGSCAQVGKKVHL
FT                   SAGVQVGGVLEPIGAMPVIIEDEVMVGGNCGIYEGTIVKERAVIGTGVILNGSTPVYDL
FT                   ALNTIYRKTSESPLVIPAGAVVVAGSRKIKGDFAAEHGLSIYTPLIIKYRDDRTDSATA
FT                   LEEALR"
FT   gene            25181..26938
FT                   /locus_tag="Ppha_0027"
FT   CDS_pept        25181..26938
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0027"
FT                   /product="carboxyl-terminal protease"
FT                   /EC_number="3.4.21.102"
FT                   /note="KEGG: plt:Plut_0014 peptidase S41A, C-terminal
FT                   protease; TIGRFAM: carboxyl-terminal protease; PFAM:
FT                   PDZ/DHR/GLGF domain protein; peptidase S41"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42384"
FT                   /db_xref="GOA:B4SAL5"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR004447"
FT                   /db_xref="InterPro:IPR005151"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="InterPro:IPR041489"
FT                   /db_xref="UniProtKB/TrEMBL:B4SAL5"
FT                   /protein_id="ACF42384.1"
FT                   /translation="MQSNEKRSRGWLWRGSLRQGLLALMGAFFFFSAHSPALLLSAEPA
FT                   RLAPADSASSADREYFDIVKSIDLFSEVYSEVSKGYVDTLNVSGLMYAGIDGMLRTLDP
FT                   YTVFLDENDADELDELTSGHYAGIGITIASVDTLFYVTSVVDGYAAAKAGLRIGDTIVA
FT                   INGREIRTMSLDEVKTLIKGPAGSPITFLIERQGVPSFSSTLMREEVRVSTVSYSGILD
FT                   GTGYIEMKSFGSHSMDDLREAIQGLLRQASEQHFQLKGLILDLRNNPGGLLNVAVDVAS
FT                   LFVSKGSEVVSIRGRSPEMAKSYVTASPPLLPALPLVVLINSQSASAAEIVAGAIQDLD
FT                   RGVIIGERSYGKGLVQSVIRISYNSSLKLTTSKYYTPSGRLIQKEVNNAVRESRKVIPV
FT                   PQGETATQIFYTKGKRKVYGGGGILPDIQLPEPVTSPYLSELNKRGLIFLFSSAYRSLN
FT                   PVMPVQPLDRAAVMVSFADFLQRRKFVYTSDSERRFNELRESMKKVQSTNTESDSQSVT
FT                   AFQQEIDRLKKQEITAESEHVAQALEVEILRHFNDRIARTVEIGHDTAVKKAVWLFSDS
FT                   RGYSRILHP"
FT   sig_peptide     25181..25306
FT                   /locus_tag="Ppha_0027"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.993) with cleavage site probability 0.652 at
FT                   residue 42"
FT   gene            complement(26929..27615)
FT                   /locus_tag="Ppha_0028"
FT   CDS_pept        complement(26929..27615)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0028"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cch:Cag_0034 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42385"
FT                   /db_xref="GOA:B4SAL6"
FT                   /db_xref="InterPro:IPR019634"
FT                   /db_xref="InterPro:IPR021995"
FT                   /db_xref="UniProtKB/TrEMBL:B4SAL6"
FT                   /protein_id="ACF42385.1"
FT                   /translation="MLLSLPNWIIHLSSALEWGIAAALLFHYGKITGRRDIRLFGLAML
FT                   PHWSGSFFVLGYHISGDTIPILLDMSELINLFGSTALLLATLNLLKSTKKTSATSYTAA
FT                   LAAIMIAGKPQSYLGADIFDAILQLSSVVYITFLVLLLKVWRRDRTIFSGLTVAGFWFV
FT                   LIFISVTIFCMYLATVVRGYPTLSHDDLLHGLAESLLSISNLMIAIGAHRKIREYKREQ
FT                   LNAIQG"
FT   gene            complement(27616..28758)
FT                   /locus_tag="Ppha_0029"
FT   CDS_pept        complement(27616..28758)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0029"
FT                   /product="geranylgeranyl reductase"
FT                   /note="TIGRFAM: geranylgeranyl reductase; PFAM:
FT                   monooxygenase FAD-binding; FAD dependent oxidoreductase;
FT                   KEGG: cch:Cag_0035 geranylgeranyl reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42386"
FT                   /db_xref="GOA:B4SAL7"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR010253"
FT                   /db_xref="InterPro:IPR011777"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B4SAL7"
FT                   /protein_id="ACF42386.1"
FT                   /translation="MRYDVAVIGGGPSGAVAAAVLAKAGISTVLIERNLDNVKPCGGAI
FT                   PLGLIEEFQIPAELIEKKLSRMRARSPKGRIIEMHMPNGYVGMVRREKFDRYLRSEAER
FT                   AGAVIVEGLVKSISHSGDGFVINTLNDKVAPLRARKIIGADGANSKTADELHFPLNELK
FT                   VIAMQQRFKYTPAIQKFSDIVEIWFDGEVSPDFYGWIFPKADHLAIGTGTEDKRHNLKA
FT                   LQKRFIEKIGITDAPYLDEAAKIPMKPRKSFTQEKAILVGDAAGLVTPANGEGIFFAMR
FT                   SGKLGAQAMIEHIKNKTPLQNYEKEFRKLYAPIFFGLEVLQAAYYRNDRLRESFVAICA
FT                   DDDVQQITFDSYLYKKMVPAPWSTQMKIFSKNIYHLIKGC"
FT   sig_peptide     complement(28690..28758)
FT                   /locus_tag="Ppha_0029"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.899) with cleavage site probability 0.490 at
FT                   residue 23"
FT   gene            complement(28762..30237)
FT                   /locus_tag="Ppha_0030"
FT   CDS_pept        complement(28762..30237)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0030"
FT                   /product="glycyl-tRNA synthetase"
FT                   /note="TIGRFAM: glycyl-tRNA synthetase; PFAM: tRNA
FT                   synthetase class II (G H P and S); Anticodon-binding domain
FT                   protein; KEGG: cch:Cag_0036 glycyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42387"
FT                   /db_xref="GOA:B4SAL8"
FT                   /db_xref="InterPro:IPR002315"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR022961"
FT                   /db_xref="InterPro:IPR027031"
FT                   /db_xref="InterPro:IPR033731"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="UniProtKB/TrEMBL:B4SAL8"
FT                   /protein_id="ACF42387.1"
FT                   /translation="MSNSDQTRVQSVNLPPDKVMHKLVSLAKRRGFIFPSSEIYEGLSS
FT                   CFDYGPLGSEMKRNIKELWWNSMTRRHQNIVGLDASIMMNPRVWEASGHVASFNDPMID
FT                   DKTTKRRYRADHLIENHIEKLRRDGKEEELLRVQSAYEAVAGAEDSNRALYDIIIAEGI
FT                   KAQDTGSGDWTEVRQFNLMFQCNMGAVADKSNIVYLRPETAQGIFVNFHNVRESSRMKV
FT                   PFGIAQIGKAFRNEIVKGNFIFRMVEFEQMEMQYFVKPGTQAEAFEAWREERFAWYTSA
FT                   LGLRKEKLHWYKHDKLAHYADLAYDIKFEFPFGIEEIEGIHSRTDFDLKQHQEYSGKNM
FT                   EYIDQLTNERYLPYVVETSAGCDRLFLALLADAYTEDTVDGDERVVLKLSPKVAPIKAA
FT                   VLPLMKKCGMGEMASLLREELSAAHLVQYDDAGSIGKRYRRQDEIGTPFCITVDHQSLE
FT                   ENSVTVRYRDTATQERIEISRVREFLASKLITL"
FT   gene            30497..30862
FT                   /locus_tag="Ppha_0031"
FT   CDS_pept        30497..30862
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0031"
FT                   /product="DsrE family protein"
FT                   /note="PFAM: DsrE family protein; KEGG: cch:Cag_1216
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42388"
FT                   /db_xref="InterPro:IPR003787"
FT                   /db_xref="InterPro:IPR027396"
FT                   /db_xref="UniProtKB/TrEMBL:B4SAL9"
FT                   /protein_id="ACF42388.1"
FT                   /translation="MESSKLLIISTIGQENHEKATLPFVLATASQSLDVEVVMFLQSSA
FT                   VVLAKKGEAEKVRAEGFAPLGELFDTFMDMGGKLYLCSPCIKERDIAPGDLVDGVQIGA
FT                   AGTLVHEVMSADSVVTY"
FT   gene            complement(30963..31736)
FT                   /locus_tag="Ppha_0032"
FT   CDS_pept        complement(30963..31736)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0032"
FT                   /product="protein of unknown function UPF0153"
FT                   /note="PFAM: protein of unknown function UPF0153; KEGG:
FT                   cte:CT0872 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42389"
FT                   /db_xref="InterPro:IPR005358"
FT                   /db_xref="UniProtKB/TrEMBL:B4SAM0"
FT                   /protein_id="ACF42389.1"
FT                   /translation="MENFLDKLGIELNEQTRLTSESTFQFSCHKGLSCYNNCCSNPDIF
FT                   LTPYDILRMKNRLGLSSAEFLSAYTEPVIQQESKLPFVRLKLHDEGKCKFVAEEGCTVY
FT                   NDRPLACRYYPIGFGIHKNATAGGNDFYFLIKEAHCKGFEEEQEWTVGEWRKSQEIDDY
FT                   DDKNRVWMDIILDKKLLSPELEPNEKSLKMFFMASYDLDAFRDFMMESRFLQVFEVDDE
FT                   LLQMVKTDEAELMLFAHQWLQYALFKKPTMTLRQS"
FT   gene            complement(31720..31908)
FT                   /locus_tag="Ppha_0033"
FT   CDS_pept        complement(31720..31908)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0033"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42390"
FT                   /db_xref="UniProtKB/TrEMBL:B4SAM1"
FT                   /protein_id="ACF42390.1"
FT                   /translation="MALSELPRALWLETKPPRKLIHDKSSSQYIQFILLDSPLFFLLFC
FT                   GVNDGNELKQVDYGKLP"
FT   gene            31945..32229
FT                   /locus_tag="Ppha_0034"
FT   CDS_pept        31945..32229
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0034"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cch:Cag_1214 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42391"
FT                   /db_xref="UniProtKB/TrEMBL:B4SAM2"
FT                   /protein_id="ACF42391.1"
FT                   /translation="MKITEAPDCPHCGTKMKKCEPPPFNYGDGLGWCTPYFYICFNDDC
FT                   KLYANGWNNLKTNFNKTASYRCMCYPDNGVFEAMCVFTPDGMKGQIIEE"
FT   gene            complement(32299..33480)
FT                   /locus_tag="Ppha_0035"
FT   CDS_pept        complement(32299..33480)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0035"
FT                   /product="heterodisulfide reductase, putative"
FT                   /note="KEGG: cch:Cag_1582 heterodisulfide reductase,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42392"
FT                   /db_xref="GOA:B4SAM3"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR036197"
FT                   /db_xref="UniProtKB/TrEMBL:B4SAM3"
FT                   /protein_id="ACF42392.1"
FT                   /translation="MAQETAFTPDIKFIRELKAAGADTMKKCYQCATCSVVCPLSPDDR
FT                   PFPRKEMVMAQWGLKDELLKSADIWLCHNCNDCSKYCPRGARPGDVLAILRKSVIQENA
FT                   FPRIMGKIVGDPKNIWQAMAIPVLFFLVILGITGHLNFPEGEIVFSKFFPVHYIDMIFV
FT                   PLSALAVLMFAVSMSRFWKNISAESGNKLPKGDFLPSFMETLKEIMLHSKFRKCDENKD
FT                   RGIAHVLVFYGFIGLAITTAWAVFYLYGLKWESPYPLDDPDILALLGGSTTMVWIARTI
FT                   FKLVANISAISLLAGGVLIIKNRLKERGFETSTSSFDWIFVGIVLLVGLSGFLAQVMRM
FT                   MNFPPVIAYSTYFIHLVLVFYIIIYMPYSKLAHFVYRTVAITYTKMMKRDVEM"
FT   gene            complement(33575..35827)
FT                   /locus_tag="Ppha_0036"
FT   CDS_pept        complement(33575..35827)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0036"
FT                   /product="methyl-viologen-reducing hydrogenase delta
FT                   subunit"
FT                   /note="PFAM: FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; 4Fe-4S ferredoxin iron-sulfur binding
FT                   domain protein; methyl-viologen-reducing hydrogenase delta
FT                   subunit; FAD dependent oxidoreductase; KEGG: cch:Cag_1583
FT                   heterodisulfide reductase, subunit A/hydrogenase, delta
FT                   subunit, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42393"
FT                   /db_xref="GOA:B4SAM4"
FT                   /db_xref="InterPro:IPR003813"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR039650"
FT                   /db_xref="UniProtKB/TrEMBL:B4SAM4"
FT                   /protein_id="ACF42393.1"
FT                   /translation="MADDNKIGVYLCTDCGIGEMLNVDELEAVAKKEFKVPVCKKHPFL
FT                   CSREGVQIIKDDINNGEVNKIVIAACSPRVNTDVFNFDPLKYVTERVNLREQVVWVKSS
FT                   TEKTNEGSQMMAADYMRMGITRIGKSSIPEPKYTDVNRTLLVVGGGVTGLTAALEASKA
FT                   GYKSVLVEKARELGGQAKKMYKVFPTAPPFAELEKPTILAKIEEARNDGNISIHTDTTI
FT                   ASIEGGPGMYKVTINKQGTTESFEAGAIVLATGWRPYNPDNLAHLGYGKFRNVITNLQM
FT                   EELVTKGNGKVLRPSDGKPAKNVVFIQCAGQRDEKHVPYCSSVCCNVSLKQAKYVRDSD
FT                   PDAGAFVIYKDMRTLGLYENFYKTSQDDEGVFLTKGEVLGLEEGPGGNIYVEINNHLLG
FT                   RTMKINADMVVLATGMVSGMVPEDRGVNNLTPEYIGNFVKRETSDGEIVELEPLSLALN
FT                   LKYRQGPEMPHLKWGFPDSHFICFPYETKRTGIYAAGAVRHPMDAVQSVGDATGAALKA
FT                   IQCIELTAQGRAVHPRTWDRTYPEIRVESCTQCRRCTVECPFGAYDEEKDGTPLLYPSR
FT                   CRRCGVCMGACPQRVISFKDYSVDMISSVLKSIEVPDSGTFILCFVCENDAYPALDMLG
FT                   LNRVGLNTNFRFIPLRCLGGLNLVWIADALSQGVDGILLLGCKFGDDYQCHYIKGSQMA
FT                   NERLGKVQETLSRLMLESERVEQVQLAINEWEKLPGIIEEFSKKVEAIGENPYKGF"
FT   gene            complement(35831..37072)
FT                   /locus_tag="Ppha_0037"
FT   CDS_pept        complement(35831..37072)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0037"
FT                   /product="4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein; FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; KEGG: cch:Cag_1584 heterodisulfide
FT                   reductase, subunit A"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42394"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR039650"
FT                   /db_xref="UniProtKB/TrEMBL:B4SAM5"
FT                   /protein_id="ACF42394.1"
FT                   /translation="MSVETILIVGGGISGITTAVEAAEVGYNTVLVEKNPYLGGRVAQL
FT                   NKYFPKLCPPYCGLEMNFRRIKLNPKITVYTLTEVEEVSGKEGNFSVRLKVNPRYVNEK
FT                   CTSCNACVDVCPAERLNEFNFGMDKTRAIYRPHEMAHPMRYVIERNACSDPSCNKCVTA
FT                   CKYNAIDLAMKPETVEIKAGSIVYATGWKPYDAANMENLGFGRIKNVITNMMLERLAAP
FT                   NGPTGGKILRPSDGREVKKVVFVQCAGSRDENHLNYCSAICCMASLKQATYIRERIPDA
FT                   EVFIAYIDLRTPGKYEDFLGKVQADEHVKMVKGKVAMIEEDSATGNVIVTSEDVEGGRK
FT                   SRQIADMVVLATGMVPSVKENAMLNFEQNGFIQAGKTPGIYSVGVAKRPSDVTSSIQDA
FT                   TGTALKSIQSLVRS"
FT   sig_peptide     complement(37004..37072)
FT                   /locus_tag="Ppha_0037"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.875) with cleavage site probability 0.817 at
FT                   residue 23"
FT   gene            complement(37145..37237)
FT                   /locus_tag="Ppha_0038"
FT   CDS_pept        complement(37145..37237)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0038"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42395"
FT                   /db_xref="UniProtKB/TrEMBL:B4SAM6"
FT                   /protein_id="ACF42395.1"
FT                   /translation="MAKSDTIVIEYIPEVLPWGLLFFMQECQVD"
FT   gene            complement(37237..39213)
FT                   /locus_tag="Ppha_0039"
FT   CDS_pept        complement(37237..39213)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0039"
FT                   /product="adenylylsulfate reductase, alpha subunit"
FT                   /note="TIGRFAM: adenylylsulfate reductase, alpha subunit;
FT                   PFAM: fumarate reductase/succinate dehydrogenase
FT                   flavoprotein domain protein; KEGG: cch:Cag_1585
FT                   adenylylsulfate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42396"
FT                   /db_xref="GOA:B4SAM7"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR011803"
FT                   /db_xref="InterPro:IPR015939"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR037099"
FT                   /db_xref="UniProtKB/TrEMBL:B4SAM7"
FT                   /protein_id="ACF42396.1"
FT                   /translation="MGVEKNEFKFCKKPEVVYIDTDILLIGGGMACCGAVYEAAKWATP
FT                   KGLRITMVDKASVDRSGAVAQGLSAINTYCGENDPADYVKYVRTDLMGIIREDLVYDLG
FT                   RHVDNSVHLFEEWGLPVWKRDEDGSTQDGAKPAPKLSEGGKPVRSGRWQIMINGESYKV
FT                   IVAEAAKKALEFNRKATGVDQNLFERVFISELIHDKNDPNRIAGAIGFSVRENKAYVFT
FT                   AKTMLLACGGAVNVYRPRSTAEGQGRAWYPVWNAGTTYALAAQAGCELVLMENRFVPAR
FT                   FKDGYGPVGAWFLFFKCKATNSLGEDYCVTNLATANKDFGKYAEDPHKLTTAMRNHMMM
FT                   IDMKAGKGPILMRTHEAMQALGETMTPKQMKHLEAEAWEDFLDMCIGQAVVWAGNNIEP
FT                   DKTPSELMPTEPYLLGSHAGCAGIWVSGPDDLKGFPAEWNWGYNRMTTVDGLFTAGDGV
FT                   GASGHKFSSGSHAEGRIAGKNMTAYCLDHVDYKPELGRDVEEVIAEIYAPMEIFGKNKD
FT                   YSTDPNVNPNYIRPKMFQARLQKIMDEYVAGVATWYTTSKTMLEKGLEHLSLLKEDASK
FT                   MAAEDNHELMRCWENYHRLMAGEAHARHILFREDSRYPGYYFRADHFYVDDENWKCFTI
FT                   SKYDRSTQNWTLSKRDYVQVIPD"
FT   gene            complement(39242..39664)
FT                   /locus_tag="Ppha_0040"
FT   CDS_pept        complement(39242..39664)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0040"
FT                   /product="adenylylsulfate reductase, beta subunit"
FT                   /note="TIGRFAM: adenylylsulfate reductase, beta subunit;
FT                   PFAM: 4Fe-4S ferredoxin iron-sulfur binding domain protein;
FT                   KEGG: cte:CT0864 adenylylsulfate reductase, subunit B"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42397"
FT                   /db_xref="InterPro:IPR011802"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR022738"
FT                   /db_xref="InterPro:IPR038465"
FT                   /db_xref="UniProtKB/TrEMBL:B4SAM8"
FT                   /protein_id="ACF42397.1"
FT                   /translation="MPSFVIKEKCDGCKGQERTACMYICPNDLMKLDVDRMLAWNQEPD
FT                   QCWECYNCVKICPQQAIEVRGYADFVPLGGNVIPLRGTDAIMWTIKFRNGILKRYKFPI
FT                   RTTSEGSIDLYSGKPEHDYANLKKPGFFNMTEYPTL"
FT   gene            complement(39791..41002)
FT                   /locus_tag="Ppha_0041"
FT   CDS_pept        complement(39791..41002)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0041"
FT                   /product="sulfate adenylyltransferase"
FT                   /EC_number="2.7.7.4"
FT                   /note="KEGG: cch:Cag_1587 ATP-sulfurylase; TIGRFAM: sulfate
FT                   adenylyltransferase; PFAM: ATP-sulfurylase"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42398"
FT                   /db_xref="GOA:B4SAM9"
FT                   /db_xref="InterPro:IPR002650"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR020792"
FT                   /db_xref="InterPro:IPR024951"
FT                   /db_xref="InterPro:IPR025980"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4SAM9"
FT                   /protein_id="ACF42398.1"
FT                   /translation="MSLVNPHGREKILKPLLLSGQALQNEQERAKSMARVTLSSRETGD
FT                   LIMLGIGGFTPLSGFMGYEDWKGSVEECKLADGTFWPIPITLSTTKEQADKLKIGAEVA
FT                   LVDEESGETMGSMTIEEKYAIDKSHECREVFKTDDPKHPGVLMVMNQGDVNLGGSVKVF
FT                   SEGSFPSEFEGIYMTPAQTRKMFEDNGWSTVAAFQTRNPMHRSHEYLVKIAIEICDGVL
FT                   IHQLLGKLKPGDIPADVRRDCINVLMDNYFVKGTCIQGGYPLDMRYAGPREALLHALFR
FT                   QNFGCSHLIVGRDHAGVGDYYGPFDAHYIFDQIPKDALETKPLKIDWTFYCYKCDGMAS
FT                   MKTCPHTNEDRLNVSGTKLRKMLSEGEEVPEHFSRPEVLEVLHRYYATLTEKVDIGLQT
FT                   NTGG"
FT   gene            complement(41661..42779)
FT                   /locus_tag="Ppha_0042"
FT   CDS_pept        complement(41661..42779)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0042"
FT                   /product="conserved hypothetical protein"
FT                   /note="PFAM: conserved hypothetical protein; KEGG:
FT                   cte:CT0845 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42399"
FT                   /db_xref="GOA:B4SAN0"
FT                   /db_xref="InterPro:IPR018383"
FT                   /db_xref="UniProtKB/TrEMBL:B4SAN0"
FT                   /protein_id="ACF42399.1"
FT                   /translation="MDKHRSNKDTSKTPYTSTDTEIPTQDQIIEAERCGFQCQAKAAKV
FT                   RAEVLFPGVLAAITVAAAATFLSDHYGAPTMLFALLIGMAFRFLSEDNGKALAGIQFAS
FT                   TTILRIGVALLGMRITIDQIQSLGIKPLTIVIGSVFLTILFGITLSKAMGRGKRFGILT
FT                   GGSVGICGASAALAIAAILPKDEYNERNTIFTVISVTALSTLAMIFYPIVARQFGLDDQ
FT                   ATGIFLGGTIHDVAQVVGAGYSVSEKTGDTATVIKLLRVSMLVPTVFALSMIFHTRTKI
FT                   DGETAKKFSFPPFIIFFVLLVGINSTHLVPDQMNKFINEVSRWSLVTAIGALGMKTSLK
FT                   SLFEVGWKPISIIMAETVFLATLVLGAIYWTS"
FT   gene            42838..43029
FT                   /locus_tag="Ppha_0043"
FT   CDS_pept        42838..43029
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0043"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42400"
FT                   /db_xref="UniProtKB/TrEMBL:B4SAN1"
FT                   /protein_id="ACF42400.1"
FT                   /translation="MLTYRFYINRCKDNKKGWGVKDNLKCGRIRKNHGIASFHAAIQVL
FT                   HGYRGGRWLGLLGGIEYV"
FT   gene            43098..43583
FT                   /locus_tag="Ppha_0044"
FT   CDS_pept        43098..43583
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0044"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ccr:CC_3052 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42401"
FT                   /db_xref="UniProtKB/TrEMBL:B4SAN2"
FT                   /protein_id="ACF42401.1"
FT                   /translation="MVKLKKVTLQYIEIEDRIRMLADLDGEERAVFWLTQRLCRRLVPK
FT                   LVHHLEHSAPDSHLVDKGLMLSVQQHDAGWQQKFSEPVRSTGLSRSVLPEKVDLFCPAG
FT                   GAAIIFPLDDGGEPARLQMTMLELRQWMAVIYRQFQVAGWPMEVWPQWFALSEPGKN"
FT   gene            complement(43608..43925)
FT                   /locus_tag="Ppha_0045"
FT   CDS_pept        complement(43608..43925)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0045"
FT                   /product="ATP-dependent Clp protease adaptor protein ClpS"
FT                   /note="PFAM: ATP-dependent Clp protease adaptor protein
FT                   ClpS; KEGG: cph:Cpha266_0046 ATP-dependent Clp protease
FT                   adaptor protein ClpS"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42402"
FT                   /db_xref="GOA:B4SAN3"
FT                   /db_xref="InterPro:IPR003769"
FT                   /db_xref="InterPro:IPR014719"
FT                   /db_xref="UniProtKB/TrEMBL:B4SAN3"
FT                   /protein_id="ACF42402.1"
FT                   /translation="MNSSLANRWTASLTTPVTKQREQGSGPDLLDAYRVVLFNDEEHTF
FT                   EEVIEQIIKAVRCSRQKAEKHTWEVHTRGRSIVFAGAMLLCLRVSSILEEIALKTEIQT
FT                   S"
FT   gene            complement(43991..44959)
FT                   /locus_tag="Ppha_0046"
FT   CDS_pept        complement(43991..44959)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0046"
FT                   /product="Muramoyltetrapeptide carboxypeptidase"
FT                   /EC_number="3.4.17.13"
FT                   /note="PFAM: peptidase U61 LD-carboxypeptidase A; KEGG:
FT                   cph:Cpha266_0047 muramoyltetrapeptide carboxypeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42403"
FT                   /db_xref="GOA:B4SAN4"
FT                   /db_xref="InterPro:IPR003507"
FT                   /db_xref="InterPro:IPR027461"
FT                   /db_xref="InterPro:IPR027478"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR040449"
FT                   /db_xref="InterPro:IPR040921"
FT                   /db_xref="UniProtKB/TrEMBL:B4SAN4"
FT                   /protein_id="ACF42403.1"
FT                   /translation="MFCGVMKTITPKALHKGDTIGLISPSSHCAYPEKIGQAIGYLEKN
FT                   GYQVKPSRHLNCIDTDPAIADQHKLHDLHEMFREPAIKAIICLRGGAGASRLLKKIDYS
FT                   LIADNPKIFVGYSDITALSLALFAKTGLISFSGPMLTTELYEPTPYTEEHFWEMLTSPS
FT                   YALSLRNHPAHPVTCIRAGEAEGSLIGGNLSVLSSMIGTPYLPSLNDALLFLEDINEPA
FT                   YRIDRMLSHLDNAALLASCKGVLFGQFGNGAENTKEEHLRLQNIFAYYSEHAHTNGPVM
FT                   RGLSYGHIRNLMTIPVGARFKMRVTETGDFSLGALHPVIEE"
FT   gene            complement(45005..45271)
FT                   /locus_tag="Ppha_0047"
FT   CDS_pept        complement(45005..45271)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0047"
FT                   /product="H+transporting two-sector ATPase delta/epsilon
FT                   subunit"
FT                   /note="PFAM: H+transporting two-sector ATPase delta/epsilon
FT                   subunit; KEGG: pvi:Cvib_0024 H+-transporting two-sector
FT                   ATPase, delta/epsilon subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42404"
FT                   /db_xref="GOA:B4SAN5"
FT                   /db_xref="InterPro:IPR001469"
FT                   /db_xref="InterPro:IPR020546"
FT                   /db_xref="InterPro:IPR036771"
FT                   /db_xref="UniProtKB/TrEMBL:B4SAN5"
FT                   /protein_id="ACF42404.1"
FT                   /translation="MANSDKGFHIEIVTPLKLHFSGEIVSVTAPGELGQFQVLKNHAPL
FT                   LSSLTKGTVKLALADRSEQSFSILDGFFEVSSNKAILLTETIS"
FT   gene            complement(45287..46675)
FT                   /locus_tag="Ppha_0048"
FT   CDS_pept        complement(45287..46675)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0048"
FT                   /product="ATP synthase F1, beta subunit"
FT                   /note="KEGG: cph:Cpha266_0049 F0F1 ATP synthase subunit
FT                   beta; TIGRFAM: ATP synthase F1, beta subunit; PFAM:
FT                   H+transporting two-sector ATPase alpha/beta subunit central
FT                   region; H+transporting two-sector ATPase alpha/beta subunit
FT                   domain protein; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42405"
FT                   /db_xref="GOA:B4SAN6"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005722"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR024034"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036121"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4SAN6"
FT                   /protein_id="ACF42405.1"
FT                   /translation="MQEGKISQIIGPVVDVDFPEGRLPSILDALTVTRADGTKLVLETQ
FT                   QHLGEERVRTVAMESTDGLVRGMNVTHTGKPIQVPVGLEVLGRMLNVVGDPIDGRGPVN
FT                   TKKSYSIHRLAPRFDEISTKAEMFETGIKVIDLLEPYSRGGKTGLFGGAGVGKTVLIME
FT                   LINNIAKQQSGFSVFAGVGERTREGNDLWHEMMESGVIDKTALVFGQMNEPPGARQRVA
FT                   LTGLSIAEYFRDEEGRDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGEL
FT                   QDRIVSTKKGSVTSVQAIYVPADDLTDPAPATAFAHLDATTVLSRSIAELGIYPAVDPL
FT                   DSTSRILDPNIVGDDHYDTAQAVKQLLQRYKDLQDIIAILGMDELSDEDKLVVSRARKV
FT                   QRFLSQPFFVAEAFTGLAGKYVKLEETIKGFKEIIAGRHDNLPESAFYLVGTIEEAVEK
FT                   AKTL"
FT   gene            complement(46796..46868)
FT                   /locus_tag="Ppha_R0001"
FT                   /note="tRNA-Thr3"
FT   tRNA            complement(46796..46868)
FT                   /locus_tag="Ppha_R0001"
FT                   /product="tRNA-Thr"
FT   gene            47024..47566
FT                   /locus_tag="Ppha_0049"
FT   CDS_pept        47024..47566
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0049"
FT                   /product="Redoxin domain protein"
FT                   /note="PFAM: alkyl hydroperoxide reductase/ Thiol specific
FT                   antioxidant/ Mal allergen; Redoxin domain protein;
FT                   Thioredoxin domain; KEGG: pvi:Cvib_0026 redoxin domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42406"
FT                   /db_xref="GOA:B4SAN7"
FT                   /db_xref="InterPro:IPR013740"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B4SAN7"
FT                   /protein_id="ACF42406.1"
FT                   /translation="MKKMVFSLKRRVFALLFLGTLAATLFAPTPAAALPLAPEFTAVSL
FT                   DGKTVASTKLAGKAYIVNFFASWCPPCRAEIPDMVLLQKKYESKGFTFIGVAVNENEPS
FT                   MRAFITKNGISYPVVMVEERLIKAFSRYIEGGIRAIPTSFVVNSSGRITQVITGGRSKE
FT                   VFEKIIIDALKKPVTHK"
FT   sig_peptide     47024..47125
FT                   /locus_tag="Ppha_0049"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.849 at
FT                   residue 34"
FT   gene            47709..49562
FT                   /locus_tag="Ppha_0050"
FT   CDS_pept        47709..49562
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0050"
FT                   /product="Phosphoenolpyruvate carboxykinase (GTP)"
FT                   /EC_number="4.1.1.32"
FT                   /note="PFAM: phosphoenolpyruvate carboxykinase (GTP); KEGG:
FT                   cch:Cag_2012 phosphoenolpyruvate carboxykinase"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42407"
FT                   /db_xref="GOA:B4SAN8"
FT                   /db_xref="InterPro:IPR008209"
FT                   /db_xref="InterPro:IPR008210"
FT                   /db_xref="InterPro:IPR013035"
FT                   /db_xref="InterPro:IPR018091"
FT                   /db_xref="InterPro:IPR035077"
FT                   /db_xref="InterPro:IPR035078"
FT                   /db_xref="UniProtKB/TrEMBL:B4SAN8"
FT                   /protein_id="ACF42407.1"
FT                   /translation="MQMNPPDYVKNKKLIQWVQEMAEQCCPSTIHWCDGSEEEYDILAR
FT                   QMVESGTFIKLSEEKRPNSYLCRSDPSDVARVEDRTYICSIRRQDAGPTNNWVAPREMK
FT                   ETLKGLFKGCMTGRTMYVIPFSMGPLGSPIAHIGVEITDSPYVVTNMRIMTRMGIKVME
FT                   LLGENSDFVPCLHSVGAPLQPGEQDVAWPCNDTKYIVHFPEERSIASFGSGYGGNALLG
FT                   KKCFALRIASSMARDEGWLAEHMLILGVESPDGEKTYIGGAFPSACGKTNFAMLIPPQS
FT                   FDGWKVTTIGDDIAWIKPGEDGLLRAINPEYGFFGVAPGTSDKSNPNAMATLAKNCIFT
FT                   NVAMTPDGDVWWEGMTDEAPEHLIDWQGQEWTPDCGRLSSHPNARFTSPANQCPSLDAD
FT                   WEDPKGVPISAFIFGGRRGDTVPLVYQSANWNSGVYLAATMGSEKTAAAAGKVGDVRRD
FT                   PFAMIPFCGYHMGDYFNHWLHVGRTLPELPRIFGVNWFRKDENGKFLWPGFGENMRVLK
FT                   WIVDRVRGTAGGVESPLGWMPKYDMIDWTGLEEMTEEKFIKLMSVDREAWKKELLSHEA
FT                   LFETIYDRLPKEFPHIRELMLSTLWMSPAHWSLAPEHYSEG"
FT   gene            complement(49631..49843)
FT                   /locus_tag="Ppha_0051"
FT   CDS_pept        complement(49631..49843)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0051"
FT                   /product="protein of unknown function DUF1458"
FT                   /note="PFAM: protein of unknown function DUF1458; KEGG:
FT                   cte:CT2229 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42408"
FT                   /db_xref="InterPro:IPR009923"
FT                   /db_xref="InterPro:IPR025543"
FT                   /db_xref="InterPro:IPR036694"
FT                   /db_xref="UniProtKB/TrEMBL:B4SAN9"
FT                   /protein_id="ACF42408.1"
FT                   /translation="MSAHIYKKIELVGSSPTSIEEAVNNAVAKAAETIRNIRWVEILET
FT                   RCHVEEQKVAYWQVTVKVGFTLDEE"
FT   gene            complement(49930..50814)
FT                   /locus_tag="Ppha_0052"
FT   CDS_pept        complement(49930..50814)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0052"
FT                   /product="zinc finger SWIM domain protein"
FT                   /note="PFAM: zinc finger SWIM domain protein; KEGG:
FT                   cph:Cpha266_1236 zinc finger, SWIM domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42409"
FT                   /db_xref="GOA:B4SAP0"
FT                   /db_xref="InterPro:IPR007527"
FT                   /db_xref="UniProtKB/TrEMBL:B4SAP0"
FT                   /protein_id="ACF42409.1"
FT                   /translation="MEYYWYKRPTSSAPRAVAGGIKAQNKRGAFGQTWWGKEWITTLEN
FT                   FDIGERITRGKSYARKGQVTDLVITAKKGVAAKVQGSRVRPYKVSITLTPYSKEQKELL
FT                   AQKLTSKPIYIAQLLSGEMPENLARVFKTAGLALFPAKYNDLTTTCSCPDYSNPCKHIA
FT                   AVVYLMAEAFDQDPFLLFTLRGIDKEEFLRKIGYKRQTATGDDPPAIPEPLPSEHAAFW
FT                   GYSPSPEPSCTHLSPAVQATMPKRLGSIPYWRSSINFLSAMETTYNLATLLAEKLIDRQ
FT                   RAEQEKVPSESPD"
FT   gene            complement(50820..53843)
FT                   /locus_tag="Ppha_0053"
FT   CDS_pept        complement(50820..53843)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0053"
FT                   /product="Non-specific serine/threonine protein kinase"
FT                   /EC_number="2.7.11.1"
FT                   /note="KEGG: cph:Cpha266_1235 SNF2-related protein; PFAM:
FT                   SNF2-related protein; helicase domain protein; SMART:
FT                   DEAD-like helicases"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42410"
FT                   /db_xref="GOA:B4SAP1"
FT                   /db_xref="InterPro:IPR000330"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR022138"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038718"
FT                   /db_xref="UniProtKB/TrEMBL:B4SAP1"
FT                   /protein_id="ACF42410.1"
FT                   /translation="MIALHISIIDGVPLLWSEGKKIGMLKELRLATAGIGMFSLLDNTT
FT                   KEFCVWLPCREKKAVPSSPLVGAMPDLSDEEQLHAFPITALRLNFNALFELSLLTEKGN
FT                   IPGSGIIFGSSLHWARQVVKIALNIVRTQSLLPSIIKNDTFWEALWLPLPDSATSLAVE
FT                   QLADAMPAVCRSLGRTDTQPPETPKKLLLKGLLSFLVNTLSRTFERAGVPKISDFESIH
FT                   DAWLHALSNSDPRLKWKNEQEIEQFACQLNAWRRPIDLHERSPFRFCLQLTEPPLKGRK
FT                   KERWHVAYQLQLKADPSLILDAGDLWNPESEASQHALTYTSDCTEFLLTSLGQASGLCP
FT                   AVTQSLKKKQPGGFDLDTEGAYRFLLEYAELLRSAGFVVKLPSWWIGRRGVNRIGIKTK
FT                   VKLPSMKGSGSGLTLDRMVACDYAAALGNEELDLQELKTLANLKVPLVRVRGQWTQIDH
FT                   KELANALHFLEKHPTGELSARELLSTALGAQKKEDALFLRSVEIEGWLQELLEKLSSQG
FT                   QFELLPPPEHFEGTLRLYQERGFSWLSFLRKWGLGACLADDMGLGKTIQTLALLQRERE
FT                   LGEKRAVLLICPTSVVNNWRKEAERFTPDLAVLVHHGIDRMKTADFRKAASASALVISS
FT                   YGLLQRDLEFLSKVPWAGIILDEAQNIKNPETKQSKAARTIRADYRIALTGTPVENHVG
FT                   DLWALMDFLNPGFLGTQHFFKQNFYTPIQWYGDPEASARLKSLTGPFILRRMKSDKSII
FT                   SDLPDKIEMKEYCSLTKEQASLYKAVVDELQEKIESAEGIDRRGLVLALLVKLKQVCNH
FT                   PAHLLGDNSAIAHRSGKIKRLTELLGDIREAGEKTLLFTQFTMMGTMLQHYLQELYGEE
FT                   VLFLHGGVTKKRRDEMVESFQKEEGSSPSIFILSLKAGGTGLNLTTANHVVHFDRWWNP
FT                   AVENQATDRAFRIGQHKNVEVHKFITTGTLEERIDEMIEKKTTVAGQVLGTGEQWLTEL
FT                   SNNDLRKLIMLGQEAMGE"
FT   gene            complement(53944..54087)
FT                   /locus_tag="Ppha_0054"
FT   CDS_pept        complement(53944..54087)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0054"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42411"
FT                   /db_xref="UniProtKB/TrEMBL:B4SAP2"
FT                   /protein_id="ACF42411.1"
FT                   /translation="MQGALPFRKTIIFSDIERLHVVLNRLLFYFIPSFKSGKGPESNRM
FT                   KY"
FT   gene            complement(54217..54762)
FT                   /locus_tag="Ppha_0055"
FT   CDS_pept        complement(54217..54762)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0055"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fgr:FG06081.1 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42412"
FT                   /db_xref="GOA:B4SAP3"
FT                   /db_xref="UniProtKB/TrEMBL:B4SAP3"
FT                   /protein_id="ACF42412.1"
FT                   /translation="MNVVNPEAIGLFGLIITVWVFGLEQLGFGLDKETDHAKLGRNLAN
FT                   VALWFGGVAQLFTAVCMFLFDMGLPADIRIYLGTIFATYGLFWVIVALHFYNPGDKKIY
FT                   AHMFLGIFFITAVFSYKAILLGKIWPLATVLLLINVLTILLPFAWYKQNALITKICGAT
FT                   NVAIGLCALPLLFKSLGV"
FT   gene            55025..56326
FT                   /locus_tag="Ppha_0056"
FT   CDS_pept        55025..56326
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0056"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: protein of unknown function DUF894 DitE; major
FT                   facilitator superfamily MFS_1; KEGG: plt:Plut_0053
FT                   transporter, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42413"
FT                   /db_xref="GOA:B4SAP4"
FT                   /db_xref="InterPro:IPR010290"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B4SAP4"
FT                   /protein_id="ACF42413.1"
FT                   /translation="MTLPAETVLPTNPKPQKRNGLSGQLLTAFPAFESPNFRRYFPGQV
FT                   ISMIGTWIQMVAQGWLVLEITGSAFDVGLAAAASTLPTLFLSLLGGVVVDRYPRRTILL
FT                   WTQSAAMLLAFVLGLFAVTGTVTIWIILVLSFLLGCVNALNVPALQAFLSEIVEREHLA
FT                   SAIAMNSAIYNGSRVIGPAIAGFLISATGTGTAFLLNGVSFFAVILSLLSMKNTLIEPA
FT                   AKTSQNPLQSIREGLSYAWGHPVIRTSIFFIAVISIFAWSYVTMLPVIAKRTFGMDASG
FT                   MGYLYGVSGLGSVVGTVLVSIYSRKIDRLVFIAGGTILFALALIGFTYTTHLPAALFFL
FT                   FVSGFGLVSAVSTLSATIQGTVDDRFRGRVMSLYMMIFMGFMPIGNLEIGYLSEHFGTG
FT                   IAIRIGCVVTILAAVTLIFTSRGVRKAYSSYKAS"
FT   gene            complement(56330..57310)
FT                   /locus_tag="Ppha_0057"
FT   CDS_pept        complement(56330..57310)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0057"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="KEGG: cph:Cpha266_0071 helix-turn-helix domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42414"
FT                   /db_xref="GOA:B4SAP5"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR025272"
FT                   /db_xref="UniProtKB/TrEMBL:B4SAP5"
FT                   /protein_id="ACF42414.1"
FT                   /translation="MTLKREQRIMGFRKNNYSVQYHYYYCNDSKQQFTTTELDEINLIQ
FT                   VYNQYRDEHNLPFPEEISAIRAAYGLSAAKIAEILGLGTNTYRNYEQGEVPSESSARLI
FT                   QVAQDPEEFKKIVHLSGALLGKQQEKLTARIEHLIESRKKTSCVDLEEYFLGSKLPDEY
FT                   SGYRKPSLEKLCEMVLFFAEQLKPWKTKLNKLLFYADFLNFKTTGYSISGARYCAISMG
FT                   PVPDNFNTIFEWIEKQGDVTVEETEFDNGGTGEQFFPGDGRKFNAEMFSAEELHTLTTV
FT                   AETFSRISTREIIRISHEEKAWIENVNATNQMISYLKYGFDLKAV"
FT   gene            complement(57264..57695)
FT                   /locus_tag="Ppha_0058"
FT   CDS_pept        complement(57264..57695)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0058"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cph:Cpha266_0072 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42415"
FT                   /db_xref="UniProtKB/TrEMBL:B4SAP6"
FT                   /protein_id="ACF42415.1"
FT                   /translation="MTASKQQISAFLRDFKEKMKIWNILFRDDRGKNSQTLLNLELRPI
FT                   ERRKIITALEIDDYSEGPLEDNLNKGSEMWVFGKLVKRQEIYIKITMGAPGTSVICISF
FT                   HIAEHKISYPFKREKNEKPDNRQGNDPEAGTANHGIPQK"
FT   gene            58168..58326
FT                   /pseudo
FT                   /locus_tag="Ppha_0059"
FT   gene            58431..59144
FT                   /locus_tag="Ppha_0060"
FT   CDS_pept        58431..59144
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0060"
FT                   /product="yecA family protein"
FT                   /note="TIGRFAM: yecA family protein; PFAM: SEC-C motif
FT                   domain protein; KEGG: cte:CT2274 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42416"
FT                   /db_xref="InterPro:IPR004027"
FT                   /db_xref="InterPro:IPR011978"
FT                   /db_xref="InterPro:IPR036255"
FT                   /db_xref="UniProtKB/TrEMBL:B4SAP7"
FT                   /protein_id="ACF42416.1"
FT                   /translation="MMTQNQLSDNGSIQISDSELDELQNFLMSDALPGGAMSLDTLDGF
FT                   FTALVIGPVTVLPSAWLPLVWDMSGGGEEPEFESQEQAQRIVELLMKLMNSIVELLSKY
FT                   PDYYEPLPDTYSYESEVVRDSLIKLWAMGFMIGVSYNEADWEPLLSDEAASVLLSAIAM
FT                   LGIRPHDAVPLPTKKFREIWENVPDCVLALNEFWRPFRLGEIISARGMAGAGRIGRNDP
FT                   CPCGSGKKFKKCCGK"
FT   gene            complement(59264..59488)
FT                   /locus_tag="Ppha_0061"
FT   CDS_pept        complement(59264..59488)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0061"
FT                   /product="addiction module component, TIGR02574 family"
FT                   /note="TIGRFAM: addiction module component, TIGR02574
FT                   family; PFAM: Putative addiction module component CHP02574
FT                   family protein; KEGG: gsu:GSU0056 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42417"
FT                   /db_xref="InterPro:IPR013406"
FT                   /db_xref="UniProtKB/TrEMBL:B4SAP8"
FT                   /protein_id="ACF42417.1"
FT                   /translation="MNTNTVSVFDLSPPEKLQLVEDLWDDLAMTPSEVPVYEWQKKELA
FT                   RRKANLANNPASGLSWAEVKLRARSRYVR"
FT   gene            complement(60144..61208)
FT                   /locus_tag="Ppha_0062"
FT   CDS_pept        complement(60144..61208)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0062"
FT                   /product="4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein; KEGG: mae:Maeo_0832 4Fe-4S ferredoxin iron-sulfur
FT                   binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42418"
FT                   /db_xref="GOA:B4SAP9"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:B4SAP9"
FT                   /protein_id="ACF42418.1"
FT                   /translation="MIRPKLAEFKLMFLMMAVFTTVAIGFWQAFDQPFYLINFAIIGLS
FT                   ISLGMGLWPLLPRDKKPWARRLSQVLVGGYLFFGLGCGLIYLSFGVIVPENMEIEGFWF
FT                   MVFAGVFQAAAIHYFVAKIVGPIFFNRGWCGWACWTAAVLDLLPWKMSPGRVPGRWGHL
FT                   RYLHFALALGLVASLVFIFGYTVESQHGIVIYKEAIQTDTPQYTSMFMIPEMWWFLIGN
FT                   LLYFGSGIVLAVVLKDNRAFCKYVCPIVGFLKPSASVSMTRIAPKNDRCTRCTKCTVNC
FT                   PMDIDVMRYVQEGKPVLSTECVLCLTCTSVCPEEVLGTKMGPSLSSSDYLRVIKPASKR
FT                   SAQQAHQPDSQTAV"
FT   sig_peptide     complement(61131..61208)
FT                   /locus_tag="Ppha_0062"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.930) with cleavage site probability 0.886 at
FT                   residue 26"
FT   gene            complement(61859..63478)
FT                   /locus_tag="Ppha_0063"
FT   CDS_pept        complement(61859..63478)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0063"
FT                   /product="drug resistance transporter, EmrB/QacA subfamily"
FT                   /note="TIGRFAM: drug resistance transporter, EmrB/QacA
FT                   subfamily; PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   cph:Cpha266_0093 drug resistance transporter, EmrB/QacA
FT                   subfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42419"
FT                   /db_xref="GOA:B4SAQ0"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR004638"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B4SAQ0"
FT                   /protein_id="ACF42419.1"
FT                   /translation="MARPEQQKGTSVAAMLPNTAQTYDTGLRKIIITLTVIVSAMLELI
FT                   DTTIVNVAITQISGNLGASIEDVSWVVTSYAIANVIVIPLSGFLGNLLGRRNYYIGSIL
FT                   LFTLASLFCGLATDIWALVFFRFIQGLGGGALLPTSQAILYETYRPEERGKATGIFSMG
FT                   LVLGPTIGPLLGGYLVDYLSWEWCFFVNIPVGLLAAWSSFTYLREPKGRHAVTTIDWTG
FT                   IGLLAVGIGSLQFILERGQSKDWFDTPYITIFTFIAVAALLAFVFWELHTKEPAVDLRV
FT                   LARSKNLAIAAVLTFIVGYGLYGSLFVFPVFVQRLLGFTALLTGEVLFPSAMVTGIISL
FT                   PLGIALQRGVSPKLLMAVGMSAFIFFCFELSQQTMQSGSSNFFWILLVRGVALGFIFIP
FT                   VTMLAVSGLHGKDIGQATGLNNMVRQLGGSFGIALTNTYITNRMATHRVELLSHLSPYD
FT                   PAAAERINLLQQAATIRGGLSPAGAETVALKALEGTLTAQSYHLAYMDAFMLIAFLFTV
FT                   CLPLLLLIRIQKKEPVDLSSAH"
FT   gene            complement(63500..64540)
FT                   /locus_tag="Ppha_0064"
FT   CDS_pept        complement(63500..64540)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0064"
FT                   /product="secretion protein HlyD family protein"
FT                   /note="PFAM: secretion protein HlyD family protein; KEGG:
FT                   cph:Cpha266_0094 secretion protein HlyD family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42420"
FT                   /db_xref="GOA:B4SAQ1"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:B4SAQ1"
FT                   /protein_id="ACF42420.1"
FT                   /translation="MEQPESNTMAEKNPSGKESAKAKSPLRMVIIGLLVALSLIWGGSK
FT                   LYHSFLYVETDNAQIVGDIYPVISRVPGRVDAVLASDNEEVKQGDTLIRLEAADYEVRR
FT                   DIAAAALLSAQASVAASADQANAAQAGANAAGATSRKLQADLRRNENLRQQDVISQAEF
FT                   DAVKAGAQASSAQYAAAGNQYQASLALVPLQKAEVKKREAELRQAELQLSYTTITAPAS
FT                   GHVAKKSVQPGQYVAPGQQLIALVGSNDLWIVANFKETQLDKIAPGLPVTIKVDAYPGK
FT                   EFKGKVESLSSGTGAQFALLPPDNASGNFVKVTQRIPVKIILTEKPDKSRPLSAGMNVV
FT                   VEIKVK"
FT   gene            complement(64527..64958)
FT                   /locus_tag="Ppha_0065"
FT   CDS_pept        complement(64527..64958)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0065"
FT                   /product="UspA domain protein"
FT                   /note="PFAM: UspA domain protein; KEGG: cph:Cpha266_0095
FT                   UspA domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42421"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:B4SAQ2"
FT                   /protein_id="ACF42421.1"
FT                   /translation="MEKPRKKIICAVDFSASSDAVVHYAASMHCCDAELIVLSVVPRGE
FT                   RENGMLRKQLHEFSRYSDILSENKALALFTVEHGEPAAAILNYAKEHHADMIILGSHGT
FT                   TAIARLLVGSTAEAVLRHAACPVVILKTPNNNKKDHGTT"
FT   gene            complement(64960..66291)
FT                   /locus_tag="Ppha_0066"
FT   CDS_pept        complement(64960..66291)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0066"
FT                   /product="outer membrane efflux protein"
FT                   /note="PFAM: outer membrane efflux protein; KEGG:
FT                   cph:Cpha266_0096 outer membrane efflux protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42422"
FT                   /db_xref="GOA:B4SAQ3"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="InterPro:IPR028351"
FT                   /db_xref="UniProtKB/TrEMBL:B4SAQ3"
FT                   /protein_id="ACF42422.1"
FT                   /translation="MITKSILIRTAGIAATALMLAWPRPATADSAPAEAPLTLDRAIHL
FT                   VRENNPALKAAAEEITAADARITQSRSAYFPQVSASAGYTWLDTVSKISFGSSGEIQFM
FT                   PNDNYDAKVTAKATLLDFGKRGANVDLAMSGKKTAEQSLELARRELSYQTVQLFYGILF
FT                   LQESLRVEEKEIAALSKALDYTTKRYQAGSATRFDVLSTEVRIAAARNRTLDLQHELLR
FT                   SQLTLRRLTGIAANAPLMLQGSFALTPNVPVSSGLVAQALEQRLELQLSRENEAAAKLH
FT                   RSLAMKQGVPVVTGSISYGITNGYQPDINEMRNNVAAGIHLEIPLFTGFRTSAERQESA
FT                   ARMRAATQRRIDTEQQVKTDVEETIHALQTASEKITTTGVQVQQAELAARHVRARYENG
FT                   MATALDLLDTEAALSQAELARLQAAYAYVINNYTLKRTTGEVFW"
FT   sig_peptide     complement(66205..66291)
FT                   /locus_tag="Ppha_0066"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 29"
FT   gene            66499..68598
FT                   /locus_tag="Ppha_0067"
FT   CDS_pept        66499..68598
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0067"
FT                   /product="transcriptional regulator, NifA subfamily, Fis
FT                   Family"
FT                   /note="PFAM: sigma-54 factor interaction domain-containing
FT                   protein; helix-turn-helix Fis-type; GAF domain protein;
FT                   ATPase associated with various cellular activities AAA_5;
FT                   SMART: AAA ATPase; KEGG: cph:Cpha266_0097 DNA-binding
FT                   protein fis / transcriptional regulator, Fis family"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42423"
FT                   /db_xref="GOA:B4SAQ4"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="UniProtKB/TrEMBL:B4SAQ4"
FT                   /protein_id="ACF42423.1"
FT                   /translation="MSNSSVHEASMLMQYISDAVGSIRDPQDLFRTVIDKLRLVFEFDS
FT                   AAILTFDKECRYSNLFFEMLRFQLPETIDRNKRLIAGSWIEPHLGDLSVSVIGIEEALE
FT                   LYPADMPLPQILFDLGMRQVVLSPLRTGGKGIGFLCFVSKDEKRWSESEKELLATLSSP
FT                   IAVAVSNALAYEELRQREAQTAMQLAVNNVLLTIKDRNRMLLAVCEQIDKLVPCTFLGI
FT                   RVMGEDGNYRIFDNFMRDQSGGFVPVSAIEVLDVDDIEAIAKESFSLISNSGCFCGDAF
FT                   LRLSRQYRILALVKEKYGICSLLTVPLWDTPGSRAGLIISDTSRSFEEHDQATVNLIVP
FT                   QLSLALQNYLAFEEIDELRRKLEGERTCLIEEIKAAHNFEEIIGNSASLSAVLRRVSQV
FT                   APTDATVLIQGETGTGKELFARALHNLSARSKRALIKVNCATLPGPLIESELFGHEKGS
FT                   FTGATERRIGKFELAEGGTIFLDEIGELPLELQAKLLRVLQERELERLGGRQVIKVDVR
FT                   VIAATNRDLAREVAEGRFREDLFFRLNVFPLFIPSLSERREDIAMLAAHFAAKFSREFA
FT                   RPLRTFRESDMQRLVAREWKGNIRELAHLIEQAVIVSEGASLDFSALLSSLPSVQDAQH
FT                   SLRQKTMRDFESDVAMMERELILDALDHSNGRVSGEGGAAEKLAMHPKTLYSRIDKLAI
FT                   RKRYQ"
FT   gene            complement(68635..69828)
FT                   /locus_tag="Ppha_0068"
FT   CDS_pept        complement(68635..69828)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0068"
FT                   /product="putative transcriptional regulator, GntR family"
FT                   /note="PFAM: aminotransferase class I and II; KEGG:
FT                   cph:Cpha266_1972 putative transcriptional regulator, GntR
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42424"
FT                   /db_xref="GOA:B4SAQ5"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:B4SAQ5"
FT                   /protein_id="ACF42424.1"
FT                   /translation="MPRFSKAVSSLRSSEIRDLMTLASRPDIISFAGGMPGNELFPVEA
FT                   VEELFRGLDLKKKQAAFQYGPTPGLPSLLESLGGFLEKKGLPVKENRLLITTGSQQGLN
FT                   LLAKAFIDPGEPVLVENPCFIGALSAFRASEAELRGVAVDRDGISMEALQQELDRKERA
FT                   KFLYITPYFHNPAGLLYTAERKAQLINALQGQHIPLIEDDAYGDLYFYEEDRPRLKPIK
FT                   AINPAGINVCYTGSFSKILGPGLRLGWMLAPDEIYQKCELIKQSADACSPSFTQVLADA
FT                   FIRSGQIYTYIAGVRQEYKRRAEAMVAALREHMPDYVQWNEPRGGFYIWLTLPDEADAT
FT                   RIMMEAVEGGAVFVAGKTFDPEGKRNNSLRLSYCNNSPEQIAEGIPIVAAAIRKFCG"
FT   gene            complement(69838..70266)
FT                   /locus_tag="Ppha_0069"
FT   CDS_pept        complement(69838..70266)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0069"
FT                   /product="amino acid-binding ACT domain protein"
FT                   /note="PFAM: amino acid-binding ACT domain protein; KEGG:
FT                   cph:Cpha266_1971 amino acid-binding ACT domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42425"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="UniProtKB/TrEMBL:B4SAQ6"
FT                   /protein_id="ACF42425.1"
FT                   /translation="MIIKQLSVFLENRTGRLTELTGILAENDINISAFSIADSSDYGIL
FT                   RMIVGRPEAAAEVLRKAGFAVKVTEVVGMIIPHKPGGLHKALQIISDNNVAIDYMYAFA
FT                   SGNCKATVIIRAESLEKIIAVLQEHKMELLQEGDVYQV"
FT   gene            70760..72106
FT                   /locus_tag="Ppha_0070"
FT   CDS_pept        70760..72106
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0070"
FT                   /product="peptidase M12A astacin"
FT                   /note="PFAM: peptidase M12A astacin; SMART: peptidase
FT                   metallopeptidase; KEGG: cph:Cpha266_0056 peptidase M12A,
FT                   astacin"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42426"
FT                   /db_xref="GOA:B4SAQ7"
FT                   /db_xref="InterPro:IPR001506"
FT                   /db_xref="InterPro:IPR006026"
FT                   /db_xref="InterPro:IPR024079"
FT                   /db_xref="InterPro:IPR034035"
FT                   /db_xref="UniProtKB/TrEMBL:B4SAQ7"
FT                   /protein_id="ACF42426.1"
FT                   /translation="MAAKKDGNPKEYGELCPSGRVRTAIINGNTFSYKSLQYTEVDGMA
FT                   MFEGDIVLGKVADVDRDTEIRKQEMQGVIARGIIITGNQYRWPNCKVPYTIDPALPNQA
FT                   RVTDAIAHWEANTRFRFVLRTAANAASYPDWVTFRSGSGCSSYVGRQGGQQFISLASGC
FT                   SKGNAIHEIGHTIGFWHEHSREDRNAFVTIHWDKIMPGYEHNFNQQIADGDDVGAYEYG
FT                   SIMHYSRDAFSIDGSDTITPTDPSASIGQRTGLSPGDIAAANTLCPLVVCPAAPKICPS
FT                   SPIIQCPAAPKVCSPAPLIQCPAAPKLCPPSPLQCAAGPNCAPAPKIVCLPSPLLKCPP
FT                   APKIYCGAAPLVKPFPGEEIRRKGYSLDPSTGTGQGGMNQIPQIVININFNGYQPPTVQ
FT                   TNYSGTDPYADENSDWTASEYPDPGDCCDNSMTDESVGSSGNFDPECSE"
FT   gene            72179..73465
FT                   /locus_tag="Ppha_0071"
FT   CDS_pept        72179..73465
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0071"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: Radical SAM domain protein; SMART: Elongator
FT                   protein 3/MiaB/NifB; KEGG: cph:Cpha266_0055 radical SAM
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42427"
FT                   /db_xref="GOA:B4SAQ8"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR008792"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017200"
FT                   /db_xref="InterPro:IPR023885"
FT                   /db_xref="InterPro:IPR034391"
FT                   /db_xref="InterPro:IPR041881"
FT                   /db_xref="UniProtKB/TrEMBL:B4SAQ8"
FT                   /protein_id="ACF42427.1"
FT                   /translation="MSYPYFPFSLCQQEDGQFMLSSPYGECKVNRDAAAILRLCNGSRS
FT                   LQDIVGKLQARYDLDHALMHVKSEKLINNLAAKGLVWIKEKPMRWFNAPPPQTIFWEVT
FT                   SRCNLQCLHCVVSAGESVTHDLSTRRCLELIDEWAAIGVQEITFSGGEPLLREDLFELA
FT                   AAAKQRNLTISMATNGTLMTRDVARRCKALGFDVQISLDGSTAEIYGAVRGRKEAFADV
FT                   MEGIRNTLSEGVNLTVGTVLTKNNVDDIPELLKLVERSGIPYFRLIPFIPSGRGQQNRD
FT                   LELDPLQVKKVSEELVAQRDLWSFTILPVEFELTFSAPSGASLDRSRASECGGATHYCT
FT                   VTPSGAVLPCHYFEGVVTHSVRNRSFMEVWRNSRFLNYFRSIEIGDIKGYCHDCRWLAD
FT                   CRGGCKAANFSYKDPFQSNRHCWVVRENQ"
FT   gene            73517..73879
FT                   /locus_tag="Ppha_0072"
FT   CDS_pept        73517..73879
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0072"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cph:Cpha266_0054 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42428"
FT                   /db_xref="InterPro:IPR039366"
FT                   /db_xref="UniProtKB/TrEMBL:B4SAQ9"
FT                   /protein_id="ACF42428.1"
FT                   /translation="MIVSYRISFPEPLILPSAASLRIEIRDTSLIDAPSVTLAVTLYHA
FT                   DQLANRAFIIGTVELPEQISPKAAITLWAHLSLSGEVRVNKEDFITTSAYPIMKTDEHG
FT                   QVVVAMQPVDSSARAT"
FT   gene            complement(73894..75195)
FT                   /locus_tag="Ppha_0073"
FT   CDS_pept        complement(73894..75195)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0073"
FT                   /product="Phenylacetate--CoA ligase"
FT                   /EC_number="6.2.1.30"
FT                   /note="KEGG: cph:Cpha266_1968 phenylacetate-CoA ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42429"
FT                   /db_xref="GOA:B4SAR0"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR011880"
FT                   /db_xref="InterPro:IPR028154"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:B4SAR0"
FT                   /protein_id="ACF42429.1"
FT                   /translation="MIWNEHYECMEREELRKLQGARVSAMVERVYNTVPFYRKKLQDAG
FT                   MEPGDITTIDDLKKLPFTTKQDLRDNYPFGLFTLPQADIVRLHASSGTTGKSTVVGYTH
FT                   NDIQMWSEVVARSLTMAGVGKTDIIQVAYGYGLFTGGLGLHYGAEKVGASVIPISGGNT
FT                   KKQLQLMEDFGSTVIACTPSYAAYLGEALVEEKIDRRNLKLKAGVFGAEPWTEEMRTQI
FT                   EQLLGIKAYDIYGLSEIIGPGVSMECHCQKGMHIFEDHFIPEIINPETGVVLPYGELGE
FT                   LVFTPATKEAMPLIRYRTRDLTRLHADKCECGRTLVRMEKCVGRSDDMLIIRGVNVFPS
FT                   QVESVLLEMSETKPHYLLVVDRENNLDILEIQVEIEEQFFSDEIKELEGLRQRIKANIA
FT                   SVLGISATIRLVEPGTIERSMGKAQRVVDKRKLK"
FT   gene            complement(75192..75782)
FT                   /locus_tag="Ppha_0074"
FT   CDS_pept        complement(75192..75782)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0074"
FT                   /product="pyruvate ferredoxin/flavodoxin oxidoreductase"
FT                   /note="PFAM: pyruvate ferredoxin/flavodoxin oxidoreductase;
FT                   KEGG: cph:Cpha266_1967 indolepyruvate oxidoreductase
FT                   subunit B"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42430"
FT                   /db_xref="GOA:B4SAR1"
FT                   /db_xref="InterPro:IPR002869"
FT                   /db_xref="InterPro:IPR019752"
FT                   /db_xref="UniProtKB/TrEMBL:B4SAR1"
FT                   /protein_id="ACF42430.1"
FT                   /translation="MQTNIILAGVGGQGILTIAAVIDQAALQSGLTIRQAEVHGMSQRG
FT                   GAVQSHLRIADREIYSDLIAEGTANLILSVEPLEALRYLPFLATNGRVVTSTEPFINME
FT                   GYPAMEEIMRELYRTNQPILINAPELARKAGSPRTSNMIMLGAAAPFTGIDQEKLEEAI
FT                   GRLFQAKGEEIVAMNIRAFRKGVELSQPQATVS"
FT   gene            complement(75790..77400)
FT                   /locus_tag="Ppha_0075"
FT   CDS_pept        complement(75790..77400)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0075"
FT                   /product="Indolepyruvate ferredoxin oxidoreductase"
FT                   /EC_number="1.2.7.8"
FT                   /note="PFAM: thiamine pyrophosphate protein domain protein
FT                   TPP-binding; KEGG: cph:Cpha266_1966 indolepyruvate
FT                   ferredoxin oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42431"
FT                   /db_xref="GOA:B4SAR2"
FT                   /db_xref="InterPro:IPR002880"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR017721"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:B4SAR2"
FT                   /protein_id="ACF42431.1"
FT                   /translation="MNKQLLLGAEAIALGALDAGISGVYAYPGTPSTEITEYIQKKKDD
FT                   REETVRSAWSANEKTAYEAALGMSYGGKRSLVCMKHVGLNVAADAFINSAITGVNGGLV
FT                   VAVADDPSMHSSQNEQDSRVYGKFAMVPLLEPASQQELYNATRYAFDLSESVKLPVLLR
FT                   LTTRLAHSRAGVEATATRAQNPLNALYAPERFVLMPQNARRQYNNLLGIQDRLEELSEN
FT                   SSLNRLLPGRGSIGVLAFGIAFNYVMEVRQAYSLDFPILKIGHYPLPRKQIEALFNTCE
FT                   TILVAEEGYPVYEELLRGYFGHQNGKQIRGRLDGTLPRAGELNADSIAHALGMAKKEVL
FT                   AIPSIMVNRPPELCKGCGHRDLYEALNTVMSSCKEQHVFSDIGCYTLGALAPYNAIHTC
FT                   VDMGASITMAKGAADAGLRPAVAVIGDSTFTHSGMTGLLDAVNDRTPLTIIIADNDTTA
FT                   MTGGQDSSANGSRLLSICIGLGVEEAHLRTIIPLKSHLAENIAILQEEINWNGVSVVIA
FT                   QRECIETAARKKRNKPINP"
FT   gene            77748..79775
FT                   /locus_tag="Ppha_0076"
FT   CDS_pept        77748..79775
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0076"
FT                   /product="multi-sensor signal transduction histidine
FT                   kinase"
FT                   /note="KEGG: cph:Cpha266_1834 multi-sensor signal
FT                   transduction histidine kinase; TIGRFAM: PAS sensor protein;
FT                   PFAM: response regulator receiver; ATP-binding region
FT                   ATPase domain protein; PAS fold-3 domain protein; PAS
FT                   fold-4 domain protein; PAS fold domain protein; SMART: PAS
FT                   domain containing protein; PAC repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42432"
FT                   /db_xref="GOA:B4SAR3"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B4SAR3"
FT                   /protein_id="ACF42432.1"
FT                   /translation="MFPSRKKATLLVVESSPLLSTSTARFIRQQGYDAVTADNGESCME
FT                   FLKSLKIDVLFLDIDIPGKNGREILAYVHDHFPDLPVIMTTLVKSESDETDSFTAGAFD
FT                   YLLKPINRIRLDMTIKKAITESQRRQEASLFSVVITNSPIAIAITDREGNFEYVNNAFC
FT                   RTTGYSMADVIGKKPSILKSGEQSDSFYKELWDTITSGRNWQGEFHNKKKNGELYWENS
FT                   VIVPIIDPTWAISHYVSIKQDVSLRKKELEAFSESERRFQELADLLPQTIFEVDLQGWI
FT                   TYTNREGFETFGYTQEDFQKGVHSMSLFVPEERGRVMLNMERRMKDIPFADHEYTGLKK
FT                   DGTTFPILVYTAKIIRNGKPVGVRGIVLDITARKQTEEKLQQLNQTLEERIEERTKKLE
FT                   TTHQQMILHEKLASIGMLAAGIAHELNNPINFVKINFTTLKESVSDFQEMLKEYRSVIR
FT                   SFEAGECSAVELQRMHQMEAELYIDTLFGDITEIFTESQRGFERITAIIASMRNFSFSH
FT                   AIDERVLFDINHGVRDALTIARNEYRNCAEIETLLEELPLVPCNPEQINQVFLNLIVNS
FT                   AHAIASAKRSVPGKITIHTWCDTTDVYCSVADDGPGIPQEVQNRIFDPFFTTKEPGKGT
FT                   GLGLSISYDIIVNKHAGTLSVECPAGKGTVFTLSLPLKAV"
FT   gene            complement(79809..80420)
FT                   /locus_tag="Ppha_0077"
FT   CDS_pept        complement(79809..80420)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0077"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cph:Cpha266_2683 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42433"
FT                   /db_xref="InterPro:IPR018971"
FT                   /db_xref="UniProtKB/TrEMBL:B4SAR4"
FT                   /protein_id="ACF42433.1"
FT                   /translation="MEMDATGVSRGDWIFQGEFDQTTAYLSDQKKILGFNPFCHSVELT
FT                   STENVYKWLFRVTDPQSNPFDIIFFVEQSEELLIELPENVECSNPDELSEEMIKLYTIG
FT                   KKVQWKHYPVASRIEDPEKYLFEGKAFADMYMHPVEENKTRVQFDLKIDVRFILYPAFR
FT                   IIPEKILHAMTNAGMSMIMQTATNKMFHSITKDFESIRQV"
FT   gene            complement(80550..81623)
FT                   /locus_tag="Ppha_0078"
FT   CDS_pept        complement(80550..81623)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0078"
FT                   /product="peptide chain release factor 1"
FT                   /note="TIGRFAM: peptide chain release factor 1; PFAM: Class
FT                   I peptide chain release factor; PCRF domain protein; KEGG:
FT                   cch:Cag_0010 peptide chain release factor 1"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42434"
FT                   /db_xref="GOA:B4SAR5"
FT                   /db_xref="InterPro:IPR000352"
FT                   /db_xref="InterPro:IPR004373"
FT                   /db_xref="InterPro:IPR005139"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4SAR5"
FT                   /protein_id="ACF42434.1"
FT                   /translation="MLDKLQSIKEKHLDLEQLLSDPNAAADQVRFRKLNKEYSDLREIV
FT                   QAYDLYAATKTELDESRQLLKSESDAEMKELVQAEISELQKKLPELEQQLKILLLPKEE
FT                   ADSRNVIIEIRAGTGGEEAALFAADLTRMYQRYAEHQGWQCETLHFNESSVPGGFREIT
FT                   LSVNGHDVYGTMKYESGVHRVQRVPDTETQGRIHTSAVSVAVLPEAEEVDVEIRREDLR
FT                   FDTYRSGGKGGQNVNKVETAVRITHMPTGIVSACQEQRSQLQNKERAMQMLRTKLYDIQ
FT                   LAEQQQQRADLRRSMVTTGDRSAKIRTYNYPQSRVTDHRIAFTSHALPQILQGDLQDII
FT                   NALKMHDQAARLQAELV"
FT   gene            complement(81642..83003)
FT                   /locus_tag="Ppha_0079"
FT   CDS_pept        complement(81642..83003)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0079"
FT                   /product="membrane-associated zinc metalloprotease"
FT                   /note="TIGRFAM: membrane-associated zinc metalloprotease;
FT                   PFAM: peptidase M50; KEGG: cph:Cpha266_2681 RseP peptidase.
FT                   Metallo peptidase. MEROPS family M50B"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42435"
FT                   /db_xref="GOA:B4SAR6"
FT                   /db_xref="InterPro:IPR004387"
FT                   /db_xref="InterPro:IPR008915"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="InterPro:IPR041489"
FT                   /db_xref="UniProtKB/TrEMBL:B4SAR6"
FT                   /protein_id="ACF42435.1"
FT                   /translation="MDFLSSVFFFIVAIFILVTAHELGHFLTAKLFGMRVDKFYIGFDF
FT                   WEKRIWRKKIGETEYGIGVFPLGGYVKIAGMVDESLDTNFQGSDPQPWEFRAKPVWQRL
FT                   IVLAGGVTMNLILAAVIFFGITFVLGEARTSVNTPAFVEKGSVFETMGMKTGDRLQLAN
FT                   GKKLESWEEALDPELFITPSLNYTILRDQQSITLKAPSNILSTINETQSLGIRPIVPPL
FT                   IDEALENMPAQKAGIQSGGLITAINGKTVSDWTEVVGIISAHAAKPISITWHYLKPVEG
FT                   EKITAARIRTEGKIFIATVTPNESGKIGISLKQTLVTERRKVGITESMVSGVNQTWKMS
FT                   AMTVQGFAKIFTGKEDFRKSVGGPIKIAKIASQSAEQGPVSFLFFLAMLSISLAIINIL
FT                   PVPALDGGQFVLNAFEGIIRREIPFEIKMRIQQIGMALLLSLFAYILINDLFNP"
FT   sig_peptide     complement(82941..83003)
FT                   /locus_tag="Ppha_0079"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.642) with cleavage site probability 0.636 at
FT                   residue 21"
FT   gene            complement(83094..84242)
FT                   /locus_tag="Ppha_0080"
FT   CDS_pept        complement(83094..84242)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0080"
FT                   /product="1-deoxy-D-xylulose 5-phosphate reductoisomerase"
FT                   /EC_number="1.1.1.267"
FT                   /note="KEGG: cch:Cag_0008 1-deoxy-D-xylulose 5-phosphate
FT                   reductoisomerase; TIGRFAM: 1-deoxy-D-xylulose 5-phosphate
FT                   reductoisomerase; PFAM: 1-deoxy-D-xylulose 5-phosphate
FT                   reductoisomerase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42436"
FT                   /db_xref="GOA:B4SAR7"
FT                   /db_xref="InterPro:IPR003821"
FT                   /db_xref="InterPro:IPR013512"
FT                   /db_xref="InterPro:IPR013644"
FT                   /db_xref="InterPro:IPR026877"
FT                   /db_xref="InterPro:IPR036169"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4SAR7"
FT                   /protein_id="ACF42436.1"
FT                   /translation="MRSLAILGSTGSIGLSTLDVVRQHPEKFKIAGLAEGHDVALLAEQ
FT                   IKEFLPAAVSVRDADSVKKLQTLLGSHKPEIFHGLEGAAAIASAEGVDMVVSAIVGAAG
FT                   LLPTVSAIKAGKHIALANKETLVVAGKLVSDLVKKHNVHLLPVDSEHSAIFQSLAGHRA
FT                   EDVERIILTASGGPFRNTSAEELKNVTLEQALKHPQWTMGAKITIDSATMMNKGLEVIE
FT                   AHWLFSMPAEKIGVVVHPQSIIHSMVEYIDGCVIAQLGSPDMRAPIAYALSWPERSESG
FT                   IHKLDLPKIGTLTFEEPDMERFPALRLAFEALKAGLTYPAVLNAANEIAVAAFLDRKIG
FT                   FTDIAATVEKTMQAHEAYDPIELDEYLQADRWAREMAKKFIA"
FT   gene            84404..84477
FT                   /locus_tag="Ppha_R0002"
FT                   /note="tRNA-Val1"
FT   tRNA            84404..84477
FT                   /locus_tag="Ppha_R0002"
FT                   /product="tRNA-Val"
FT   gene            complement(84553..86646)
FT                   /locus_tag="Ppha_0081"
FT   CDS_pept        complement(84553..86646)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0081"
FT                   /product="ATP-dependent metalloprotease FtsH"
FT                   /EC_number="5.6.1.1"
FT                   /note="KEGG: cph:Cpha266_2678 FtsH-2 peptidase. Metallo
FT                   peptidase. MEROPS family M41; TIGRFAM: ATP-dependent
FT                   metalloprotease FtsH; PFAM: peptidase M41; AAA ATPase
FT                   central domain protein; peptidase M41 FtsH extracellular;
FT                   ATPase associated with various cellular activities AAA_5;
FT                   SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42437"
FT                   /db_xref="GOA:B4SAR8"
FT                   /db_xref="InterPro:IPR000642"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR005936"
FT                   /db_xref="InterPro:IPR011546"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037219"
FT                   /db_xref="InterPro:IPR041569"
FT                   /db_xref="UniProtKB/TrEMBL:B4SAR8"
FT                   /protein_id="ACF42437.1"
FT                   /translation="MAKKPLKPSNPYKNEPENNIPRPKFSIMYYVVVIVLLIGVQLAFF
FT                   WQGSTQEIPYSTFRKLIAENKIESVKIAPEKIYIKLKPGVQTGIAVKEPPKDGPGMLLP
FT                   QSASKQDEIFVNPVRDDTLIELLESKGIKYQGMASSTWISELLQWILPFGLLIGIYFFV
FT                   FRRMGGPGSQFMNIGKNKAALYENLDEHSRITFKDVAGLDEAKAEVMEVVDFLKDPKKY
FT                   TTLGGKLPKGVLLVGPPGTGKTLLAKAVAGEADVPFFSISGSDFVEMFVGVGAARVRDL
FT                   FKQAKEKAPCIIFIDEIDAVGRSRGKGAMMGANDERENTLNQLLVEMDGFATDKGVILI
FT                   AATNRPDVLDSALLRPGRFDRQIMVDKPDLKGRIDIFKVHTKSLSLSEDVNLKALASQT
FT                   PGFAGAEIANTANEAALLASRRNKVSIEMKDFEDAIERCVAGLEKKNKVINPREKQIVA
FT                   YHEAGHAIVSWMMPENDPVQKISIVPRGMSALGYTMNIPLEDRYLMTKSELLARICGLL
FT                   GGRIAEQIIFSEISTGAQNDLEKVTSIAYNMVMVYGMSEKLGNLSFFESNNPYYGSPGI
FT                   DKKYGEETARLIDREVMAIVEESRLRVMDLLTVNREKLEKLASELLLKEMLQYPQIEEI
FT                   LGKRPEGLFPVQPEEEFAPENGTESSRSSALQNNSDQFSDKEQAELEEAVARLRGERKA
FT                   EEK"
FT   gene            86903..87727
FT                   /locus_tag="Ppha_0082"
FT   CDS_pept        86903..87727
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0082"
FT                   /product="orotidine 5'-phosphate decarboxylase"
FT                   /note="TIGRFAM: orotidine 5'-phosphate decarboxylase; PFAM:
FT                   Orotidine 5'-phosphate decarboxylase; KEGG:
FT                   cph:Cpha266_2677 orotidine 5'-phosphate decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42438"
FT                   /db_xref="GOA:B4SAR9"
FT                   /db_xref="InterPro:IPR001754"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR011995"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:B4SAR9"
FT                   /protein_id="ACF42438.1"
FT                   /translation="MSVVRDKANCRISALKSLLCVGLDSDPEKIPAVFLPYENPVLEFN
FT                   RAVIRATSDVAIAYKLNTAFYEARGIAGLLDMEKTLGSIPDVCMTIADAKRADIGNTSK
FT                   MYAQAFFDHWSFDALTVAPYMGFDSLEPFFAYEDKLLFVLCLTSNEGSVDFEEQAMQDG
FT                   RPLYRSVLDKVASWNRNGNGGVVVGATKSALLSEIRCEAPNLFLLIPGVGAQGGSLEDT
FT                   VHFGVDANRQSAVINVSRSLIYPSGSFSGIDDYERAVAAEASKMHSVMKAIL"
FT   gene            87830..89677
FT                   /locus_tag="Ppha_0083"
FT   CDS_pept        87830..89677
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0083"
FT                   /product="glucosamine/fructose-6-phosphate
FT                   aminotransferase, isomerizing"
FT                   /note="TIGRFAM: glucosamine/fructose-6-phosphate
FT                   aminotransferase, isomerizing; PFAM: glutamine
FT                   amidotransferase class-II; sugar isomerase (SIS); KEGG:
FT                   cte:CT0130 glucosamine-fructose-6-phosphate
FT                   aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42439"
FT                   /db_xref="GOA:B4SAS0"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR005855"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR035466"
FT                   /db_xref="InterPro:IPR035490"
FT                   /db_xref="UniProtKB/TrEMBL:B4SAS0"
FT                   /protein_id="ACF42439.1"
FT                   /translation="MCGIVGYIGWQEASPLLLKGLKRLEYRGYDSAGIALLNGSTLTVM
FT                   KQKGSVSGLEKDTLVLRASMQGATAGIGHTRWATHGEPSDRNAHPHLNAAGDIAIIHNG
FT                   IIENYSALKQELVSEGYQFLSATDSEVLVHLIDWIWKQDPLLDLESATRSALRHVEGAY
FT                   GLCVVSSREPDKIVVARKGSPLVIGIGLGEFFIASDAAPIVEHTKKVVYLADGELAVVR
FT                   RGGYCVKSIENIEQQKTVTELDFTLEKIEKGGFEHFMLKEIFEQPEVVHDVMRGRVRLD
FT                   EGWLRLGGIADYLDRLKQAKRIVICACGTSWHAALLGEYLIEEFARIPVEVDYASEFRY
FT                   RNPLVGVEDVVIVISQSGETADTLAALRTAKEKGAMVMGICNVVGSTIARETVCGMYTH
FT                   AGPEIGVASTKAFTAQVAMLYMLALSLSKGRTMSDSEITLHLRELSEIPEKVARILELD
FT                   SQIKLIAERFKDAKNFLYLGRGFNFPVALEGALKLKEISYIHAEGYPAAEMKHGPIALI
FT                   DEDMPVIILATRDNTYAKILSNIEEVRSRKGRVIAIASEGDTEVSRLTEEVIYIPQASG
FT                   PITPLLTVVPLQLLAYHIATLRGCNVDRPRNLAKSVTVE"
FT   gene            89794..90735
FT                   /locus_tag="Ppha_0084"
FT   CDS_pept        89794..90735
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0084"
FT                   /product="domain of unknown function DUF1731"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase;
FT                   short-chain dehydrogenase/reductase SDR; 3-beta
FT                   hydroxysteroid dehydrogenase/isomerase; Male sterility
FT                   domain; domain of unknown function DUF1731; KEGG:
FT                   cch:Cag_0004 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42440"
FT                   /db_xref="GOA:B4SAS1"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR010099"
FT                   /db_xref="InterPro:IPR013549"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B4SAS1"
FT                   /protein_id="ACF42440.1"
FT                   /translation="MRGHVVVTGATGVIGAELARRLIERGEKLVLLVRSPEAASLKIPG
FT                   AAAYVRWDSEMASGEWSASVDGAKAVIHLAGKPLLESRWSEEHKAECYNSRILGTRHIV
FT                   SAIASASEKPQVFISSSAIGYYGSFFSCDDTADISESGRAGSDFLAKICFDWEKEALEA
FT                   EKSGVRLVLLRTGIVLTTRGGMLQKMLAPFRFFLGGPIGSGLQCISWIHIDDELACILE
FT                   ALDNAAYSGAMNAVSPQPVSMNDFAKGLGAVLGRPSLLPVPRFAVDMLMGEGGEYAVKG
FT                   QRVKPVVLQKHGFAFRYPKLSDALADLIANKK"
FT   gene            90771..91268
FT                   /locus_tag="Ppha_0085"
FT   CDS_pept        90771..91268
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0085"
FT                   /product="Ferritin Dps family protein"
FT                   /note="PFAM: Ferritin Dps family protein; KEGG:
FT                   cph:Cpha266_2674 ferritin, Dps family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42441"
FT                   /db_xref="GOA:B4SAS2"
FT                   /db_xref="InterPro:IPR008331"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="InterPro:IPR014490"
FT                   /db_xref="InterPro:IPR033921"
FT                   /db_xref="UniProtKB/TrEMBL:B4SAS2"
FT                   /protein_id="ACF42441.1"
FT                   /translation="MGTRGREIVGEHLPRVLELLNKAFADEWLAYYQYWIGAKLVQGPM
FT                   KDAVIAELLQHAADELRHADMVSARIIQLGGKPVTSPLEWFSLSNCGYAAPDDPFVKKI
FT                   LEQNIAGEQCAINVYNSIIEEIGFKDPITYNLAVQILQDEVQHEEDLQALFEDLGVFLV
FT                   RS"
FT   gene            91467..92801
FT                   /locus_tag="Ppha_0086"
FT   CDS_pept        91467..92801
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0086"
FT                   /product="ammonium transporter"
FT                   /note="TIGRFAM: ammonium transporter; PFAM: Rh family
FT                   protein/ammonium transporter; KEGG: cph:Cpha266_2672
FT                   ammonium transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42442"
FT                   /db_xref="GOA:B4SAS3"
FT                   /db_xref="InterPro:IPR001905"
FT                   /db_xref="InterPro:IPR018047"
FT                   /db_xref="InterPro:IPR024041"
FT                   /db_xref="InterPro:IPR029020"
FT                   /db_xref="UniProtKB/TrEMBL:B4SAS3"
FT                   /protein_id="ACF42442.1"
FT                   /translation="MRKKLLTTLLFLLAASLFQGTAHAADAVVTDTGTTSWMLTSTALV
FT                   LLMVPGLAMFYGGLVRTKNVIGTMMHSFAAMVIIGVLWPMVGYALSFGPGVLGGFIGWD
FT                   SKYFMLQGIDDTIMSTQIPEYVFAMFQGKFAIITPALIAGAFAERVNFKGYAVFIALWS
FT                   IFVYSPICHWVWAADGFLFNLGAMGAIDFAGGTVVHISSGITALVAALYLGKRRGYPKN
FT                   VMQPNNLVMTLIGAGLLWVGWFGFNAGSAIASNLATARALTVTQMAAASGAFTWMVIEI
FT                   FHHGKATSLGVASGILAGLVAITPAAGVVQPVGAFALGMLASIFCYSAILLKSKLGYDD
FT                   SLDAFGVHGVGGIVGAIALVFFIRPSWMADAAAKTADHSWTMWQQLGVQATAVGVTVVY
FT                   AAVISFILLFLVEKTIGLRISEDDEMSGLDHSMHGEHGYGLINLN"
FT   sig_peptide     91467..91541
FT                   /locus_tag="Ppha_0086"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 25"
FT   gene            92811..93152
FT                   /locus_tag="Ppha_0087"
FT   CDS_pept        92811..93152
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0087"
FT                   /product="nitrogen regulatory protein P-II"
FT                   /note="PFAM: nitrogen regulatory protein P-II; KEGG:
FT                   cch:Cag_1998 nitrogen regulatory protein P-II (GlnB, GlnK)"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42443"
FT                   /db_xref="GOA:B4SAS4"
FT                   /db_xref="InterPro:IPR002187"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="UniProtKB/TrEMBL:B4SAS4"
FT                   /protein_id="ACF42443.1"
FT                   /translation="MKLITAIIQPDRLDHVREALIQADITRITVSRVTGHGRQEDIEIY
FT                   RGQKIAPNLIPKIRLDIAVNNEFVDITVDTIISAASHGVGEIGDGKIFITPLEECIRIR
FT                   TRERGGKAI"
FT   gene            complement(93212..93769)
FT                   /locus_tag="Ppha_0088"
FT   CDS_pept        complement(93212..93769)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0088"
FT                   /product="Tetratricopeptide TPR_2 repeat protein"
FT                   /note="PFAM: TPR repeat-containing protein;
FT                   Tetratricopeptide TPR_2 repeat protein; SMART:
FT                   Tetratricopeptide domain protein; KEGG: plt:Plut_0092 TPR
FT                   repeat"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42444"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:B4SAS5"
FT                   /protein_id="ACF42444.1"
FT                   /translation="MKKILCCIPLVTALMLLTVGITLAESANSSFNLGFEKHQQGDLPT
FT                   AIRLYSKAIEINPAFAMAFQMRGIAQQQLKKYPQAISDYTMAITFGDNAFKSVNYYNRG
FT                   IVKNMTGDFTGAIVDFSQTIALDRKMAEAFFHRGIAKSKIGDLAGRFDDFRNAALLRDH
FT                   NAERWLNTYYPGWRELPPSPAP"
FT   sig_peptide     complement(93695..93769)
FT                   /locus_tag="Ppha_0088"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.937 at
FT                   residue 25"
FT   gene            94003..95277
FT                   /locus_tag="Ppha_0089"
FT   CDS_pept        94003..95277
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0089"
FT                   /product="conserved hypothetical protein"
FT                   /note="PFAM: conserved hypothetical protein; KEGG:
FT                   plt:Plut_0094 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42445"
FT                   /db_xref="InterPro:IPR008323"
FT                   /db_xref="UniProtKB/TrEMBL:B4SAS6"
FT                   /protein_id="ACF42445.1"
FT                   /translation="MPEIIPFNGILYSPELLKSASELICPPYDVISAAFQQRLYGSSPY
FT                   NAIRLELPLEADPYSAAAERLAEWLQGGELQNDSVPAIYPYFQTFEDSDGVSHTRCGFF
FT                   AAMRLYDFSEKKVLPHEKTLSGPKADRLNLFRKTKTNISGIFGLYADESKTADCLMKAF
FT                   TESHEPIVDAHFEGVSNRLWRITDPEIVGQFQQSLQDRAVYIADGHHRYDTGVNYRNER
FT                   AAANPSHTGQEPYNFILTYLANIHDEGLLIFPIHRLVHSLEGFDAALLKSRLAEFFTVT
FT                   ELHDRAALKAFLDGEPSSYAYGVVTSGMVLGICLKTDPKPLLDPARPEALQRLGLVLLH
FT                   DLILFRLLGISQEAMAKQSNLTYVKDDREVFDAIDSGKVQVGFVVKPTTVEQVLSVSET
FT                   GEVMPQKSTFFYPKLMTGMLFNPLD"
FT   gene            95287..95724
FT                   /locus_tag="Ppha_0090"
FT   CDS_pept        95287..95724
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0090"
FT                   /product="protein of unknown function UPF0079"
FT                   /note="PFAM: protein of unknown function UPF0079; KEGG:
FT                   cph:Cpha266_2666 protein of unknown function UPF0079"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42446"
FT                   /db_xref="GOA:B4SAS7"
FT                   /db_xref="InterPro:IPR003442"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B4SAS7"
FT                   /protein_id="ACF42446.1"
FT                   /translation="MTEEFLSLSAEESCQYARRFAATLQPGDMVSLCGQLGAGKTEFMR
FT                   GVTEYFNCDDQLSSPTFPLLNIYEGSLDGEPVTLHHFDLYRINSQQELEGIGFDEYLSS
FT                   GDFSFVEWADRFPEYATRYTVTVTLEYAGNDSRRIVIKRKS"
FT   gene            95724..96395
FT                   /locus_tag="Ppha_0091"
FT   CDS_pept        95724..96395
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0091"
FT                   /product="peptidase M22 glycoprotease"
FT                   /note="PFAM: peptidase M22 glycoprotease; KEGG:
FT                   cch:Cag_1986 protease, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42447"
FT                   /db_xref="GOA:B4SAS8"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR022496"
FT                   /db_xref="UniProtKB/TrEMBL:B4SAS8"
FT                   /protein_id="ACF42447.1"
FT                   /translation="MNILAIECTHAALSVAVTNAGVVTEARSADWKKAAETLVPLIEQV
FT                   MAESALDLKQLDSIAISSGPGSFTALRIGMAIAKGVAYGLGIPLVPVPTMPAMAASLHA
FT                   ESGSIMAVIPSRKGEYYYASYFPEELASGLWHDEVKRGSAADVVAAISLVNGGAVVVGR
FT                   GLNELIPLLADSGAVYREADLFSARSLFPAALRLFAGADAAELNGVTPDYRQMFTPNGG
FT                   N"
FT   gene            complement(96522..97412)
FT                   /locus_tag="Ppha_0092"
FT   CDS_pept        complement(96522..97412)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0092"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42448"
FT                   /db_xref="GOA:B4SAS9"
FT                   /db_xref="UniProtKB/TrEMBL:B4SAS9"
FT                   /protein_id="ACF42448.1"
FT                   /translation="MREIIYFSRSKPSDLLHINSFTTMQDKWSIASTLFSAIGSVATTV
FT                   YSYVAVLDILNKSKKSAGLDRKGPAISGVKSFYKPIFKWLTYLFAAIGAITVAISAFVS
FT                   LAVMVVQTIAPDWNPVMKLQKGMASGVMAVVAPQLTVSGPETQRVAIPEPTLIKPSYRP
FT                   AKIEPFTVSLSPATIDNEIHVKATIRNTTSQPVYISLNNAQRPVLIDDSSGHTSEMLYQ
FT                   EGISMSSYEMSGKEREEGTYTKIPPGEALAIGLHFSVYHPAPQNGGTANITFGFIYLYD
FT                   GKAEKVSKTPTTSFR"
FT   gene            97887..98126
FT                   /locus_tag="Ppha_0093"
FT   CDS_pept        97887..98126
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0093"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42449"
FT                   /db_xref="UniProtKB/TrEMBL:B4SAT0"
FT                   /protein_id="ACF42449.1"
FT                   /translation="MTQLIIHKDKMQEALMRFLSTIQTDEIRLEFDDKHFFAEPVQGKS
FT                   VLDILAEQAEDMGPEDLSLNVDHYLYGLSKRSEK"
FT   gene            98123..98530
FT                   /locus_tag="Ppha_0094"
FT   CDS_pept        98123..98530
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0094"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: syn:sll1715 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42450"
FT                   /db_xref="GOA:B4SAT1"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="InterPro:IPR039018"
FT                   /db_xref="UniProtKB/TrEMBL:B4SAT1"
FT                   /protein_id="ACF42450.1"
FT                   /translation="MIYFLDTSYLVALTHSRDQFHQEAVSISKTLIQPIRLVTTSAVLM
FT                   EFANMLSSPHLRGKAFNYIQLLKNDIHTEIVCVSEEQFESGLIMFGKYHDKEWGLVDCL
FT                   SFLVMKEKGITLALTSDDHFEQAGFTTLLQL"
FT   gene            98858..99253
FT                   /locus_tag="Ppha_0095"
FT   CDS_pept        98858..99253
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0095"
FT                   /product="iojap-like protein"
FT                   /note="TIGRFAM: iojap-like protein; PFAM: Iojap-related
FT                   protein; KEGG: plt:Plut_0097 iojap-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42451"
FT                   /db_xref="GOA:B4SAT2"
FT                   /db_xref="InterPro:IPR004394"
FT                   /db_xref="UniProtKB/TrEMBL:B4SAT2"
FT                   /protein_id="ACF42451.1"
FT                   /translation="MSSLKEEEMVSATQVKEVAVGELLARRAAELALEKKCEEVKILDL
FT                   RGLTSVTDYFVIVTADSDRKAKAAAEHIIDELKVDGERPMHVEGMDSMHWILLDYIDVV
FT                   VHIFMPDERHFYDLESLWSDAPVITLS"
FT   gene            99376..101859
FT                   /locus_tag="Ppha_0096"
FT   CDS_pept        99376..101859
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0096"
FT                   /product="DNA gyrase, A subunit"
FT                   /EC_number="5.6.2.3"
FT                   /note="KEGG: cph:Cpha266_2663 DNA gyrase subunit A;
FT                   TIGRFAM: DNA gyrase, A subunit; PFAM: DNA
FT                   gyrase/topoisomerase IV subunit A; DNA gyrase repeat
FT                   beta-propeller"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42452"
FT                   /db_xref="GOA:B4SAT3"
FT                   /db_xref="InterPro:IPR002205"
FT                   /db_xref="InterPro:IPR005743"
FT                   /db_xref="InterPro:IPR006691"
FT                   /db_xref="InterPro:IPR013757"
FT                   /db_xref="InterPro:IPR013758"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR035516"
FT                   /db_xref="UniProtKB/TrEMBL:B4SAT3"
FT                   /protein_id="ACF42452.1"
FT                   /translation="MQRERIVPISIEEEMRGSYLDYSMSVIVSRALPDVRDGLKPVHRR
FT                   VLFGMHELGLQAGKPHKKSARVVGEVLGKFHPHGDTAVYDSLVRLVQEFSMRYPLIDGQ
FT                   GNFGSVDGDSPAAMRYTEVRMKSIAGEMLKDLDKATVDFSLNFDDSLEEPTVLPSAIPN
FT                   LLANGSSGIAVGMATNIPPQNLREVVDGMIALIANPELEVADLMKYVIAPDFPTGGIIY
FT                   GYEGVRSAYMTGRGKVVIRARAIVEITPKNSRESIVVTELPYQVNKVRLIEKIVELVHD
FT                   KKIEGIADIRDESDRDGMRLVIELKRDAVAMVVLNNLYKHTPMQDTFGVIMLALVDGVP
FT                   RILNLKEMMVYYIKHRNEIVLRRTQFDLATAEKRAHILEGLKICLDNLDEVISTIRESP
FT                   DASTAQERLIERFGLSELQSKAILEMRLQRLTGMERKKIDLEYTEVLAFIEELRFILGS
FT                   PEKQMQIIREELLKVREVYGDERRTEIVPQEGDFSIEDMIAQEDVVITITHEGFIKRFP
FT                   VSGYRRQARGGKGVTGAQAKHDDFVEHMFIASTHNYILFFTNRGRCHWLKVYEIPEAGR
FT                   AARGRALANIMELQQGEKIRAYINIRNFDEPGFIVMATTNGIVKKTPLEDFSHPRKNGI
FT                   AAITIDEHDELLDARLTDGDHQIILAKNSGFVVRFPEAEIRSMGRTAMGVKGITLDEGE
FT                   KCISMVTTKRFDTALLAVTDNGFGKRSRVEDYRLTRRGARGVITLKAHEKVGALIGLLD
FT                   VNDDDDLIIITAQGIVNRQHVSDIRLTGRNTSGVRLVRLMAGDIISALARVPKSDEEVD
FT                   SDVLLEDPDGQIDLF"
FT   gene            101966..103663
FT                   /locus_tag="Ppha_0097"
FT   CDS_pept        101966..103663
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0097"
FT                   /product="CTP synthase"
FT                   /EC_number="6.3.4.2"
FT                   /note="KEGG: cph:Cpha266_2661 CTP synthetase; TIGRFAM: CTP
FT                   synthase; PFAM: glutamine amidotransferase class-I; CTP
FT                   synthase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42453"
FT                   /db_xref="GOA:B4SAT4"
FT                   /db_xref="InterPro:IPR004468"
FT                   /db_xref="InterPro:IPR017456"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR033828"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4SAT4"
FT                   /protein_id="ACF42453.1"
FT                   /translation="MARPKNVKHIFVTGGVISSLGKGILSASLGMLLKSRGLKVAIQKY
FT                   DPYINVDPGTMSPYQHGEVYVTDDGAETDLDLGHYERFLDESTTQSSNLTMGRVYKSVI
FT                   DKERRGEYLGATVQVVPHVIDEIKDRMAEQAKNGDLDVLITEIGGTIGDIESLPFLEAM
FT                   RQMKLEMGDSNLLNIHLTFVPYIKAASELKTKPTQHSVKMLLGVGIQPDILVCRSEKPL
FT                   SREIKNKVGHFCNVNELDVIGLNDCDTIYEVPLMLLKEKLDLRVLKKLGLKKYKEPTLD
FT                   YWRDFCNKVKFPQDGEVTIGICGKYTEYPDAYKSIIESFIHAGASNNVKVNVKLLRAED
FT                   AELNAFDFAKELEGINGILVAPGFGDRGIEGKIKYIQYAREHNVPFLGICLGMQCASIE
FT                   FARNVCGLQDANSTEFNKRTRFPVIDLMAHQKKVKEKGGTMRLGSYPCIISEGSKAYAV
FT                   YHKFLINERHRHRYEFNNAYRKNFEESGMVFSGTSPNGELVEIIELKNHRWFVAVQFHP
FT                   ELKSRVQKVHPVFHGFVAAAKEYAHGVHQMDLVVEMPSLVPVLTEPTQ"
FT   gene            104060..105554
FT                   /locus_tag="Ppha_R0003"
FT   rRNA            104060..105554
FT                   /locus_tag="Ppha_R0003"
FT                   /product="16S ribosomal RNA"
FT   gene            105723..105799
FT                   /locus_tag="Ppha_R0004"
FT                   /note="tRNA-Ile1"
FT   tRNA            105723..105799
FT                   /locus_tag="Ppha_R0004"
FT                   /product="tRNA-Ile"
FT   gene            105835..105907
FT                   /locus_tag="Ppha_R0005"
FT                   /note="tRNA-Ala1"
FT   tRNA            105835..105907
FT                   /locus_tag="Ppha_R0005"
FT                   /product="tRNA-Ala"
FT   gene            106046..108989
FT                   /locus_tag="Ppha_R0006"
FT   rRNA            106046..108989
FT                   /locus_tag="Ppha_R0006"
FT                   /product="23S ribosomal RNA"
FT   gene            109061..109169
FT                   /locus_tag="Ppha_R0007"
FT   rRNA            109061..109169
FT                   /locus_tag="Ppha_R0007"
FT                   /product="5S ribosomal RNA"
FT   gene            109304..109570
FT                   /locus_tag="Ppha_0098"
FT   CDS_pept        109304..109570
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0098"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42454"
FT                   /db_xref="UniProtKB/TrEMBL:B4SAT5"
FT                   /protein_id="ACF42454.1"
FT                   /translation="MRSCYYVRRSSWRKSFTSNSKKIGSFFTDIDDAAIPEGKETIVNT
FT                   DITTLSSDYHHSYIKAGHLMNLPSSLNGRVSEGNISLRLKMWF"
FT   gene            109679..110380
FT                   /locus_tag="Ppha_0099"
FT   CDS_pept        109679..110380
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0099"
FT                   /product="PHP domain protein"
FT                   /note="PFAM: PHP domain protein; SMART: phosphoesterase PHP
FT                   domain protein; KEGG: cph:Cpha266_0756 PHP C-terminal
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42455"
FT                   /db_xref="GOA:B4SAT6"
FT                   /db_xref="InterPro:IPR003141"
FT                   /db_xref="InterPro:IPR016195"
FT                   /db_xref="UniProtKB/TrEMBL:B4SAT6"
FT                   /protein_id="ACF42455.1"
FT                   /translation="MQWLYCDFHIHTTWSDGEYSPGEVISLYGEAGFDVIAITDHVLDT
FT                   ESIRRSGRPVSELSVMDSSKFGSYQEELWDAARKAWERYNMLLIPGVELTNNTSRYHIL
FT                   ALDIKEYISPDMPVEDIIACIRRQQGISVACHPYIRNHSGDDPSFYLWENHERLATMFD
FT                   AWEVANRDDLFNVVGLKKFNYIGNSDFHEERHLLSWKTLLQCEKNVESVKAAIRKNDRV
FT                   SLFLYRGGKIK"
FT   gene            complement(110428..112626)
FT                   /locus_tag="Ppha_0100"
FT   CDS_pept        complement(110428..112626)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0100"
FT                   /product="catalase/peroxidase HPI"
FT                   /note="TIGRFAM: catalase/peroxidase HPI; PFAM: Haem
FT                   peroxidase; KEGG: cph:Cpha266_0755 catalase/peroxidase HPI"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42456"
FT                   /db_xref="GOA:B4SAT7"
FT                   /db_xref="InterPro:IPR000763"
FT                   /db_xref="InterPro:IPR002016"
FT                   /db_xref="InterPro:IPR010255"
FT                   /db_xref="InterPro:IPR019793"
FT                   /db_xref="InterPro:IPR019794"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4SAT7"
FT                   /protein_id="ACF42456.1"
FT                   /translation="MSEQGKCPVTGRTAVNPVTTGGMSNRDWWPNQLHLDMLHQHSSLT
FT                   NPMGEEFRYKEEFKKLDLKSVKKDLYALMTDSQEWWPADYGHYGGLFIRMAWHSAGTYR
FT                   TSDGRGGGGTGNQRFAPLNSWPDNANLDKARRLLWPIKQKYGRKLSWADLMILAGNCAL
FT                   ESMGFKTFGFGGGRVDIWEPEEDIYWGKEVEWLGSNRYSGERDLENPLAAVQMGLIYVN
FT                   PEGPDGNPDPVAAGRDIRETFARMAMNDEETVALVAGGHTFGKCHGVGDPKLIGPEPEA
FT                   AEIEEQGLGWKSGYGSGKGDETMTSGLEGAWTPDPIHWDMGYLGMLFKYEWELTKSPAG
FT                   AWQWKPKDVAEEDLAPAAHDPSKRVPTMMTTADLAMRMDPLYGPIARRYYEHPEQFADA
FT                   FARAWFKLTHRDMGPRSRYLGAEVPAEELIWQDPVPAVDHELIGEGKIKELKKRILASG
FT                   LSIPELLSTAWASASTFRSSDKRGGANGSRIRLSPQKEWEVNQPEQLQRVLGKLEEIRN
FT                   AFNGEQSGGKQVSLADLIVLGGCAAVEEAARRAGNDVTVPFIPGRTDASQEQTDVESFA
FT                   VLEPLADGFRNYTKRKYSVTPEEMLIDRSQLLTLTATEMTVLLGGLRVLGVNFRQSPHG
FT                   LFTNRPETLTNDFFVNLLDMGTEWKPLSKEHETFEGRDRKTGEVRWSATRVDLIFGSNA
FT                   RLRAIAEVYGSDDAQGKFVQDFVAAWNKVMNLDRFDLS"
FT   gene            complement(112903..113322)
FT                   /locus_tag="Ppha_0101"
FT   CDS_pept        complement(112903..113322)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0101"
FT                   /product="ferric uptake regulator, Fur family"
FT                   /note="PFAM: ferric-uptake regulator; KEGG:
FT                   cph:Cpha266_0754 ferric uptake regulator, Fur family"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42457"
FT                   /db_xref="GOA:B4SAT8"
FT                   /db_xref="InterPro:IPR002481"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B4SAT8"
FT                   /protein_id="ACF42457.1"
FT                   /translation="MQQQSGEKTLRYSRQRQRLLELLQSTDTHPTAGWLYDMMKPDFPN
FT                   LSLGTVYRNLAVLIEQGMVKKIDAGSTFDRFEAKTTPHYHLICRKCGTIIDFENRLFPE
FT                   IETVISKAADFTVEGHRIDFFGTCGACRARNRNNS"
FT   gene            113611..114216
FT                   /locus_tag="Ppha_0102"
FT   CDS_pept        113611..114216
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0102"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cph:Cpha266_2695 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42458"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="InterPro:IPR018550"
FT                   /db_xref="UniProtKB/TrEMBL:B4SAT9"
FT                   /protein_id="ACF42458.1"
FT                   /translation="MNYVVRIPVCTFLLLCLFSIADAGAASPENRKNTGVYLNEISAAT
FT                   GYCRGELKKEHENFAVYPLLARIGFNINSLAGIDGSRNTLQLGVEPFVNIVAASDHGVE
FT                   TGLGVGLRYYHNCFVPFDLFIEASAAPIFLSIASIEQGNPGFNFLLQSGVGFQYKLSAR
FT                   NAFFAGYRFRHISNGGLVAASNSGINSDAIIAGLSWLY"
FT   sig_peptide     113611..113688
FT                   /locus_tag="Ppha_0102"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.992) with cleavage site probability 0.495 at
FT                   residue 26"
FT   gene            complement(114244..114585)
FT                   /locus_tag="Ppha_0103"
FT   CDS_pept        complement(114244..114585)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0103"
FT                   /product="transcriptional coactivator/pterin dehydratase"
FT                   /note="PFAM: transcriptional coactivator/pterin
FT                   dehydratase; KEGG: plt:Plut_0106 pterin-4A-carbinolamine
FT                   dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42459"
FT                   /db_xref="GOA:B4SAU0"
FT                   /db_xref="InterPro:IPR001533"
FT                   /db_xref="InterPro:IPR036428"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4SAU0"
FT                   /protein_id="ACF42459.1"
FT                   /translation="MKGLNYMLCIPHTSVSRSMLEAQCRRLINNIPGWELIRVENMMRL
FT                   RCTFTFPDFREALAFTNSVGELAEAEQHHPELITEWGKVTVTWWTHSVKGVHMNDFIMA
FT                   ARTGVVANI"
FT   gene            115163..116657
FT                   /locus_tag="Ppha_R0008"
FT   rRNA            115163..116657
FT                   /locus_tag="Ppha_R0008"
FT                   /product="16S ribosomal RNA"
FT   gene            116826..116902
FT                   /locus_tag="Ppha_R0009"
FT                   /note="tRNA-Ile2"
FT   tRNA            116826..116902
FT                   /locus_tag="Ppha_R0009"
FT                   /product="tRNA-Ile"
FT   gene            116938..117010
FT                   /locus_tag="Ppha_R0010"
FT                   /note="tRNA-Ala2"
FT   tRNA            116938..117010
FT                   /locus_tag="Ppha_R0010"
FT                   /product="tRNA-Ala"
FT   gene            117149..120092
FT                   /locus_tag="Ppha_R0011"
FT   rRNA            117149..120092
FT                   /locus_tag="Ppha_R0011"
FT                   /product="23S ribosomal RNA"
FT   gene            120164..120272
FT                   /locus_tag="Ppha_R0012"
FT   rRNA            120164..120272
FT                   /locus_tag="Ppha_R0012"
FT                   /product="5S ribosomal RNA"
FT   gene            120364..120792
FT                   /locus_tag="Ppha_0104"
FT   CDS_pept        120364..120792
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0104"
FT                   /product="thioesterase superfamily protein"
FT                   /note="PFAM: thioesterase superfamily protein; KEGG:
FT                   cph:Cpha266_2516 thioesterase superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42460"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:B4SB39"
FT                   /protein_id="ACF42460.1"
FT                   /translation="MADGIDIGIYAYTHEMSVRDYECDMQGIVNNSVYQNYLEHVRHEY
FT                   LKHVGIDFSAYARQGVNLVVVRAELDYKYPLTSGDTFVVALTMRRESALKFAFYQDIFL
FT                   LPDHKPVLKAKIIGTALNQRGRPEIPEAFVALLNPAHE"
FT   gene            120823..121350
FT                   /locus_tag="Ppha_0105"
FT   CDS_pept        120823..121350
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0105"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cch:Cag_0092 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42461"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR024552"
FT                   /db_xref="UniProtKB/TrEMBL:B4SB40"
FT                   /protein_id="ACF42461.1"
FT                   /translation="MKPLIQVGHSYLALSQGEQQLRDAHFEEAAESYKRALEVSRTIPA
FT                   EEAFDYNGFDALCHTGLSGAYVKLGRYEEALHSAEIGLRYFNRRGELHQDEGKQWIAAV
FT                   FRRAQALEGIGRKEEALKAFQMAGEMIAERKGEMSDKEELQRMTAEHIASLQALTPDKK
FT                   PAGYKAWWEFWS"
FT   gene            121356..122354
FT                   /locus_tag="Ppha_0106"
FT   CDS_pept        121356..122354
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0106"
FT                   /product="glycosyl transferase family 9"
FT                   /note="PFAM: glycosyl transferase family 9; KEGG:
FT                   cph:Cpha266_2514 glycosyl transferase, family 9"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42462"
FT                   /db_xref="GOA:B4SB41"
FT                   /db_xref="InterPro:IPR002201"
FT                   /db_xref="UniProtKB/TrEMBL:B4SB41"
FT                   /protein_id="ACF42462.1"
FT                   /translation="MKPIKKILVIRLSSIGDIILTTPLLRSLKVAWPEAKIDYCTKTPF
FT                   VSLLAGNPRLSAISTNEHPPSGSYDLVVDLQHNMRSHAIVHSLRAERLVHYRKGNWKKW
FT                   LLVQCKLNLYGSPRSVVERYLETVKELGAAGDLQGCELYPSPEEKAYAHPYFTSGRKTL
FT                   ALCFGAKHFTKRYPPQRFAAILSHLLREEPLQVLLLGGKEDAPQATEIINSLPAACRPT
FT                   VINLAGSCTLMQTAALLERSDAILCNDTGLMHMASAFGKQLFVLFGSSSSAFGFLPYHV
FT                   PYDLFEVEGLPCRPCSHIGRDRCPKKHFRCMNDLSDTLIASRILEFFSHLS"
FT   gene            122545..122949
FT                   /locus_tag="Ppha_0107"
FT   CDS_pept        122545..122949
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0107"
FT                   /product="ribosomal protein S6"
FT                   /note="PFAM: ribosomal protein S6; KEGG: plt:Plut_0114 30S
FT                   ribosomal protein S6"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42463"
FT                   /db_xref="GOA:B4SB42"
FT                   /db_xref="InterPro:IPR000529"
FT                   /db_xref="InterPro:IPR014717"
FT                   /db_xref="InterPro:IPR020814"
FT                   /db_xref="InterPro:IPR035980"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4SB42"
FT                   /protein_id="ACF42463.1"
FT                   /translation="METNKLYECTLIIDGGLQDEAIAAAMALVQRVITEKGGSISSVLE
FT                   IGRRKTAYPIKKKTIGYYAHIEFTAATSVIAEVEKVIRYEEDLLRYLIIHLTSALLEMR
FT                   KRVEKYSVVIGSPEDSALAEAAAASDTVAK"
FT   gene            123016..123489
FT                   /locus_tag="Ppha_0108"
FT   CDS_pept        123016..123489
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0108"
FT                   /product="single-strand binding protein"
FT                   /note="TIGRFAM: single-strand binding protein; PFAM:
FT                   single-strand binding protein/Primosomal replication
FT                   protein n; KEGG: cph:Cpha266_2511 single-strand binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42464"
FT                   /db_xref="GOA:B4SB43"
FT                   /db_xref="InterPro:IPR000424"
FT                   /db_xref="InterPro:IPR011344"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:B4SB43"
FT                   /protein_id="ACF42464.1"
FT                   /translation="MAELKMPEINSVVIAGNLTKDPVFRQTNSGGTPVVNFSIACNRRF
FT                   RDSNHQWQEDVCYVGVVAWNKLAESCRDNLKKSSAVLVDGELQSRTWKAQDGSSRTVVE
FT                   IKARRIQFLNKRKKNGEEDDEGFIEDDCHDNHHEEIHEEDPTHIYEYKYLSSD"
FT   gene            123525..123803
FT                   /locus_tag="Ppha_0109"
FT   CDS_pept        123525..123803
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0109"
FT                   /product="ribosomal protein S18"
FT                   /note="PFAM: ribosomal protein S18; KEGG: cch:Cag_0096 30S
FT                   ribosomal protein S18"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42465"
FT                   /db_xref="GOA:B4SB44"
FT                   /db_xref="InterPro:IPR001648"
FT                   /db_xref="InterPro:IPR036870"
FT                   /db_xref="UniProtKB/TrEMBL:B4SB44"
FT                   /protein_id="ACF42465.1"
FT                   /translation="MRQKFTHAQGHKSQGNKSLSNALASKKKVSKNQVVFFDYRDERKL
FT                   KRFINDQGKIIPRRITGLSAKEQNLLTHSVKWARFLAVIPYVVDEYK"
FT   gene            123840..124295
FT                   /locus_tag="Ppha_0110"
FT   CDS_pept        123840..124295
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0110"
FT                   /product="ribosomal protein L9"
FT                   /note="PFAM: ribosomal protein L9; KEGG: cph:Cpha266_2509
FT                   50S ribosomal protein L9"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42466"
FT                   /db_xref="GOA:B4SB45"
FT                   /db_xref="InterPro:IPR000244"
FT                   /db_xref="InterPro:IPR009027"
FT                   /db_xref="InterPro:IPR020069"
FT                   /db_xref="InterPro:IPR020070"
FT                   /db_xref="InterPro:IPR020594"
FT                   /db_xref="InterPro:IPR036791"
FT                   /db_xref="InterPro:IPR036935"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4SB45"
FT                   /protein_id="ACF42466.1"
FT                   /translation="MKVILRNNVATLGDAGEVVAVKNGYANNFLIPQGMAIRATEGTLK
FT                   ALETEKKQQTKKIELQRKHAREHAQTIEQMSLKVYAKAGDSGKLFGTVTSADIADALKA
FT                   QGIDIDRRKITIEAPIKSLGKYEADAKIFQDITVKVHFEVEAEGSEA"
FT   gene            124399..124599
FT                   /locus_tag="Ppha_0111"
FT   CDS_pept        124399..124599
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0111"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cph:Cpha266_1405 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42467"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B4SB46"
FT                   /protein_id="ACF42467.1"
FT                   /translation="MQSKENHMEAKEIILDVMKKEGSPLNAGRIAEISGLDRKEVDKAM
FT                   KALKDEELIVSPKRCYWEVKA"
FT   gene            complement(124621..124935)
FT                   /locus_tag="Ppha_0112"
FT   CDS_pept        complement(124621..124935)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0112"
FT                   /product="rhodanese domain protein"
FT                   /note="KEGG: cph:Cpha266_0154 rhodanese domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42468"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:B4SB47"
FT                   /protein_id="ACF42468.1"
FT                   /translation="MLVDVREAYEVARKSFDVPEIMLIPFRDFEKRFQEIPVKRQVIIA
FT                   CNSGSRSAVATRILMTHGYRKVVNMQYGIMRWAKEGLPVKGRPKQTFGARLLQMFRGKS
FT                   "
FT   gene            complement(125171..125767)
FT                   /locus_tag="Ppha_0113"
FT   CDS_pept        complement(125171..125767)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0113"
FT                   /product="yecA family protein"
FT                   /note="TIGRFAM: yecA family protein; KEGG: cph:Cpha266_0914
FT                   YecA family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42469"
FT                   /db_xref="InterPro:IPR011978"
FT                   /db_xref="InterPro:IPR036255"
FT                   /db_xref="UniProtKB/TrEMBL:B4SB48"
FT                   /protein_id="ACF42469.1"
FT                   /translation="MKPTDPLQQPLSVEELDRLESFLLSDLMPEDSLSSIEMVDGYMTA
FT                   LIAGPGVVPPEIWIPSIWNQEKSAVPRFSSVDEEEMIWEFLLRHMNTIALQFLNNPDGF
FT                   LPLFERFSYPDEEAKELAVENWAVGFTLGMELTQEAWKPLFADEESGLLAMPMLILSKI
FT                   TDDYKALSEEDVSDMIQLMPGFVVKIYRYWNENNE"
FT   gene            complement(125891..126310)
FT                   /locus_tag="Ppha_0114"
FT   CDS_pept        complement(125891..126310)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0114"
FT                   /product="protein of unknown function UPF0047"
FT                   /note="PFAM: protein of unknown function UPF0047; KEGG:
FT                   cph:Cpha266_0833 protein of unknown function UPF0047"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42470"
FT                   /db_xref="InterPro:IPR001602"
FT                   /db_xref="InterPro:IPR035917"
FT                   /db_xref="UniProtKB/TrEMBL:B4SB49"
FT                   /protein_id="ACF42470.1"
FT                   /translation="MKSYHKELWLQIPARMDFVNITGDVERALQESGIQEGLCLVNAMH
FT                   ITASVFINDDEPGLHQDYKRWLEELAPHEPLSRYQHNRTGEDNGDAHHKRQIMGREVVV
FT                   AVTKGRLHFGTWEQIFYGEFDGKRKKRVLIKIIGE"
FT   gene            complement(126428..128141)
FT                   /pseudo
FT                   /locus_tag="Ppha_0115"
FT   gene            128557..128991
FT                   /locus_tag="Ppha_0116"
FT   CDS_pept        128557..128991
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0116"
FT                   /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
FT                   /note="KEGG: cph:Cpha266_0798 RNA polymerase, sigma-24
FT                   subunit, ECF subfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42471"
FT                   /db_xref="UniProtKB/TrEMBL:B4SB50"
FT                   /protein_id="ACF42471.1"
FT                   /translation="MDLMDDIYSLAYWMTGSEASATELVNITYLNVTLDTPESEVYKTF
FT                   RECYFDTFGYEEAPCIPKPSCNPMEKMGSVLLQRDADIKLSVLLSAVSGLKHGAISKII
FT                   GKPLDTIREWLSVGRKSLAERVLTYDASLLHGISIDKDPL"
FT   gene            complement(129025..129186)
FT                   /pseudo
FT                   /locus_tag="Ppha_0117"
FT   gene            complement(129368..130834)
FT                   /locus_tag="Ppha_0118"
FT   CDS_pept        complement(129368..130834)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0118"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cph:Cpha266_0162 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42472"
FT                   /db_xref="GOA:B4SB51"
FT                   /db_xref="InterPro:IPR031566"
FT                   /db_xref="UniProtKB/TrEMBL:B4SB51"
FT                   /protein_id="ACF42472.1"
FT                   /translation="MKPTKRSLLFFACMFAVSVGLSGALYAEALDITAVAPALAVTFQK
FT                   SLPPVWLVTPFIALLVMIATGPLLFHRFWDRHYPKVSVGLGFIVACYYGLLMDGGWHVL
FT                   EHTLEEYLSFIALISSLFVVSGGILIRIERKGTPLMNALLLFFGAIISNLVGTTGASML
FT                   LIRPYMRINKGRLKPFHIVFFIFIVSNIGGALTPIGDPPLFLGFLKGVPFFWVLPKVWL
FT                   PWLITVAGLLLIFIILDVKRGTGDMKGAEVNGGVSITGRRNFLFLAVIIAAVFLDPAVI
FT                   EGIPSLQKLFHLPFGIRELIMFMVAIAAYKFSNHEAFKGNEFNFEPIKEVAFLFIGIFA
FT                   TMIPALELIGYYASSHAADFSVSRFYWLTGALSGVLDNAPTYLNFFAGALGKFGLDIGS
FT                   PEDIRHFATGVASPLQGDVSSDIYLMAISIAAVFFGAMTYIGNAPNFMVKNIAAQADVD
FT                   VPDFLEYIYKYSLPILLPFFILLWVLFFNY"
FT   sig_peptide     complement(130751..130834)
FT                   /locus_tag="Ppha_0118"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.908 at
FT                   residue 28"
FT   gene            131085..134274
FT                   /pseudo
FT                   /locus_tag="Ppha_0119"
FT   gene            complement(131674..133154)
FT                   /locus_tag="Ppha_0120"
FT                   /note="ribosomal slippage"
FT   CDS_pept        complement(join(131674..132684,132684..133154))
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /ribosomal_slippage
FT                   /locus_tag="Ppha_0120"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42473"
FT                   /db_xref="UniProtKB/TrEMBL:B4S9X8"
FT                   /protein_id="ACF42473.1"
FT                   /translation="MRSVINHQMMFGRTDISAIVFDPKSRDDIPKILRGLQGIYTDEEL
FT                   RKRVFAILEEVRPERKKGEGKADPNTGRPGMEQWAILVLGVVRLGINADYDRLHELVNH
FT                   HDTLRQMLGHNDWTDKTSYELQTIKDNVRLFTPELLDRINQEIVRAGHTLVKKKEEENF
FT                   PLMARGDSFVVETNVHFPADTSQLFDAIRKAIEVCAKWSFDEGLSQWRQYDHNIRHIKR
FT                   MRRIVQQLKHSTSKKPEKKALKDQQIKQALLDYLAAVDYQLQRAVRTGAELGGLNPLRL
FT                   SQLNGYIAHAEVQMGQIRRRINDEVIPHAEKVFSIFQPHTEWISKGKAGVPVELGLRVC
FT                   IIEDQYRFILHHQVMEKVVDSDIAVSIIEETKQRFPNLRSISYDKGFHSPDNQRDLKAL
FT                   LEKVVMPKKGKLSKIDKAHESEPEFRRLRRQHSAVESAINALEVHGLDICPDDGIKGFN
FT                   RYVALAVLARNIHRYGALLYKQDAKRHRGPYKKAA"
FT   gene            complement(134281..135690)
FT                   /locus_tag="Ppha_0121"
FT   CDS_pept        complement(134281..135690)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0121"
FT                   /product="RND efflux system, outer membrane lipoprotein,
FT                   NodT family"
FT                   /note="TIGRFAM: RND efflux system, outer membrane
FT                   lipoprotein, NodT family; PFAM: outer membrane efflux
FT                   protein; KEGG: cph:Cpha266_0775 RND efflux system, outer
FT                   membrane lipoprotein, NodT family"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42474"
FT                   /db_xref="GOA:B4SB53"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="InterPro:IPR010131"
FT                   /db_xref="UniProtKB/TrEMBL:B4SB53"
FT                   /protein_id="ACF42474.1"
FT                   /translation="MNTKLLIPLCLAATTLTACSLAPTYVRPTAPVTKEWPVASAAPQS
FT                   VEESHTADIGWRSMFRSPKLQSLIEASLANNRDLRIAALNIEAARHTWRIQRSDLLPSI
FT                   NSSGNYTRQQLSTSMSGTGKTEITSTYSAGIGTTAYELDLFGRVRSLSNRAINQYLATE
FT                   EGRKAAQTSLVAEVANAYLTYLADVELLRLTESTLKTRQDACDLIKRSFDLGAKSRLDV
FT                   AQSATLVESARASRAQYQRHVEQDKNALTLLVGKEIDPTLLEPQPLADVEVMERLPVGI
FT                   PSVVLLDRPDVRQAEYALKAENANIGAARASFFPSISLTGSAGFASASLSDLFEAGSSG
FT                   VWSFAPQVTLPIFQGGRLRSNLKLAETNRDIAVTRYEKAIQSAFREVADALVARATYTE
FT                   QLQAQQALVKESDQACTITKARYDHGIDSSFALLDAQRSLFEAQQNEILIHQQTLANLI
FT                   DLYKALGGGWQ"
FT   sig_peptide     complement(135628..135690)
FT                   /locus_tag="Ppha_0121"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.997) with cleavage site probability 0.580 at
FT                   residue 21"
FT   gene            complement(135687..138848)
FT                   /locus_tag="Ppha_0122"
FT   CDS_pept        complement(135687..138848)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0122"
FT                   /product="transporter, hydrophobe/amphiphile efflux-1
FT                   (HAE1) family"
FT                   /note="TIGRFAM: transporter, hydrophobe/amphiphile efflux-1
FT                   (HAE1) family; PFAM: acriflavin resistance protein; KEGG:
FT                   cph:Cpha266_0776 transporter, hydrophobe/amphiphile
FT                   efflux-1 (HAE1) family"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42475"
FT                   /db_xref="GOA:B4SB54"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR004764"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:B4SB54"
FT                   /protein_id="ACF42475.1"
FT                   /translation="MSGFFIERPVFAWVISICIMLGGIIAINTLPVEQYPRIAAPTINV
FT                   SATYPGASAEAVENSVTQVIEQALTGIDHLRYFSAGSDSNGNVTITVTFEPEANPDIAQ
FT                   VQVQNKLQSIMSNLPQQVQQQGIKVTKGDTGFLMVVGVYSDDPRIDEYAMNDFINSKLL
FT                   DPLSRVPGVGNIQVFGQPYSMRIWLDPHRMASFNLTTTEVQAAITAQNADVSAGQLGGT
FT                   PSVPGQQLNATITAQSRLKSVGDFEKIMLKVNSDGSQIRLRDVARVELGVQNYDMTTRF
FT                   NGKPAAGMAITLATGANALNTATLVKAKMSALKPLLPPGVQIVYPFDTTPFVKTSIEGV
FT                   VHTLIVAVILVFLVMFLFLQNFRATLVPTIAVPVVLLGTFGVMSMFGFSINTLSMFAMV
FT                   LAIGLLVDDAIVVVENVERIMEEERLSPLEATRKSMKQISSALIGIALVLSAVFVPMAF
FT                   FKGSTGTIYRQFSITIVSAMLLSVLVALILTPALCASLLKPVRADGHLYGAGPLGRFFA
FT                   WFNGMFNHNRERYVNGARVMTERVKRSLLAFMLIVVLLGIVLTRIPTSFLPDEDQGFLF
FT                   VQLSTPSGATKERTLESVKRMERYLLNQEKESIESIFSVTGFSFAGQGQNSAMGFVQLR
FT                   DWSKRKNKGQDVASIAGRTMGALSSVKDAMIFAFYPPAVMELGNASGFDLQLLDRTGKG
FT                   HEALMAARNQLLGMAAKNPSLSGVRPNGLEDVPQFKIDIDHEQASAFGVSIADINSTLQ
FT                   TAWGSSYVNDFVHEGRIKKVFMQGDAPYRMNPGDVNIWHVRNSSGDMVPFSSFSSGRWS
FT                   FGSPKLERFNGISSVNIQGAPAPGVSSGDAMAIMANLAEKLPEGFGVEWTGLSYEERAA
FT                   GQQTLLLYTLSLLFVFLCLAALYESWSVPIAVMLVVPLGVLGTVLATFLSGLSNDVFFK
FT                   VGLLTTVGLTAKNAILIVEFAKTLYESGMSLQEAVLSAASQRLRPIIMTSMAFILGVTP
FT                   LAFSSGAGSASQHAIGIGVIGGMLSGTVLTIFFVPLFFILVQSRFARKRVTDTAVTQNK
FT                   QGIEP"
FT   gene            complement(138876..140030)
FT                   /locus_tag="Ppha_0123"
FT   CDS_pept        complement(138876..140030)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0123"
FT                   /product="efflux transporter, RND family, MFP subunit"
FT                   /note="TIGRFAM: efflux transporter, RND family, MFP
FT                   subunit; PFAM: secretion protein HlyD family protein; KEGG:
FT                   cph:Cpha266_0777 efflux transporter, RND family, MFP
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42476"
FT                   /db_xref="GOA:B4SB55"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:B4SB55"
FT                   /protein_id="ACF42476.1"
FT                   /translation="MMKRSYIIAGLLVTLIAGWFLWPKGASEQRQDSGMKPEVSVVTMK
FT                   PELLVLTKELPGRTSAVRMAEIRPQVSGIVTKRFFVEGSLVQQGQQLYQIDPATYKAAC
FT                   NSAKASLSKAEANVISLQAKAGRYEELVKIGGVSQQEYDDAKASLAQARADVAMARSEV
FT                   AAAAINLDYTRVMSPISGRIGQSKVTEGALVNANQADPLAVVQQLDQIYVDVSQSSGEL
FT                   IQLRQRHQGQVGDSSAGSAPIELLVDGKPKGEPGTLKFSDVTVNPSTGTVLLRILFTNP
FT                   GNEILPGMFVHARLEQWREENAILVPQKSVSRSADGSVSVWVVGPDGKANPRPIIVTEV
FT                   VGERWLVSSGLKAGEKVVYEGIMKIQPGMAVKTVEAALPPVPAR"
FT   gene            complement(140046..140942)
FT                   /locus_tag="Ppha_0124"
FT   CDS_pept        complement(140046..140942)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0124"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG:
FT                   cph:Cpha266_0778 transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42477"
FT                   /db_xref="GOA:B4SB56"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR041479"
FT                   /db_xref="UniProtKB/TrEMBL:B4SB56"
FT                   /protein_id="ACF42477.1"
FT                   /translation="MVWRRRWISSSYADSLLPEDIPQGFVGFSCLQLDGVQLFGDLAFH
FT                   KKAAGTGAGIVDLHARFRRKHAWHDGGNFGTVVIRNGQGKNRRNNLHKRTIVLKFDQRE
FT                   HIMSRPKKVTDSEILDAIERVVVKHGASRLSIDAVAQEAGISKSRVVYDYKSKTALLEA
FT                   LIDRQFERDTARIESALVECADTPHPELFARLKIAERALDDTERAVSMAITSSMSSEES
FT                   LRQRMLKWIERDLLAMDSGAKPEAARMAYFAFIGFSCHEWFGLVDRSDEERLPFLEQIR
FT                   KMYIGYPESHPTTTPNP"
FT   gene            141278..141508
FT                   /locus_tag="Ppha_0125"
FT   CDS_pept        141278..141508
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0125"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cph:Cpha266_1475 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42478"
FT                   /db_xref="GOA:B4SB57"
FT                   /db_xref="UniProtKB/TrEMBL:B4SB57"
FT                   /protein_id="ACF42478.1"
FT                   /translation="MNNHFDLPTVIVIVITFVLFTIALFVKGLTHDILMEAGVFLVSVK
FT                   LILMSYKSSVTSRKVMDELQEIKSMLHARKE"
FT   gene            complement(141513..141701)
FT                   /pseudo
FT                   /locus_tag="Ppha_0126"
FT   gene            complement(141808..143046)
FT                   /locus_tag="Ppha_0127"
FT   CDS_pept        complement(141808..143046)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0127"
FT                   /product="ATPase (AAA+ superfamily)"
FT                   /note="KEGG: cph:Cpha266_0783 ATPase (AAA+ superfamily)"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42479"
FT                   /db_xref="InterPro:IPR025420"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041682"
FT                   /db_xref="UniProtKB/TrEMBL:B4SB58"
FT                   /protein_id="ACF42479.1"
FT                   /translation="MNKASHYSRLIEMRIAEALADTPVVLVAGPRQAGKTTLVRQMAIE
FT                   GMRYLTLDDELTLLSARNDPVGMIRSLDCAVIDEIQRAPQLLLAIKKSVDEDRRPGRFL
FT                   LTGSANLMVLPAVADSLAGRMETLTLLPLSQSELHGSTANWIDAAFAGRLLKVTMPVTG
FT                   DELCEVVLRGGYPEAISRTDARRRTVWARQYLNAIIQRDVRDVASIDKLDQLPRFLRIL
FT                   AEISGQMCNYTKLGGQVGLDSKTASRYTGVLEQMYLLKRIEVWARNRLKRVVKTPKLQF
FT                   IDAGLLATLLDLGATEVQQDRSRFGKILETFVYSELLKHSSTAEGDYKLLYYRDLDMFE
FT                   VDMVIENASGQLIGVEVKASATVNAGDLRGLKKLASVAGGLFKMGILLYDGTETMPLGD
FT                   GLWAAPLSTLWGQ"
FT   gene            143245..143460
FT                   /pseudo
FT                   /locus_tag="Ppha_0128"
FT   gene            143462..143599
FT                   /pseudo
FT                   /locus_tag="Ppha_0129"
FT   gene            complement(143622..143732)
FT                   /pseudo
FT                   /locus_tag="Ppha_0130"
FT   gene            complement(143761..143835)
FT                   /pseudo
FT                   /locus_tag="Ppha_0131"
FT   gene            complement(144009..144197)
FT                   /pseudo
FT                   /locus_tag="Ppha_0132"
FT   gene            144289..145068
FT                   /locus_tag="Ppha_0133"
FT   CDS_pept        144289..145068
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0133"
FT                   /product="ATPase (AAA+ superfamily)-like protein"
FT                   /note="KEGG: cph:Cpha266_0779 ATPase (AAA+
FT                   superfamily)-like"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42480"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR025420"
FT                   /db_xref="UniProtKB/TrEMBL:B4SB59"
FT                   /protein_id="ACF42480.1"
FT                   /translation="MITRHLLFAGGYPRIHADHLDPAVMLGDYFATYVERDLRDLIQLR
FT                   SIRQFENFVRLAAGRVGQLLNLQSLAADAGVSSVTAKSWLTLLEASYIVFLLPPWFANV
FT                   GKRLTKSPKLYFYDVGLASWLIGITQESHLQAHPLRGSLFENLVVLEMLKARINDGLAA
FT                   NLHFYRDSSGLEVDVLLEAGNMIRLFEIKSSQTINQESFIQLNKVAAIFGERVVKKVVL
FT                   YAGHEQQERSNSTVSSYLYAGEAATNEGILGSAHETD"
FT   gene            145291..145542
FT                   /locus_tag="Ppha_0134"
FT   CDS_pept        145291..145542
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0134"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42481"
FT                   /db_xref="UniProtKB/TrEMBL:B4SB60"
FT                   /protein_id="ACF42481.1"
FT                   /translation="MQEQKSTFTVVVTGDVTMDWNIAHKSRALREPTEWTGQARSNMNW
FT                   QFGSAALLADLIATMTRERHLKWTPTGGQKVAEFKLVT"
FT   gene            complement(145548..146474)
FT                   /locus_tag="Ppha_0135"
FT   CDS_pept        complement(145548..146474)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0135"
FT                   /product="Integrase catalytic region"
FT                   /note="PFAM: Integrase catalytic region; KEGG:
FT                   cph:Cpha266_1954 integrase, catalytic region"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42482"
FT                   /db_xref="GOA:B4SB61"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:B4SB61"
FT                   /protein_id="ACF42482.1"
FT                   /translation="MSVRRWWVSDKEPLPVAKQCVLVSVNRSTIYLPSIVLFPDAEDLQ
FT                   LLELIDKEYTKHPFYGSRKIMHYLRSEGYQINRKRVQRLMRRLGLAGMAPGPNTSKPHP
FT                   EHKIYPYLLRGVDVTKPNQVWSTDITYIRLPKGFMYLVAVIDWYSRKVLSWRLSNSMES
FT                   TFCVDCLQEALRKYGTPDIFNTDQGAQFTSAAFVGALTEHPSISISMDGRGRALDNIFV
FT                   ERLWRSVKYEDIYLKGYSTAAELQCGLKEYFVLFNVERQHQSLGYSTPDKVYRTAVGGG
FT                   ARIVDKYNKNKQTEELKVKEGQRLSAA"
FT   gene            complement(146471..146764)
FT                   /locus_tag="Ppha_0136"
FT   CDS_pept        complement(146471..146764)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0136"
FT                   /product="transposase IS3/IS911 family protein"
FT                   /note="PFAM: transposase IS3/IS911 family protein; KEGG:
FT                   net:Neut_1719 transposase IS3/IS911 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42483"
FT                   /db_xref="GOA:B4SB62"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:B4SB62"
FT                   /protein_id="ACF42483.1"
FT                   /translation="MTKRTRKNFSSDFKAKVALEAIQGVKTLNEIGQEFGVHPVQVGKW
FT                   KKELQEQASSLFEAKRGPKPVEPAADPEKLYTEIGRLKVELDWLKKKSGLSL"
FT   gene            146778..147641
FT                   /locus_tag="Ppha_0137"
FT   CDS_pept        146778..147641
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0137"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42484"
FT                   /db_xref="UniProtKB/TrEMBL:B4SB63"
FT                   /protein_id="ACF42484.1"
FT                   /translation="MGQVNNLNHCLKFGVHYTVIHYNSDELKIERQLWNIRTPDFERCR
FT                   ILLVVSEGGRSALESAQHELWKHFDESHVTFVLYARNQELELCRNQQYAIKILQAFYCM
FT                   GLKEADAVYREDIQSYPEELHSLFISQSTAYQLLYSFSVLCQGYLVVLCGPDGNNDDGF
FT                   SLEVNDSTEEIRTAIKEMKWGEVLRCNCVAQSLDPRLTASGPAGRNQMRKEVSGSSYWN
FT                   MFDAKHKQQLLQTLERMFKRVDGNVAFNNSKAAELLSALPEVSQIENDPLLVAQAFLEL
FT                   QSLLRG"
FT   gene            147647..148153
FT                   /locus_tag="Ppha_0138"
FT   CDS_pept        147647..148153
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0138"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42485"
FT                   /db_xref="UniProtKB/TrEMBL:B4SB64"
FT                   /protein_id="ACF42485.1"
FT                   /translation="MCDWQRLRTNLNHDWLKNEYLKNLDALIVQLQANKTINSHLSREL
FT                   EAYLTSWLRRHEEVETLLNSAEDRLSPRTYFEKDPLNRCSLEAKSWLAPLVHVLWLVPS
FT                   GISERVDEAREVLAKADYYHTGLQSELSGSQELVLILKLLEAFTDCVGNFSRLLSSFPD
FT                   KVVSV"
FT   gene            148150..149943
FT                   /locus_tag="Ppha_0139"
FT   CDS_pept        148150..149943
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0139"
FT                   /product="response regulator receiver protein"
FT                   /note="PFAM: sigma-54 factor interaction domain-containing
FT                   protein; SMART: AAA ATPase; KEGG: ilo:IL0196 anaerobic
FT                   nitric oxide reductase transcription regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42486"
FT                   /db_xref="GOA:B4SB65"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B4SB65"
FT                   /protein_id="ACF42486.1"
FT                   /translation="MIKLPRVLIIDDQYGRSHYSGDGMHPRTSFCILAGMKDVTGDIPF
FT                   PETLGSPIVEALFFRGQIEKNGVVYNDLDGTIDAIRKGWKEWPRWAMVMLDLQFITGQV
FT                   RPEGTVEGCDTDRDPSSYFGLSILDRIRSEPDLHDIPVVLLSSMNRTPIEKRFADYSVC
FT                   QFLDKDEIDRHYGRERIATLLKDHGLVEDPSGEIIGHSVTLLKCLREARMQARAGGKNI
FT                   LILGERGTGKELLARYMHKHSGRSGELEMCFLQGCPETLVEDLLFGHVKGAYSGASADQ
FT                   AGAAERADKGTLFIDEFGAIPPSVQTKLLRLLGSTREVQRMGSSKKRIVDLLVVLATNR
FT                   MNLQVTGDFHMDLLDRINVEHSVKLPALRERIEDIPALLEHFVSSYEAKYRDALQTEPR
FT                   NIDPEAIAQMMAYPWYGNIRQLEAVVAHAVNRFPKLRILSVSHLSIPQELTEKPVVSSP
FT                   VKSDGGNFRLIFSEILSQLETITFDTSPEKRGELVEALPKLKAAYSTCAANMIRSALIA
FT                   TSKHNPGHPMGQIQITPAVNLLFGNKKLSASQCADEIKRLFRYSPKSVQQYWSSDSVLT
FT                   EAYNIAVNLRPKQGDSNQRGS"
FT   gene            150085..152454
FT                   /locus_tag="Ppha_0140"
FT   CDS_pept        150085..152454
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0140"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: nmr:Nmar_1474 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42487"
FT                   /db_xref="UniProtKB/TrEMBL:B4SB66"
FT                   /protein_id="ACF42487.1"
FT                   /translation="MDTISANHELHYFIPDEQGESTYSVKLQDEIDRVLTAITKSGCVY
FT                   REIPVFLSKDKNAIKSIAIIPSTSEHALRALLRQILDLAYGEKDGWYPYDRYKMVYHKK
FT                   TYFVFLYVPGTSEELLAILQPLEAICTELFIGNVERSFRLSELITNIQVPPSEKKELSP
FT                   HELRLCIERSVFSGGATEIRELLNRESNAFHTVLNTIMSITGLESRYRPAIRLLLGAVT
FT                   AGEVTVEEAANALNQDKRVEIKEAINVLVSAPPLIEDRAVASLQDYVKGKRCLLIEDKY
FT                   KEDGWVYVLPLLLKGLDFNVKSNPTGVPEEENLQKYDFIILDLYSSPANPFGDKTEGES
FT                   GHHQIQTISSIPLSVRQILNKIRDLYKKDGLVKTYIPNVIIFSADRSGVCVRTMLTDLG
FT                   CIDYFFKEPFDGVHKGQFYSTFKNCIVNAMMASTARVCGYVNREYGWTVFDEWIRQFTP
FT                   SDRPTVLRFMKHFRYYSAFDIINLLDIFFKEKTRYDSSGKKVISGLLPIHLPADETLLI
FT                   SYLGRLNKSGPATVSIFSKAKWFRDDLLGAEKPVMVTYDDLPKKISERLDKRGFANVII
FT                   LDDVVMSGGQIQNYLWKFIQRHFSAKINNREKPINLCVISVIGVDVDKIMGIDRNGDVV
FT                   VKICKDSHHKLYDSCNCKETITIPIHFIDKHKGVIKICEEITANQGLDYWSKVERVLQT
FT                   YTGISEPRKKERQCDFEPLGWKDCGALVATYSNVPGNSLPIIWGDRRDNNDNPLWTPLH
FT                   RRYFNPWIEGDGKDDQICKKNTEPCPLKIPCGRAKH"
FT   gene            152461..152610
FT                   /pseudo
FT                   /locus_tag="Ppha_0141"
FT   gene            complement(152799..152960)
FT                   /locus_tag="Ppha_0142"
FT   CDS_pept        complement(152799..152960)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0142"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cph:Cpha266_0773 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42488"
FT                   /db_xref="InterPro:IPR021558"
FT                   /db_xref="UniProtKB/TrEMBL:B4SB67"
FT                   /protein_id="ACF42488.1"
FT                   /translation="MGRVLEWVQKYREKLRMEGMRPIQIWVPDTRHSGFAEECRRQSLL
FT                   VKHDPLEK"
FT   gene            153224..154531
FT                   /locus_tag="Ppha_0143"
FT   CDS_pept        153224..154531
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0143"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cph:Cpha266_0774 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42489"
FT                   /db_xref="InterPro:IPR025420"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041682"
FT                   /db_xref="UniProtKB/TrEMBL:B4SB68"
FT                   /protein_id="ACF42489.1"
FT                   /translation="MLRFIDNDLRCWQESSRRKPLILRGARQVGKTWSLKEFGKNRFES
FT                   LALVDLERNQPLRKLFDGDLKVTRICSDLEVLLQQKITPGKTLLFFDEIQACPRAITAL
FT                   RYFYEEMPELHVIAAGSLLEFALEESSFPVGRVQFLNLYPLCFAEYLEAIGNGAAATAV
FT                   LGNPAEISPAVHELLREELKRYFFIGGMPAAVKAYLEKQSLRDAFEVQQEIAESYRMDF
FT                   AKYTPRVDRFCLDSVFTSLSQHIGKQIKYARLGEGYSNPTLKKAFDALCLAQVARRIPS
FT                   AEPSGLPLGATASAKSFKALMLDIGLMRYLSGMPNDIEYAKSDLLAIYRGAMAEQFIGQ
FT                   EMLVAQQGCLYYWDRQAKSSSAEVDYLAVLDGKIHPVEVKSGATGSLRSLHLFLASYPE
FT                   CGKALVFSDRPYADFPEQKITFLPLYSAFAATTSRQ"
FT   gene            complement(154542..154793)
FT                   /locus_tag="Ppha_0144"
FT   CDS_pept        complement(154542..154793)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0144"
FT                   /product="plasmid stabilization system"
FT                   /note="PFAM: plasmid stabilization system; KEGG:
FT                   cph:Cpha266_1217 plasmid stabilization system"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42490"
FT                   /db_xref="InterPro:IPR007712"
FT                   /db_xref="InterPro:IPR035093"
FT                   /db_xref="UniProtKB/TrEMBL:B4SB69"
FT                   /protein_id="ACF42490.1"
FT                   /translation="MERLHAFLYEINPDAAARAARAILEGAGFLESMPDIGRPMDDDTG
FT                   RREWFISFSAGAFVLRYMWNKNDTIVIVRVWHSKEKRT"
FT   gene            complement(154820..155089)
FT                   /locus_tag="Ppha_0145"
FT   CDS_pept        complement(154820..155089)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0145"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cph:Cpha266_1216 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42491"
FT                   /db_xref="GOA:B4SB70"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="InterPro:IPR013321"
FT                   /db_xref="UniProtKB/TrEMBL:B4SB70"
FT                   /protein_id="ACF42491.1"
FT                   /translation="MSQTKGVKLDDTTRQRLAALARIRDRSPHWLMCKAIETFLDREEH
FT                   YEQEKREDMERWERYQLTGVAVPHEKAAAWMENLAQGKVTSCPT"
FT   gene            155255..155719
FT                   /locus_tag="Ppha_0146"
FT   CDS_pept        155255..155719
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0146"
FT                   /product="transcriptional regulator, BadM/Rrf2 family"
FT                   /note="TIGRFAM: transcriptional regulator, Rrf2 family;
FT                   PFAM: protein of unknown function UPF0074; KEGG:
FT                   cph:Cpha266_0509 transcriptional regulator, BadM/Rrf2
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42492"
FT                   /db_xref="InterPro:IPR000944"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B4SB71"
FT                   /protein_id="ACF42492.1"
FT                   /translation="MKVLTKNTDYAIRALLALAARKGSYVSARSIATEHDIPYQFLRGL
FT                   LQEMIRHDLIVSKEGVQGGFMMKKDPDTISVTQLIEIFQGKVQMSECMFRKQICGNRAR
FT                   CVLRHEIMRIEQVVQSEFEKVTIGKLMRDLQAANQVKPPSVDLEQEMLNP"
FT   gene            155732..156625
FT                   /locus_tag="Ppha_0147"
FT   CDS_pept        155732..156625
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0147"
FT                   /product="4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein; KEGG: cte:CT1701 iron-sulfur cluster-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42493"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:B4SB72"
FT                   /protein_id="ACF42493.1"
FT                   /translation="MQRQIITIDEKKCTGCGDCIPGCPEGALQVIDGKARLISDLFCDG
FT                   LGACIGHCPTGAMNIVSREAEAYDEKRVMHESIVKGGANVIAAHLRHLMDHGQNEFVGQ
FT                   ALEYLEEQGIANPLECGAVSQTETRHANAGQQHAPHAGGCPGSRTIDFNANGKTEAAVA
FT                   AMPGAPVQSALRQWPIQLHLVSPQAPCFERSDLLLAADCAAFAVGDFHGKFMQGKSLAI
FT                   ACPKLDSGMEIYVEKLAAMIDLSHINTITVAIMEVPCCGGLMSIVAEAQRRASRKVPVK
FT                   KVVISLQGETLSEEWV"
FT   gene            156658..157110
FT                   /locus_tag="Ppha_0148"
FT   CDS_pept        156658..157110
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0148"
FT                   /product="TPR repeat-containing protein"
FT                   /note="PFAM: TPR repeat-containing protein; SMART:
FT                   Tetratricopeptide domain protein; KEGG: pvi:Cvib_1456 TPR
FT                   repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42494"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:B4SB73"
FT                   /protein_id="ACF42494.1"
FT                   /translation="MEKGLNFKVGEAMLKDAMGGYRGTATEISRVIAEHPERAEAYYDR
FT                   GNARSSCNDFDGAIADFSMALQIGLRFREAITAYGNRGMARVKSGDMDGAIQDFSAIIE
FT                   RKPANKRLLSTAYKNRALVKEKKGDSEGAAGDRTMALLLSSDRNKQ"
FT   gene            157132..158760
FT                   /locus_tag="Ppha_0149"
FT   CDS_pept        157132..158760
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0149"
FT                   /product="hybrid cluster protein"
FT                   /note="TIGRFAM: hybrid cluster protein; PFAM: Prismane;
FT                   KEGG: cch:Cag_1490 hydroxylamine reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42495"
FT                   /db_xref="GOA:B4SB74"
FT                   /db_xref="InterPro:IPR004137"
FT                   /db_xref="InterPro:IPR010048"
FT                   /db_xref="InterPro:IPR011254"
FT                   /db_xref="InterPro:IPR016099"
FT                   /db_xref="InterPro:IPR016100"
FT                   /db_xref="UniProtKB/TrEMBL:B4SB74"
FT                   /protein_id="ACF42495.1"
FT                   /translation="MGMYCNQCQESVHGSGCIVRGVCGKDDMTAKLQDVLVYATEGLAL
FT                   AAEQQQGSVSRNVGQLISESLFVTVTNTNFDEDAIVAQIRKTLALRDELKATLAVQPDH
FT                   DVACWTGSSKDEFLAKAETSGLESLSENEDLQSLKSLVLFGIKGLAAYTDHAAVLGYHD
FT                   DEIYAFYVKGLAALTKELTADELTALVLETGGVAVKAMALLDKANTETYGQPEITTVKT
FT                   GVGKNPGILISGHDLRDLEDLLKQTEGTGVDVYTHCEMLPAHYYPAFKKYSHFVGNYGG
FT                   SWWSQDREFETFNGPILMTTNCIVPVRESYRNRMFTTGMAGYPGLKHIAARPEGGQKDF
FT                   SALVELAKSCPAPKELENGTITGGFAHNQVIALADKVVAAVKSGAIKRFVVMAGCDGRH
FT                   KSRQYYTDVAAALPDNTVILTAGCAKYRYNKLELGDIGGIPRVLDAGQCNDSYSLAVIA
FT                   LKLKEVFELDDINDLPISFDIAWYEQKAVTVLLALLFLGVKGIRLGPTLPEFLTPNVAA
FT                   VLVEKFGIKPIGTVAADVEAMMAGA"
FT   gene            complement(158912..159052)
FT                   /pseudo
FT                   /locus_tag="Ppha_0150"
FT   gene            complement(159156..159569)
FT                   /locus_tag="Ppha_0151"
FT   CDS_pept        complement(159156..159569)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0151"
FT                   /product="PilT protein domain protein"
FT                   /note="PFAM: PilT protein domain protein; KEGG:
FT                   cch:Cag_1433 possible NtrR protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42496"
FT                   /db_xref="GOA:B4SB75"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR022907"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:B4SB75"
FT                   /protein_id="ACF42496.1"
FT                   /translation="MSLYMLDTNIASHVIKGDIPLVRERLIAVPIQRVVISSVTQAELL
FT                   YGLAKRTYPKGLTARVHEFLIRVKILAWDKEVAIVYGDLRAKCETTGVTLSPLDLMIAA
FT                   HAQAVNAILVTGDKAFTRIQDRLIIENWTLSPD"
FT   gene            complement(159566..159826)
FT                   /locus_tag="Ppha_0152"
FT   CDS_pept        complement(159566..159826)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0152"
FT                   /product="SpoVT/AbrB-like protein"
FT                   /note="KEGG: rpd:RPD_2062 SpoVT/AbrB-like"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42497"
FT                   /db_xref="GOA:B4SB76"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="UniProtKB/TrEMBL:B4SB76"
FT                   /protein_id="ACF42497.1"
FT                   /translation="MPVTAKIFMSGRSQAVRLPKEFRFEGKEVFIRRDAISGDVILSHH
FT                   PDSWAGLFELDTTTEVPADFMQADDRTQPEQLRDPFEGWAE"
FT   gene            159988..160206
FT                   /pseudo
FT                   /locus_tag="Ppha_0153"
FT   gene            complement(160323..160454)
FT                   /locus_tag="Ppha_0154"
FT   CDS_pept        complement(160323..160454)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0154"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42498"
FT                   /db_xref="UniProtKB/TrEMBL:B4SB77"
FT                   /protein_id="ACF42498.1"
FT                   /translation="MFQLVLLQENTLSLDFFGQIADRFVVREGLALDADQLFRQPVG"
FT   gene            160528..160878
FT                   /locus_tag="Ppha_0155"
FT   CDS_pept        160528..160878
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0155"
FT                   /product="protein of unknown function DUF891"
FT                   /note="PFAM: protein of unknown function DUF891; KEGG:
FT                   plt:Plut_0606 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42499"
FT                   /db_xref="InterPro:IPR009241"
FT                   /db_xref="UniProtKB/TrEMBL:B4SB78"
FT                   /protein_id="ACF42499.1"
FT                   /translation="MIHFLKNNPTLEVRFFKTDGGTEPVRDWLRELPAVERKRIGEEIK
FT                   TVQYGWPLGMPLVRKMEKDLWEVRVHLPTRIARVLFTVQDGLIVLLHGFIKKSQATPKS
FT                   DLQLAKSRMRNT"
FT   gene            160875..161159
FT                   /locus_tag="Ppha_0156"
FT   CDS_pept        160875..161159
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0156"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cch:Cag_1578 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42500"
FT                   /db_xref="GOA:B4SB79"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR039554"
FT                   /db_xref="UniProtKB/TrEMBL:B4SB79"
FT                   /protein_id="ACF42500.1"
FT                   /translation="MMNEKNIGSSFDEFLEEEALLDEATAVAVKRVIAWQIAQEMKAQH
FT                   LTKSSMASKMQTSRAALNRLLDATDTSLTLTTLASAASVLGKKFRIELV"
FT   gene            161440..161769
FT                   /locus_tag="Ppha_0157"
FT   CDS_pept        161440..161769
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0157"
FT                   /product="DNA polymerase beta domain protein region"
FT                   /note="PFAM: DNA polymerase beta domain protein region;
FT                   KEGG: cch:Cag_0015 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42501"
FT                   /db_xref="InterPro:IPR041633"
FT                   /db_xref="UniProtKB/TrEMBL:B4SB80"
FT                   /protein_id="ACF42501.1"
FT                   /translation="MKHKMIGGMTSNQTMQRDQALRTLSSHKAELEERYGVKKVGIFGS
FT                   VARNSARDDSDIDIVVEMEPNILLRVQLKEELEQLLGSKVDLIRYWKRMNPFLKARIDK
FT                   EAQYV"
FT   gene            161762..161902
FT                   /locus_tag="Ppha_0158"
FT   CDS_pept        161762..161902
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0158"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cch:Cag_1579 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42502"
FT                   /db_xref="UniProtKB/TrEMBL:B4SB81"
FT                   /protein_id="ACF42502.1"
FT                   /translation="MYEEYQAIEEFMEDCMDLIDLWEAKFAGQDQLSVSLDEVIKELKK
FT                   G"
FT   gene            161971..162198
FT                   /locus_tag="Ppha_0159"
FT   CDS_pept        161971..162198
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0159"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gur:Gura_3207 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42503"
FT                   /db_xref="InterPro:IPR013406"
FT                   /db_xref="UniProtKB/TrEMBL:B4SB82"
FT                   /protein_id="ACF42503.1"
FT                   /translation="MAKIELPLSQFTYAEKLDLLETIWDDLSRDEAAFESPAWHENILN
FT                   ERKEAFSAGTAQHSDWAEAKERIKRNLSCS"
FT   gene            complement(162250..162413)
FT                   /pseudo
FT                   /locus_tag="Ppha_0160"
FT   gene            162641..162901
FT                   /locus_tag="Ppha_0161"
FT   CDS_pept        162641..162901
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0161"
FT                   /product="protein of unknown function UPF0175"
FT                   /note="PFAM: protein of unknown function UPF0175; KEGG:
FT                   cph:Cpha266_0647 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42504"
FT                   /db_xref="InterPro:IPR005368"
FT                   /db_xref="UniProtKB/TrEMBL:B4SB83"
FT                   /protein_id="ACF42504.1"
FT                   /translation="MAAQHITLDIPEKILIAEKTDALAFGRELRVLAAVKLFEMGRLSS
FT                   GRASELAGMSRVEFLLSLSRYNVFPLASELDDLEHDHASSH"
FT   gene            162885..163367
FT                   /locus_tag="Ppha_0162"
FT   CDS_pept        162885..163367
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0162"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cph:Cpha266_0648 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42505"
FT                   /db_xref="InterPro:IPR021799"
FT                   /db_xref="UniProtKB/TrEMBL:B4SB84"
FT                   /protein_id="ACF42505.1"
FT                   /translation="MLQAISNTSPLLYLYRIGLIDRLPEIFGEIWTPEAVKIELMVGDK
FT                   SGYDVPNRSDFSLIRIINPKAQSSEWLSLDLGPGELAAMPLALENLHCIVLLDDMLARR
FT                   TAHAAGLQVWGTLKVLLEMKAQGLVNRVEPYVNRLTDAGMWVSDVVKRRILVLAGE"
FT   gene            163372..163959
FT                   /pseudo
FT                   /locus_tag="Ppha_0163"
FT   gene            complement(164076..164399)
FT                   /locus_tag="Ppha_0164"
FT   CDS_pept        complement(164076..164399)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0164"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="PFAM: helix-turn-helix domain protein; KEGG:
FT                   plt:Plut_1818 transcriptional regulator, XRE family"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42506"
FT                   /db_xref="GOA:B4SB85"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:B4SB85"
FT                   /protein_id="ACF42506.1"
FT                   /translation="MSKATTYKSDALAAVHETASDMFEAGVIDKQTMRHFDESCLTPIH
FT                   PFSPEEIKALREREEVSQRVFAHYLNVTKESVSQWERGQKKPAGTTLKLLSLVERRGIN
FT                   AIA"
FT   gene            complement(164392..164766)
FT                   /locus_tag="Ppha_0165"
FT   CDS_pept        complement(164392..164766)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0165"
FT                   /product="protein of unknown function DUF1044"
FT                   /note="PFAM: protein of unknown function DUF1044; KEGG:
FT                   plt:Plut_1817 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42507"
FT                   /db_xref="InterPro:IPR009387"
FT                   /db_xref="UniProtKB/TrEMBL:B4SB86"
FT                   /protein_id="ACF42507.1"
FT                   /translation="MRIFKNRWFAKFAKDEGISDEKLCKAVKDAENGLIDADYGGGVIK
FT                   QRIARLHEGKSGGYRSIIFYSQGDKAFFVYGFPKNAQANITKADVKEYKELAKITFSLC
FT                   DEKLEKLIRTGAFKAVTCYE"
FT   gene            165117..165553
FT                   /pseudo
FT                   /locus_tag="Ppha_0166"
FT   gene            165715..166158
FT                   /locus_tag="Ppha_0167"
FT   CDS_pept        165715..166158
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0167"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: vei:Veis_3132 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42508"
FT                   /db_xref="UniProtKB/TrEMBL:B4SB87"
FT                   /protein_id="ACF42508.1"
FT                   /translation="MSFILVQQEADALLAMEKHYTGAERFTFPSLDGALRISLHSEAMR
FT                   EEFNLDITRGRIELKKNTFQLRAQRAIVLARIDIGGAPHRNPDGEEMPCPHLHVYREGH
FT                   GDKWAIPLPIQFSNSKNAWQILYEFMDYCTVITKPIILQELFT"
FT   gene            166155..166922
FT                   /locus_tag="Ppha_0168"
FT   CDS_pept        166155..166922
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0168"
FT                   /product="Domain of unknown function DUF1829"
FT                   /note="PFAM: Domain of unknown function DUF1828; Domain of
FT                   unknown function DUF1829; KEGG: vei:Veis_3133 Lj965
FT                   prophage protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42509"
FT                   /db_xref="InterPro:IPR014960"
FT                   /db_xref="InterPro:IPR014961"
FT                   /db_xref="UniProtKB/TrEMBL:B4SB88"
FT                   /protein_id="ACF42509.1"
FT                   /translation="MIGEINTLLEKYTQWLKDKTIAKQICADWVEITTPYIDRHNDCLQ
FT                   IYARKEGAGYMLTDDGYTMSDLVSSGCQLDSPKRQDLLKTTLAGFGVQLDRDQLIVHTT
FT                   PENFSLKKHTIIQAMLAVNDLFYLASPFVASLFVEDVTNWFELSDIRYTPKIKFTGKSG
FT                   YDHMFDFVIPKSRKQPERLVQAIANPRKESAEALVFKWLDTKETRASDSQLYVFLNDTG
FT                   SIVSSSVVDALKNYDLKPLLWSERENYRDDLAA"
FT   gene            complement(167106..167279)
FT                   /pseudo
FT                   /locus_tag="Ppha_0169"
FT   gene            167405..168179
FT                   /pseudo
FT                   /locus_tag="Ppha_0170"
FT                   /note="Appr-1-p processing domain protein"
FT   gene            complement(168193..169221)
FT                   /locus_tag="Ppha_0172"
FT   CDS_pept        complement(168193..169221)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0172"
FT                   /product="phenylalanyl-tRNA synthetase, alpha subunit"
FT                   /note="TIGRFAM: phenylalanyl-tRNA synthetase, alpha
FT                   subunit; PFAM: phenylalanyl-tRNA synthetase class IIc;
FT                   KEGG: cph:Cpha266_2505 phenylalanyl-tRNA synthetase, alpha
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42510"
FT                   /db_xref="GOA:B4SB89"
FT                   /db_xref="InterPro:IPR002319"
FT                   /db_xref="InterPro:IPR004188"
FT                   /db_xref="InterPro:IPR004529"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR022911"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4SB89"
FT                   /protein_id="ACF42510.1"
FT                   /translation="MENTIRSLQQEIIDFEITTAADLEAFRLRYTVRKGLIAALFGQLK
FT                   TVEPAEKPRMGQLLNQLKQTADAKLTEAEERLAGTESKSSSNRIDLTLPGRRYFTGSEH
FT                   PVQKVLGEMKSIFSAMGFGIATGPELETDQYNFDLLNFPPDHPARDMQDTFFVTSGNPG
FT                   SDVLLRTHTSPVQIRVMLDQKPPIRVICPGKVYRNEAISSRSYCVFHQLEGLYIDKKVS
FT                   FADLKATIYSFAKQMFGTDVKLRFRPSFFPFTEPSAEVDVTCYLCGGKGCKVCKKSGWL
FT                   EIMGCGMVHPNVMRNCGIDPEEWSGYAFGMGVDRTVLLRYKIDDIRLLFENDLRMLKQF
FT                   TA"
FT   gene            complement(169240..169587)
FT                   /locus_tag="Ppha_0173"
FT   CDS_pept        complement(169240..169587)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0173"
FT                   /product="ribosomal protein L20"
FT                   /note="TIGRFAM: ribosomal protein L20; KEGG:
FT                   cph:Cpha266_2504 50S ribosomal protein L20"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42511"
FT                   /db_xref="GOA:B4SB90"
FT                   /db_xref="InterPro:IPR005813"
FT                   /db_xref="InterPro:IPR035566"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4SB90"
FT                   /protein_id="ACF42511.1"
FT                   /translation="MPKANNAVASKARRKRVLKKAKGFWGSRGNILTVVKHAVDKAEQY
FT                   AYRDRRVKKRTFRSLWIMRINAAARLNGTTYSRMINAMLKKNVEIDRKALAEIAVKDPA
FT                   AFTVIVKSLFE"
FT   gene            complement(169614..169808)
FT                   /locus_tag="Ppha_0174"
FT   CDS_pept        complement(169614..169808)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0174"
FT                   /product="ribosomal protein L35"
FT                   /note="PFAM: ribosomal protein L35; KEGG: cch:Cag_1713 50S
FT                   ribosomal protein L35"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42512"
FT                   /db_xref="GOA:B4SB91"
FT                   /db_xref="InterPro:IPR001706"
FT                   /db_xref="InterPro:IPR018265"
FT                   /db_xref="InterPro:IPR021137"
FT                   /db_xref="InterPro:IPR037229"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4SB91"
FT                   /protein_id="ACF42512.1"
FT                   /translation="MPKMKSHRGACKRFKTTSSGKIKRERMNGSHNLEKKNSKRCRRLH
FT                   QTALLEGLKAKQIKRMIQA"
FT   gene            complement(169858..170490)
FT                   /locus_tag="Ppha_0175"
FT   CDS_pept        complement(169858..170490)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0175"
FT                   /product="translation initiation factor IF-3"
FT                   /note="TIGRFAM: translation initiation factor IF-3; PFAM:
FT                   initiation factor 3; KEGG: cch:Cag_1714 translation
FT                   initiation factor IF-3"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42513"
FT                   /db_xref="GOA:B4SB92"
FT                   /db_xref="InterPro:IPR001288"
FT                   /db_xref="InterPro:IPR019814"
FT                   /db_xref="InterPro:IPR019815"
FT                   /db_xref="InterPro:IPR036787"
FT                   /db_xref="InterPro:IPR036788"
FT                   /db_xref="UniProtKB/TrEMBL:B4SB92"
FT                   /protein_id="ACF42513.1"
FT                   /translation="MKKQKVTTQKPKLTYRVNEQIRVPEVRIIFPDGTQEVMKTIDAKR
FT                   VAEERNQDLIEVQPNAEPPVCKFDNLGRLLYKMDKRDKDLKKKQKTTTLKELRFHPNTD
FT                   KHDFDFKSAHLEEFLRKGNRVRATIVFLGRSIIYKDKGLELAERLTERLSIVSTRDGDP
FT                   KFEGKKLFVYFEPDKKKIDAYERIKAKTNQPSAAPLAPLAPEDLTEE"
FT   gene            complement(170514..172487)
FT                   /locus_tag="Ppha_0176"
FT   CDS_pept        complement(170514..172487)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0176"
FT                   /product="threonyl-tRNA synthetase"
FT                   /note="TIGRFAM: threonyl-tRNA synthetase; PFAM: tRNA
FT                   synthetase class II (G H P and S); TGS domain protein;
FT                   Anticodon-binding domain protein; Threonyl/alanyl tRNA
FT                   synthetase SAD; KEGG: cch:Cag_1715 threonyl-tRNA
FT                   synthetase, class IIa"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42514"
FT                   /db_xref="GOA:B4SB93"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002320"
FT                   /db_xref="InterPro:IPR004095"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR012676"
FT                   /db_xref="InterPro:IPR012947"
FT                   /db_xref="InterPro:IPR018163"
FT                   /db_xref="InterPro:IPR033728"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4SB93"
FT                   /protein_id="ACF42514.1"
FT                   /translation="MSDNQDILAVIALTLPDGSVKTFPIGTTGNDVALSIGRKLAQDAL
FT                   ALRVNGVAIDLSTPLTADAAIEIITFSSPAGQDIFWHSSSHLMAQAIEELYPGSKFGAG
FT                   PSIEQGFYYDVASTHRFREEDLRKIEERMLEISKRDIQIRREEMSRTDAIEFFKTVRND
FT                   PYKVEILEDTLKEVERVSLYHQDGFTDLCIGPHIPSTSKVKAVLLSNISSSYWRGDSAR
FT                   ENMQRIYGITFPSEKLLKEHVARLEEAKRRDHRKLGAELELFMLSPEVGSGLPIWLPKG
FT                   AIIRNELETFLKEEQRKRGYLPVYTPHIGNIELYKRSGHYPYYSDSQFPPLTYHDEEGK
FT                   QEQYLLKPMNCPHHHLIYSSKMRSYRDLPLRLTEFGTVYRHEQSGELNGLVRARGFTQD
FT                   DSHIYCRPDQLVDEICSAIELTQFVFGTLGFSEVQTRLSMHDPENQAKYGGTAEVWEQA
FT                   EKDVQEAADRMGIDYFIGVGEASFYGPKIDFIVRDALGRKWQLGTVQVDYVMPERFDLT
FT                   YTGSDGQKHRPVVIHRAPFGSMERFIGVLIEHTAGNFPLWLAPVQAVVLPIAEDVLDYA
FT                   KSVHQALLAAGIRAELDTRSEKIGKKIRDAEVSKIPCMIVIGQKEQESGEVSLRRHRIG
FT                   DEGRFSVSGLIEKLKTEITGKS"
FT   gene            complement(172665..174071)
FT                   /locus_tag="Ppha_0177"
FT   CDS_pept        complement(172665..174071)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0177"
FT                   /product="chlorophyllide reductase subunit Z"
FT                   /note="TIGRFAM: chlorophyllide reductase subunit Z; PFAM:
FT                   oxidoreductase/nitrogenase component 1; protein of unknown
FT                   function DUF1197; KEGG: cch:Cag_1716 chlorophyllide
FT                   reductase subunit Z"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42515"
FT                   /db_xref="GOA:B4SB94"
FT                   /db_xref="InterPro:IPR000510"
FT                   /db_xref="InterPro:IPR010244"
FT                   /db_xref="InterPro:IPR013580"
FT                   /db_xref="InterPro:IPR016209"
FT                   /db_xref="UniProtKB/TrEMBL:B4SB94"
FT                   /protein_id="ACF42515.1"
FT                   /translation="MGKTIRDESTASAYWAAVNTFCSLQDVHVIADAPVGCYNLVGVAV
FT                   IDYTDAVPYLENLTPTSLTEKEIASSGSSEIVRQTIEKLQAPGRQLILVSSAESEMIGS
FT                   DHERMLTMKYPDVRFFPSNSLGENEWQGRDRALVWLNDTFGNNTPPSVKIGSVSIIGPT
FT                   YGCFNSPSDLAEIKRLIAGIGGELLHVYPFESSLHDIADLKNSDVIVVMYHEFGHALAE
FT                   KLGRPVLQAPFGLGETEQFIHDLGRLLKKEDEADAFLLKEKKTTLKPIWDLWRGPQAEW
FT                   FPTIRFGATAAKTYALGLETFLSGEMGMQCLFSHNTAEADNTLVRNEIQQKQPQFLFGR
FT                   IVDKIYLAELDSKTRFIPAGFPGPIVRRALGTPFMGHSGAVYLLQEIVNALYDMLFNFL
FT                   PLNRRTAVEEPAQKVAWSSEANALLNEMVKKAPFISQISYGRELKRKAELLTLKQGKEC
FT                   VTPELLGMVN"
FT   gene            complement(174094..175869)
FT                   /locus_tag="Ppha_0178"
FT   CDS_pept        complement(174094..175869)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0178"
FT                   /product="glycoside hydrolase family 3 domain protein"
FT                   /note="PFAM: glycoside hydrolase family 3 domain protein;
FT                   KEGG: cph:Cpha266_2499 glycoside hydrolase, family 3 domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42516"
FT                   /db_xref="GOA:B4SB95"
FT                   /db_xref="InterPro:IPR001764"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR019800"
FT                   /db_xref="InterPro:IPR036881"
FT                   /db_xref="InterPro:IPR036962"
FT                   /db_xref="UniProtKB/TrEMBL:B4SB95"
FT                   /protein_id="ACF42516.1"
FT                   /translation="MKKQSRLALFPLFILLLLMTAGETGSAKSKPGTEKWCAQQIFSRK
FT                   DSHIEESLKGLTLSEKVGEMLIAQIEAHYSGSYDKEYQLLSRLVQEGKIGGIMFLKGDA
FT                   FSAAMLANHFQSIAPRPLLMSADMERGVAMRLSGATEFPPNMAVAATQDPELAALMAKA
FT                   IAEEAKIVGLHQNYAPTVDLNSNPLNPIINTRSFGDRIPLTITMSNAVIKGLQSHGMIA
FT                   TAKHFPGHGNVTIDSHISLPLLQADRQELDAYELKPFKAAIEQGVISIMIGHLAVPKLT
FT                   GTLEPASISKTIVTDLLRHDLGFTGLIITDALNMKALYNGENVPEISVKAVQAGNDLLL
FT                   FSPDPELAHSSIVKAVEEGVIPMEQIDASVRRILQAKQWLEIDNRKLVNLNRIKDEINP
FT                   ESHRTLAQTITSRAITLAGDANHYLPLNREASSGNVLNIILQDKTNSETGKGYSKKLDH
FT                   YYAATHIRIDPDTDSLRYANATELATRASAVLVTSFVKALSGSGTLKLTEKQQQFIHSL
FT                   TGIVPKEKPLIFVSFGTPYIINYFPEITTYLCTYSENDSSEEMAVEVLKGNLTPQGMLP
FT                   VSLQEPSRLNGTSLQ"
FT   sig_peptide     complement(175780..175869)
FT                   /locus_tag="Ppha_0178"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.491 at
FT                   residue 30"
FT   gene            complement(175893..177341)
FT                   /locus_tag="Ppha_0179"
FT   CDS_pept        complement(175893..177341)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0179"
FT                   /product="Glycine dehydrogenase (decarboxylating)"
FT                   /EC_number="1.4.4.2"
FT                   /note="PFAM: glycine cleavage system P-protein; KEGG:
FT                   cph:Cpha266_2496 glycine dehydrogenase subunit 2"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42517"
FT                   /db_xref="GOA:B4SB96"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR020581"
FT                   /db_xref="InterPro:IPR023012"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4SB96"
FT                   /protein_id="ACF42517.1"
FT                   /translation="MREKLIFELSRKGRKGYSLSGNELPEQPLENIIPSKYLRTTPAEL
FT                   PEVAESEVVRHFVRLSNLNYHVDKNMYPLGSCTMKYNPKINDYTCDLPGFSALHPLQPG
FT                   ETTQGALQLMFELAEMLREIAGMAAVTLQPAAGAHGELTGILLIKKYHESIGSKRHKLL
FT                   VVDSAHGTNPASAALAGYDIISVKGNADGRTDLDDLRSKLDGDVAALMLTNPNTIGLFE
FT                   TEILAISKMVHDNGSLLYMDGANMNALLGITRPGDMGFDVVHYNLHKTFAAPHGGGGPG
FT                   SGPVGVSEKLIPFLLVPVIVKEGTTYKLSYDRPESIGRMMNFYGNFAVLVRAYTYIRML
FT                   GPDGLRRVSENAIINANYLLSLLLESYDLPYPKPVMHEFCLSGDRQKKAHGVKTLDIAK
FT                   RLLDYGFHAPTIYFPLIVSEALMIEPTETESKETLDVFAQALLSIADEAANNPALVTSA
FT                   PVTTPVKRLDDAMASRQLNICCSL"
FT   gene            complement(177455..177655)
FT                   /locus_tag="Ppha_0180"
FT   CDS_pept        complement(177455..177655)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0180"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42518"
FT                   /db_xref="UniProtKB/TrEMBL:B4SB97"
FT                   /protein_id="ACF42518.1"
FT                   /translation="MVKKIMITNRISATSVIPITELAGKPVTGTPVSLAKTQKVAEYDN
FT                   WFLQDVEKGLTKITAEKSLEN"
FT   gene            177788..178441
FT                   /locus_tag="Ppha_0181"
FT   CDS_pept        177788..178441
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0181"
FT                   /product="protein of unknown function DUF1016"
FT                   /note="PFAM: protein of unknown function DUF1016; KEGG:
FT                   pna:Pnap_0993 protein of unknown function DUF1016"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42519"
FT                   /db_xref="InterPro:IPR041527"
FT                   /db_xref="UniProtKB/TrEMBL:B4SB98"
FT                   /protein_id="ACF42519.1"
FT                   /translation="MNEHDRSLSVNIDVLLAQLRTLIADARKDAKRTVDVIQVRTCWEI
FT                   GRHIVEFEQGGQARAAYGKKLLSRLAESLTGEFGKGFDATNLRHMRRFYLAFPICDTVR
FT                   RELSWSHYRALLRVDNPEARLWYVNEAAAQNWSFRALDRQIGTLYYERLLLSNDKASVE
FT                   AEAEANIAALPRSPREFVRDPVMLEFLGLPGTGKLLESKLEQALMDVVSSMAKY"
FT   gene            178529..178879
FT                   /locus_tag="Ppha_0182"
FT   CDS_pept        178529..178879
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0182"
FT                   /product="prevent-host-death family protein"
FT                   /note="TIGRFAM: prevent-host-death family protein; KEGG:
FT                   gur:Gura_3866 prevent-host-death family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42520"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="InterPro:IPR036165"
FT                   /db_xref="UniProtKB/TrEMBL:B4SB99"
FT                   /protein_id="ACF42520.1"
FT                   /translation="MRVRATAKELKFNSKKLIYSVNRGEGVIITFRGKPCAKLFPYQEI
FT                   KKQTEKNELFSHSMQLADALIGATAIAHGLPVLTGNDKHYKCNEGSSDQEVCAIATWKL
FT                   QRVGSLFDGVGV"
FT   gene            179090..179551
FT                   /locus_tag="Ppha_0183"
FT   CDS_pept        179090..179551
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0183"
FT                   /product="protein of unknown function DUF1526"
FT                   /note="PFAM: protein of unknown function DUF1526; KEGG:
FT                   gur:Gura_4147 protein of unknown function DUF1526"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42521"
FT                   /db_xref="UniProtKB/TrEMBL:B4SBA0"
FT                   /protein_id="ACF42521.1"
FT                   /translation="MFAHYAWNMVLSESLYTPLQCLEVILRNSVHDAATAHFKTDRWFD
FT                   LPGLLSPQEVNKVQEAKNTLVKSKKPLDAGRIIPELTFGFWISLFDVRYEKILWPWLLK
FT                   PVVPNMSRHIRIRENLSKRLNRVRTLRNRIFHHEPIWHWRDLQSQHTEA"
FT   gene            complement(179610..180536)
FT                   /locus_tag="Ppha_0184"
FT   CDS_pept        complement(179610..180536)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0184"
FT                   /product="Integrase catalytic region"
FT                   /note="PFAM: Integrase catalytic region; KEGG:
FT                   cph:Cpha266_1954 integrase, catalytic region"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42522"
FT                   /db_xref="GOA:B4SB61"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:B4SB61"
FT                   /protein_id="ACF42522.1"
FT                   /translation="MSVRRWWVSDKEPLPVAKQCVLVSVNRSTIYLPSIVLFPDAEDLQ
FT                   LLELIDKEYTKHPFYGSRKIMHYLRSEGYQINRKRVQRLMRRLGLAGMAPGPNTSKPHP
FT                   EHKIYPYLLRGVDVTKPNQVWSTDITYIRLPKGFMYLVAVIDWYSRKVLSWRLSNSMES
FT                   TFCVDCLQEALRKYGTPDIFNTDQGAQFTSAAFVGALTEHPSISISMDGRGRALDNIFV
FT                   ERLWRSVKYEDIYLKGYSTAAELQCGLKEYFVLFNVERQHQSLGYSTPDKVYRTAVGGG
FT                   ARIVDKYNKNKQTEELKVKEGQRLSAA"
FT   gene            complement(180533..180826)
FT                   /locus_tag="Ppha_0185"
FT   CDS_pept        complement(180533..180826)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0185"
FT                   /product="transposase IS3/IS911 family protein"
FT                   /note="PFAM: transposase IS3/IS911 family protein; KEGG:
FT                   net:Neut_1719 transposase IS3/IS911 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42523"
FT                   /db_xref="GOA:B4SB62"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:B4SB62"
FT                   /protein_id="ACF42523.1"
FT                   /translation="MTKRTRKNFSSDFKAKVALEAIQGVKTLNEIGQEFGVHPVQVGKW
FT                   KKELQEQASSLFEAKRGPKPVEPAADPEKLYTEIGRLKVELDWLKKKSGLSL"
FT   gene            181056..181328
FT                   /pseudo
FT                   /locus_tag="Ppha_0186"
FT   gene            181743..181970
FT                   /locus_tag="Ppha_0187"
FT   CDS_pept        181743..181970
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0187"
FT                   /product="prevent-host-death family protein"
FT                   /note="TIGRFAM: prevent-host-death family protein; KEGG:
FT                   gur:Gura_3866 prevent-host-death family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42524"
FT                   /db_xref="InterPro:IPR006442"
FT                   /db_xref="InterPro:IPR036165"
FT                   /db_xref="UniProtKB/TrEMBL:B4SBA3"
FT                   /protein_id="ACF42524.1"
FT                   /translation="MRATAKELKFNSKKLIDSVNRGEEVIITFRGKPCAKLVPYQEIKN
FT                   QTEKNELFGMWEDNDMVNNVDEYVRGLREG"
FT   gene            181976..182353
FT                   /locus_tag="Ppha_0188"
FT   CDS_pept        181976..182353
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0188"
FT                   /product="PilT protein domain protein"
FT                   /note="PFAM: PilT protein domain protein; KEGG:
FT                   gur:Gura_3865 PilT protein domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42525"
FT                   /db_xref="GOA:B4SBA4"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR022907"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:B4SBA4"
FT                   /protein_id="ACF42525.1"
FT                   /translation="MVIDSDVLIWYMRGNEKAYQLIENSYNFFISVITYMELVQGMRNK
FT                   QELIKLRKALNAWNAQILYVSEEISAKAMFYVEQHFLSHSMQLADALIGATAIAHGLTV
FT                   LTGNDKHYKVMKDFHIKKFVP"
FT   gene            complement(182595..184799)
FT                   /locus_tag="Ppha_0189"
FT   CDS_pept        complement(182595..184799)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0189"
FT                   /product="DEAD/DEAH box helicase domain protein"
FT                   /note="PFAM: helicase domain protein; DEAD/DEAH box
FT                   helicase domain protein; SMART: DEAD-like helicases; KEGG:
FT                   pau:PA14_28840 putative helicase"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42526"
FT                   /db_xref="GOA:B4SBA5"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B4SBA5"
FT                   /protein_id="ACF42526.1"
FT                   /translation="MHPLNSDESQAFFLLDEKIQRWIWEQKWMTLRDAQERAIAPILAG
FT                   NTDVIIAAATATGKTEAAFLPICSKLLAKECQNASVLYISPLKALINDQFSRMEQLCER
FT                   LDIPVHPWHGDVSVSKKGKFLKKPTGILLITPESVEALFVNHGSAVPQIFNNLLYIVID
FT                   ELHSFIGSERGQQLQSLLHRIEFAIKRKIPRIGLSATIGDMHLASRFLRPETEAKTVII
FT                   VSNATGQELQLLLRGYVNKAPLLHPIEETEEVPPDGSSLEIGEDLFKTLRGKSNLIFPN
FT                   SREQVENFSDLLRNKCEEQHLPNEFWPHHGNLAKGLREEAEAAIKDKSHPVNIVCTSTL
FT                   EMGIDIGSVISIAQIGVPPSVASLRQRLGRSGRKDGDPAILRIYIQENEVTISSKPLAC
FT                   LRSNLIQTIAMVRLLLEKWYEPPPSGGLHLSTMVQQLLSLIAQYGGITAVQAYNLLCKN
FT                   GAFQEIGQQMFVDLLRTLGNQRLIMQASDGLLLHGQLGERIVNHYSFYAAFTTPEEYRL
FT                   LTGDRTLGTLPLDRPVEVNSLLIFGGRRWTVLDVDAQKKVISLKPATGKKLPQFDGQAG
FT                   RVHDQIRKEMFAVYTEKGIPIFLDAQAKELLGEAREAFDRLSLSNKKILIQGNETYLFC
FT                   WMGDKILDTLVAMLRSKGLTANNYGIAIEISSVSPNKLQSCLRALLKEGVPDAYELARS
FT                   VANKATEKYDNFLTDELLSADYAASKFDAEGAFKVLTSIM"
FT   gene            complement(184780..186126)
FT                   /locus_tag="Ppha_0190"
FT   CDS_pept        complement(184780..186126)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0190"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pmy:Pmen_3425 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42527"
FT                   /db_xref="InterPro:IPR021228"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B4SBA6"
FT                   /protein_id="ACF42527.1"
FT                   /translation="MTTAIRPKERDAIIQSLRAGVVPRLGQHLIQVGRVNEIAALIKDI
FT                   ERIADNGSGIRFVIGEYGSGKTFFLNLVRAIALEKRLVTAHADLNPDRRLHATGGQARS
FT                   LYAELMRNISTRTKPGGGAMPTIVERFITEALKDSKISGNNPESVIHQKLEFLSEMVGG
FT                   YDFAHVIAAYWKGHDTGNEQLKADAIRWLRAEFTTKTDARNALGVRTIIDDGSFYDHLK
FT                   LISRFVRLAGFNGMLICLDELVNLYKLSNVQARNSNYEQILRILNDSLQGTAGGLGFIM
FT                   GGTPDFLMDPRKGLFSYPALQSRLAENSFAVKGLVDYSGPVLRLSNLSPEDFFILLVKI
FT                   RHVFAYGNSPEYLISDEGLKAFMEHCSKRIGDAYFRTPRNTITSFVNLLSVLEQNQHTT
FT                   LQEILGTVEIKPDTNPDFDFIPEESSSFNTSISPTTIIDDEASLASFKL"
FT   gene            complement(186123..190157)
FT                   /locus_tag="Ppha_0191"
FT   CDS_pept        complement(186123..190157)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0191"
FT                   /product="Sel1 domain protein repeat-containing protein"
FT                   /note="PFAM: Sel1 domain protein repeat-containing protein;
FT                   KEGG: psa:PST_3463 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42528"
FT                   /db_xref="GOA:B4SBA7"
FT                   /db_xref="InterPro:IPR006597"
FT                   /db_xref="InterPro:IPR007791"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR025266"
FT                   /db_xref="InterPro:IPR028932"
FT                   /db_xref="InterPro:IPR029024"
FT                   /db_xref="UniProtKB/TrEMBL:B4SBA7"
FT                   /protein_id="ACF42528.1"
FT                   /translation="MGNKLTTGRILIVFIIAFALIKTYWHVFVFMSISAIVIWSIIKAI
FT                   KKIQYSQSLHLHAQNHINDSKSYPNQGEIIISNTTKSHKEIKDLTSIRCKAEDGDAQAE
FT                   YELGMIYDCGYFANGQGIPQDNTEAVKWYRLAANHGHPTAQYNLGWMYYAGAGVEQDYD
FT                   EALRLTQLASENGMPNTQARFDLIKKAKDDYIEEEQWNLLTKKQVHSATLLPSIKYETD
FT                   INIIADKNKITQSSKAITAKYGTKELTTPLTENKFETLIKTEKSTPAKLKSTIDAEILV
FT                   QTQNTKEIAAIKLQIATLLKETIRSYMQSIFSTMRFKEMQTVSQDSPNQGYAPTPSENT
FT                   TKSPETTGIVNTSADKLDAYRRFINNNSIDASSNLPSSFLKNNIEQELIKLEHWFERII
FT                   TFDAPILVSFASLLWHMSIKKLTISEKEAIDIANLLESINIGIEPDSRFSDFIPNPEHN
FT                   VVLFRISENTPKLPSSEYSVATLSLHLASAFALTETTVHISEKQNWKQLLEILPHLSSD
FT                   EIIRLQAHTLFIKTSAQTFSINDIKKNIAIIDQSQKESLWKFLVGIAKLNGCTDITKIK
FT                   NFTRLYTMLGLDALTIPSHTHEIAVEPIAIQTTDFLPSSGYSIPAQQIIAEGISLEMNE
FT                   NEATHTVANAISSKSLTKKIISTDELWVPFGKAIEHSGYTIPDGLLYFGTALKSITKSQ
FT                   EEPSLIDISLPVEKANSDINSNNMRYWPNYSQIHATHRAAYLDWLSTGRKEPMANIGYV
FT                   FLFFYGLERRVLLDNAFSAVDDLPVIIEEVQRLLTVYKNNASFRQYANNFLDILQIIRG
FT                   GVSFYQTEPSLESYSWKQPLIFKVALGQMAADKVPLPAEWALAWVINDPSIQKKTPVKR
FT                   CKLEFLDLFKLQYTEKFNAGMLLIPNKKKLHATYHPASPLFDKDVTIPIADLPDVTNVS
FT                   EESEKIRDLVNECTDKLEDYSRFLGRNPDSNNSLEAMSLLPKLLVKKYVATKFQKLTTW
FT                   LEQQSLSDTPVQVSFQSILELIPPINQNCFGKTEVITVANFLGKINFGIEPDPRFGNFF
FT                   SKQENNIVLFKISDNAPNIPSAEYSASTLVLHLASAVATSDGTVNISEKQQLEKHLEVC
FT                   LHLSSDEKTRLKAHLLFLLSSFPGINNVKKRIELLKQEQRESLGKFLVCIAQADGYIDV
FT                   MEIKILTQIYAMLGLDAQSLYSQAHTAAIEPVVVKTSDFETLPEYSISASPKISNGISL
FT                   DMDKIKTIHAETNTISSILNDIFSENEHEQITTLMSEARRTDVPITGLDPKSFAFMKEL
FT                   ACKLMWTRVELEKLAADHSLMLDGTLESINDASFDHFGDMFFEGDDPIIINAQFAKEIN
FT                   V"
FT   gene            complement(190482..190724)
FT                   /locus_tag="Ppha_0192"
FT   CDS_pept        complement(190482..190724)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0192"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gur:Gura_3956 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42529"
FT                   /db_xref="InterPro:IPR018841"
FT                   /db_xref="InterPro:IPR036782"
FT                   /db_xref="UniProtKB/TrEMBL:B4SBA8"
FT                   /protein_id="ACF42529.1"
FT                   /translation="MEQLLDVITVTTHTNYTLELVFENGERRIFDMKPFFDKKPFTKLF
FT                   NSPLFFKASVQYGTVVWPGNLDIAPETLWRRSVPA"
FT   gene            complement(190736..191005)
FT                   /locus_tag="Ppha_0193"
FT   CDS_pept        complement(190736..191005)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0193"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gur:Gura_3957 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42530"
FT                   /db_xref="InterPro:IPR025427"
FT                   /db_xref="UniProtKB/TrEMBL:B4SBA9"
FT                   /protein_id="ACF42530.1"
FT                   /translation="MPTISMFFGILISIFYGDDEQHHTPHVHARYQGKSVSIAIEDGSL
FT                   LAGNIPHRQLRMVQVWIDIHREELMADWELACAGEEPFRIAPLQ"
FT   gene            complement(191173..191994)
FT                   /locus_tag="Ppha_0194"
FT   CDS_pept        complement(191173..191994)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0194"
FT                   /product="Ribonuclease III"
FT                   /EC_number="3.1.26.3"
FT                   /note="PFAM: ribonuclease III; double-stranded RNA binding
FT                   domain protein; KEGG: cph:Cpha266_2495 ribonuclease III"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42531"
FT                   /db_xref="GOA:B4SBB0"
FT                   /db_xref="InterPro:IPR000999"
FT                   /db_xref="InterPro:IPR011907"
FT                   /db_xref="InterPro:IPR014720"
FT                   /db_xref="InterPro:IPR036389"
FT                   /db_xref="UniProtKB/TrEMBL:B4SBB0"
FT                   /protein_id="ACF42531.1"
FT                   /translation="MSALEKFWEKLRSLADLGDGNETNRSSGAVNTSGTETDLSAETVA
FT                   YLQQLVGEPVSNLPLYQTALTHRSVVHDPATTSLIESNQRLEFLGDSVLGMLISEYLFR
FT                   KFPTSAEGELSSNRAKIVNSKSLAGFARSLCLGDHLILGESADHHKIRSSESALADAFE
FT                   SLIGAIYLDKGIKTAFDFVIRSIIEHVNFNTIVAAEHNYKSRLIEYTQSNHLPPPLYTV
FT                   ITETGAEHEKSFTVGVSCSGELLGTGTAQRKKDAEQLAAKEAMERIHLTLS"
FT   gene            complement(192005..193258)
FT                   /locus_tag="Ppha_0195"
FT   CDS_pept        complement(192005..193258)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0195"
FT                   /product="3-oxoacyl-(acyl-carrier-protein) synthase 2"
FT                   /note="TIGRFAM: 3-oxoacyl-[acyl-carrier-protein] synthase
FT                   2; PFAM: Beta-ketoacyl synthase; KEGG: cch:Cag_1660
FT                   3-oxoacyl-(acyl-carrier-protein) synthase II"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42532"
FT                   /db_xref="GOA:B4SBB1"
FT                   /db_xref="InterPro:IPR000794"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR017568"
FT                   /db_xref="InterPro:IPR018201"
FT                   /db_xref="InterPro:IPR020841"
FT                   /db_xref="UniProtKB/TrEMBL:B4SBB1"
FT                   /protein_id="ACF42532.1"
FT                   /translation="MAQDRKRVVVTGIGVLSPVGLTKEEFWTALHEGKSGAAPITYFDA
FT                   TDFATTFACELKGFKAVDYIDRKAADRMDPYCQYAVIAATHALTDSGLDLKEIDPLRIG
FT                   VVHGSGIGGMTTYDQQFRNYLDRGPRRISPFFIPMLIPDIAAGQISIRHGLMGPNYATA
FT                   SACATSLHAIMDSFMLIQCGMADYMVCGGSEAPITPMSIGGFNSAKALSTANDRPEQAS
FT                   RPYDRDRDGFVMGEGAGSLILESLESAKARGAKIYGEIVGVGATADAYHLTAPHPEGLG
FT                   AVNAMRSAITLAGITPENIDYINTHGTATPLGDLAEIAAIKTLFGEHARKLSISSTKSM
FT                   TGHLLGAAGVVESIACLLAMQHQTVPPTINLDNLDPLVELDVTPNIPKKRSIEYALNNG
FT                   FGFGGHNGSIIFRNGSSL"
FT   gene            complement(193309..193548)
FT                   /locus_tag="Ppha_0196"
FT   CDS_pept        complement(193309..193548)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0196"
FT                   /product="acyl carrier protein"
FT                   /note="TIGRFAM: acyl carrier protein; PFAM:
FT                   phosphopantetheine-binding; KEGG: cte:CT2117 acyl carrier
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42533"
FT                   /db_xref="GOA:B4SBB2"
FT                   /db_xref="InterPro:IPR003231"
FT                   /db_xref="InterPro:IPR006162"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4SBB2"
FT                   /protein_id="ACF42533.1"
FT                   /translation="MTAAEIKDKVYDIIVSKMGVNRDQIKMESKFSDDLGADSLDTVEL
FT                   IMELESEFGVQIPDEDAEKIGTVQQAIDYIVNKK"
FT   gene            complement(193636..194373)
FT                   /locus_tag="Ppha_0197"
FT   CDS_pept        complement(193636..194373)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0197"
FT                   /product="3-oxoacyl-(acyl-carrier-protein) reductase"
FT                   /note="TIGRFAM: 3-oxoacyl-(acyl-carrier-protein) reductase;
FT                   PFAM: short-chain dehydrogenase/reductase SDR; KR domain
FT                   protein; KEGG: plt:Plut_0131
FT                   3-oxoacyl-(acyl-carrier-protein) reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42534"
FT                   /db_xref="GOA:B4SBB3"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR011284"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B4SBB3"
FT                   /protein_id="ACF42534.1"
FT                   /translation="MFEGKIAVVTGSARGIGQAIAFDLAARGADIVVCDIKAEWLTETA
FT                   EGVEKLGRKAYCFELDVTNAEAVQNVFNDIAAATGRIDILVNNAGITRDGLLMRMSEED
FT                   WDAVLTVNLKGTFVCTKAVSRIMMKQRSGSIINIASVVGLMGNAGQANYAASKGGVIAF
FT                   TKSVAKELASRNIRANAVAPGFISSKMTDALSDEVRQKMLDAIPLSSFGTPQDVANAVA
FT                   FLAGEQSSYITGQVISVNGGMVM"
FT   gene            complement(194402..195310)
FT                   /locus_tag="Ppha_0198"
FT   CDS_pept        complement(194402..195310)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0198"
FT                   /product="malonyl CoA-acyl carrier protein transacylase"
FT                   /note="TIGRFAM: malonyl CoA-acyl carrier protein
FT                   transacylase; PFAM: Acyl transferase; KEGG:
FT                   cph:Cpha266_2491 [acyl-carrier-protein]
FT                   S-malonyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42535"
FT                   /db_xref="GOA:B4SBB4"
FT                   /db_xref="InterPro:IPR001227"
FT                   /db_xref="InterPro:IPR004410"
FT                   /db_xref="InterPro:IPR014043"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="InterPro:IPR016036"
FT                   /db_xref="InterPro:IPR020801"
FT                   /db_xref="InterPro:IPR024925"
FT                   /db_xref="UniProtKB/TrEMBL:B4SBB4"
FT                   /protein_id="ACF42535.1"
FT                   /translation="MKAFVFPGQGSQYCGMGRDIFDNFPAARTMMERADSILGYRITDI
FT                   MFSGSEEELRQTKYTQPAIFLHSIAVATLLGRQDIAMTAGHSLGEYSALCFAGSISFDD
FT                   AMRIVAKRGELMQNAGKENPGTMAAIIGMPDSSLEALLAEAGKEGVIQAANFNSPGQVV
FT                   LSGDIAAVKKAIELAPSKGARMAKELVVSGAFHSPLMKPVEEELAAALAEIEIKDAEIP
FT                   VCMNAVATPVTSAAEIRKNLILQLTSSVLWSQSIEAMVQSGMREFIEVGPQKVLQGLIK
FT                   RIDKTVTIRGIDTAADLLPLV"
FT   gene            complement(195348..196337)
FT                   /locus_tag="Ppha_0199"
FT   CDS_pept        complement(195348..196337)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0199"
FT                   /product="3-oxoacyl-(acyl-carrier-protein) synthase III"
FT                   /EC_number="2.3.1.41"
FT                   /note="KEGG: cch:Cag_1664 3-oxoacyl-(acyl carrier protein)
FT                   synthase III; TIGRFAM: 3-oxoacyl-(acyl-carrier-protein)
FT                   synthase III; PFAM: 3-Oxoacyl-[acyl-carrier-protein (ACP)]
FT                   synthase III domain protein;
FT                   3-Oxoacyl-[acyl-carrier-protein (ACP)] synthase III"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42536"
FT                   /db_xref="GOA:B4SBB5"
FT                   /db_xref="InterPro:IPR004655"
FT                   /db_xref="InterPro:IPR013747"
FT                   /db_xref="InterPro:IPR013751"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="UniProtKB/TrEMBL:B4SBB5"
FT                   /protein_id="ACF42536.1"
FT                   /translation="MKAAITATAKYLPANILSNHDLELMLDTNDEWIRARTGISERRVL
FT                   KDPEKATSYMCGEVGKQLLEKRGIAASEIELIIVATMTPDMLFPSTACFTQSIIGASNA
FT                   WAFDINAACSGFLYALNVGSRFIESGAHKKVMVIGADKMSAVIDYTDRSTAILFGDGAG
FT                   GVILEPAKEEGFGILDTRLYADGANGTDHLLMTGGGSRYPASHETVDKKMHYIYQDGKQ
FT                   VFKAAVMAMAEVAGEIMSRNNLTADDIDYLVPHQANQRIINATAERMGIDDKKVISNVA
FT                   RYGNTTAGTIPICLAELDEGQKLHTGSNLVLVSFGAGYTWGGTYIKWQ"
FT   gene            complement(196440..197465)
FT                   /locus_tag="Ppha_0200"
FT   CDS_pept        complement(196440..197465)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0200"
FT                   /product="fatty acid/phospholipid synthesis protein PlsX"
FT                   /note="TIGRFAM: fatty acid/phospholipid synthesis protein
FT                   PlsX; PFAM: fatty acid synthesis plsX protein; KEGG:
FT                   cch:Cag_1665 fatty acid/phospholipid synthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42537"
FT                   /db_xref="GOA:B4SBB6"
FT                   /db_xref="InterPro:IPR003664"
FT                   /db_xref="InterPro:IPR012281"
FT                   /db_xref="UniProtKB/TrEMBL:B4SBB6"
FT                   /protein_id="ACF42537.1"
FT                   /translation="MLTIVVDAMGGDHAPACVIEGTVQALQESGNRFNILLIGQSEKVE
FT                   PLLASYDTSALNLTFLHAPEVVTMEDIPATAVKTKQESSLVKGLQLCKAKQADAFVSAG
FT                   NTGAQMAASLFVLGRLPGVLRPTIYAYFPRLSEGLTNIVDIGANVDCKPEHLVQFAQML
FT                   TIYQRYGAGIEQPLTGLLNIGEEEGKGSEMLKQAYWLLKEADRAGKINFLGNIEGHDIL
FT                   KGKASIVVCDGVVGNTILKFGESIPEFMGILFKRSLEKVMISGQMDEKMAAMTTSLFKG
FT                   LFDPFDVEIFGGVPFLGVDGISIVGHGRSSSRAIKNMIYMAEHMIEKRVNEHIAEVLSE
FT                   K"
FT   gene            complement(197494..197685)
FT                   /locus_tag="Ppha_0201"
FT   CDS_pept        complement(197494..197685)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0201"
FT                   /product="ribosomal protein L32"
FT                   /note="TIGRFAM: ribosomal protein L32; PFAM: ribosomal L32p
FT                   protein; KEGG: cph:Cpha266_2488 50S ribosomal protein L32"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42538"
FT                   /db_xref="GOA:B4SBB7"
FT                   /db_xref="InterPro:IPR002677"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4SBB7"
FT                   /protein_id="ACF42538.1"
FT                   /translation="MANPKAKMSKSRRDKRRAQFNARTKPATTVNCPNCGEPTLPHRAC
FT                   RHCGHYRGRCVVNKLAKS"
FT   gene            complement(197704..198243)
FT                   /locus_tag="Ppha_0202"
FT   CDS_pept        complement(197704..198243)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0202"
FT                   /product="protein of unknown function DUF177"
FT                   /note="PFAM: protein of unknown function DUF177; KEGG:
FT                   cph:Cpha266_2487 protein of unknown function DUF177"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42539"
FT                   /db_xref="InterPro:IPR003772"
FT                   /db_xref="UniProtKB/TrEMBL:B4SBB8"
FT                   /protein_id="ACF42539.1"
FT                   /translation="MHKEKSLIEIGLVTLVEGTNEFHFTCNAADFAGRQLAEAGFTREI
FT                   ALHVIAEKSADEITITINTSTLADFTCDICLAPVSKNLTGTLVLSYIFGTAHDADHEGD
FT                   EDYSRLDRNAESIDITGEVCETLLLSLPMKVTCTDNPDCRLYGSTGYMEENEEPQSGTN
FT                   TLWHESLEKLKKNIVN"
FT   gene            198415..198486
FT                   /locus_tag="Ppha_R0013"
FT                   /note="tRNA-Asn1"
FT   tRNA            198415..198486
FT                   /locus_tag="Ppha_R0013"
FT                   /product="tRNA-Asn"
FT   gene            198678..198839
FT                   /locus_tag="Ppha_0203"
FT   CDS_pept        198678..198839
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0203"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42540"
FT                   /db_xref="UniProtKB/TrEMBL:B4SBB9"
FT                   /protein_id="ACF42540.1"
FT                   /translation="MYVFVSVFFIFSESDLSHLLNFCADMRATNLKNLLLSLALLLLSI
FT                   VAPEGGVF"
FT   gene            198936..200618
FT                   /locus_tag="Ppha_0204"
FT   CDS_pept        198936..200618
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0204"
FT                   /product="2-isopropylmalate synthase"
FT                   /note="TIGRFAM: 2-isopropylmalate synthase; PFAM: pyruvate
FT                   carboxyltransferase; LeuA allosteric (dimerisation) domain;
FT                   KEGG: cph:Cpha266_2478 2-isopropylmalate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42541"
FT                   /db_xref="GOA:B4SBC0"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR002034"
FT                   /db_xref="InterPro:IPR005668"
FT                   /db_xref="InterPro:IPR013709"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR036230"
FT                   /db_xref="InterPro:IPR039371"
FT                   /db_xref="UniProtKB/TrEMBL:B4SBC0"
FT                   /protein_id="ACF42541.1"
FT                   /translation="MKKMKYRKYAAYPSVAITARSWPDKSITKAPIWCSVDLRDGNQAL
FT                   PVPMSVEEKVTMFQLLVSIGFKEIEVGFPSASATEFAFARRLIEERLIPDDVTIQVLTQ
FT                   AREHLIRKTFDAISGAKHAIVHLYNSTSTLQRDVVFRKNREEIKAIAVEGTALVRRLKD
FT                   ESGNAGIRFEYSPESFTGTELDYALDVCHAVMDTWGASADEKIILNLPSTVEMSQPNIY
FT                   ADRIEWFCRNIKARDAVLISVHAHNDRGTAVATAELAVMAGADRVEGALFGNGERCGNM
FT                   DVVIMALNLFSQGVDPELDFSDLPRIREVYRRCTRMDIHPRNPYSGELVYTAFSGSHQD
FT                   AISKGMKAQPLSPGGLWAVPYLPIDPQDVGCNYEAIVRINSQSGKGGVAYVLEKEYGIQ
FT                   IPKWMQPDFAEVVQAVADTTGVELSVEQIHDLFHAEYVKLRQPITLKKCQISWDDEEPR
FT                   RQDEEDTTISCIVQTREKEFNFTAQGNGPLDAFVKGFVRESGVDFSVDEYAEHAIGRSA
FT                   GALAIAYIKIGCTDGRVSFGAGIDSNISLASIKATVSALNRLP"
FT   gene            200775..201677
FT                   /locus_tag="Ppha_0205"
FT   CDS_pept        200775..201677
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0205"
FT                   /product="periplasmic solute binding protein"
FT                   /note="PFAM: periplasmic solute binding protein; KEGG:
FT                   cph:Cpha266_2476 periplasmic solute binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42542"
FT                   /db_xref="GOA:B4SBC1"
FT                   /db_xref="InterPro:IPR006127"
FT                   /db_xref="InterPro:IPR006128"
FT                   /db_xref="UniProtKB/TrEMBL:B4SBC1"
FT                   /protein_id="ACF42542.1"
FT                   /translation="MVRFVIKCIAVLPLLLFFAGCVQPARRGKLQVVASIAPLSYFAER
FT                   IGGSHVSVSVMVPPGGNPHSYEPAPRQMVKLGEATLFIKAGSGVEFELDWMDRFLSINR
FT                   ELRVCNGAEGVRLIPIKHHDEQETHHHEQDAHHHEGYDPHYWLSPANGVIIARNIEKAL
FT                   VLADPAHRDDYAVNCSKLVAELQALDREIRQKVASLKSRRFLVFHPAWGYYAEAYQFEQ
FT                   IAVEEEGKTLTPGQMQRVIEKAKANHIKVVFVSPQFNISQAKTIAAEIGGVTRSVDPLA
FT                   ADYQENLRSATQAFSESLP"
FT   gene            201674..202342
FT                   /locus_tag="Ppha_0206"
FT   CDS_pept        201674..202342
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0206"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: cph:Cpha266_2475 ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42543"
FT                   /db_xref="GOA:B4SBC2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B4SBC2"
FT                   /protein_id="ACF42543.1"
FT                   /translation="MTTPVIECNRLSVELGGVMVLDGVTLSVCKGDYLGLVGPNGGGKT
FT                   TLLRVILGLEKSSGGSVSVFGALPGSFPERIGYVPQRLFFDREFPISVRELVLMGRLSK
FT                   KKLFQHFNRIDREKADAALGVAGLERLADRRIGTLSGGELQRTLIARALAGEPELLLLD
FT                   EPTASVDPQMKTTIYDLLDNQKKKLTIVLVSHDIGGIKDHVSGIATLNTTLYAPRDICL
FT                   "
FT   gene            202317..203138
FT                   /locus_tag="Ppha_0207"
FT   CDS_pept        202317..203138
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0207"
FT                   /product="ABC-3 protein"
FT                   /note="PFAM: ABC-3 protein; KEGG: cch:Cag_1676 ABC 3
FT                   transport family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42544"
FT                   /db_xref="GOA:B4SBC3"
FT                   /db_xref="InterPro:IPR001626"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:B4SBC3"
FT                   /protein_id="ACF42544.1"
FT                   /translation="MLQEIFAFEFMRNALLAALLSSVACGVIGTYVVVKKIGFISGGIA
FT                   HTAFGGIGLGYYLGINPLLGVIPFSLAAALAIGLLSKKGKVAEDTAIGTFWAVGMAVGV
FT                   LFIGLKPGYAPDLFSYLFGNILTVPSFDLWMILLLDLLILAVVWLLSKEFLAISFDEEY
FT                   AAVSGLQTTALYLVMLCLIALTVVVMVRVVGIVMVIALLTIPAAIARMLSRSLPGMMVR
FT                   AVVLSALFSILGLWLSFLLDIASGATIILVAGFSFFLAQGWRFVSTFLRGR"
FT   gene            complement(203280..203450)
FT                   /locus_tag="Ppha_0208"
FT   CDS_pept        complement(203280..203450)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0208"
FT                   /product="Ric1 protein"
FT                   /note="KEGG: plt:Plut_0144 Ric1 protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42545"
FT                   /db_xref="GOA:B4SBC4"
FT                   /db_xref="InterPro:IPR000612"
FT                   /db_xref="UniProtKB/TrEMBL:B4SBC4"
FT                   /protein_id="ACF42545.1"
FT                   /translation="MDIRRWILAVVLPPAAVTNKEAGTIMLTGLLTLFGWLPGAAFAIF
FT                   MMLQEQRQVKA"
FT   gene            203662..203970
FT                   /locus_tag="Ppha_0209"
FT   CDS_pept        203662..203970
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0209"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: plt:Plut_0145 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42546"
FT                   /db_xref="UniProtKB/TrEMBL:B4SBC5"
FT                   /protein_id="ACF42546.1"
FT                   /translation="MLNKVHPDVVLDDVDEVIDEPNFNNHNTSPDPPSPYADLEKKYRK
FT                   NRFNKNRSKTSSDLFGVNGAGKHPASKSVDGNRLQKRKPKKKAFSKASRVTSGKRNP"
FT   gene            204073..204903
FT                   /locus_tag="Ppha_0210"
FT   CDS_pept        204073..204903
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0210"
FT                   /product="glycerophosphoryl diester phosphodiesterase"
FT                   /note="PFAM: glycerophosphoryl diester phosphodiesterase;
FT                   KEGG: cph:Cpha266_2470 glycerophosphoryl diester
FT                   phosphodiesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42547"
FT                   /db_xref="GOA:B4SBC6"
FT                   /db_xref="InterPro:IPR017946"
FT                   /db_xref="InterPro:IPR030395"
FT                   /db_xref="UniProtKB/TrEMBL:B4SBC6"
FT                   /protein_id="ACF42547.1"
FT                   /translation="MAFEIQAHRGGRALFPENTLHAFCHAASLGIRVLELDLVVSKDHQ
FT                   ILVSHDPWLSAPLCADAHGHQLSAEDRFRYIIYEMNSADIASFDCGLPHPSFPGQLRVA
FT                   SFKPPLATVFREVDSYIVSSGMKGEMIYNLEIKSWPDKDDLFHPPPDQYAALVVQLIET
FT                   AGLSLRVRIQSFDERVIRAAWRVNPRLCYGLLIEERHNPDRLMLELGFVPRYVNPHFSL
FT                   VEREMTEAFHEKGIGMIPWTVNRREEMLAMKSLGAEGIITDYPERAIALFGLPD"
FT   gene            complement(204933..206276)
FT                   /locus_tag="Ppha_0211"
FT   CDS_pept        complement(204933..206276)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0211"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cph:Cpha266_2467 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42548"
FT                   /db_xref="GOA:B4SBC7"
FT                   /db_xref="InterPro:IPR025738"
FT                   /db_xref="UniProtKB/TrEMBL:B4SBC7"
FT                   /protein_id="ACF42548.1"
FT                   /translation="MATGFARYRYRPFLLLILALLCVPAFAGASKVLETEPFLASSINN
FT                   DHPFVGQEVLLTYRLYFNTDAPKISDEVAPSLQGVWASETKTERFIRSIPVTIQGKQFR
FT                   SAVIKQFKVVPIQSGKITLSGYSMLCTIPQDNVAMDGKVLPDNRFRITAPALTISVHAL
FT                   PEPVPDKLSGAVGLFSLNLMADKQKLKTGEPLSLKLTLAGTGSLLTLELPSLLIHESFR
FT                   RNPPERKTILSKESELTSGTIISTMVVWPQSKGVFQITATPLVVFNPETKRFSTLYAQP
FT                   LTITVDSTAQQATADESAPLNTSTEKKKTITSIFIAIALLIVMSSAAIVLVRKKRLMDA
FT                   KRVLAENKSEQPEASGKSARTMKEQLFTLLEEAGIKSPGGMTRTELNDAMQEIKIPDET
FT                   RSELPVVLDSLDRILYSPSREKESRIPDWITTKVEALLRALKKAGSSR"
FT   sig_peptide     complement(206193..206276)
FT                   /locus_tag="Ppha_0211"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.969 at
FT                   residue 28"
FT   gene            complement(206282..207112)
FT                   /locus_tag="Ppha_0212"
FT   CDS_pept        complement(206282..207112)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0212"
FT                   /product="pyrroline-5-carboxylate reductase"
FT                   /EC_number="1.5.1.2"
FT                   /note="KEGG: plt:Plut_0150 delta 1-pyrroline-5-carboxylate
FT                   reductase; TIGRFAM: pyrroline-5-carboxylate reductase;
FT                   PFAM: NADP oxidoreductase coenzyme F420-dependent"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42549"
FT                   /db_xref="GOA:B4SBC8"
FT                   /db_xref="InterPro:IPR000304"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR028939"
FT                   /db_xref="InterPro:IPR029036"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B4SBC8"
FT                   /protein_id="ACF42549.1"
FT                   /translation="MLFSFIKNNFMNDLHIGFVGTGRIARALIAGLSQREGTFLAGFDK
FT                   EPAALASIAADYPVLPCLSIIELALKSQVIILAVKPYQMEEVLGELKPVLGAKHLLISV
FT                   AAGISSEFIRKFAQAETRVIRVMPNTPAFVGKGMTALCRGKMATDEDLLLASDLFRSIG
FT                   QVAILDESQMDAATALSGSGPAYMFHILDALAEGGVQCGLSPAEALLLGAQTMIGAATM
FT                   VLSGQKSPAELKRDVTTPGGTTEAGLKVMDEKNIRQILVETVAAAAARSRELMK"
FT   gene            complement(207411..207746)
FT                   /locus_tag="Ppha_0213"
FT   CDS_pept        complement(207411..207746)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0213"
FT                   /product="cytochrome c class I"
FT                   /note="PFAM: cytochrome c class I; KEGG: cch:Cag_0917
FT                   cytochrome c-555"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42550"
FT                   /db_xref="GOA:B4SBC9"
FT                   /db_xref="InterPro:IPR002323"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:B4SBC9"
FT                   /protein_id="ACF42550.1"
FT                   /translation="MSRFLSAAFCALFVFSMSSTDAQAAYNAAAGKTVYDANCSTCHKT
FT                   GIMGAPKTGDKAVWAPRLSLGEAVLVSKSIKGFTGKKGMMPAKGGNPKLTDAQVGNAVA
FT                   FMIQQSK"
FT   sig_peptide     complement(207672..207746)
FT                   /locus_tag="Ppha_0213"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.697 at
FT                   residue 25"
FT   gene            complement(207979..208413)
FT                   /locus_tag="Ppha_0214"
FT   CDS_pept        complement(207979..208413)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0214"
FT                   /product="cytochrome c class I"
FT                   /note="PFAM: cytochrome c class I; KEGG: cph:Cpha266_2463
FT                   cytochrome c, class I"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42551"
FT                   /db_xref="GOA:B4SBD0"
FT                   /db_xref="InterPro:IPR002323"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:B4SBD0"
FT                   /protein_id="ACF42551.1"
FT                   /translation="MKPFLPFLTVGLFFLGACGLEKPPASLEFPEAKTDAAPVAAPAAA
FT                   PVAEPVKEEAPADPKLAAGKTIYDTNCAACHDAGMMGAPKPGDKAAWSARIAQGVEVMA
FT                   KKSIDGFTGKAGMMPAKGGNASLTDEEVTNAVAFMADKSK"
FT   sig_peptide     complement(208354..208413)
FT                   /locus_tag="Ppha_0214"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.691) with cleavage site probability 0.622 at
FT                   residue 20"
FT   gene            complement(208478..209929)
FT                   /locus_tag="Ppha_0215"
FT   CDS_pept        complement(208478..209929)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0215"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: Radical SAM domain protein; SMART: Elongator
FT                   protein 3/MiaB/NifB; KEGG: cph:Cpha266_2462 radical SAM
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42552"
FT                   /db_xref="GOA:B4SBM7"
FT                   /db_xref="InterPro:IPR006158"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR034466"
FT                   /db_xref="UniProtKB/TrEMBL:B4SBM7"
FT                   /protein_id="ACF42552.1"
FT                   /translation="MPRQKNVLLVFLPSESGVDGARSLYDEKRSNPLLRSFNHSLRSLI
FT                   KQSQFAIPPLSLMILSSLDVPGVEQSICDMRFEEFPFDKTWDLVGISVQTGMARKAFTL
FT                   ADQLRSRGIAVVLGGAHVTLFTDSCKPHADVLVLGEADDLWKEVLTDLTTERLKPLYQS
FT                   ANFPDLNISRPVSKRSLVKNRYFTTNLIQTGRGCQYNCDFCNVHLLNGHTLRRRAIADV
FT                   VSEVERFKLHDQRIFFFVDDSINADPLYAQELFRQLIPLKIRWFGQSTTTLGQQHELLE
FT                   TFARSGCQALLVGIESIEAKSRHAHKKNQNRAGELVCAIKNIREAGISLYGSFIYGLDG
FT                   DTLDTPAAILDFINQTKLDVPGINILRPIPGTKVFERLREEGRLLFDPLDVTAYRYSFG
FT                   QEMLYQPKNIPLDAFVESYSLLTRQVFSIKNALIRGVRAPQAKSAVMLFNLFYAHLYRL
FT                   SRHDLQQQMEKKHTKKPFCHTPNNF"
FT   gene            complement(209938..210603)
FT                   /locus_tag="Ppha_0216"
FT   CDS_pept        complement(209938..210603)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0216"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cch:Cag_0105 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42553"
FT                   /db_xref="InterPro:IPR011716"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:B4SBM8"
FT                   /protein_id="ACF42553.1"
FT                   /translation="MMLLHTLLLVFALAPSMQEMLGEYRLRLKADAFYERHAYSRAETV
FT                   YRELAALPEQNERGVASFNLACALYMQGKYPEAATLFALRSKAEGRQKELGVKAIFNEG
FT                   NTLAMKAIGSNGKAEKKILFRQSLNRFKTVLLTDPDEGDAKINYEIVRRYLYELEQSEH
FT                   PSSSSSGKKSASPPPSGISNDSAERLLDHARQDETALMRHLPLRTKSTAQGSKNNRDW"
FT   gene            complement(210624..211763)
FT                   /locus_tag="Ppha_0217"
FT   CDS_pept        complement(210624..211763)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0217"
FT                   /product="Serine--glyoxylate transaminase"
FT                   /EC_number="2.6.1.45"
FT                   /note="PFAM: aminotransferase class V; KEGG:
FT                   cph:Cpha266_2460 serine--glyoxylate transaminase"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42554"
FT                   /db_xref="GOA:B4SBM9"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR024169"
FT                   /db_xref="UniProtKB/TrEMBL:B4SBM9"
FT                   /protein_id="ACF42554.1"
FT                   /translation="MKKRLFTPGPTPVPENVMLRMAAPIIHHRNPEFMEILTRVHADLK
FT                   YLFRTTQPVVVLSCSGTGGMEATISSIFKQGDKVITINAGKFGERWGELVRVFTGNCVE
FT                   EKVAWGSAIQPERMAELLKEHPDAKAVCLTHSETSTGTAADIKTLSALIREESDALVLV
FT                   DGITAVGAHEFHFDDWGVDVCITGSQKGLMMPPGLALVAISERAQDIIKGQSGMPQYYM
FT                   SLKKALKAHAGDDTPFTPAVSLVIGLDEALQMIKAEGIENIWKRHESLANACRQGCNAL
FT                   GMKLFSNSPSFAVTPVWIPEGVKWSAFNKALKNSNGITVAAGQDEYKDKIFRISHLGFY
FT                   DELDMLTVIGGIERALKEINFDFEIGAGVSAVQKAFLGN"
FT   gene            complement(211781..212884)
FT                   /locus_tag="Ppha_0218"
FT   CDS_pept        complement(211781..212884)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0218"
FT                   /product="carbamoyl-phosphate synthase, small subunit"
FT                   /note="TIGRFAM: carbamoyl-phosphate synthase, small
FT                   subunit; PFAM: glutamine amidotransferase class-I;
FT                   Carbamoyl-phosphate synthase small chain; KEGG:
FT                   pvi:Cvib_0222 carbamoyl phosphate synthase small subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42555"
FT                   /db_xref="GOA:B4SBN0"
FT                   /db_xref="InterPro:IPR002474"
FT                   /db_xref="InterPro:IPR006274"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR035686"
FT                   /db_xref="InterPro:IPR036480"
FT                   /db_xref="UniProtKB/TrEMBL:B4SBN0"
FT                   /protein_id="ACF42555.1"
FT                   /translation="MQPTAAKLVLENGSVYHGTAFGHIGETTGEVVFNTSHTGYQEILT
FT                   DPSYAGQMVMMTYPLIGNYGINPTDNESEKIWASAFIVHEVSRVHSNFEATESLDSCLK
FT                   RAGVMGLAGIDTRKLVREIREKGAMRGVISALETDDEKLRETALQSPEMSGRDLVKTVT
FT                   AKENYTLEKENARYHVAALDYGIKTNILRMLQDAGCRITVLKAGTSADEIIQLNPDGVF
FT                   LSNGPGDPSAVGYAIETIKQLVDYNRTTKPLPIFGICLGHQLLSLAFGAETYKLKFGHH
FT                   GSNHPVKNLASNQIEITSQNHGFAVEMESLPDELEMTHLNLYDNTVEGVKHRHLPCFSV
FT                   QYHPEAAPGPHDSHYLFAEFTSLMDLT"
FT   gene            complement(212893..213249)
FT                   /locus_tag="Ppha_0219"
FT   CDS_pept        complement(212893..213249)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0219"
FT                   /product="preprotein translocase, YajC subunit"
FT                   /note="TIGRFAM: preprotein translocase, YajC subunit; PFAM:
FT                   YajC family protein; KEGG: plt:Plut_0157 YajC"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42556"
FT                   /db_xref="GOA:B4SBN1"
FT                   /db_xref="InterPro:IPR003849"
FT                   /db_xref="UniProtKB/TrEMBL:B4SBN1"
FT                   /protein_id="ACF42556.1"
FT                   /translation="MHNFIQPLLLFAPPVAGQAAPNPLIQIVPLVLIFIVFYFFMIRPQ
FT                   QKKQKDREKVLDSLKRGDKVVTIGGAHGTVAGIDTEKKTVLVQVSETTKIKFDRTAIAN
FT                   IEKQETSDKLTTKE"
FT   sig_peptide     complement(213190..213249)
FT                   /locus_tag="Ppha_0219"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.902) with cleavage site probability 0.884 at
FT                   residue 20"
FT   gene            complement(213327..214379)
FT                   /locus_tag="Ppha_0220"
FT   CDS_pept        complement(213327..214379)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0220"
FT                   /product="metalloendopeptidase, glycoprotease family"
FT                   /EC_number="3.4.24.57"
FT                   /note="KEGG: cph:Cpha266_2457 O-sialoglycoprotein
FT                   endopeptidase; TIGRFAM: metalloendopeptidase, glycoprotease
FT                   family; PFAM: peptidase M22 glycoprotease"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42557"
FT                   /db_xref="GOA:B4SBN2"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR017861"
FT                   /db_xref="InterPro:IPR022450"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4SBN2"
FT                   /protein_id="ACF42557.1"
FT                   /translation="MNILGIETSCDETSGAVLCSGQVRSNVVSSQRCHAHFGGVVPELA
FT                   SREHERLIVSIVDAAVTEANITKNDLDVIAATAGPGLIGAVMVGLCFAQGMAYALQIPF
FT                   VPVNHIEAHIFSPFIQEDPFHSSPEGAFVSLTVSGGHTLLSVVEPDLSYSVIGRTLDDA
FT                   AGEAFDKTGKMLGLPYPAGPVIDKLAEKGDPAFHLFPRALTSKSQTSKNYLGNFDFSFS
FT                   GLKTSVLTWLQKQSAEFIEHHKADIAASIQYAIVSVLVEKTIAAARSRGIKSVSIAGGV
FT                   SANSALRRAMKEACKREGITLHVPGTVYSTDNAAMIATLAALKLSRGMKAECCYNIAPY
FT                   ASFAAGSRMA"
FT   gene            214404..214631
FT                   /locus_tag="Ppha_0221"
FT   CDS_pept        214404..214631
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0221"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cch:Cag_0110 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42558"
FT                   /db_xref="GOA:B4SBN3"
FT                   /db_xref="UniProtKB/TrEMBL:B4SBN3"
FT                   /protein_id="ACF42558.1"
FT                   /translation="MGKANNPGNNSKQREKVSAFHVLLILVGANIMLLMAPDLGLLNSM
FT                   LYIPDLYTWSATAIGFALLILGFRGFMKKI"
FT   gene            214732..215730
FT                   /locus_tag="Ppha_0222"
FT   CDS_pept        214732..215730
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0222"
FT                   /product="ATPase associated with various cellular
FT                   activities AAA_3"
FT                   /note="PFAM: ATPase associated with various cellular
FT                   activities AAA_3; ATPase associated with various cellular
FT                   activities AAA_5; KEGG: cph:Cpha266_2455 ATPase associated
FT                   with various cellular activities, AAA_3"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42559"
FT                   /db_xref="GOA:B4SBN4"
FT                   /db_xref="InterPro:IPR011703"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041628"
FT                   /db_xref="UniProtKB/TrEMBL:B4SBN4"
FT                   /protein_id="ACF42559.1"
FT                   /translation="MQHAVELEELGEQITEASRFLEKTREQLSQRIIGQHEVISRIFIA
FT                   MLVNGHILLEGVPGLAKTLIIRTFAAAMNLKFQRIQFTPDMLPADLIGTMIYNPKDMEF
FT                   YPRKGPVFANVILADEINRSPAKVQSALLEAMQEHQVTIGSQTFPLQEPFMVLATQNPI
FT                   EHEGTYILPEAQVDRFMMKVLVDYPSYDEELEIMLQSATTVSELPVIPVVQPHDISRAR
FT                   ALIDRIYVDPRVQRYIVDLVVATRKPAQYGMAELEAMIEYGASPRASIFLLLAAKAHAF
FT                   LQHRPYITPEDVKTIAYDTLRHRIRPGYEAEADNIKPDDIIRQILQHVQVP"
FT   gene            215746..216654
FT                   /locus_tag="Ppha_0223"
FT   CDS_pept        215746..216654
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0223"
FT                   /product="protein of unknown function DUF58"
FT                   /note="PFAM: von Willebrand factor type A; protein of
FT                   unknown function DUF58; KEGG: cph:Cpha266_2454 protein of
FT                   unknown function DUF58"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42560"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR002881"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:B4SBN5"
FT                   /protein_id="ACF42560.1"
FT                   /translation="MSTEKSVEKSEEHLKELQNIIRRVEIRSKRMASELFSGEYHSSFK
FT                   GKGIEFSNVREYQYGDDVRSIDWNTSARKHELYVKLFTEERERSLLLVVDASASMLFGS
FT                   REHSKKEVALEVSAVLAFSALQNNDKVGLLVFTDRVETYIPPRKGRHHVLVILEELIRM
FT                   KPGNSATNINAALSFVRYTRQRQEIIFLLTDLVDSDYEKGMKLLNTRHDFILVHISDPL
FT                   DKALPLSSLLDIEEPETGMRLTLDGGSRREIEHYRSVQCKHYEELRHRLRRMRIDSLFL
FT                   DTDRSFIGDLNSFFQHRERKV"
FT   gene            216713..217606
FT                   /locus_tag="Ppha_0224"
FT   CDS_pept        216713..217606
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0224"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cch:Cag_0113 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42561"
FT                   /db_xref="GOA:B4SBN6"
FT                   /db_xref="UniProtKB/TrEMBL:B4SBN6"
FT                   /protein_id="ACF42561.1"
FT                   /translation="MVLSSSFSSAAETVQPTITVKVNPDTVLVGDRMHYTIRVRHSEQE
FT                   VASLEGFDRSGTSAEQPFELISRKHVATTPFSGAAEDLFAFEFGVFGAGHQSIPSFTVV
FT                   IRDTKGKIAQKINYRPATTLFVRALTDSSMRELRPIKPPLKPSIPSVLIMGLFFGAFGI
FT                   AGMVLLLLFLLKRTVRNSAERIDSGQVAQRKLKKLGSSLSAGMPPHECYEELSNIMRTF
FT                   LENHYRISALEAVTQEIERDLKKLGVAGFESIMNLLKQADLVKFADSRPDAEESRQSLN
FT                   KASEVIRSARSSKAEG"
FT   gene            complement(217743..218207)
FT                   /locus_tag="Ppha_0225"
FT   CDS_pept        complement(217743..218207)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0225"
FT                   /product="peptidoglycan-associated lipoprotein"
FT                   /note="TIGRFAM: peptidoglycan-associated lipoprotein; PFAM:
FT                   OmpA/MotB domain protein; KEGG: cph:Cpha266_0860 OmpA/MotB
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42562"
FT                   /db_xref="GOA:B4SBN7"
FT                   /db_xref="InterPro:IPR006664"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR014169"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="InterPro:IPR039001"
FT                   /db_xref="UniProtKB/TrEMBL:B4SBN7"
FT                   /protein_id="ACF42562.1"
FT                   /translation="MKSLMRSLFIPAMLFLGACCCGEDVVVAPAAAPPPPPPPPIQIIL
FT                   PGLGDLFYDFDKSDLRADAVEQLKTNANWMQVFKNNSVIIEGHCDERGTNEYNLALGER
FT                   RANSARNYTINLGIDPVRLKTVSYGEEKPFATGSTEEAWAQNRRAHFVAE"
FT   sig_peptide     complement(218139..218207)
FT                   /locus_tag="Ppha_0225"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.932) with cleavage site probability 0.733 at
FT                   residue 23"
FT   gene            complement(218314..219063)
FT                   /locus_tag="Ppha_0226"
FT   CDS_pept        complement(218314..219063)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0226"
FT                   /product="surface antigen msp4 family protein"
FT                   /note="PFAM: surface antigen msp4 family protein; KEGG:
FT                   cph:Cpha266_0396 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42563"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="InterPro:IPR027385"
FT                   /db_xref="UniProtKB/TrEMBL:B4SBN8"
FT                   /protein_id="ACF42563.1"
FT                   /translation="MKKTLALLVLLAVTGVASTPVQAATHYISGMGGISRMNNMTPEES
FT                   YQGAGGNSNSNFDLGSGVNALGAIGCDYGNYRLEGEVGYQQNTLKSGISNMDNVLQYYP
FT                   QEGSRYDMRGDVSTLSLMGNGYYDVHLGGGVDFYATAGVGIAQVSFHDMNFSYNYDPVT
FT                   NALYDNPNPGYNDHATTLAYQLGAGLAFPLSQNVKLDLRYRYFATTDFTYTNDWVDASS
FT                   SSNTPVASGINSNIVSHSALLGLRVEF"
FT   sig_peptide     complement(218992..219063)
FT                   /locus_tag="Ppha_0226"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 24"
FT   gene            219500..219664
FT                   /locus_tag="Ppha_0227"
FT   CDS_pept        219500..219664
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0227"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42564"
FT                   /db_xref="UniProtKB/TrEMBL:B4SBN9"
FT                   /protein_id="ACF42564.1"
FT                   /translation="MPRAYAREELGVGVTCLFSDVPVDLFAEIAPVLDVTPDVHLNVNG
FT                   AIGIHYYLH"
FT   gene            219689..220045
FT                   /locus_tag="Ppha_0228"
FT   CDS_pept        219689..220045
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0228"
FT                   /product="histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   KEGG: dol:Dole_1520 PAS/PAC sensor hybrid histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42565"
FT                   /db_xref="GOA:B4SBP0"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B4SBP0"
FT                   /protein_id="ACF42565.1"
FT                   /translation="MALVLDAVYCRSHSEALPGEYVQLVVRDNGRGIDKETIKSIFEPF
FT                   FTTKPMTESSGFGLSTVHGIVRQNNGFIEVFSRDGEGTTFEIYIPRCCVEVHGSSPAKE
FT                   SFEELVDGETILSS"
FT   gene            220139..223555
FT                   /locus_tag="Ppha_0229"
FT   CDS_pept        220139..223555
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0229"
FT                   /product="MCP methyltransferase/methylesterase, CheR/CheB
FT                   with PAS/PAC sensor"
FT                   /EC_number="3.1.1.61"
FT                   /EC_number="2.1.1.80"
FT                   /note="KEGG: cch:Cag_0563 putative PAS/PAC sensor protein;
FT                   TIGRFAM: PAS sensor protein; PFAM: CheB methylesterase; MCP
FT                   methyltransferase CheR-type; PAS fold-4 domain protein; PAS
FT                   fold domain protein; SMART: PAS domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42566"
FT                   /db_xref="GOA:B4SBP1"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000673"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR000780"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR022641"
FT                   /db_xref="InterPro:IPR022642"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR035909"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:B4SBP1"
FT                   /protein_id="ACF42566.1"
FT                   /translation="MVYALKLMRIMTKEPSGNLKAKKLDGVTLKAANNCFPIVGIGASA
FT                   GGLEALEIFLKNVPSRCGIAFVIVQHLDPTHKGIMVELLQRVTDIPVVQVRDRLKIEPD
FT                   HVYVIPPNKDMSLLHGVLHLLAPVEPRGLRLPIDFFFRSLADDLQQQSIGVILSGMGSD
FT                   GSHGLRAIKENGGGVFVQAPSSAKFDGMPRSAIEAGRVDVIAPVEELPAKIITYLRHFP
FT                   LLPLQQDPPLEERALSGLEKVVILLRTHTGQDFSLYKKSTIYRRIERRMGIHQIEKIAD
FT                   YVRFLQENPHETDLLFKELLIGVTSFFRDPAVWEILKLKAIPALLAAHPAGGVLRAWVV
FT                   GCSSGEEAYSLAIIFKEAVASVKPLGNFKLQIFATDLDKDAIDKARTGCFPLNISAEVS
FT                   TERLQRFFERDNNSYRILREIRETVVFAPQNVIMDPPFTKLDILVCRNLLIYMEPELQK
FT                   KLFPLFHYTLNPGGILFLGSAESLGSFTSLFKPIDGKTRLFSKLHHGVRPEPLALPFSF
FT                   AHSLPVPQDVAIDQPKSKSSAINLQSMTDQFLLEHYTPAAVLTNDKGDIIYISGHTGKY
FT                   LEPAAGKANWNIFAMAREGLRYELNLMFGNALRQQGVATKRGLSVSSNGETQAVNLTIR
FT                   LLEKPDALHGLVLIVFSDVERVVGGTLRDPALSVDRGGARQKLLEQELSQARDEILSIR
FT                   EEMQTSQEELKSTNEEMQSANEELQSTNEELTTSKEEMQSMNEELQTVNHELQSKVSDL
FT                   SQANNDMKNLLNSTDIATLFLDDALNIRRFTTRTAAIIKLIASDVGRPITDIVTELHYP
FT                   ALADDAREVLHTLVYSEKQVSASNGRWFSVKIMPYRTQENRIVGLVITFSDISVAKKLE
FT                   ESLRESEERLRAAIESSGIIVAAVDKEFRYIWFYDPRHMFHASTSIGMRDEELPGMQNA
FT                   AELMEIRQKVIATGESVHRDLMLKQADGCRSFYTLIARPLRDAGGNVIGVITVAADNTA
FT                   RKEAEVAQKESEDRFRLLFDAIPEGALLLDAKGRIIMVNPEAERILGFSREEMQGKTSS
FT                   ELRWKIVREDGSDFPFEEHPAFVALRTAQPVRGVIIGVFQPGHNHCRWIRINAQPWFQA
FT                   GMEAPFQVYMTFVDIKSFRSCPEIKQEENPS"
FT   gene            223552..224529
FT                   /locus_tag="Ppha_0230"
FT   CDS_pept        223552..224529
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0230"
FT                   /product="putative PAS/PAC sensor protein"
FT                   /note="KEGG: cch:Cag_0562 putative PAS/PAC sensor protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42567"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR027395"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B4SBP2"
FT                   /protein_id="ACF42567.1"
FT                   /translation="MTRKRAPLVDLSILRRQAEAQLIAGRKKHLDVTASPDEMQRIIHE
FT                   LAVYQIELEMQQDELLQTRLELEESLDCYTELYDFAPLGYLTLDREGVIRKVNLSGSKL
FT                   IGIDRSHLIGDRLGGFILAEDLPGYNAMLERVFSSRDHASCEVILQRDGTSSSFDPFIS
FT                   GTTDVLHSRTVRIDAVVSNDGQECRAVISDISMQKQVERENKALMERLIQARRTKSIDQ
FT                   PGGESTGNFNHQLLDKVIHSRIRFAALSYLYVVEQACFVEIKKQVRTTDGNLSVHMRML
FT                   ELAEYISCDKDVQSRKPQTIYRITPKGHDAFMQYKECLMAFLGT"
FT   gene            225264..225410
FT                   /locus_tag="Ppha_0231"
FT   CDS_pept        225264..225410
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0231"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cph:Cpha266_0794 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42568"
FT                   /db_xref="GOA:B4SBP3"
FT                   /db_xref="UniProtKB/TrEMBL:B4SBP3"
FT                   /protein_id="ACF42568.1"
FT                   /translation="MLETIVIILVVLWLLGVVTSYTMGGLIHGLLVLAIVVILIRVIQG
FT                   RRI"
FT   gene            225586..226155
FT                   /locus_tag="Ppha_0232"
FT   CDS_pept        225586..226155
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0232"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cch:Cag_1035 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42569"
FT                   /db_xref="InterPro:IPR024447"
FT                   /db_xref="UniProtKB/TrEMBL:B4SBP4"
FT                   /protein_id="ACF42569.1"
FT                   /translation="MKKTIWLAAGVAGMLLGTPAIEARGAVNVQIRALNDHSFVIDSRP
FT                   SFINLPERGFSVAVGTPYDIVYYDHRYYINQKGSWYRSSSYRGPWKVIREKNLPGKIRR
FT                   HRLEDIKRYRDTEYSKISNRRTLEQQRSDENNRRVLEQQRSDENNRRVLEQQRSDENNR
FT                   RVLEQQRSDENNRRVLEQQRHDENRR"
FT   sig_peptide     225586..225654
FT                   /locus_tag="Ppha_0232"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.996) with cleavage site probability 0.455 at
FT                   residue 23"
FT   gene            226218..226508
FT                   /locus_tag="Ppha_0233"
FT   CDS_pept        226218..226508
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0233"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cch:Cag_1041 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42570"
FT                   /db_xref="UniProtKB/TrEMBL:B4SBP5"
FT                   /protein_id="ACF42570.1"
FT                   /translation="MNLKEAYKKKAAAELELAQARLVEFRAKAKNFNAEAHLNYAKQLD
FT                   EFEHGIETAKGKLKELGEAGEEAWEKLKDGVESALRSSSNALKDIADKFKD"
FT   gene            226631..227092
FT                   /locus_tag="Ppha_0234"
FT   CDS_pept        226631..227092
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0234"
FT                   /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
FT                   /note="KEGG: cph:Cpha266_0798 RNA polymerase, sigma-24
FT                   subunit, ECF subfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42571"
FT                   /db_xref="UniProtKB/TrEMBL:B4SBP6"
FT                   /protein_id="ACF42571.1"
FT                   /translation="MIKEKRTPMDLMDDIYSLAYWMTGSENAAVELVNRTYLHVDRNTP
FT                   EKEMFSIFRGCYFDSFGRDGLHPVSKSLRKPMNRLVASLSRRDADIKLSVLFSEISGLK
FT                   HRTISTIIGKPLDTIRVWLSAGRKSLATGMLSLDAPLLPGVSLTRESVL"
FT   gene            227089..228186
FT                   /locus_tag="Ppha_0235"
FT   CDS_pept        227089..228186
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0235"
FT                   /product="glycosyl transferase group 1"
FT                   /note="PFAM: glycosyl transferase group 1; KEGG:
FT                   cph:Cpha266_1356 glycosyl transferase, group 1"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42572"
FT                   /db_xref="GOA:B4SBP7"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:B4SBP7"
FT                   /protein_id="ACF42572.1"
FT                   /translation="MKKLRIAQIAPLVERVPPKKYGGTERVVYHLTEGLVERGHDVTLF
FT                   ASGDSITSARLVAPIKEALRLGGEEHTPMIVSMMMLSRVYEKMLHEFDIIHSHLEYLTL
FT                   PYAHKTLVPTVLTMHGRLDLGDSSAMLRTYRDMAYVSISDSQRRPVEDINWAKTIYHGY
FT                   PASCFEFNATPGDYFLYLGRFSEEKKPDQAIMLARECNIPLKIAAKIDPTDQEYFEKKI
FT                   RPLLDHPLIEYVGEVGDQQKVELLKNAKALLNTIDWPEPFGLVMIEALACGTPVIVRGC
FT                   GSAPEVITHGKTGFICESKLDFIEAIHKVDSLSRYVCREEFERRFSLDTMVDNYEELYY
FT                   SLHQNRMTNHALSVPLHQNGANVFG"
FT   gene            228342..228824
FT                   /locus_tag="Ppha_0236"
FT   CDS_pept        228342..228824
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0236"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cph:Cpha266_1270 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42573"
FT                   /db_xref="GOA:B4SBP8"
FT                   /db_xref="InterPro:IPR025517"
FT                   /db_xref="UniProtKB/TrEMBL:B4SBP8"
FT                   /protein_id="ACF42573.1"
FT                   /translation="MKQLFSWRIFTSFGLFLSFFMILISGVILYIGPSGRGPGAMGWSM
FT                   IGLTKPEWQNQHIIFGFAFSLISLFHLFAINWKVFFSYLKTKSTDGTRRSVELLAIIAL
FT                   SLLFGIGTYNKVQPFSGILDFGRSISKSWEGPKMQSPERQQRSGTIINSRGNHESE"
FT   sig_peptide     228342..228431
FT                   /locus_tag="Ppha_0236"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.636) with cleavage site probability 0.302 at
FT                   residue 30"
FT   gene            228853..228996
FT                   /pseudo
FT                   /locus_tag="Ppha_0237"
FT   gene            229159..231522
FT                   /locus_tag="Ppha_0238"
FT   CDS_pept        229159..231522
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0238"
FT                   /product="Tetratricopeptide TPR_2 repeat protein"
FT                   /note="PFAM: TPR repeat-containing protein;
FT                   Tetratricopeptide TPR_3; Tetratricopeptide TPR_4;
FT                   Tetratricopeptide TPR_2 repeat protein; SMART:
FT                   Tetratricopeptide domain protein; KEGG: ter:Tery_3497
FT                   peptidase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42574"
FT                   /db_xref="GOA:B4SBP9"
FT                   /db_xref="InterPro:IPR002151"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:B4SBP9"
FT                   /protein_id="ACF42574.1"
FT                   /translation="MTGYLQYWRGGKSWRSGRFAAASAGLIFFIIIALTGTIGATLSLA
FT                   ALKSDASMRTLVEARKALEQAEKSADPDQIEVALSLNNLAGQCFFLNQYATADTLFRRA
FT                   LAIREKSLGSAHLDVATSLNNLAELYKIQARYAEAEPLCIRALAIREGSFGPDHPSIAM
FT                   SLNALAGLYFIQGRYLESELLFKRALAMHDRLLGPDHPDHPEVVMGLNNLATLCQFQGR
FT                   YTEAEPYYRRALAISEKLARHDQPEVATSLNNFAEFCKILGRYAEAEPLLTRALSIREK
FT                   IFGTAHPDVATSLNNLAGLYFAQGRFREAAPLYKRSLAIREKIFGSAHPDVAISLNNLA
FT                   ELYKTQGKYAEAAPLFLQALAIKEKFFCSAHIQTVVGLNALAGFYSFQGRYADAEALMK
FT                   RALAIRDKIVGSVQPDRATCMNNLAGLYSAQGRYRAAELLYSRSFALRVESVGPEHVMV
FT                   AESLNNQAELCRSLGQYADAAPLYNRALAIQEKVFGLDHPCVARTLNNIGKLYSIQNKY
FT                   ADAEQLYRRALVIREKFFGPDHPYVARSLNNLASLYSADGRYAEAHRLYVRALAIREEA
FT                   LGFDHPDVALSLNNLAALYQAQGRCALAEPLYTRALDIQEKAFGVEHPDVATTLNNLGR
FT                   LYYAGNRNVESEALYRRALAIQEKVFGAWHPDVATTLNNLALLYKFEGRYADAKPLFTR
FT                   SIAIREKCFGQDNQNVAVSLQNLAELYTAEGRYAEAEPFTRRSLAIVEKSLGPVDANVA
FT                   TLLEHLAIICRKTGQGVVADEAQKRAAVIRSLHH"
FT   sig_peptide     229159..229296
FT                   /locus_tag="Ppha_0238"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.927) with cleavage site probability 0.866 at
FT                   residue 46"
FT   gene            231624..231995
FT                   /locus_tag="Ppha_0239"
FT   CDS_pept        231624..231995
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0239"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cph:Cpha266_2281 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42575"
FT                   /db_xref="UniProtKB/TrEMBL:B4SBQ0"
FT                   /protein_id="ACF42575.1"
FT                   /translation="MMKCFVKRTVLRLMKSLLLSFFVLLGVSPLSQARTLKVGDEYAGG
FT                   IVIYLFQPGEEGFKERAEEVMIVGETTLSEHLYWSDAKAASDKFDSPSYGDWGESGALL
FT                   PERVTANEVIKSDVQQIYR"
FT   sig_peptide     231624..231725
FT                   /locus_tag="Ppha_0239"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.993 at
FT                   residue 34"
FT   gene            232008..232520
FT                   /locus_tag="Ppha_0240"
FT   CDS_pept        232008..232520
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0240"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cph:Cpha266_0521 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42576"
FT                   /db_xref="InterPro:IPR011460"
FT                   /db_xref="UniProtKB/TrEMBL:B4SBQ1"
FT                   /protein_id="ACF42576.1"
FT                   /translation="MFSSESVLFLMDYFCMMEAHKRKCLSLLTVMMIYSTSPFLLAAPS
FT                   NGETEVTRGKVALLEKQSKSAYTASVQHGLIAAKENLSGNFNWSDAFGACERMEENGYN
FT                   DWHLPNKDELNKLYLARTLIGGFSDDRYWSSTEYDQQSALSQQFLDGSQKLIPKVESLS
FT                   VRPVRTF"
FT   sig_peptide     232008..232136
FT                   /locus_tag="Ppha_0240"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.767) with cleavage site probability 0.761 at
FT                   residue 43"
FT   gene            232579..233574
FT                   /locus_tag="Ppha_0241"
FT   CDS_pept        232579..233574
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0241"
FT                   /product="sulfate ABC transporter, periplasmic
FT                   sulfate-binding protein"
FT                   /note="TIGRFAM: sulfate ABC transporter, periplasmic
FT                   sulfate-binding protein; PFAM: extracellular solute-binding
FT                   protein family 1; KEGG: plt:Plut_1552 thiosulphate-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42577"
FT                   /db_xref="GOA:B4SBQ2"
FT                   /db_xref="InterPro:IPR000957"
FT                   /db_xref="InterPro:IPR005669"
FT                   /db_xref="InterPro:IPR034408"
FT                   /db_xref="UniProtKB/TrEMBL:B4SBQ2"
FT                   /protein_id="ACF42577.1"
FT                   /translation="MFFALLLFLFAVSGTAATTPGESCSLLNVSYDTSRELYKTENAAF
FT                   VQYWKKKTGQTVIINQSHGATGKQSRAVINGLEEADVVTLALASDIDAIAECKLLACNW
FT                   QKRFPFKSTPYSSTILFVVRKGNPKQIRNWDDLVKPGVSVITSNPKTSGAARWNYLAAW
FT                   GYKQKQTGSKEEAQDFVKALYRNVQVLDTGARGSTITFAQRGFGDVLLTWEYEAHHILE
FT                   EYGADNFEIVAPSISILAEPPVAIVDKNVMKHGSRKLAEAYLHFLYTSRAQEIIAQHFY
FT                   RPCIPAARKKYAANFSPVKLFTLQEVFGSWRIAQKTHFGDGGVFDQIYVP"
FT   sig_peptide     232579..232629
FT                   /locus_tag="Ppha_0241"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.996) with cleavage site probability 0.554 at
FT                   residue 17"
FT   gene            233664..234674
FT                   /locus_tag="Ppha_0242"
FT   CDS_pept        233664..234674
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0242"
FT                   /product="von Willebrand factor type A"
FT                   /note="PFAM: von Willebrand factor type A; KEGG:
FT                   cph:Cpha266_2452 von Willebrand factor, type A"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42578"
FT                   /db_xref="GOA:B4SBQ3"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR033881"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:B4SBQ3"
FT                   /protein_id="ACF42578.1"
FT                   /translation="MLDWFARIPRIELAEPSWLLLLPLFALAAWFRAWREHLGKTPAIL
FT                   FPGVERLKDSGFDAHLWLREMPHWLRWSAFVLCVLALTGPHLLFRQSEAESRGIDVILA
FT                   LDISESMLQKDVGGTSRLDAAREVSRNFVLRRSNDRIGLVVFRGKGYTQCPLTLDHEVL
FT                   AMLLDRLSPGVIQDDGTAIGTAILIAVNRLKASESLHKVLILVTDGENNAGEVGPGTAA
FT                   SIAARSGVRIYVINAGFKVVEDRIDPPEESGRYIQKDEESLQGIARTTGGGYFRVEDPA
FT                   AFDQTIRSIDRLEKKRFTGPVMEHRSGLFLPLLTMAILLLLLEVVLSNTRLLRIP"
FT   gene            234715..235746
FT                   /locus_tag="Ppha_0243"
FT   CDS_pept        234715..235746
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0243"
FT                   /product="von Willebrand factor type A"
FT                   /note="PFAM: von Willebrand factor type A; KEGG:
FT                   cph:Cpha266_2451 von Willebrand factor, type A"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42579"
FT                   /db_xref="GOA:B4SBQ4"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:B4SBQ4"
FT                   /protein_id="ACF42579.1"
FT                   /translation="MCFAWPDNIGYLLFLMPLAVILGYGVVRQLHAREAVFGPALIDAM
FT                   MGRLSLRVLVVKKLLIFCGIALLLFALAGPRFCSGGRPVLRKGADIVFMLDVSRSMRAR
FT                   DVLPDRLGQAKQEITSISRAVTGGRMSILLFAASPLVQCPLTTDRDAFDALLGMASPDL
FT                   IEEQGTSFRAAFELAGRLLEPTLEDRMASGVKGEKIVVLLSDGEDHTGEVRSAVQQLKK
FT                   ANVHLFVIGVGMRQPVVIPLDDAGEGVKRDEHDRVIMSSFRPEFLQMLAREAAGFYFRS
FT                   SAEHAVYKEVSESINRIASASRWVMEPGEREPLYRYFVAAGLFLLLTETMVGRAAGKRR
FT                   SCS"
FT   gene            235854..236153
FT                   /locus_tag="Ppha_0244"
FT   CDS_pept        235854..236153
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0244"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cch:Cag_1877 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42580"
FT                   /db_xref="UniProtKB/TrEMBL:B4SBQ5"
FT                   /protein_id="ACF42580.1"
FT                   /translation="MEQQNSGKKVLDSIERARLGLRVFSLPFAEAEEVIDAYVSGGDYD
FT                   PACVELFKDQLDTQRHIQEKSVELLSTGAQILRLVVGALIKNIPQPPTEESSSS"
FT   gene            236184..237509
FT                   /locus_tag="Ppha_0245"
FT   CDS_pept        236184..237509
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0245"
FT                   /product="AAA ATPase central domain protein"
FT                   /note="PFAM: AAA ATPase central domain protein; Clp domain
FT                   protein; SMART: AAA ATPase; KEGG: cph:Cpha266_2449 AAA
FT                   ATPase, central domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42581"
FT                   /db_xref="GOA:B4SBQ6"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004176"
FT                   /db_xref="InterPro:IPR018368"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036628"
FT                   /db_xref="InterPro:IPR041546"
FT                   /db_xref="UniProtKB/TrEMBL:B4SBQ6"
FT                   /protein_id="ACF42581.1"
FT                   /translation="MQFDPNKFTLKAQEALQAASTLAASRQHQQIEPEHLLYAMFDDKS
FT                   SIAVQIAQKLEASAETLQLALDREIERIPRVTGASATGQYISQNLGKVFDVALKEAESL
FT                   KDEYISSEHLLIAMGEAGIPVSRMLRDAGFNRDSILKVLATVRGSQRVTSQSAEESYNS
FT                   LKKYSRNLNDQARKGKLDPVIGRDEEIRRVLQILSRRTKNNPVLIGEPGVGKTAIVEGI
FT                   AQRIVAGDVPENLKSKEIAALDIAQLVAGAKFRGEFEERLKAVVREVQSAEGEVILFID
FT                   ELHLLVGAGSAEGSMDAANILKPALARGELRCIGATTLDEYRKHIEKDAALERRFQTVV
FT                   VDQPSVEDTVSILRGLKEKYEIHHGVRIKDAAIVAAAELSNRYIADRFLPDKAIDLIDE
FT                   ASSRLRLEIDSSPEELDRINREIRRLEIEREALRREIEAGGQ"
FT   gene            237621..240362
FT                   /locus_tag="Ppha_0246"
FT   CDS_pept        237621..240362
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0246"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cph:Cpha266_1202 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42582"
FT                   /db_xref="GOA:B4SBQ7"
FT                   /db_xref="InterPro:IPR000184"
FT                   /db_xref="InterPro:IPR039910"
FT                   /db_xref="UniProtKB/TrEMBL:B4SBQ7"
FT                   /protein_id="ACF42582.1"
FT                   /translation="MRLSRKRVASLLVLSLFSQESPITASAAISRIPVEQLDGKQRVSV
FT                   VPCADYEAGALHTLMFGAHWRSLWTTPVEMPVLDLGSFAGGLVPFEKGGGFQTMTLSFR
FT                   GANGREYRFRSLDKDPSRGMPSKLKNTVISAVLQDQVTTSNPVSGVIVSPLLDAASIYN
FT                   VAPELTVLPYDKDRLGEYYDEFSGLAGTIEERPNESEGAGTGFKGSDKISGTYTVFNSL
FT                   EKDNDNQVDSASYLRARLLDLFIGDWDRHSDQWKWAGYKKEGNTRWYPIPRDRDHAFSR
FT                   QDGVFSWIITRVVPRMTNFGENYPSIKNLSFSGRPLDRRLLSGIDRTEWDSVTIEVKQK
FT                   LTDQLIHDAVMKMPPAMYDKEGARLERELRSRRDLLDKASAELYLLYAGDVDVYTSNKS
FT                   EYAKVHRTADGSIEVAVSKRDGNTGAAKGVPFYSRIFHPVETNEVRLYLQGGDDRVIVD
FT                   GPVCKGGVKVRVIGGEGQDIFEDYSIRALSGDPDTSAMMTFFYDDGEKSEFVTGNHTVV
FT                   DRHTVSVPVDDQEKYDLMARDEGREIGFRPSVDYSSDTGVFLGMGATLVDYSFRATPYR
FT                   YRMQLNGGFSTGEDIRYKLKYTGDFRSLFRNTSLFVEAGTTGIDIINFYGLGNEKYYNG
FT                   TGLTEDDFEILNQVTSLSASLRYPMDRNYNWSAGVGAKWIDLALTPGSFNDLNRAQVPG
FT                   INHDFAGSFRVGFHYDSRDSGDDIALSPRKQASSLAVAGQAGNTTALSGIMVDVSGSYY
FT                   PEFFGNEQAYGKLSGEFRTYIPLVSSRYSRLALRFGGEKLWGEYPFYEAAFLGGSTSLR
FT                   GYDRQRFAGDASLYAGSELRLYLGTFKFLVPIMYGPLAFAETGRVFLDGEDSSAWHSSA
FT                   GGGLWFGGIESRYSASIVFAQGFDDGRLMEDYGIYLRTGFSF"
FT   sig_peptide     237621..237704
FT                   /locus_tag="Ppha_0246"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.994) with cleavage site probability 0.849 at
FT                   residue 28"
FT   gene            240564..241814
FT                   /locus_tag="Ppha_0247"
FT   CDS_pept        240564..241814
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0247"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gvi:gll1120 unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42583"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B4SBQ8"
FT                   /protein_id="ACF42583.1"
FT                   /translation="MERTLRQAQGNWVDGDRFWGRADDIRILTRKIDEGAHISLVAQRR
FT                   MGKTSLMKELQRRLSDRYICLFIDLQKDSEPADAVVQLSLSIKPYEPLWKRVKSLFANV
FT                   WGVVSGGIEEVSYGDIALKLRAGLNSGNWMEKGDALFSILAKSDRPVLLMIDEVPLMVN
FT                   RMLKGDDFVITKERIAEVDRFMSWLRKNSIEHQGKIRIMLSGSIGFEPVLRQARLSSTI
FT                   NNYQPYDLSPWDAETATGCLRALAQQYGIEFLNQAEEAMVRKLGYCIPHHVQLFFAHVL
FT                   DRCDRQNEMQFSADEVDDLYEHEMLGIRGHAELTHYQERLELFFSKDRLPLVLAILTET
FT                   AIAGQLTIPVIRELQREYARKEPGSDEEIKEILRVLEHDGYLRKIGEGYRYESNLLKDW
FT                   WKKAHAEFYVPVNKREK"
FT   gene            241819..244200
FT                   /locus_tag="Ppha_0248"
FT   CDS_pept        241819..244200
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0248"
FT                   /product="TPR repeat-containing protein"
FT                   /note="PFAM: TPR repeat-containing protein;
FT                   Tetratricopeptide TPR_2 repeat protein; SMART: AAA ATPase;
FT                   Tetratricopeptide domain protein; KEGG: cch:Cag_1875 TPR
FT                   repeat"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42584"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B4SBQ9"
FT                   /protein_id="ACF42584.1"
FT                   /translation="MVKRFVKYNPAFLESDELIENFVVRQIDFRMITRIIRENTMASNQ
FT                   HMLVIGPRGSGKTTLVRRIALEVERDEELESACYPLIFAEESYNAVSAADFWLEALFHL
FT                   AEHTGDAQMMRTYQELRRDPDEQRLGERALGQLLDFADKIGKRLLLVVENLDMLLSEFS
FT                   DKQEAWKLRHTLMNEPRLMLLATATGRFEEIDHPAHAMFELFKIHELKALDDQECNTVW
FT                   ELIAGEKLPGEQIRPVRILTGGNARLIALIARFGAKRSFQQLLDDLIDLIDEHTDYFKS
FT                   HLDAMASKERKVYLALAELWSLSTAKEVAEVARLDVNTASALLNRLVSRSKVLFEEKGK
FT                   RTKWYRISEGIYNIYYLMRRRGGPSARVKAAVKFMVSLYDPVSAVRMLIDETGTLQPEQ
FT                   CIDHYAAFEQVVKNISDRQLLQRIGAVTPKSFLESPYLTDTVKNSLRVESVTESKKDIN
FT                   EGVDRKAVIELFKKGCQLVKDKDYETAIQFFDHIIKRYKDRTEVEISSLVVSALFNKGV
FT                   ILHKLARENEAIKTYEELIVTYSNRYEVEIAEWVVSAMFNKVTALWTLNRKDELIHAYE
FT                   ELVIKYRKRTEVEIAEWIAKALFNQGFVLSSLNREDEGIHKYEELVGLYGTRHEAEISE
FT                   RVVRALFNKGVLLLQLERYQEAEPVFMQAIERAPLMWEAYVELVKLFLKMPERLNDALD
FT                   FARKYVETPGLVEQSIEGAIKLFVELAASGYAKEALGILVDSPAESHLEPLVVALRLYT
FT                   GEEVRSAVEIQEVAKDVVKRIEHRRSVREKTDEHALASCL"
FT   gene            244339..244872
FT                   /locus_tag="Ppha_0249"
FT   CDS_pept        244339..244872
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0249"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cph:Cpha266_2448 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42585"
FT                   /db_xref="UniProtKB/TrEMBL:B4SBR0"
FT                   /protein_id="ACF42585.1"
FT                   /translation="MMKMMKIVTLAFLFAGLFCSRASAGWDPADSDHARMSVDSFRANA
FT                   GLSRFFDSAYGYVVFPDVYKGGFIMLGGGHGKGYVYELNNLVGRSTITQLNVGPQLGGQ
FT                   SFSEIIFFKSRGDLDDFKKGNYELNAQVTAIIVTTGMATNTDYSNGVAVFVLPKAGVMA
FT                   EATVGGQKFSYESY"
FT   sig_peptide     244339..244413
FT                   /locus_tag="Ppha_0249"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.977 at
FT                   residue 25"
FT   gene            244949..246376
FT                   /locus_tag="Ppha_0250"
FT   CDS_pept        244949..246376
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0250"
FT                   /product="glutamyl-tRNA(Gln) amidotransferase, B subunit"
FT                   /note="TIGRFAM: glutamyl-tRNA(Gln) amidotransferase, B
FT                   subunit; PFAM: GatB/Yqey domain protein; GatB region; GatB
FT                   central domain protein; KEGG: cph:Cpha266_2447
FT                   aspartyl/glutamyl-tRNA amidotransferase subunit B"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42586"
FT                   /db_xref="GOA:B4SBR1"
FT                   /db_xref="InterPro:IPR003789"
FT                   /db_xref="InterPro:IPR004413"
FT                   /db_xref="InterPro:IPR006075"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR017958"
FT                   /db_xref="InterPro:IPR017959"
FT                   /db_xref="InterPro:IPR018027"
FT                   /db_xref="InterPro:IPR023168"
FT                   /db_xref="InterPro:IPR042114"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4SBR1"
FT                   /protein_id="ACF42586.1"
FT                   /translation="MKYELVVGLEVHCQLNTTSKAFCGCSAKFGKSANTNVCPVCLALP
FT                   GALPVLNRRVVEDAVKLGLATGCSIAPHSVLARKNYFYPDLPKGYQISQFEEPICSEGM
FT                   VHIDAGEGNREIRLIRIHIEEDAGKSIHDIGEETYIDLNRSGVPLLEIVSYPDLRTSKE
FT                   ASAYLQKVRQIVKYLGISDGNMEEGSLRCDANVSLRPVGETEYGTRTEIKNMNSFKNVE
FT                   KAIDYEVERHREILEAGGVILQETRLWDADKGETRSMRGKEFAHDYRYFPDPDLVPVLV
FT                   DQEMIDRIMSELPEFPEERAVRFVDEYAIPAYDAAVLTVEREVADYFEESVRVSGDAKA
FT                   SSNWVMGEVMRVLKESYLDIAEFSILPERLGGLIALIGKGVISTTIAKQVFELMLKSGD
FT                   APAEIVEREGLAQVSDSGAIETVVQAILDANPGQLAAYRGGKTKLLGFFVGQCMSQMKG
FT                   KANPQMVNEVLLRKLEG"
FT   gene            complement(246381..246638)
FT                   /locus_tag="Ppha_0251"
FT   CDS_pept        complement(246381..246638)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0251"
FT                   /product="Exonuclease VII small subunit"
FT                   /note="PFAM: Exonuclease VII small subunit; KEGG:
FT                   cph:Cpha266_2446 exodeoxyribonuclease VII small subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42587"
FT                   /db_xref="GOA:B4SBR2"
FT                   /db_xref="InterPro:IPR003761"
FT                   /db_xref="InterPro:IPR037004"
FT                   /db_xref="UniProtKB/TrEMBL:B4SBR2"
FT                   /protein_id="ACF42587.1"
FT                   /translation="MATTHTGKLPIEELISRLEEITRNIENPETGLENTIGMYEEGLAI
FT                   AENCKKRLLEARKKIEVINPELAKSWPESLRTKDLFDSES"
FT   gene            246711..247724
FT                   /locus_tag="Ppha_0252"
FT   CDS_pept        246711..247724
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0252"
FT                   /product="GTP-binding protein Obg/CgtA"
FT                   /note="TIGRFAM: small GTP-binding protein; GTP-binding
FT                   protein Obg/CgtA; PFAM: GTP-binding protein HSR1-related;
FT                   GTP1/OBG sub domain protein; KEGG: cph:Cpha266_2445 GTPase
FT                   ObgE"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42588"
FT                   /db_xref="GOA:B4SBR3"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR006074"
FT                   /db_xref="InterPro:IPR006169"
FT                   /db_xref="InterPro:IPR014100"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031167"
FT                   /db_xref="InterPro:IPR035101"
FT                   /db_xref="InterPro:IPR036726"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4SBR3"
FT                   /protein_id="ACF42588.1"
FT                   /translation="MKFVDSASIFVHAGDGGKGCVSFRREKFVPKGGPDGGDGGRGGHV
FT                   WLRTNRQLTTLLDFKYKKKYIAVRGVHGQGARKTGRDGADVVIDVPCGTIVRNGETNEI
FT                   IADLTGEDQEILIARGGKGGRGNQHFATPTRQAPRYAEPGQKGELLMLNMELKLMADVG
FT                   LVGFPNAGKSTLISVISAAKPKIADYPFTTLVPNLGIVRYEEYKSFVMADIPGIIEGAA
FT                   EGKGLGLQFLRHIERTKILAILIAADSPDIADEYHTLLGELEKFEKELLDKPRLVVVTK
FT                   MDIAAEDLEIPTLEEGVRVLSISAVSGQGLKELKDELWREVSGRIRAAEPLDESLG"
FT   gene            247727..248194
FT                   /locus_tag="Ppha_0253"
FT   CDS_pept        247727..248194
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0253"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   plt:Plut_0166 acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42589"
FT                   /db_xref="GOA:B4SBR4"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR010167"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:B4SBR4"
FT                   /protein_id="ACF42589.1"
FT                   /translation="MQQAELYVRYARLADASAIAAITAEYARQGIMLERSGDNIVENIR
FT                   NFFVAEYNGEVIGCCAIAFYTLKLAEIRSLAVFNRYKMRGIGRRLVEKAESVLHEEGVE
FT                   EVFVLTLSREFFRRLGYSEIKKEYFPQKIWRDCTHCPKLMACDEIAMVKKL"
FT   gene            248225..248491
FT                   /locus_tag="Ppha_0254"
FT   CDS_pept        248225..248491
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0254"
FT                   /product="Phosphotransferase system, phosphocarrier protein
FT                   HPr"
FT                   /note="TIGRFAM: phosphocarrier, HPr family; PFAM:
FT                   phosphocarrier HPr protein; KEGG: cph:Cpha266_2443
FT                   phosphotransferase system, phosphocarrier protein HPr"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42590"
FT                   /db_xref="GOA:B4SBR5"
FT                   /db_xref="InterPro:IPR000032"
FT                   /db_xref="InterPro:IPR001020"
FT                   /db_xref="InterPro:IPR002114"
FT                   /db_xref="InterPro:IPR035895"
FT                   /db_xref="UniProtKB/TrEMBL:B4SBR5"
FT                   /protein_id="ACF42590.1"
FT                   /translation="MIVQEVIVKNKAGLHTRPAAAVVKLASRFKSDFFIEMQGVEINAK
FT                   SIIGVMSLAAPKGTRLTLKLDGEDAAEASRQLVEFFEQGFGEV"
FT   gene            248557..249633
FT                   /locus_tag="Ppha_0255"
FT   CDS_pept        248557..249633
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0255"
FT                   /product="glycosyl transferase group 1"
FT                   /note="PFAM: glycosyl transferase group 1; KEGG:
FT                   cph:Cpha266_2442 glycosyl transferase, group 1"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42591"
FT                   /db_xref="GOA:B4SBR6"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:B4SBR6"
FT                   /protein_id="ACF42591.1"
FT                   /translation="MLRDALQDRGYDVTPVAFRALYPDFLVKGGVEEAQGADLTFFNES
FT                   RLVLFNPISWFGAIRHLRSLKPDLLLVAYWSGFLAPLFFTIRRLTGIRMVVLLHNLSSH
FT                   ESFLFDPLMQRLLAASADGFLTLSEAVTKTVQRALPEIPLLQLFHPLYEPDGEHSSVQD
FT                   ARQALKLDAHSPVLLFFGYVRHYKGLDTMLRAMPAILQRDPALRLVVAGQFHEDHGIYR
FT                   KLVAQLGIEGNVDFYPGYVSTERSALFFAAADAVVLPYRSATQSGVVQLAYGHGLPVIV
FT                   TPAGALPEMVRPGKTGWVAPDCSAEGFAGAVGEFLNRRDKHELEAMRPAIEAFRRHFSW
FT                   EVFAEQAGHFLEARAVRR"
FT   gene            249633..250472
FT                   /locus_tag="Ppha_0256"
FT   CDS_pept        249633..250472
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0256"
FT                   /product="glycosyl transferase family 2"
FT                   /note="PFAM: glycosyl transferase family 2; KEGG:
FT                   plt:Plut_0169 glycosyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42592"
FT                   /db_xref="GOA:B4SBR7"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:B4SBR7"
FT                   /protein_id="ACF42592.1"
FT                   /translation="MTSPLSCIVVLNWNGAKDTLACLDSLAALISPSCRVLVVDNGSTD
FT                   GSPEKIRERFPAVELLLLPVNIGYAGGNNAGFRRVMELKAEFVIFLNNDTLVESSFYTP
FT                   LIDTLQCNPGAGIAVPKIYYSDRPERLWYAGGVVNLSTGLIRHVGLRKKDAPDFDRPAL
FT                   TGYATGCCFAMRCRDFDSVGGFDETFGMYAEDVDLSLRVRARGMSINYVPSSRVWHKVS
FT                   ASLSGRPLRKLLKKSIGALHLFRKHRAWSGMVLYLLLLPLRLAGSFGEELREKKSTT"
FT   gene            250495..251061
FT                   /locus_tag="Ppha_0257"
FT   CDS_pept        250495..251061
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0257"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cch:Cag_1865 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42593"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B4SBR8"
FT                   /protein_id="ACF42593.1"
FT                   /translation="MMQNKYRTVIDRAYLDEQGHLLRWQRTLEFLRGSSLSGASLVSGL
FT                   DLGDRTPFTASLEQHFECPFENTTVDLDLEPLSGSFGVVTAFEVLEHLYNPLHALLEVK
FT                   GLLAGEHACLFVSMPLWKPSILASSDHFHEMTRSEALSLFTRAGFTVLRSAEFRIRHPL
FT                   FYLTGVKPLLRAWYEKVQIYELVIQ"
FT   gene            251042..252208
FT                   /locus_tag="Ppha_0258"
FT   CDS_pept        251042..252208
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0258"
FT                   /product="glycosyl transferase group 1"
FT                   /note="PFAM: glycosyl transferase group 1; KEGG:
FT                   cch:Cag_1863 glycosyl transferase, group 1 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42594"
FT                   /db_xref="GOA:B4SBR9"
FT                   /db_xref="UniProtKB/TrEMBL:B4SBR9"
FT                   /protein_id="ACF42594.1"
FT                   /translation="MNLSSNRGAPCSPFRLVWFSEIQWDFLSTRKQRLLCRFPESWSIL
FT                   FIEPFALRRRHHWIPVKRGRVWVVTVPFLKSVPFRIGRLLDLPLLRWLLSLPGILLMLF
FT                   WVTILGFGSSNRIIGLSNIYWGRVAALLPCRLRFYDANDDHLAFPDNPHWLKGSLDHYL
FT                   SKVDLLFSVSRELTSRLRVPPGVRLVDLGNGVEFSHFAISRPRKPAALSRLKGPILGYA
FT                   GAMDWLDSSLIAATARAWPEYSIVLLGPAYEREWWQKQAAINELPNVHYFGKIEYSELP
FT                   AWVQHFDLALMPLLSSDLKRVSHPNKLYEYAAAGVPVLSMNYCSAVERAREVLHVAVSQ
FT                   EEFVRMVPEALADRRVEARQAFARQHSWDTLAAVMVQELEKASRERSL"
FT   gene            252205..253701
FT                   /locus_tag="Ppha_0259"
FT   CDS_pept        252205..253701
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0259"
FT                   /product="polysaccharide biosynthesis protein"
FT                   /note="PFAM: polysaccharide biosynthesis protein; KEGG:
FT                   cch:Cag_1862 polysaccharide efflux transporter, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42595"
FT                   /db_xref="GOA:B4SBS0"
FT                   /db_xref="InterPro:IPR002797"
FT                   /db_xref="InterPro:IPR029303"
FT                   /db_xref="UniProtKB/TrEMBL:B4SBS0"
FT                   /protein_id="ACF42595.1"
FT                   /translation="MNRNAVIAGQAGFSFAGFLFGQTARFAYNLVVARLLGVDALGTYA
FT                   LAIAVIQIAEVLAVAGLDSGLLRFVSLHRDDPLRQRAVIGAALKMSITLSLIVALLLLL
FT                   FSAPISTILNGSSLLRLAICCYAAAIPFNVATLLFGHAMQGFRQLKPKIVATQIVSPLL
FT                   LLLLTLLFRYTAGEDAALFFPFALAGVGAFFWIRPSLSRISGTLQGDILHAHTDKVMLA
FT                   YAIPFMAVSLLSMMSHWLDVMMLGMLTDTATVGLYHPAARTAGLIRSVLLAFTGIAAPM
FT                   IAELHTGRQNAEIGRIFKMVTRWIVTVVLPPAILFMVLPELVLSVFGARFAAEGAVALL
FT                   LLTVASFLQASFGLSATVLAMTGHARLSLLNALAALGLQVALNFLLIPKMGLNGAALAT
FT                   LLLFLMLSVLRLVEIRRILKIHPFGKALWKPFTAGLSTALLLMALRPWLLGLPPFAALA
FT                   VSALLSLCSFTVLLLLLKLEEEEREIILKHLPFLDKNPKP"
FT   sig_peptide     252205..252270
FT                   /locus_tag="Ppha_0259"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.915) with cleavage site probability 0.801 at
FT                   residue 22"
FT   gene            253706..256162
FT                   /locus_tag="Ppha_0260"
FT   CDS_pept        253706..256162
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0260"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cch:Cag_1857 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42596"
FT                   /db_xref="GOA:B4SBS1"
FT                   /db_xref="InterPro:IPR018580"
FT                   /db_xref="UniProtKB/TrEMBL:B4SBS1"
FT                   /protein_id="ACF42596.1"
FT                   /translation="MKKKILLLLTVFGGYTLLVLLLFYPLVFQSKMLLAPDTLIPQAST
FT                   MALDRLQAQTGAYPLWQPWLFSGMPTVEAFSYLSGLYYPNLVFNLFHTDGIVLQLLHLA
FT                   FAGLGLFLFLRQYGLTILAASFGGVLFMLNPYLSAMLVHGHGSQLMTVAYMPWMLWATM
FT                   RLIQRGGLVDAGMLALLAGFQLQRSHVQIAWYSWMLMLLLAVVLFFSHRGFFTKKSAVS
FT                   GMHPVLPGGGNGGADEGSHKGGPYMTLRIFLLLVLALGCGIAMSASIYLPASEYAAYSV
FT                   RGMAAEGGGSAWEYATLWSMHPLELLTFLVPGLFGFGGVTYWGFMPFTDFPHYAGIVVL
FT                   LLAVAGAVIRRKEPMTWFFIAGALLALLLSFGRFFSPVFDLFYHFAPLFSRFRVPSMAL
FT                   IMLYLIISCLAAIGVNDLLQRQSERFLKPIRIGALLLAAFLLLFLAFEPSLESFFRSLF
FT                   PEPQVGSFDLAFMVNKVRWENLTGSLWIVLLIASLFSGVLWLSIKEKLSHKITAILLFL
FT                   LALGDLLWMDIQIIYPSTSSLRSPVFADSRMVEPAFRHDDITRYLAAQKGPFRIYPAGP
FT                   LFAENKFALFGIESVGGYHPAKLKLYEEFLAKTENLASLNILRMLNVGYIVTPQPIEHS
FT                   AFKLVKTGELQLASGPVTAYVYSLQGSAPRAWFANRVTGVHGNDALFARLLDDQAPVGE
FT                   AYVDGSLWKGVRTFASATVTSLDAKAESMVLKVAAPGEAFLVTSEIHYPLRWKVKIDGR
FT                   ETAVVKVNGLLRGVVIPAGSREVRFYYDRNGFETGRRISLGAFVVALLMVAGGVIGGRF
FT                   RQKGGK"
FT   sig_peptide     253706..253795
FT                   /locus_tag="Ppha_0260"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.702) with cleavage site probability 0.418 at
FT                   residue 30"
FT   gene            complement(256608..257066)
FT                   /locus_tag="Ppha_0261"
FT   CDS_pept        complement(256608..257066)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0261"
FT                   /product="HipA domain protein"
FT                   /note="PFAM: HipA domain protein; KEGG: eca:ECA0127
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42597"
FT                   /db_xref="InterPro:IPR012893"
FT                   /db_xref="UniProtKB/TrEMBL:B4SBS2"
FT                   /protein_id="ACF42597.1"
FT                   /translation="MTMLHHTDTDDASYLELAEFLSTYGEADHIARNLEELFTRVVFNI
FT                   ATANRDDHLRNHGFIRSPSGWRLAPAFDMNPSFRKAEHVLSLDLYNRQPDFQVAIATAE
FT                   YYRMNRARAGIIVREVCEVVKEWKVLARRLGLSGQECSEAEHLFCCRR"
FT   gene            complement(257063..257392)
FT                   /locus_tag="Ppha_0262"
FT   CDS_pept        complement(257063..257392)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0262"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="SMART: helix-turn-helix domain protein; KEGG:
FT                   gur:Gura_3064 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42598"
FT                   /db_xref="GOA:B4SBS3"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:B4SBS3"
FT                   /protein_id="ACF42598.1"
FT                   /translation="MEALGQRLRDARLRRRFSMETVCARANLSRPTLYKIETGDPSVAI
FT                   GFYVQVLRVLGLLADLSLISKEDALGRRLQDESLPRRRRAPRKKAPAGASDGEPGSCAI
FT                   FLPQP"
FT   gene            257608..258849
FT                   /locus_tag="Ppha_0263"
FT   CDS_pept        257608..258849
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0263"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cch:Cag_0509 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42599"
FT                   /db_xref="InterPro:IPR025420"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041682"
FT                   /db_xref="UniProtKB/TrEMBL:B4SBS4"
FT                   /protein_id="ACF42599.1"
FT                   /translation="MLNILSNFTQYVEQKTMIIKRFQKKVLTQRIESEPRQFIQVLYGP
FT                   RQVGKTTLALQFMESTKLSVHFASADLVASGQSSWISQQWEAARIKLRQSEEKEAVLII
FT                   DEIQKIGNWSEAVKREWDSDTAQRQSLKVVLLGSSRLLLQQGLTESLAGRFETLFIGHW
FT                   SYREMNEAFDFTPEQYVWFGGYPGAAALINDEERWRRYITDSLIETSISKDILMLTRVD
FT                   KPALMKRLFELGCGYSGQILSYTKILGQLQDAGNTTTLAHYLRLLDTAGLLGGLEKYSP
FT                   EMVRRRASIPKFQVHNTALISAQQQYSFQEIVTNPSQWGRWVESAIGAHLINHARTDAI
FT                   NLFYWRQGNHEVDFVLEHKGKVIGLEVKSGRTGHASGMAAFEQQCKPYKVLLVGNSGIP
FT                   WQEFLELESLELFA"
FT   gene            258930..259172
FT                   /locus_tag="Ppha_0264"
FT   CDS_pept        258930..259172
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0264"
FT                   /product="transcriptional regulator/antitoxin, MazE"
FT                   /note="PFAM: SpoVT/AbrB domain protein; KEGG:
FT                   rrs:RoseRS_3308 transcriptional regulator/antitoxin, MazE"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42600"
FT                   /db_xref="GOA:B4SBS5"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="InterPro:IPR039052"
FT                   /db_xref="UniProtKB/TrEMBL:B4SBS5"
FT                   /protein_id="ACF42600.1"
FT                   /translation="MLTKVQKWGNSLALRIPKTWALEARLENNSEVEISLVEGKLVITP
FT                   VVTIKQDLAHLLSGVTKENLHNECDTGNAAGKENW"
FT   gene            259177..259512
FT                   /locus_tag="Ppha_0265"
FT   CDS_pept        259177..259512
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0265"
FT                   /product="transcriptional modulator of MazE/toxin, MazF"
FT                   /note="PFAM: PemK family protein; KEGG: cch:Cag_0429
FT                   transcriptional modulator of MazE/toxin, MazF"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42601"
FT                   /db_xref="GOA:B4SBS6"
FT                   /db_xref="InterPro:IPR003477"
FT                   /db_xref="InterPro:IPR011067"
FT                   /db_xref="UniProtKB/TrEMBL:B4SBS6"
FT                   /protein_id="ACF42601.1"
FT                   /translation="MAYTPDRGDMVWIAFNPQAGHEQAGRRPALVLSPKAYNSKVGLAL
FT                   LCPITSQIKGYPFEVLLPEGLNINGAILSDQVKSLDWKIRQAELICLLPSSVVDEVLHK
FT                   LHTLLGL"
FT   gene            complement(259628..260872)
FT                   /locus_tag="Ppha_0266"
FT   CDS_pept        complement(259628..260872)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0266"
FT                   /product="HipA domain protein"
FT                   /note="PFAM: HipA domain protein; KEGG: hch:HCH_01139
FT                   uncharacterized protein related to capsule biosynthesis
FT                   enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42602"
FT                   /db_xref="InterPro:IPR012893"
FT                   /db_xref="InterPro:IPR017508"
FT                   /db_xref="UniProtKB/TrEMBL:B4SBS7"
FT                   /protein_id="ACF42602.1"
FT                   /translation="MAKREEEQLLVWLDDPAFGPLQQIGTLSRGARGTVRFVYDPAWLR
FT                   QVNAFPLDPELDLSAGDFFPGGSNFGVFMDSCPDRWGQLLMKRREAIEAKEEERTPRTL
FT                   APWDFLLGVQDCTRMGALRFSHPGESLYLANEALSAPPVAKIAELQEMAFELTRKKQDD
FT                   FGKIKEWLNVLVAPGSSLGGARPKANLVDEDGALWIAKFPSADDDYDVALWEKLLHELA
FT                   QQCHITVPEARLMQIGKGYHTFLVQRFDRTSNHRRFFASAMTMLHHADTDDASYLEIAE
FT                   FLSTYGEADHIARNLEELFTRVVFNIATANRDDHLRNHGFIRSPSGWRLAPAFDMNPSF
FT                   RKAEHVLSLDLYNRQPDFQVAIATAEYYRINRARAGIIVREVCEIVKEWKVLAKRLGLS
FT                   GQECSEAEHLFYCGR"
FT   gene            complement(260859..261158)
FT                   /locus_tag="Ppha_0267"
FT   CDS_pept        complement(260859..261158)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0267"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="PFAM: helix-turn-helix domain protein; KEGG:
FT                   gur:Gura_3064 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42603"
FT                   /db_xref="GOA:B4SBS8"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:B4SBS8"
FT                   /protein_id="ACF42603.1"
FT                   /translation="MEALGQRLRDARLRRRFSMETVCARANLSRPTLYKIENGDPSVAV
FT                   GFYIQVLRVLGLLGDLSLIAKEDALGRRLQDESLPQRRRAPRKKTPAGASDGEA"
FT   gene            261357..261810
FT                   /pseudo
FT                   /locus_tag="Ppha_0268"
FT   gene            262356..262943
FT                   /locus_tag="Ppha_0269"
FT   CDS_pept        262356..262943
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0269"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sus:Acid_6999 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42604"
FT                   /db_xref="GOA:B4SBS9"
FT                   /db_xref="InterPro:IPR000157"
FT                   /db_xref="InterPro:IPR035897"
FT                   /db_xref="UniProtKB/TrEMBL:B4SBS9"
FT                   /protein_id="ACF42604.1"
FT                   /translation="MPNRTKVFISYSRQDKRWLTEVKKYLKPLVRNGLELWHDNCIEPG
FT                   DRWEEKIEQALYQTKVAILLITQDFFNSDYIEAKELSLLLRAAKNNEVTIIPLYLTDTF
FT                   STNEELSRIQGINDPKFSLDKLVESEQKTVLVSLSEQIRNLFSNSTQIGFGSWEEQRKP
FT                   ERNSEPVRVALIAVNSPTHHSLWNALSVGLSA"
FT   gene            263277..266066
FT                   /locus_tag="Ppha_0270"
FT   CDS_pept        263277..266066
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0270"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: Radical SAM domain protein; SMART: Elongator
FT                   protein 3/MiaB/NifB; KEGG: tle:Tlet_1717 radical SAM domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42605"
FT                   /db_xref="GOA:B4SBT0"
FT                   /db_xref="InterPro:IPR006158"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:B4SBT0"
FT                   /protein_id="ACF42605.1"
FT                   /translation="MLSGDLRGYFGAKVSVVVQRVDRDRDISSCIKEIQNHKPDIIGFS
FT                   IGLGSLELAESLYKQCSDIQLCGDQAPKLVLGNKIPSYYPKDCIDRFPKAAVVVGEGEL
FT                   ALRDLVEVVRGNILIKKVSNLVYKLDNGVLEQNKSEEAPDLKDLDYPPSVDTVPEIVKR
FT                   GGNALVQASRGCPWSQCAYCTIFSFRGGKRWESFSNERIIANIELLVAQGITEIEFADD
FT                   EFLGGRTSVRIRRCNILVEAFRKIRERVKDFSFRIFLEPSTIYRSNDISGNEDIRKLLQ
FT                   ELKSVGLERVYIGVESGSNKQLERYKRDGRLDVIKGAIKVLTDIGIDMDAGFIMFDTFA
FT                   TLEELQDNIVLFRSLPKGSNTWPFRPLAINEGSDYLKDCIKWNVKLTKNLSYMSYTCDY
FT                   FDPSVRLIAQTIDAVSLHTRTLFYALKRGSTMYYSDKKRTDSIRFCQEYVNRNSDIYID
FT                   LLEELVFSAQKGILDTANLIIEAEEKLKKLVAEVKKSVKDVLIDDPDYFLHDEITRIES
FT                   LHVLIDVPPVATFSASSLRRIVIVDLDHTLFDSTAVRRKCAEQAIKELGLSEKIENEAL
FT                   DLYCRCIYDNYADYELNKFPDFRVVWNTAESYRVLLALIELGIHPQNYQKESESQGFYL
FT                   RLRGMIDDIYQQYSSKIKKAQDIFWKTPMVLYDYAIEFLDNLKNDSQYNLILASEGDNI
FT                   CQGSKIKYLGLDKYFDSDHVKITGKALAATSLKVMAERAYKEIQKKIYISRKSMFELNI
FT                   TNTENDNLKNEIIAKVKWYYKILEVIDWIVLYALSVYTKNRIVDRLSVLEIANSQIEMP
FT                   GDKVQVLMIGDRWSDMEPYTHLCRQLHTVQIRQGPYMNETIGKADYCAINLQEIGVYLS
FT                   KSDTWVKILPMDIENLPEKGMIDMDKNISRELKTLSRTKNLKAVRSLAGEICRMLNIK"
FT   gene            266083..266625
FT                   /locus_tag="Ppha_0271"
FT   CDS_pept        266083..266625
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0271"
FT                   /product="NUDIX hydrolase"
FT                   /note="PFAM: NUDIX hydrolase; KEGG: chu:CHU_2826
FT                   pyrophosphohydrolase related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42606"
FT                   /db_xref="GOA:B4SBT1"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="UniProtKB/TrEMBL:B4SBT1"
FT                   /protein_id="ACF42606.1"
FT                   /translation="MGEWKWNSSCEIYRSPWIRLREDSVLRPDGKPGTYDVVEMKGGVG
FT                   IVAYRGNTHICLVGQYRYAPACYSWEIPKGAFEGFGMTEDPLETAKRELKEETGLYGGR
FT                   WTSLVSLHTLMGSTNDLVHLFTVEDLTEGPTEMEATEDITVRYVTLSEFDQMVFDGLIT
FT                   DATSIAAVAIAQKNSIR"
FT   gene            complement(266707..267414)
FT                   /locus_tag="Ppha_0272"
FT   CDS_pept        complement(266707..267414)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0272"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mag:amb1154 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42607"
FT                   /db_xref="GOA:B4SBT2"
FT                   /db_xref="UniProtKB/TrEMBL:B4SBT2"
FT                   /protein_id="ACF42607.1"
FT                   /translation="MQLNNDGKSLGEAEFNNLCSHYKDTYEIHLASIKQRDILFYALLI
FT                   ILAFFSLQVTSTALVNGALTQIINNKVGVIVDKGSNLFGALLWLLLFGASSKYFQIVVQ
FT                   IERQYDYIHHLEDVLSGRYGGTRVFTREGKSYLEKYPLFSKWIWFLYTAAFPAIILLSI
FT                   SLRIKGEINRIDVLGFELIPSFVCYFLVVISTILYLWKLHGAFLLKIVNSCIYQIKRSL
FT                   ETLTRQGGHWRNW"
FT   gene            complement(267515..268543)
FT                   /locus_tag="Ppha_0273"
FT   CDS_pept        complement(267515..268543)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0273"
FT                   /product="TIR protein"
FT                   /note="SMART: TIR protein; KEGG: fal:FRAAL5311 hypothetical
FT                   protein; putative transmembrane receptor activity"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42608"
FT                   /db_xref="GOA:B4SBT3"
FT                   /db_xref="InterPro:IPR000157"
FT                   /db_xref="InterPro:IPR035897"
FT                   /db_xref="UniProtKB/TrEMBL:B4SBT3"
FT                   /protein_id="ACF42608.1"
FT                   /translation="MAVVFISYSWIDEFDPVQNRWGRVPNPRVRELADRLRNDGVDVRL
FT                   DIYFRDGLHGFSQPQPIPGNPQDPWLAWSAQQIAEADSVLLFCTPEYAYSDPAHRMFNG
FT                   EWSDWSQLNETTRIDRQHDVPFRWWDWYAINRESSERPEKFILIGLGHYHRDQMPPVNH
FT                   GASYTDIATEAGYNTLLMRILQVWHRRVPRQGIFISYAHNDGDHWLQMLRVHLSWLERN
FT                   HGVEIWSDQNIQPGQKWRRSIQEALHRAKVAVLLVSENFLNSDFITNSELPKMLQAAES
FT                   DGVTIFWIPVRSSSYRQSPISEFQSAHPPEKPLSSLPAPEQDQAFVAIAEKLAAILGLV
FT                   ER"
FT   gene            269156..272269
FT                   /locus_tag="Ppha_0274"
FT   CDS_pept        269156..272269
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0274"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rba:RB452 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42609"
FT                   /db_xref="InterPro:IPR007555"
FT                   /db_xref="InterPro:IPR026876"
FT                   /db_xref="UniProtKB/TrEMBL:B4SBT4"
FT                   /protein_id="ACF42609.1"
FT                   /translation="MLPTVKDICQLNEGALEIRISDSIERIDNDSIDAAAGQLFLKHSY
FT                   LTNGMKELVNEGFKRLSGSSGGRPVFRLKQAMGGGKTHLIKTMAFLARHPKLRTEFFPE
FT                   TSSRYAFGAAQVAFFNGREQPNDYFWGRIAAQLGSEGFFKAGTESPGQEHWQALFDNIE
FT                   APVLILLDEMPTYFGYYRTQAVGSGTVADIAGRAFANLLTASSGKKNICIIVSDLEASY
FT                   AEGTQIINAALESSRKELNRIEFNITPVDLSGDETYAILKKRLFSRLPDNAQIAHIAES
FT                   FGKAIEQAQRSKTIEQQKSPEQLASEVEQTYPFHPQMKHIFALFKENKEFQQTRGLLEL
FT                   ASRLLKSVWERKENDVMLIGPQHFDLSIDEVREKIISISRLDDAVARDIYSSDGSAHAQ
FT                   TIDANAGNDAAAQVANLLLVSSLSTAVNPVKGLTLSETLECLATPNADLSFYQQACENL
FT                   TKSSWYLHKSAEGRIYFDKLENLTKMLTGLAARAPEPKVSELIAHRLREAFEPKSKRAY
FT                   QKVLALPSIDEIEKEVQVNRVLAIISPDSKLPPEEVGKLFSTLVRKNNLLVLTGEKSFE
FT                   VGKLHEAARQVYAVGQANTTGKVKKGDPQWEEFEDLKASYEHQFNSVVKSLFDKLLFPS
FT                   QRPGLEPKLEARPLEHTGNTTDGENQIIATLTKDPVKLYVDWVESTKFSGVRSRIERLF
FT                   ENQDEVAWSDIRDRAQSNCSMYFLVPGDLERIKQRAITEALWEDLQNGWISKKPKPKVS
FT                   GVQVLPLGQMNDAGKIMLEVTVLNSNPETTHVHYAENGEVSTESPKLNDRKLVTDALTV
FT                   AFLAVDYSGKTETGQPKIWKNELKIQWEITPEIGKVRTVRIPVLPRADTIRYTLDGSEP
FT                   RNGREYTGPFEVDNQPRRLLIFAEASGLEKKADYQIVSGDPGSGRGVAKEPPLTLPVLF
FT                   PVSNGVTLNSRELVFSALNKASERNVVFDEVQISVQHGQAAGRLDRMGQPISGEKLLHL
FT                   LSAVIDDFSPTASLTIHFRNARFQTGQDMIDFAQKIGHHYKSSEWQEA"
FT   gene            272269..272877
FT                   /locus_tag="Ppha_0275"
FT   CDS_pept        272269..272877
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0275"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rba:RB453 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42610"
FT                   /db_xref="InterPro:IPR024220"
FT                   /db_xref="UniProtKB/TrEMBL:B4SBT5"
FT                   /protein_id="ACF42610.1"
FT                   /translation="MTNSNLIGLDPSAKKRYLGFGAPSAYGSHVFRVIVPAGMTGNIIV
FT                   QEDYGYLAGINGTPDFEIRAMLPRSKWKLVAETAKRDFNARLRSKKVSISTWKPQDNYL
FT                   DRMLGKELCVLVWAVEHAANDDEIEVICRKWRALRPEERWWLYTVTAAEGGLAEDSGRG
FT                   WRKALYLALSDGQAQPKPKKKVPENDPRSIGLFDSLSND"
FT   gene            272883..277861
FT                   /pseudo
FT                   /locus_tag="Ppha_0276"
FT   gene            274166..275878
FT                   /locus_tag="Ppha_0277"
FT   CDS_pept        274166..275878
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0277"
FT                   /product="transposase IS4 family protein"
FT                   /note="PFAM: transposase IS4 family protein; KEGG:
FT                   amt:Amet_0623 transposase, IS4"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42611"
FT                   /db_xref="GOA:B4SBT6"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="UniProtKB/TrEMBL:B4SBT6"
FT                   /protein_id="ACF42611.1"
FT                   /translation="MSKPVTGKTHVGERRERRPNGDIYIYERVTGYNERTRKTYTVSQK
FT                   LQGKIKSGTQEIIPTRPKKSKNEGGLVGALRRHSGLTDLLEWVGKASGIDDDVRSSFSE
FT                   GDAAKILSIARYWIGSGGNTLPRLEGWQVMHSLPYSEVITEDVYSDLFKCVGCDEDRVQ
FT                   RYFSFRADRLGKAPVLAFDSTTISTYSENQSEARHGFNKDGDGLKTIKLLTLYSVKERE
FT                   PLAFAKQPGNVPDVISIENTLKQLKCFNLEKPLIVTDNGYYSEGNMMKFALRNMKFLTL
FT                   VDPNITWVRETVDALRETLAGMSSTCQFDPSVCGATAMRMHEFGRVRQLSRNGKLSGEE
FT                   ERFVRRLYVHVFYSPNSDTKKQLDFRKELFELKAQVEDGVMEFTKSAQRKIERYLICSK
FT                   KGRGGQLRVGFNDKAIVEATKYFGYFALVSNQAMKTFTALADYRLREKIEEIFAVVKGG
FT                   LDGARPRTWHPDNLRGRQFVQFVSLGYHCFLTKKIKEMRAELGKNGSEKTKALVNLEKK
FT                   LEQWLEQRSLAQILDWFDCIETTQVRTVMGNYRWSTESVARDRLFLKYLGVTS"
FT   gene            277865..280612
FT                   /locus_tag="Ppha_0278"
FT   CDS_pept        277865..280612
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0278"
FT                   /product="helicase domain protein"
FT                   /note="PFAM: SNF2-related protein; helicase domain protein;
FT                   type III restriction protein res subunit; DEAD/DEAH box
FT                   helicase domain protein; SMART: DEAD-like helicases; KEGG:
FT                   rba:RB460 probable DEAH ATP-dependent helicase"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42612"
FT                   /db_xref="GOA:B4SBT7"
FT                   /db_xref="InterPro:IPR000330"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR025202"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038718"
FT                   /db_xref="UniProtKB/TrEMBL:B4SBT7"
FT                   /protein_id="ACF42612.1"
FT                   /translation="MGDIRRFSSLRERLDHVFLAEKLHNARSYKRIAGYFRSSIFELVG
FT                   EEIEHIPDVRIICNSELDPNDIMVSKAAREAALKERWNQMPVETEALMHREQYKKLYEL
FT                   LLSGRVHIKVVPKNTVFVHGKAGLITLANGQRTCFLGSVNDSRAAFSKNHEILWEDQSA
FT                   EGCDWVEQEFDALWKLGHDLPDAIITEVKRISERVEVSFADLKPEEIPAAAMIESPIYR
FT                   GGEQLQPWQRSFVTSFLQHRNVFGKIRLLLADEVGLGKTLSMATAALVAALLGDGPVLV
FT                   LCPATLTLQWQTEINDWLGIPSAVWVSNAKHWLTPDGRPVPSRGAEDIAHAPYQIAIVS
FT                   TGLIVHDSEEAGILRNLRFGTLILDEAHKARVRGGLKQEQEPNNLLAFMREVVKNSKHV
FT                   LLGTATPIQTDVRELWDLVALLNQGAEFVMGRDYVSSWRDWEKTVPLVTGEEVVSDEMT
FT                   AWNLLRAPLPARETPMMDQSAARLVRMIRTDLGIPDSKFFTDAAPESLALMTRKMDLQS
FT                   ILGTDFFHRNNPFIRHVVIRRREALENAGLLDKIAVSVHPIPDARPGTYTGAVFQGIGL
FT                   MTNHPFELAYQAAESFVSELSKRTKGAQLLRSIFLQRICSSFESGKLTVTRMLKKQLNE
FT                   HDDDDIQKVERSVLETLTEAEISYLHIILEELSRSEAVDPKLRAVKWFLQHFQSEGKSW
FT                   NEWGCIVFSQYYDTVNWVALELAKLFPEQIVAVYAGAGKSGLYRGDQFVSINRDSIKKM
FT                   VKEREVSLVVATDAACEGLNLQTLGTLINIDLPWNPARLEQRLGRIKRFGQARKSVDML
FT                   NLTYHATRDEDVYAKISERMKERYDIFGGLPDCIEDDWIDNIEGFVKLADTHLHMRKQV
FT                   ANIFETTWGSTIKSEDDRWEECARVLSQKDINAVMSKPWGKRGW"
FT   gene            complement(280736..281038)
FT                   /locus_tag="Ppha_0279"
FT   CDS_pept        complement(280736..281038)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0279"
FT                   /product="plasmid stabilization system"
FT                   /note="PFAM: plasmid stabilization system; KEGG:
FT                   cph:Cpha266_0252 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42613"
FT                   /db_xref="GOA:B4SBT8"
FT                   /db_xref="InterPro:IPR007712"
FT                   /db_xref="InterPro:IPR035093"
FT                   /db_xref="UniProtKB/TrEMBL:B4SBT8"
FT                   /protein_id="ACF42613.1"
FT                   /translation="MNYEFLPEADEEFREASRYYENAAPGVGLAFIAEVHRVISIVISN
FT                   PLVAKQIRGTIRSKVLLHFPYSLFYSIESDLILIVAVAHQKRRPTYWRSRLKRME"
FT   gene            complement(281035..281265)
FT                   /locus_tag="Ppha_0280"
FT   CDS_pept        complement(281035..281265)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0280"
FT                   /product="addiction module component, TIGR02574 family"
FT                   /note="TIGRFAM: addiction module component, TIGR02574
FT                   family; PFAM: Putative addiction module component CHP02574
FT                   family protein; KEGG: mhu:Mhun_0713 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42614"
FT                   /db_xref="InterPro:IPR013406"
FT                   /db_xref="UniProtKB/TrEMBL:B4SBT9"
FT                   /protein_id="ACF42614.1"
FT                   /translation="MPMTIKKIESEALNLDIHSRGSLVGKLLLSLDEPTVSEVEQLWLD
FT                   EAERRLDDYRAGKVHGISGNEVFKRAISELS"
FT   gene            complement(281508..281771)
FT                   /locus_tag="Ppha_0281"
FT   CDS_pept        complement(281508..281771)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0281"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tde:TDE2749 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42615"
FT                   /db_xref="InterPro:IPR035069"
FT                   /db_xref="UniProtKB/TrEMBL:B4SBU0"
FT                   /protein_id="ACF42615.1"
FT                   /translation="MKDVLVFKDYTGSVHFNADDEVFFGKIEGIEDLMSFEGDSIIELK
FT                   TGFEEAVNDYLEICKNNGEKNKMGDLMSELRQTSTKKHQGLL"
FT   gene            complement(281936..282046)
FT                   /pseudo
FT                   /locus_tag="Ppha_0282"
FT   gene            complement(282256..282531)
FT                   /locus_tag="Ppha_0283"
FT   CDS_pept        complement(282256..282531)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0283"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gur:Gura_3064 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42616"
FT                   /db_xref="GOA:B4SBU1"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:B4SBU1"
FT                   /protein_id="ACF42616.1"
FT                   /translation="MQTVCARANLSRPTLYKIETGDPSVAIGFYVQVLRVLGLLADLSL
FT                   IAKEDALGRRLQDESLPQRRRAPRKKVPAGASDGEPGSSAIFSPQP"
FT   gene            283065..283475
FT                   /locus_tag="Ppha_0284"
FT   CDS_pept        283065..283475
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0284"
FT                   /product="ribosomal protein S12"
FT                   /note="TIGRFAM: ribosomal protein S12; PFAM: ribosomal
FT                   protein S12/S23; KEGG: cch:Cag_1856 30S ribosomal protein
FT                   S12"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42617"
FT                   /db_xref="GOA:B4SBU2"
FT                   /db_xref="InterPro:IPR005679"
FT                   /db_xref="InterPro:IPR006032"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4SBU2"
FT                   /protein_id="ACF42617.1"
FT                   /translation="MPTIQQLIRLGRSVKASKTASPALEKCPQKRGVCTRVYTTTPKKP
FT                   NSALRKVARVRLSNKIEVTAYIPGEGHNLQEHSIVLIRGGRVKDLPGVRYHIVRGSLDT
FT                   SGVADRKQSRSKYGAKQPKAGVPAPVKGKGKR"
FT   gene            283506..283973
FT                   /locus_tag="Ppha_0285"
FT   CDS_pept        283506..283973
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0285"
FT                   /product="ribosomal protein S7"
FT                   /note="PFAM: ribosomal protein S7; KEGG: cph:Cpha266_2427
FT                   30S ribosomal protein S7"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42618"
FT                   /db_xref="GOA:B4SBU3"
FT                   /db_xref="InterPro:IPR000235"
FT                   /db_xref="InterPro:IPR005717"
FT                   /db_xref="InterPro:IPR023798"
FT                   /db_xref="InterPro:IPR036823"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4SBU3"
FT                   /protein_id="ACF42618.1"
FT                   /translation="MPKKVGYKRIGVDFRYGDESVARFINAVMLDGKKAVATKIVYDAF
FT                   AIIAEKLAGEDPLEVYRKAMSHIAPVVEVRSKRVGGATYQIPMEVKASRRGALAFRWLK
FT                   IYAAKRGGRSMAEKLAAELMDAANEQGASVKKRDEVHRMADANKAFAHFRF"
FT   gene            284014..286128
FT                   /locus_tag="Ppha_0286"
FT   CDS_pept        284014..286128
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0286"
FT                   /product="translation elongation factor G"
FT                   /note="TIGRFAM: translation elongation factor G; small
FT                   GTP-binding protein; PFAM: elongation factor G domain
FT                   protein; protein synthesis factor GTP-binding; elongation
FT                   factor Tu domain 2 protein; elongation factor G domain IV;
FT                   KEGG: cch:Cag_1854 elongation factor G"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42619"
FT                   /db_xref="GOA:B4SBU4"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004540"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005517"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009022"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035649"
FT                   /db_xref="InterPro:IPR041095"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4SBU4"
FT                   /protein_id="ACF42619.1"
FT                   /translation="MARLVDLDKVRNIGIMAHIDAGKTTTTERILYYTGRLHRMGEVHD
FT                   GGATMDWMDQEKERGITITSAATTCFWMPKFGNYIGVNHRINIIDTPGHVDFTVEVERS
FT                   LRVLDGAVALFCAVGGVEPQSETVWRQANKYGVPRIAYINKMDRTGANFFETVKAIRER
FT                   LGANPVPLQIPIGEGEIFAGFVDLIRMKGIIYNKEDGSTYDEVEIPHDLQNEARTWRIN
FT                   MLEAVSEHDDTLLEKYLNGEDITESEVRNVLRQATLKVTIIPVLCGSSFKNKGVQFMLD
FT                   AVVEYLASPVDVGAVEGHHPRTEEPVTREPKDEEPFAALAFKIATDPFVGKLTFFRVYS
FT                   GVLKAGSYVLNTMTGKKERIGRVLQMHSNKREDIDCVYCGDIAAAVGLKDVRTGDTLCD
FT                   ENSPVVLEKMVFPEPVIEIAIEPKTKSDSDRLGMSLAKLAEEDPTFKVKTDDETGQTLI
FT                   AGMGELHLEILVDRLKREFKVEANVGKPQVAYRETIRKSVEFEGKFVRQSGGKGQFGLV
FT                   VLRVEPLEEGKGYEFVDAVKGGVIPREYIPAVNAGVQQAMKSGVVAGFPMQDIKVTLLD
FT                   GKYHEVDSSEMAFKIAGSIGFKGGAKKADPVLLEPIMKVEVVTPDEYLGDVMGDLSSRR
FT                   GHIEGMGQRAGAQFVNAKVPLSAMFGYSTDLRSMSQGRANYSMEFDCYREVPRSIAEAL
FT                   QEKRTSKDSD"
FT   gene            286197..287378
FT                   /locus_tag="Ppha_0287"
FT   CDS_pept        286197..287378
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0287"
FT                   /product="translation elongation factor Tu"
FT                   /note="TIGRFAM: translation elongation factor Tu; small
FT                   GTP-binding protein; PFAM: protein synthesis factor
FT                   GTP-binding; elongation factor Tu domain protein;
FT                   elongation factor Tu domain 2 protein; KEGG: cch:Cag_1853
FT                   elongation factor Tu"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42620"
FT                   /db_xref="GOA:B4SBU5"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004160"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004541"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR033720"
FT                   /db_xref="InterPro:IPR041709"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4SBU5"
FT                   /protein_id="ACF42620.1"
FT                   /translation="MAKESYKRDKPHVNIGTIGHVDHGKTTLTAAITSVLAKQGLAAAR
FT                   DFGSIDKAPEERERGITISTAHVEYQTKKRHYAHIDCPGHADYIKNMITGAAQMDGAIL
FT                   VVAGTDGPMPQTREHILLARQVNVPSLVVFLNKVDIADPELIELVELELRELLTQYNFP
FT                   GDDIPIVKGSALKALEGDPEGEKAIMELMDAVDSFIPDPVRDIDKPFLMPVEDVFSISG
FT                   RGTVGTGRIERGRIKINEEVEIVGLRPTRKSVVTGIEMFQKLLDEGQAGDNAGLLLRGV
FT                   DKTELERGMVIAKPGTIKPHTKFKAEVYILKKEEGGRHTPFFNGYRPQFYFRTTDVTGS
FT                   VTLPEGVEMVMPGDNLGVEVELLAPIAMDEGLRFAIREGGRTVGAGSVTTIIE"
FT   gene            287456..287767
FT                   /locus_tag="Ppha_0288"
FT   CDS_pept        287456..287767
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0288"
FT                   /product="ribosomal protein S10"
FT                   /note="PFAM: ribosomal protein S10; KEGG: plt:Plut_0179 30S
FT                   ribosomal protein S10"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42621"
FT                   /db_xref="GOA:B4SBU6"
FT                   /db_xref="InterPro:IPR001848"
FT                   /db_xref="InterPro:IPR018268"
FT                   /db_xref="InterPro:IPR027486"
FT                   /db_xref="InterPro:IPR036838"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4SBU6"
FT                   /protein_id="ACF42621.1"
FT                   /translation="MAVQQKIRIKLKSYDHSLVDKWALRIIDVVKQTDAIIFGPIPLPT
FT                   KSHVYTVNRSPHVDKKSREQFSFSSHKRLIEIINPTSRTIDMLMKLELPSGVDVEIKS"
FT   gene            287789..288418
FT                   /locus_tag="Ppha_0289"
FT   CDS_pept        287789..288418
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0289"
FT                   /product="ribosomal protein L3"
FT                   /note="PFAM: ribosomal protein L3; KEGG: cch:Cag_1851 50S
FT                   ribosomal protein L3"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42622"
FT                   /db_xref="GOA:B4SBU7"
FT                   /db_xref="InterPro:IPR000597"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR019926"
FT                   /db_xref="InterPro:IPR019927"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4SBU7"
FT                   /protein_id="ACF42622.1"
FT                   /translation="MGAILGKKIGMTRLFNEKREAVSCTIIQAGPCFVTQVKRADKEGY
FT                   DAYQIGIGERKEKKVSKPLQGHYKKAGVAPGFKLAEFDFKELNQELELGSAVSVESFTE
FT                   GEKVNVLGVSKGKGFAGVMKRHNFSGGQRTHGQSDRQRAPGSVGGSSDPSRVFKGTRMA
FT                   GRMGSDNITVRNLVIFKIMPESNLIVIKGSVPGPKNSYVKIVSTKK"
FT   gene            288426..289064
FT                   /locus_tag="Ppha_0290"
FT   CDS_pept        288426..289064
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0290"
FT                   /product="ribosomal protein L4/L1e"
FT                   /note="PFAM: ribosomal protein L4/L1e; KEGG: pvi:Cvib_0247
FT                   50S ribosomal protein L4"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42623"
FT                   /db_xref="GOA:B4SBU8"
FT                   /db_xref="InterPro:IPR002136"
FT                   /db_xref="InterPro:IPR013005"
FT                   /db_xref="InterPro:IPR023574"
FT                   /db_xref="UniProtKB/TrEMBL:B4SBU8"
FT                   /protein_id="ACF42623.1"
FT                   /translation="MHEAMELKVLNTGGTETGEVVTLRDDIFGAEISEHAMYLDVKSIL
FT                   ANRRQGTHKSKTRGEVRGGGRKPLRQKGTGNARQGSSRSPLNIGGGTIFGPVPHAYDQK
FT                   VNKKVKLLARRSALSSKAKAGQIVVIEDFVFENIKTKPFAQILKNLGLAEKKTLMLTPG
FT                   YDLIIARSGKNIAALNIMTADKASTYDILHSHTLLVQKTALKKIEDTLG"
FT   gene            289096..289407
FT                   /locus_tag="Ppha_0291"
FT   CDS_pept        289096..289407
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0291"
FT                   /product="Ribosomal protein L25/L23"
FT                   /note="PFAM: Ribosomal protein L25/L23; KEGG: cch:Cag_1849
FT                   50S ribosomal protein L23"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42624"
FT                   /db_xref="GOA:B4SBU9"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR012678"
FT                   /db_xref="InterPro:IPR013025"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4SBU9"
FT                   /protein_id="ACF42624.1"
FT                   /translation="MINPLLRPLLTEKSTGLTEKKGQYVFVVKPDADKTDIKKAVEKKF
FT                   GVEVKSIRTINCLGKSRAQNTRKGRVTGKKSDWKKAIITLEKGQSIDYYSNTAQKSEG"
FT   gene            289484..290278
FT                   /locus_tag="Ppha_0292"
FT   CDS_pept        289484..290278
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0292"
FT                   /product="ribosomal protein L2"
FT                   /note="PFAM: ribosomal protein L2; KEGG: pvi:Cvib_0249 50S
FT                   ribosomal protein L2"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42625"
FT                   /db_xref="GOA:B4SBV0"
FT                   /db_xref="InterPro:IPR002171"
FT                   /db_xref="InterPro:IPR005880"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR014726"
FT                   /db_xref="InterPro:IPR022666"
FT                   /db_xref="InterPro:IPR022669"
FT                   /db_xref="UniProtKB/TrEMBL:B4SBV0"
FT                   /protein_id="ACF42625.1"
FT                   /translation="MSYPAFDEITKSTPEKSLLVPLKKSGGRNAAGRKTSRHRGGGHKR
FT                   HYRIIDFKRNKDGIPATVAAIEYDPNRSSRIALLHYNDGEKRYILAPKGLNVGDKVESG
FT                   EKVEIKTGNTMPLKNIPLGTDIHNIEMKAGKGGQIVRSAGGFAVLAAREGDYVTLKLPS
FT                   GEIRKLRVECRATIGVVGNTDHENIVLGKAGRSRWLGIRPQTRGMAMNPVDHPMGGGEG
FT                   KSKSGGGRKHPMSPWGQLAKGLKTRNKKKASQKLIVRGRNAK"
FT   gene            290312..290611
FT                   /locus_tag="Ppha_0293"
FT   CDS_pept        290312..290611
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0293"
FT                   /product="ribosomal protein S19"
FT                   /note="TIGRFAM: ribosomal protein S19; PFAM: ribosomal
FT                   protein S19/S15; KEGG: cch:Cag_1847 30S ribosomal protein
FT                   S19"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42626"
FT                   /db_xref="GOA:B4SBV1"
FT                   /db_xref="InterPro:IPR002222"
FT                   /db_xref="InterPro:IPR005732"
FT                   /db_xref="InterPro:IPR020934"
FT                   /db_xref="InterPro:IPR023575"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4SBV1"
FT                   /protein_id="ACF42626.1"
FT                   /translation="MPRSLKKGPFIDIKLEKRILDMNSKGEKKVIKTWSRSSMISPDFV
FT                   GHTVAVHNGKNHVPVYVGDNMVGHKLGEFAPTRSFRGHAGGGKAEKGGSAPRKK"
FT   gene            290642..291001
FT                   /locus_tag="Ppha_0294"
FT   CDS_pept        290642..291001
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0294"
FT                   /product="ribosomal protein L22"
FT                   /note="TIGRFAM: ribosomal protein L22; PFAM: ribosomal
FT                   protein L22/L17; KEGG: cph:Cpha266_2418 50S ribosomal
FT                   protein L22"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42627"
FT                   /db_xref="GOA:B4SBV2"
FT                   /db_xref="InterPro:IPR001063"
FT                   /db_xref="InterPro:IPR005727"
FT                   /db_xref="InterPro:IPR036394"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4SBV2"
FT                   /protein_id="ACF42627.1"
FT                   /translation="MEAKAILRDTPTSPRKMRLVAGLVRGKPVDLAKAILLNSTKAASR
FT                   NVMMTLKSAVANYAQRNPDERVSDQELFVKTIFVDEGTTLKRTLPAPMGRAFRIRKRSN
FT                   HLTIVIDKVKNPVTK"
FT   gene            291018..291767
FT                   /locus_tag="Ppha_0295"
FT   CDS_pept        291018..291767
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0295"
FT                   /product="ribosomal protein S3"
FT                   /note="KEGG: cch:Cag_1845 30S ribosomal protein S3;
FT                   TIGRFAM: ribosomal protein S3; PFAM: ribosomal protein S3-
FT                   domain protein; KH type 2 domain protein; Ribosomal protein
FT                   S3 domain; SMART: KH domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42628"
FT                   /db_xref="GOA:B4SBV3"
FT                   /db_xref="InterPro:IPR001351"
FT                   /db_xref="InterPro:IPR004044"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR005704"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR018280"
FT                   /db_xref="InterPro:IPR036419"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4SBV3"
FT                   /protein_id="ACF42628.1"
FT                   /translation="MGQKVNPTGFRLGIIRDWASRWYDDSPVISEKIKQDHVIRTYVLA
FT                   RLKKERAGIARIIIERTTKHVKINIYAARPGAVVGRKGEEINNLSQELSRITGKEVKID
FT                   VVEVVKPEIEAQLIGDNIAYQLENRVSFRRAMKQAIQQAMRSGAEGVRIRCGGRLGGAE
FT                   IARSEQYKEGKIPLHTIRANVDYASVTAHTIAGTIGIKVWVYKGEVLVQRIDAIEEDEL
FT                   KRIKERRNDAGARNRDSRTKRRHRTKR"
FT   gene            291812..292231
FT                   /locus_tag="Ppha_0296"
FT   CDS_pept        291812..292231
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0296"
FT                   /product="ribosomal protein L16"
FT                   /note="PFAM: ribosomal protein L16; KEGG: pvi:Cvib_0253 50S
FT                   ribosomal protein L16"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42629"
FT                   /db_xref="GOA:B4SBV4"
FT                   /db_xref="InterPro:IPR000114"
FT                   /db_xref="InterPro:IPR016180"
FT                   /db_xref="InterPro:IPR020798"
FT                   /db_xref="InterPro:IPR036920"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4SBV4"
FT                   /protein_id="ACF42629.1"
FT                   /translation="MLMPKRVKYRKTQRGRMKGNSGRGTDVSFGSFGLKAIEPAWITSR
FT                   QIEAARVAMTRFMKRDGKIWIRIFPDKPVTKKPAETRMGSGKGSPEFWVAVVKPGRIMF
FT                   EADGVPKEVATEAFRLAAKKLPIKTRFIVRPDYED"
FT   gene            292266..292472
FT                   /locus_tag="Ppha_0297"
FT   CDS_pept        292266..292472
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0297"
FT                   /product="ribosomal protein L29"
FT                   /note="PFAM: ribosomal protein L29; KEGG: cph:Cpha266_2415
FT                   50S ribosomal protein L29"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42630"
FT                   /db_xref="GOA:B4SBV5"
FT                   /db_xref="InterPro:IPR001854"
FT                   /db_xref="InterPro:IPR036049"
FT                   /db_xref="UniProtKB/TrEMBL:B4SBV5"
FT                   /protein_id="ACF42630.1"
FT                   /translation="MKKYEIAALNKQELIDRLKELENRLADINFFKVIEQPQNPMVFRN
FT                   SKRDIARMKNRLHQLAASETGQV"
FT   gene            292520..292804
FT                   /locus_tag="Ppha_0298"
FT   CDS_pept        292520..292804
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0298"
FT                   /product="ribosomal protein S17"
FT                   /note="PFAM: ribosomal protein S17; KEGG: cch:Cag_1842 30S
FT                   ribosomal protein S17"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42631"
FT                   /db_xref="GOA:B4SBV6"
FT                   /db_xref="InterPro:IPR000266"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019979"
FT                   /db_xref="InterPro:IPR019984"
FT                   /db_xref="UniProtKB/TrEMBL:B4SBV6"
FT                   /protein_id="ACF42631.1"
FT                   /translation="MGSVSMEQNAPVRGRKKSWLGKVVSDKMDKSCVVAVERSVQHPVY
FT                   KKYFKKTTKLTAHDEKNEAGIGDLVKVVECRPLSKRKSCRLVEIIEKAR"
FT   gene            292843..293211
FT                   /locus_tag="Ppha_0299"
FT   CDS_pept        292843..293211
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0299"
FT                   /product="ribosomal protein L14"
FT                   /note="TIGRFAM: ribosomal protein L14; PFAM: ribosomal
FT                   protein L14b/L23e; KEGG: cph:Cpha266_2413 50S ribosomal
FT                   protein L14"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42632"
FT                   /db_xref="GOA:B4SBV7"
FT                   /db_xref="InterPro:IPR000218"
FT                   /db_xref="InterPro:IPR005745"
FT                   /db_xref="InterPro:IPR019972"
FT                   /db_xref="InterPro:IPR036853"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4SBV7"
FT                   /protein_id="ACF42632.1"
FT                   /translation="MIQKETNLVVADNSGAKKVRCIHVFGGTGRRYASLGDQIIVSVKA
FT                   AVPGGIVKKKDVCRAVVVRCVKESRRKDGSYIRFDENAVVLLNAQGEPRGTRIFGPVAR
FT                   ELRDRKFMKIVSLAPEVL"
FT   gene            293222..293297
FT                   /locus_tag="Ppha_R0014"
FT                   /note="tRNA-Gly1"
FT   tRNA            293222..293297
FT                   /locus_tag="Ppha_R0014"
FT                   /product="tRNA-Gly"
FT   gene            293329..293571
FT                   /locus_tag="Ppha_0300"
FT   CDS_pept        293329..293571
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0300"
FT                   /product="ribosomal protein L24"
FT                   /note="TIGRFAM: ribosomal protein L24; PFAM: KOW domain
FT                   protein; KEGG: cch:Cag_1840 50S ribosomal protein L24"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42633"
FT                   /db_xref="GOA:B4SBV8"
FT                   /db_xref="InterPro:IPR003256"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR005825"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR041988"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4SBV8"
FT                   /protein_id="ACF42633.1"
FT                   /translation="MKTGIKKVKLHVKKNDSVVVISGNDKGKEGKILKVFPIKSRVIVE
FT                   GVNIRKRHMRPTQGQTQGSIIEREFPIHSSNVKKS"
FT   gene            293633..294220
FT                   /locus_tag="Ppha_0301"
FT   CDS_pept        293633..294220
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0301"
FT                   /product="ribosomal protein L5"
FT                   /note="PFAM: ribosomal protein L5; KEGG: cch:Cag_1839 50S
FT                   ribosomal protein L5"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42634"
FT                   /db_xref="GOA:B4SBV9"
FT                   /db_xref="InterPro:IPR002132"
FT                   /db_xref="InterPro:IPR020930"
FT                   /db_xref="InterPro:IPR022803"
FT                   /db_xref="InterPro:IPR031309"
FT                   /db_xref="InterPro:IPR031310"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4SBV9"
FT                   /protein_id="ACF42634.1"
FT                   /translation="MDKNKEMTPTTPSLARLETFFKEKVTPNLVERFQYKNAMLVPKLK
FT                   KISINIGVGAAAAEPKLLEIALQELAQITGQKPQIRKSKKAISNFKLREGQAIGCRVTL
FT                   RRKAMYEFFDRFVSLAVPRIRDFRGLSDTSFDGRGNYTVGVREQIIFPEIDIDKVPRIS
FT                   GMDISFVTSASTDEEAYVLLSELGMPFKKKNN"
FT   gene            294237..294506
FT                   /locus_tag="Ppha_0302"
FT   CDS_pept        294237..294506
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0302"
FT                   /product="ribosomal protein S14"
FT                   /note="PFAM: ribosomal protein S14; KEGG: cch:Cag_1838 30S
FT                   ribosomal protein S14"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42635"
FT                   /db_xref="GOA:B4SBW0"
FT                   /db_xref="InterPro:IPR001209"
FT                   /db_xref="InterPro:IPR023036"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4SBW0"
FT                   /protein_id="ACF42635.1"
FT                   /translation="MAKKSVIARNEKRIKLVAKYAVLRAELLKAGDYEALRKLPRDSSA
FT                   TRVRNRCVLTGRGRGVYAKYGLCRHMFRKFALEGKLPGVKKASW"
FT   gene            294571..294966
FT                   /locus_tag="Ppha_0303"
FT   CDS_pept        294571..294966
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0303"
FT                   /product="ribosomal protein S8"
FT                   /note="PFAM: ribosomal protein S8; KEGG: cch:Cag_1837 30S
FT                   ribosomal protein S8"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42636"
FT                   /db_xref="GOA:B4SBW1"
FT                   /db_xref="InterPro:IPR000630"
FT                   /db_xref="InterPro:IPR035987"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4SBW1"
FT                   /protein_id="ACF42636.1"
FT                   /translation="MPVTDSIADYITRIRNAGRAKNKTTDIPYSKLRENLSQLLVEKGY
FT                   IKNFTVITTEKFPFLRIDLKYTAHGDPAIKEISRVSKPGRRVYDGKDIKKYLGGLGLYI
FT                   LSSSKGVITDKEARAQGVGGEILFRIY"
FT   gene            294995..295534
FT                   /locus_tag="Ppha_0304"
FT   CDS_pept        294995..295534
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0304"
FT                   /product="ribosomal protein L6"
FT                   /note="PFAM: ribosomal protein L6; KEGG: cph:Cpha266_2408
FT                   50S ribosomal protein L6"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42637"
FT                   /db_xref="GOA:B4SBW2"
FT                   /db_xref="InterPro:IPR000702"
FT                   /db_xref="InterPro:IPR019906"
FT                   /db_xref="InterPro:IPR020040"
FT                   /db_xref="InterPro:IPR036789"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4SBW2"
FT                   /protein_id="ACF42637.1"
FT                   /translation="MSRIGKMPIPLSNQAKIEIKDSNIRVSGPKGTLEQRLTDQVTVSE
FT                   ENGLVTVLRIDDSKKAKAQHGLYRMLISNMVDGVTKGFTRKLEIAGVGYRAELKNDLLA
FT                   LTLGYSHMIYFKAPDEIKIEVPDQVTVLVSGIDKALVGQVAAKIRSFRKPEPYRGKGIK
FT                   YEGEVIRRKEGKAAGK"
FT   gene            295592..295951
FT                   /locus_tag="Ppha_0305"
FT   CDS_pept        295592..295951
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0305"
FT                   /product="ribosomal protein L18"
FT                   /note="TIGRFAM: ribosomal protein L18; PFAM: ribosomal
FT                   protein L18P/L5E; KEGG: cph:Cpha266_2407 50S ribosomal
FT                   protein L18"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42638"
FT                   /db_xref="GOA:B4SBW3"
FT                   /db_xref="InterPro:IPR004389"
FT                   /db_xref="InterPro:IPR005484"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4SBW3"
FT                   /protein_id="ACF42638.1"
FT                   /translation="MSQIDKASRRQKIKDRSRGNVQGTSAKPRLCVYRSLSQIYAQLID
FT                   DVNGKTILAASTLSKDNSALKGSKSELCRIIGNQLGQKALAQGITCVVFDRNGFRYHGR
FT                   VKALADGAREAGLIF"
FT   gene            295975..296493
FT                   /locus_tag="Ppha_0306"
FT   CDS_pept        295975..296493
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0306"
FT                   /product="ribosomal protein S5"
FT                   /note="TIGRFAM: ribosomal protein S5; PFAM: ribosomal
FT                   protein S5 domain protein; Ribosomal protein S5; KEGG:
FT                   cch:Cag_1834 30S ribosomal protein S5"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42639"
FT                   /db_xref="GOA:B4SBW4"
FT                   /db_xref="InterPro:IPR000851"
FT                   /db_xref="InterPro:IPR005324"
FT                   /db_xref="InterPro:IPR005712"
FT                   /db_xref="InterPro:IPR013810"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018192"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4SBW4"
FT                   /protein_id="ACF42639.1"
FT                   /translation="MAKTSAKNIRPGELNLKEKLVHINRTAKVVKGGKRFGFNAIVVVG
FT                   DKEGHVGYGLGKANEVQDAIAKGIEDGKKNVIKVPIVKGTIPHQIVAKFGSAKVMMKPA
FT                   TPGTGLIAGGAVRAVLEMAGIHDILTKSLGSSNPHNVVKAAIKGLQSISDAYDVGERRS
FT                   KSLKEVFES"
FT   gene            296496..296696
FT                   /locus_tag="Ppha_0307"
FT   CDS_pept        296496..296696
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0307"
FT                   /product="ribosomal protein L30"
FT                   /note="PFAM: ribosomal protein L30; KEGG: plt:Plut_0199 50S
FT                   ribosomal protein L30"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42640"
FT                   /db_xref="GOA:B4SBW5"
FT                   /db_xref="InterPro:IPR005996"
FT                   /db_xref="InterPro:IPR016082"
FT                   /db_xref="InterPro:IPR036919"
FT                   /db_xref="UniProtKB/TrEMBL:B4SBW5"
FT                   /protein_id="ACF42640.1"
FT                   /translation="MTNAIMSEKILRITQVRSIIGGTKKQRATIQALGLGRPNYHVDRQ
FT                   DNPCTRGQIRVVQHLVKVEEV"
FT   gene            296731..297285
FT                   /locus_tag="Ppha_0308"
FT   CDS_pept        296731..297285
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0308"
FT                   /product="ribosomal protein L15"
FT                   /note="PFAM: ribosomal protein L15; KEGG: plt:Plut_0200 50S
FT                   ribosomal protein L15"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42641"
FT                   /db_xref="GOA:B4SBW6"
FT                   /db_xref="InterPro:IPR001196"
FT                   /db_xref="InterPro:IPR005749"
FT                   /db_xref="InterPro:IPR021131"
FT                   /db_xref="InterPro:IPR030878"
FT                   /db_xref="InterPro:IPR036227"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4SBW6"
FT                   /protein_id="ACF42641.1"
FT                   /translation="MDLSSLRPAKGAVKNKKRVGRGQGSGNGTTAGKGNNGQQSRSGYK
FT                   RPIIEGGQVPVYRRLPKFGFTPLDKKPVNTVNLTQIDKWIQDGLVENEITILDLKSLLH
FT                   ASNADYFKILGNGELTSAITITAHAFSKSAEEKIAAAGGTVVKAFRTLEEASKVRDLPF
FT                   EEALLKPKAKLVKRAKKSTKP"
FT   gene            297304..298635
FT                   /locus_tag="Ppha_0309"
FT   CDS_pept        297304..298635
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0309"
FT                   /product="preprotein translocase, SecY subunit"
FT                   /note="TIGRFAM: preprotein translocase, SecY subunit; PFAM:
FT                   SecY protein; KEGG: cph:Cpha266_2403 preprotein translocase
FT                   subunit SecY"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42642"
FT                   /db_xref="GOA:B4SBW7"
FT                   /db_xref="InterPro:IPR002208"
FT                   /db_xref="InterPro:IPR023201"
FT                   /db_xref="InterPro:IPR026593"
FT                   /db_xref="InterPro:IPR030659"
FT                   /db_xref="UniProtKB/TrEMBL:B4SBW7"
FT                   /protein_id="ACF42642.1"
FT                   /translation="MKLNESIRNINKIPELRQRILYTLLLLFVYRLGSHITIPGVDAAA
FT                   VSGASQTHSNDLFGLFDLFVGGAFARASIFSLGIMPYISASIIVQLLGAVTPYFQKLQK
FT                   EGEDGRQKISQMTRYGTVLIAVLQAWGVSVSLASPASFGTAIVPDPGIFFTITVVVLLT
FT                   ASTVFVMWLGEKITERGIGNGISLIIMIGILARFPQALVAEFRSVSLGSKNWVIEIIIL
FT                   AMMAAIVAFVVILTVGTRRVPVQHAKRVVGRKVYGGSTQYIPMRINTAGVMPIIFAQSI
FT                   MFLPGTFLSFFPENEVMQSIAKLLAYDSWWYALMFGTMIVFFTYFYTAIAFNPKEVADT
FT                   MRRQGGFIPGVRPGKSTADFIDNILTRITLPGAISLAIIAILPTFLTKFANVTPGFAQF
FT                   FGGTSLLIIVGVGLDTLQQVESHLLMRHYDGFMKSGKTRGRQSR"
FT   gene            298646..299443
FT                   /locus_tag="Ppha_0310"
FT   CDS_pept        298646..299443
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0310"
FT                   /product="methionine aminopeptidase, type I"
FT                   /note="TIGRFAM: methionine aminopeptidase, type I; PFAM:
FT                   peptidase M24; KEGG: pvi:Cvib_0267 methionine
FT                   aminopeptidase, type I"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42643"
FT                   /db_xref="GOA:B4SBW8"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001714"
FT                   /db_xref="InterPro:IPR002467"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:B4SBW8"
FT                   /protein_id="ACF42643.1"
FT                   /translation="MITIKSEREIELMRESGALVAKALDLLEQEIKPGMTTKELDVMAE
FT                   EFIRDNHAVPSFLNYTPKGDPDATPYPATLCVSLNEEVVHGIPSKKRVIREGDIVSVDC
FT                   GVYKGGYHGDAARTFVLGVIDEKVQQLVDVTRECLARGIAMAVEGNRLHDISSAIEDYA
FT                   RSFRFSVIENMVGHGIGSELHEDPAVPNYGKKNTGPLLKTGMTLAIEPMIALGRSRRAI
FT                   SRRGGWVAVTEDGKPSAHFEHTIVVRAGKAEILTGTFLDGKHP"
FT   gene            299483..299701
FT                   /locus_tag="Ppha_0311"
FT   CDS_pept        299483..299701
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0311"
FT                   /product="translation initiation factor IF-1"
FT                   /note="TIGRFAM: translation initiation factor IF-1; PFAM:
FT                   RNA binding S1 domain protein; S1 IF1 family protein; KEGG:
FT                   plt:Plut_0203 translation initiation factor IF-1"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42644"
FT                   /db_xref="GOA:B4SBW9"
FT                   /db_xref="InterPro:IPR004368"
FT                   /db_xref="InterPro:IPR006196"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/TrEMBL:B4SBW9"
FT                   /protein_id="ACF42644.1"
FT                   /translation="MAKEESIEIEGVILEALPNAQFKVKLENSLEVLAHVSGKIRMHYI
FT                   RILPGDKVKVQISPYDISKGRITYRYK"
FT   gene            299818..299934
FT                   /locus_tag="Ppha_0312"
FT   CDS_pept        299818..299934
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0312"
FT                   /product="ribosomal protein L36"
FT                   /note="PFAM: ribosomal protein L36; KEGG: cch:Cag_1828 50S
FT                   ribosomal protein L36"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42645"
FT                   /db_xref="GOA:B4SBX0"
FT                   /db_xref="InterPro:IPR000473"
FT                   /db_xref="InterPro:IPR035977"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4SBX0"
FT                   /protein_id="ACF42645.1"
FT                   /translation="MKIYSSIKKRCEHCRIVKRKGKRYVICKVNPSHKQRQG"
FT   gene            299968..300345
FT                   /locus_tag="Ppha_0313"
FT   CDS_pept        299968..300345
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0313"
FT                   /product="ribosomal protein S13"
FT                   /note="PFAM: ribosomal protein S13; KEGG: cph:Cpha266_2399
FT                   30S ribosomal protein S13"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42646"
FT                   /db_xref="GOA:B4SBX1"
FT                   /db_xref="InterPro:IPR001892"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR018269"
FT                   /db_xref="InterPro:IPR019980"
FT                   /db_xref="InterPro:IPR027437"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4SBX1"
FT                   /protein_id="ACF42646.1"
FT                   /translation="MRIAGVNLPLNKHAVIALTHVYGIGRASAESILQRAGIAPNRKIS
FT                   ELNDEEAHAIREIIAEQYKVEGQARGEQQTAIKRLMDIGCYRGLRHRRSLPVRGQRTRT
FT                   NARTRKGKRKTVAGKKKAVKK"
FT   gene            300394..300777
FT                   /locus_tag="Ppha_0314"
FT   CDS_pept        300394..300777
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0314"
FT                   /product="ribosomal protein S11"
FT                   /note="PFAM: ribosomal protein S11; KEGG: cch:Cag_1826 30S
FT                   ribosomal protein S11"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42647"
FT                   /db_xref="GOA:B4SBX2"
FT                   /db_xref="InterPro:IPR001971"
FT                   /db_xref="InterPro:IPR018102"
FT                   /db_xref="InterPro:IPR019981"
FT                   /db_xref="InterPro:IPR036967"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4SBX2"
FT                   /protein_id="ACF42647.1"
FT                   /translation="MATISKKKKKVKVTPEGAVHIKASFNNIMVTITDLQGNTVSWSSA
FT                   GKNGFKGSKKNTPYASQITSEAAAKEAYDLGMRHVNVFIKGPGAGRDAAIRALQGAGLD
FT                   VRTIKDITPLPHNGCRPPKRRRV"
FT   gene            300815..301426
FT                   /locus_tag="Ppha_0315"
FT   CDS_pept        300815..301426
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0315"
FT                   /product="ribosomal protein S4"
FT                   /note="PFAM: ribosomal protein S4; RNA-binding S4 domain
FT                   protein; KEGG: cch:Cag_1825 30S ribosomal protein S4"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42648"
FT                   /db_xref="GOA:B4SBX3"
FT                   /db_xref="InterPro:IPR001912"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR005709"
FT                   /db_xref="InterPro:IPR022801"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4SBX3"
FT                   /protein_id="ACF42648.1"
FT                   /translation="MARFRGSITKVSRRLGIALAPKAEKYLERRPFPPGQHGQGRKGKV
FT                   SEYALQLREKQKMKYLYGILEKQFRNYYKKAVSQRGVTGDNLVKLLERRFDNVVFRAGF
FT                   APSRSGARQLVTHGHLLINGKKVDIPSYIVSPSEVIEFRQRSKNMGAVTDSLNKAPESR
FT                   IPSWIQVDKANQKAVFLSVPERVEVQEPFNEQLVVELYSK"
FT   gene            301456..302439
FT                   /locus_tag="Ppha_0316"
FT   CDS_pept        301456..302439
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0316"
FT                   /product="DNA-directed RNA polymerase, alpha subunit"
FT                   /note="KEGG: plt:Plut_0207 DNA-directed RNA polymerase
FT                   subunit alpha; TIGRFAM: DNA-directed RNA polymerase, alpha
FT                   subunit; PFAM: RNA polymerase alpha subunit domain protein;
FT                   RNA polymerase dimerisation; RNA polymerase insert; SMART:
FT                   RNA polymerase RpoA/D/Rpb3-type"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42649"
FT                   /db_xref="GOA:B4SBX4"
FT                   /db_xref="InterPro:IPR011260"
FT                   /db_xref="InterPro:IPR011262"
FT                   /db_xref="InterPro:IPR011263"
FT                   /db_xref="InterPro:IPR011773"
FT                   /db_xref="InterPro:IPR036603"
FT                   /db_xref="InterPro:IPR036643"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4SBX4"
FT                   /protein_id="ACF42649.1"
FT                   /translation="MIYQMQMPAKIEVDESSHTDCFGRFIAQPLERGYGVTLGNVMRRV
FT                   LLASLPGTAITGIKIDGVFHEFAAIDGVREDVPEIVLNLKKVRFKSTCKRNCKTSLTLV
FT                   GPMDFTAGDIIAQEGEFEVLNKDMHVATINAGATVKIDLYIGRGRGYMPAEENRPEGMP
FT                   IGYIAVDAIYTPIRNVKFTVENTRVGQRTDYEKMILDVETDGSVSPDDSISLAGKIITD
FT                   HVTFFANFSPTEEEFTEEEFKQQDDEFETMRRLFHTKIEDLDLSVRSHNCLRLAEIDTI
FT                   GELVSHKEDELLNYKNFGKKSLTELKEQLEKFDLKFGMDITKYQMK"
FT   gene            302486..302944
FT                   /locus_tag="Ppha_0317"
FT   CDS_pept        302486..302944
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0317"
FT                   /product="ribosomal protein L17"
FT                   /note="PFAM: ribosomal protein L17; KEGG: cph:Cpha266_2395
FT                   50S ribosomal protein L17"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42650"
FT                   /db_xref="GOA:B4SC70"
FT                   /db_xref="InterPro:IPR000456"
FT                   /db_xref="InterPro:IPR036373"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4SC70"
FT                   /protein_id="ACF42650.1"
FT                   /translation="MRKVKPARKLGRTAAHRKATLSNLSTQLLVYKRIETTEAKAKETR
FT                   RVVEKIITKARKGTVHAQREIFKDIRDKQAIRILFEEIVAKVGTRQGGYTRVIKLAPRF
FT                   GDAAKMAVIELVDYQEAPSASQKTGKQDRAKRVKGSKKTAEAAVSVAG"
FT   gene            complement(302986..303672)
FT                   /locus_tag="Ppha_0318"
FT   CDS_pept        complement(302986..303672)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0318"
FT                   /product="methyltransferase GidB"
FT                   /note="TIGRFAM: methyltransferase GidB; PFAM: glucose
FT                   inhibited division protein; KEGG: plt:Plut_0209
FT                   glucose-inhibited division protein B"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42651"
FT                   /db_xref="GOA:B4SC71"
FT                   /db_xref="InterPro:IPR003682"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4SC71"
FT                   /protein_id="ACF42651.1"
FT                   /translation="MERMNDNVLTLQMLCAEQGMEIDLPTLQQLARYGDCLERWNHKIN
FT                   LISRKEDAPVIIKHIFHSLLITLYHSFREGEDVLDLGTGGGLPGIPLSLLFPRTRFLLV
FT                   DATGKKIAACQAMITELGINNAIALHTRVEELKGVVFDTVLSRQVAPLDKLCSYSAPLL
FT                   KAGGTLICLKGGNLENEIAAAMKSNKGQEGFPSKVELHPIHGISPFFSEKQIVIVHGKN
FT                   SSANND"
FT   gene            303856..304977
FT                   /locus_tag="Ppha_0319"
FT   CDS_pept        303856..304977
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0319"
FT                   /product="Mannose-1-phosphate guanylyltransferase (GDP)"
FT                   /EC_number="2.7.7.22"
FT                   /note="PFAM: Nucleotidyl transferase; KEGG: cch:Cag_1821
FT                   mannose-1-phosphate guanylyltransferase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42652"
FT                   /db_xref="GOA:B4SC72"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:B4SC72"
FT                   /protein_id="ACF42652.1"
FT                   /translation="MGNDARAHVYAVIMAGGIGKKLWPLSRKKMPKQFVDLLDDGTMIA
FT                   KTVRRISGLVPEENIFIITSEMGRTLLSASLGSFRQDHIIVEPASRNTAPCIALATAHI
FT                   KKRDVDAVTIVLPSDHLVLDQQAFIKVVEAGIEIASEKKGLVTIGIKPDRPETAYGYIQ
FT                   ADAELPLPSVLSDSSDFMLFKVKAFAEKPDAATAVEFLESKDFYWNSGVFIWHIDAISR
FT                   EFERSMPELYKDLLAIYDSLGTESEQKVIEDVYSWIHPLSIDYGIMEKAETVFVLTGEF
FT                   GWTDLGCWDEVLKVAGDRSVSAGDVPDNRLVQIDCDNNFIKNSSGKVVCTIGMHDIIIV
FT                   VTDDALLVCSKGKSCHVGDAVDTLRREGLEEYL"
FT   gene            complement(304974..306428)
FT                   /locus_tag="Ppha_0320"
FT   CDS_pept        complement(304974..306428)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0320"
FT                   /product="cysteinyl-tRNA synthetase"
FT                   /EC_number="6.1.1.16"
FT                   /note="KEGG: pvi:Cvib_0277 cysteinyl-tRNA synthetase;
FT                   TIGRFAM: cysteinyl-tRNA synthetase; PFAM: Cysteinyl-tRNA
FT                   synthetase class Ia DALR; tRNA synthetase class I (M);
FT                   Cysteinyl-tRNA synthetase class Ia"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42653"
FT                   /db_xref="GOA:B4SC73"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015273"
FT                   /db_xref="InterPro:IPR015803"
FT                   /db_xref="InterPro:IPR024909"
FT                   /db_xref="InterPro:IPR032678"
FT                   /db_xref="UniProtKB/TrEMBL:B4SC73"
FT                   /protein_id="ACF42653.1"
FT                   /translation="MSLFIYNSLGRTKEKFEPLHPPIVTMYVCGPTVYGHAHLGHAKSY
FT                   VSFDVVVRWLRHSGYRVKYVQNITDVGHLTDDADEGEDKISKQALLEKTDPMEISQFYT
FT                   RSFYEDMDKLEVLRPNIAPAATAHIPEQIELIERLIDAGHAYEVHGNVYFSVESFPGYG
FT                   KLSGRTDQEAVQSGIRVGVRSEKQHPSDFALWKKAEEGHLMKWNSPWSIGYPGWHLECS
FT                   AMSMKYLGETIDIHGGGMENKFPHHDCEIAQSESVTGKPYVRFWMHNNMVTVNGIKMGK
FT                   SLKNFINLKDLFLSFDPMVIRFFILQSHYRSPLDFSDAAIRASQTGLEKLRETQRRLRE
FT                   QTPGSGDFDTAPFIQRFTEAMDDDFNTPIAISVLFDLSKSINAALDRTESISELPQQEA
FT                   AAFLDLAGREILCILQHDNQSGSRNEELNGKRLDGVMDILLDLRAEARKSKDFALSDKI
FT                   RDQLLVAGIEIKDTKEGASWSKRASV"
FT   gene            306573..307154
FT                   /locus_tag="Ppha_0321"
FT   CDS_pept        306573..307154
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0321"
FT                   /product="GTP-binding protein HSR1-related"
FT                   /note="PFAM: GTP-binding protein HSR1-related; KEGG:
FT                   plt:Plut_0212 GTPase EngB"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42654"
FT                   /db_xref="GOA:B4SC74"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR019987"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030393"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4SC74"
FT                   /protein_id="ACF42654.1"
FT                   /translation="MKIVNTAFHISVSALSGLPEDSFPEIVFAGRSNVGKSTLLNSLTG
FT                   VKGLAKTSATPGKTRLINYFLINRDVYFVDLPGYGYAAVGHAEKALWGNLLSSYIIQRR
FT                   SISLVVLLLDSRHPAMQSDRAMISFLESHDRPYGIVLTKYDKLTQKEKVQTGRIMESCA
FT                   AKAKFIVNYSSFSGKGKSELLAHFDQYICQ"
FT   gene            307166..308470
FT                   /locus_tag="Ppha_0322"
FT   CDS_pept        307166..308470
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0322"
FT                   /product="Adenylosuccinate synthase"
FT                   /EC_number="6.3.4.4"
FT                   /note="PFAM: adenylosuccinate synthetase; KEGG:
FT                   cph:Cpha266_2390 adenylosuccinate synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42655"
FT                   /db_xref="GOA:B4SC75"
FT                   /db_xref="InterPro:IPR001114"
FT                   /db_xref="InterPro:IPR018220"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033128"
FT                   /db_xref="InterPro:IPR042109"
FT                   /db_xref="InterPro:IPR042110"
FT                   /db_xref="InterPro:IPR042111"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4SC75"
FT                   /protein_id="ACF42655.1"
FT                   /translation="MESKKFRTPSQSATVIVGTQFGDEGKGKLVDYLSDKYDIVVRYQG
FT                   GANAGHTICFDNKTVVLHLIPSGIFHKGCVCVIGNGVVIDPAALLDEIRKVEELGYEVT
FT                   GRLFISHNAHLIMPYHKLLDSLHESAQGDQKIGTTGRGIGPSYEDKFARKGIRVVDLLN
FT                   PEVLKEKLRENLAAKNKLFKNIYEKEEIDVETMVREYEDFDKIIDPYVTNTQLYLNRQL
FT                   QEGKTVLLEGAQGCLLDVDHGTYPYVTSSNPTSGGASTGSGIAPNYIGKVIGVCKAYMT
FT                   RVGNGAFPTELLDETGERLGKIGHEFGATTGRKRRCGWIDLVALRYSLTINGVTEIALT
FT                   KLDVLDTFEEIRICTSYMLDGKEIHDFPTDHQTLSRVTPLYTTLKGWMASNAHARSFSE
FT                   MQPEAQNYVTFLEDELQVQVTFISVGPGREETVFR"
FT   gene            308489..308809
FT                   /locus_tag="Ppha_0323"
FT   CDS_pept        308489..308809
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0323"
FT                   /product="protein of unknown function DUF77"
FT                   /note="PFAM: protein of unknown function DUF77; KEGG:
FT                   plt:Plut_0214 protein of unknown function DUF77"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42656"
FT                   /db_xref="InterPro:IPR002767"
FT                   /db_xref="InterPro:IPR029756"
FT                   /db_xref="UniProtKB/TrEMBL:B4SC76"
FT                   /protein_id="ACF42656.1"
FT                   /translation="MALMDIAVLPLDAKEGGFSGFVAGLQELLAASGCSYRLHDMGTTV
FT                   EGPAPLLFNLALKLHEYSFSQGGRRVYTVMKIDDRRDRAVRLGDKSASVKAKIVPTREP
FT                   GE"
FT   gene            308907..310169
FT                   /locus_tag="Ppha_0324"
FT   CDS_pept        308907..310169
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0324"
FT                   /product="light-independent protochlorophyllide reductase,
FT                   N subunit"
FT                   /note="TIGRFAM: light-independent protochlorophyllide
FT                   reductase, N subunit; PFAM: oxidoreductase/nitrogenase
FT                   component 1; KEGG: cph:Cpha266_2388 light-independent
FT                   protochlorophyllide reductase subunit N"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42657"
FT                   /db_xref="GOA:B4SC77"
FT                   /db_xref="InterPro:IPR000510"
FT                   /db_xref="InterPro:IPR005970"
FT                   /db_xref="UniProtKB/TrEMBL:B4SC77"
FT                   /protein_id="ACF42657.1"
FT                   /translation="MMQVPGDIQVIKEDNVTHSFCGLACVGWMYQKIKDSFFLILGTHT
FT                   CAHFLQNALGMMIFAKPRFGIALMEEGDLSKQEPSLQDIISEIMADHHPSVIFLLSSCT
FT                   PEVMKVDFKGLAHLLSTPDVPVLFVPASGLVYNFTQAEDSVLAALVPFCPEAPAGQKKV
FT                   VFLGSVNDVTADDLRAEAEELGIPVGGFLPESRFDKMPAIGPDTVLAPIQPYLSRVAVK
FT                   LSRERGCSVLHSLFPFGPDGTRAFWEDLAREFGITVDLRDREKAAWEKIRSQTELLKGK
FT                   KIFLTADTMMELPLARFLHSAGADVVECSSAYINKKFHARELEALDGVRVVEQPNFHRQ
FT                   LEDVRRIKPDLIITSLMTANPFVGNGFVVKWSMEFMLMSIHSWSGVITLANMFVSPLQR
FT                   RSKLPAFDKEVWLEGVMPSAE"
FT   gene            310211..311818
FT                   /locus_tag="Ppha_0325"
FT   CDS_pept        310211..311818
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0325"
FT                   /product="light-independent protochlorophyllide reductase,
FT                   B subunit"
FT                   /note="TIGRFAM: light-independent protochlorophyllide
FT                   reductase, B subunit; PFAM: oxidoreductase/nitrogenase
FT                   component 1; Proto-chlorophyllide reductase 57 kD subunit;
FT                   KEGG: cph:Cpha266_2387 light-independent
FT                   protochlorophyllide reductase subunit B"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42658"
FT                   /db_xref="GOA:B4SC78"
FT                   /db_xref="InterPro:IPR000510"
FT                   /db_xref="InterPro:IPR005969"
FT                   /db_xref="InterPro:IPR013580"
FT                   /db_xref="InterPro:IPR016209"
FT                   /db_xref="InterPro:IPR042298"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4SC78"
FT                   /protein_id="ACF42658.1"
FT                   /translation="MRLAFWLYEGTALHGISRVTNSMKGVHTVYHAPQGDDYITATYTM
FT                   LERTPQFPGLSISVVRGRDLAQGVSRLPSTLQQVEHHYHPELIVIAPSCSTALLQEDLH
FT                   QLAAHSGLPQEKILVYALNPFRVSENEAADGLLTELVKRFASPQEKTAQPSVNLLGFTS
FT                   LGFHLRANLTSIRRMLQTLGIAVNVVAPWGASIDDLRKLPAAWLNIAPYREIGSTAAEY
FT                   LADAFAMPALYEAPIGVEPTLAWLRSLIEKLNAAGAERGVAPIVMPQLNAFSLDGLSAP
FT                   SGVPWFARTADMESFSNKRAFVFGDATHTVALVKFLRDELGMQIIGAGTYLERHADWVR
FT                   KELEGYLPGALIVTDKFQDVAQIIDDQMPDLVCGTQMERHSCRKLDVPCMVVCPPTHIE
FT                   NHLLGYYPFFGFDGADVIADRVYLSCKLGLEKHLIDFFGDAGLEYEEPEVSAPSEEPVA
FT                   LSVAPNDHPSPEAAAEAVVIAEEGEMKWSDEAETMLKKVPFFVRKKVRKNTETFARASG
FT                   ASMISVDVFRQAKESLGG"
FT   gene            311852..312679
FT                   /locus_tag="Ppha_0326"
FT   CDS_pept        311852..312679
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0326"
FT                   /product="light-independent protochlorophyllide reductase,
FT                   iron-sulfur ATP-binding protein"
FT                   /EC_number="1.18.6.1"
FT                   /note="KEGG: cph:Cpha266_2386 protochlorophyllide reductase
FT                   iron-sulfur ATP-binding protein; TIGRFAM: light-independent
FT                   protochlorophyllide reductase, iron-sulfur ATP-binding
FT                   protein; PFAM: NifH/frxC-family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42659"
FT                   /db_xref="GOA:B4SC79"
FT                   /db_xref="InterPro:IPR000392"
FT                   /db_xref="InterPro:IPR005971"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030655"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4SC79"
FT                   /protein_id="ACF42659.1"
FT                   /translation="MSLVLAVYGKGGIGKSTTSANISAALALKGAKVLQIGCDPKHDST
FT                   FPITGKLQKTVIEALEEVDFHHEELSAEDIIETGFAGIDCLEAGGPPAGSGCGGYVVGE
FT                   SVALLQELGLYDKYDVILFDVLGDVVCGGFSAPLNYADYAIIIATNDFDSIFAANRLCM
FT                   AIQQKSVRYKVKLAGIVANRVDYVTGGGTNMLDQFAEKVGTKLLAKVPYHELIRKSRFA
FT                   GKTMYAMEDTPDKEECLKPYNEIADFLIQESPIASVPVPIGDREIFKMVNGWQ"
FT   gene            312709..313326
FT                   /locus_tag="Ppha_0327"
FT   CDS_pept        312709..313326
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0327"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sfu:Sfum_2080 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42660"
FT                   /db_xref="InterPro:IPR012657"
FT                   /db_xref="InterPro:IPR026354"
FT                   /db_xref="InterPro:IPR036583"
FT                   /db_xref="UniProtKB/TrEMBL:B4SC80"
FT                   /protein_id="ACF42660.1"
FT                   /translation="MSLMTYRTHKITKIMKTSDQTFLPPHGNYRNLLSYQKAEVVYDLT
FT                   FRFCKRFLMRGDRTIDQMVQAARSGKQNIVEGSKASVTSKEMEIKLTNVARASLEELLE
FT                   DYRDFLRVRDGNIWQKESKEARYVRKLGSKPQENFERYREFVETRPSEVVANIAICLIH
FT                   QTNYLLDQQIRRLEKDFLKEGGLRECMTRARLQAREQQKNRG"
FT   gene            complement(313416..313988)
FT                   /locus_tag="Ppha_0328"
FT   CDS_pept        complement(313416..313988)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0328"
FT                   /product="bacteriochlorophyll 4-vinyl reductase"
FT                   /note="TIGRFAM: bacteriochlorophyll 4-vinyl reductase;
FT                   KEGG: cch:Cag_1810 bacteriochlorophyll 4-vinyl reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42661"
FT                   /db_xref="GOA:B4SC81"
FT                   /db_xref="InterPro:IPR010249"
FT                   /db_xref="InterPro:IPR024096"
FT                   /db_xref="UniProtKB/TrEMBL:B4SC81"
FT                   /protein_id="ACF42661.1"
FT                   /translation="MSTPSKIGPNSIIQTVAALETTYGKKKSEAMLRKIGQGYLVGNLP
FT                   KEMVEEAKFHSLVIALQKEIGDTATSGILKESGERTARYLLKVRIPGIFQQLVKLLPPR
FT                   PAFRLFLFAISKNAWTFAGSGEFSYTMNRPPEITVKVTFPSHQVVGNFYLGTFTALLQE
FT                   LVNPTTKIKPDIRKENGNIRCHYRCEI"
FT   gene            complement(314012..315130)
FT                   /locus_tag="Ppha_0329"
FT   CDS_pept        complement(314012..315130)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0329"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cch:Cag_1809 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42662"
FT                   /db_xref="InterPro:IPR032812"
FT                   /db_xref="UniProtKB/TrEMBL:B4SC82"
FT                   /protein_id="ACF42662.1"
FT                   /translation="MQSSSPIMKVFLILLLWLASGCASDRPPSGGPLDTTPLQVIFSDP
FT                   APSAVNVSAESIQLTFNHEITGRQLLNALVISPPIGDCDITVDGKKAIIKGFKPLEPGK
FT                   TYILTLDKKLSDHSGHTLQAPYTLAFSTGAVINRGTISGKVINADYSPATNALILAFTE
FT                   LPEHVGARNLLQREPDYFIQAEPSGLFSLRHMAAGSYRIVAVNDRNNDLRYNTATEEIG
FT                   LCSRAIVPSGSSDLLFMLSGKHNDTARFLSRPAVKTGSLTETGALSGKCFASGQYVVVE
FT                   ASSLTASYSTIAVRDRNETWHYSFPELPPGSYTVSAFVPSGTKKPEPQRQRNHGSLEPF
FT                   QAAEPFGYYPEKVTVRPRWTTEHIDIRIITSR"
FT   sig_peptide     complement(315056..315130)
FT                   /locus_tag="Ppha_0329"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.851) with cleavage site probability 0.537 at
FT                   residue 25"
FT   gene            315267..316736
FT                   /locus_tag="Ppha_0330"
FT   CDS_pept        315267..316736
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0330"
FT                   /product="glycogen/starch synthase, ADP-glucose type"
FT                   /EC_number="2.4.1.21"
FT                   /note="KEGG: cph:Cpha266_2377 glycogen/starch synthases,
FT                   ADP-glucose type; TIGRFAM: glycogen/starch synthase,
FT                   ADP-glucose type; PFAM: glycosyl transferase group 1;
FT                   Starch synthase catalytic domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42663"
FT                   /db_xref="GOA:B4SC83"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR011835"
FT                   /db_xref="InterPro:IPR013534"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4SC83"
FT                   /protein_id="ACF42663.1"
FT                   /translation="MSRRNFKVLYVSGEVSPFVRISPLADFMASFPQAIEEEGFEARIM
FT                   MPKYGTINDRKFRLHDVLRLSDIEVDLKEKVDLLNVKVTALPSSKIQTYFLYNEKYFKR
FT                   NGLFTDIHNGSDLKGSTDKVVFFNVGVLETLQRLGWKPDIIHCHDWHAALIPLLLKTVY
FT                   ASHEFFRDIKTVFTIHNIYRQGILPMKAFQKLLPEEVSSALHCSNDEVNMLYTGVEHAD
FT                   LLTTTSKVYAEEIVHDGLQTYGLGRVLEEHQAKFYGILNGIDSRQWNSAADKLIKKRYS
FT                   LEHMDGKLDNKKALLEEAGLPYTEGTPVVGVILNFDEFQGAELLQQSLEQLAALDIQLI
FT                   ISGSGDKKYEKVFQDFALEHPEQVSVHGEYSDSFFHLAIAGLDILLMPGMIESCGMIQM
FT                   FAMNYGTIPVAYAGGGIVETIEERDEESGSGFIFHDYSAESLVGKLEEALACFHDEESW
FT                   QQIVMTAMTRDFTWKKSAEEYDQLYRELLEP"
FT   gene            316745..317335
FT                   /locus_tag="Ppha_0331"
FT   CDS_pept        316745..317335
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0331"
FT                   /product="histidinol-phosphate phosphatase family protein"
FT                   /note="TIGRFAM: histidinol-phosphate phosphatase family
FT                   protein; hydrolase, HAD-superfamily, subfamily IIIA; PFAM:
FT                   Polynucleotide kinase 3 phosphatase central region; KEGG:
FT                   plt:Plut_0221 histidinol-phosphate phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42664"
FT                   /db_xref="GOA:B4SC84"
FT                   /db_xref="InterPro:IPR004446"
FT                   /db_xref="InterPro:IPR006543"
FT                   /db_xref="InterPro:IPR006549"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:B4SC84"
FT                   /protein_id="ACF42664.1"
FT                   /translation="MAQTIKVLFLDRDGTINQDTGSYVFLKEQLKLIDRADDAIALAKS
FT                   AGFRIVLVSNQAGIARGIATIAQVEEVNRYLNELLALKNASFDRSYYCPFHPAYPHPEY
FT                   DRFAEFRKPATGMVELAINDFLAEGLIVDRSASFFVGDKTLDIECGLRAGLRPVLVRTG
FT                   HNEEALCMTQNIIPEFVADDLYKAVTEHILAIS"
FT   gene            317372..318496
FT                   /locus_tag="Ppha_0332"
FT   CDS_pept        317372..318496
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0332"
FT                   /product="oxygen-independent coproporphyrinogen III
FT                   oxidase"
FT                   /EC_number="1.3.98.3"
FT                   /note="KEGG: plt:Plut_0222 putative oxygen-independent
FT                   coproporphyrinogen III oxidase; TIGRFAM: oxygen-independent
FT                   coproporphyrinogen III oxidase; PFAM: Radical SAM domain
FT                   protein; HemN domain protein; SMART: Elongator protein
FT                   3/MiaB/NifB"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42665"
FT                   /db_xref="GOA:B4SC85"
FT                   /db_xref="InterPro:IPR004559"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010723"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR034505"
FT                   /db_xref="UniProtKB/TrEMBL:B4SC85"
FT                   /protein_id="ACF42665.1"
FT                   /translation="MLTLYLHIPFCKARCSYCDFYLVTGRGHISDFFRALSLETASRLT
FT                   DLKGETVGAIHFGGGTPSMVPVSYLAAWLEEVAALCSFSPEIEITLEANPEDLDKKKME
FT                   ELRAAGITRLSIGVQSFTAEKLQALGRAHTALQSRQVTAAALRLFESVSVDLICGVPGE
FT                   NTVMWKSDLHEALALRPHHVSVYMLSVEPKTILHHRVAKGSVTVPDDAVQAACYEHAQS
FT                   ELQLQGYSHYEVSNFCLPGHHSRYNLASWKREPYLGFGPSAHSFSVSQEREIRTANVSS
FT                   LTRYLAAPADAVVFREELSAEERFTEQVFLSLRINSGLDVDFLRKGNKLEHTLSQTIAR
FT                   FSEKGWIEQQEGSLYLTQKGFLFVDLIAGEFLFG"
FT   gene            318524..321166
FT                   /locus_tag="Ppha_0333"
FT   CDS_pept        318524..321166
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0333"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cch:Cag_0197 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42666"
FT                   /db_xref="GOA:B4SC86"
FT                   /db_xref="InterPro:IPR021280"
FT                   /db_xref="UniProtKB/TrEMBL:B4SC86"
FT                   /protein_id="ACF42666.1"
FT                   /translation="MIHRTINRTLAVSLFLAAEILYLRTMAPTFSFWDCGEFIATAYTL
FT                   GIPHPPGAPLFLLLGRLFSMIPFFGDIGARVNLISTLASAATIMLTYLITVRLIIMYRK
FT                   RDPDLWSPAEKVSAYGGAVIGALALALSDSFWFNAVEAEVYALSSLFTALVVWLILRWY
FT                   EEEPKPGHERWLLLVMYIIGLSIGVHLLSLLAVFAVALVYYFKKYDVTVKSFALLMVAS
FT                   SGLFFLIYIGIIKGLPILLQLTSWWGFLLFLALLAYATWYSHLHRKALMNTLLMSLFLI
FT                   IIGYTSYGMIFVRAQAGPPINENNPSSSETFFSYLNRDQYGDMPLWPRRWSTEPVHQYF
FT                   YQHYSSDLDYFLTYQMQKMYFRYFGWQFIGRENDMEGSGVDWSVLWGIPFLVGVAGAIT
FT                   HFRREWKMGLVVTALFVLTGAALVIYLNQTEPQPRERDYSYAGSFFAFALWIGIGVESI
FT                   WQWLAKRSKSGVPGNQMLFAVLTVTAGLLFINARMLQANYRVHDRSGNFVPWDWAWNML
FT                   QSCEKDAILFTNGDNDTFPLWYLQEVERIRTDVRVVNLSLANTGWYLDQLKNSSPRGAK
FT                   PVAFTMSDGEIAGITYVPIDSVDAELPSQDARQQLLRNARLHGQSLPSEPLGTMKWLLK
FT                   PGLTYDGQGYLRPQDIAVYEILMNNFSRRPIYFALTVDPESMIGLQNYLRLDGLAYRVV
FT                   PIKSVDPMSYVDSALLYRNLVGLYRYRNLNNTAINLEETSRRLCGNYTPLFVRLALELA
FT                   AEPEGQLTIPDASGKEKIYHRGALALQVLDTSSKLLPLAQYPLNPELAGSVIALYVRLG
FT                   EKQKSSPYISYLEKLSRQSSSLSDPRLFYVLARAYRDIGRNEDAKRIIVLLARELKQPG
FT                   LVDEFETMK"
FT   gene            321175..321972
FT                   /locus_tag="Ppha_0334"
FT   CDS_pept        321175..321972
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0334"
FT                   /product="acyl-(acyl-carrier-protein)--UDP-N-acetylglucosamine
FT                   O-acyltransferase"
FT                   /EC_number="2.3.1.129"
FT                   /note="KEGG: cch:Cag_0198 UDP-N-acetylglucosamine
FT                   acyltransferase; TIGRFAM:
FT                   acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine
FT                   O-acyltransferase; PFAM: transferase hexapeptide repeat
FT                   containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42667"
FT                   /db_xref="GOA:B4SC87"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR010137"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR029098"
FT                   /db_xref="InterPro:IPR037157"
FT                   /db_xref="UniProtKB/TrEMBL:B4SC87"
FT                   /protein_id="ACF42667.1"
FT                   /translation="MQSTIHPTAVIGQSAILGEGVTVGPFTVIEDDVEIGDGTIIWPHV
FT                   HIASGARIGCDCKIHSGAVLANEPQDLKFSGEKTLLYVGDRTVIRECVTLNRGTKASGK
FT                   TVIGSDNLFMAYSHVGHDCVIGNHVVVANCVPFGGHCVVGDYVVIGGLAAVHQFVRIGR
FT                   FSMLGGLSRITLDVPPFIMASGNETFRYEGLNAIGLKRRGFTSEKITLIKDAYRILFQS
FT                   GLLLANGLEKVKSELPQEPEILEILDFFASGVHGRKFVKPFKN"
FT   gene            321992..322975
FT                   /locus_tag="Ppha_0335"
FT   CDS_pept        321992..322975
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0335"
FT                   /product="ROK family protein"
FT                   /note="PFAM: ROK family protein; KEGG: pvi:Cvib_0291 ROK
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42668"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="UniProtKB/TrEMBL:B4SC88"
FT                   /protein_id="ACF42668.1"
FT                   /translation="MSRWAIGVDLGGTGIKAAIVGEESGILTKQRALTDTVSGPTGIVG
FT                   QLAAIITDLYHVASETLDVADFAGVGLGAPGAVDAEKGILSYPPNLPGWTVFPLRDELQ
FT                   KLLRQKEELSIPVFLDNDANVAAFGEAVYGAGREFRDFLMVTLGTGVGGGIVLNRKLYR
FT                   GPHGTAGEVGFMIIDFESPIFHADICGTLESLIGKKAIVALACKMIKASKSDSRLARLY
FT                   NRDHSRISPRKLEHAALSGDAVALAVWERVGTILGVGLANVTALMDIRKFVIGGGIAAA
FT                   GNLVFDPALDQLRRSTLPSMHEGLELVPAHLGNKAGIYGAAALCFG"
FT   gene            322994..323686
FT                   /locus_tag="Ppha_0336"
FT   CDS_pept        322994..323686
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0336"
FT                   /product="phosphoribosyltransferase"
FT                   /note="PFAM: phosphoribosyltransferase; KEGG: plt:Plut_0226
FT                   competence protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42669"
FT                   /db_xref="GOA:B4SC89"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:B4SC89"
FT                   /protein_id="ACF42669.1"
FT                   /translation="MLEQQLHLLFPHVCLICRKLLLKGEEYCCSSCRAKFDPFTTPRAA
FT                   EELLRRTIAEHFDETFLFERGWCRYQFHKKSPLQQLLHAMKYEGLYNLGNSFGRQLGEW
FT                   ISSGADTADIECIVPVPLHRLKKIERSYNQAEKIAEGIAQSLQKPLQRKLLVRKRYTVS
FT                   QTGLSAAERKKNPEGAFQVAKGVVGRHVLLVDDVITTGATMAAAASALREGGAERISLA
FT                   AVALAIKE"
FT   gene            323694..324437
FT                   /locus_tag="Ppha_0337"
FT   CDS_pept        323694..324437
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0337"
FT                   /product="protein of unknown function DUF558"
FT                   /note="PFAM: protein of unknown function DUF558; KEGG:
FT                   cch:Cag_0201 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42670"
FT                   /db_xref="GOA:B4SC90"
FT                   /db_xref="InterPro:IPR006700"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:B4SC90"
FT                   /protein_id="ACF42670.1"
FT                   /translation="MELFYTSTQHIDLDARNLVVDGDEFHHLVRVLRKKTGEKILVTDG
FT                   NGLRCEASIAEIGKTSFTADILACSRIDRPNTEVTVALSLLKAPQRFELFLEKATELGV
FT                   STIIPMLTARTLSHPSNEKVQGKLNRWRTIMLSAARQSKRHYLPQLTEPLTFKKAAALQ
FT                   GYDLKLIPYELSEAPPKVKCSGKKILFLIGGEGGFTANEIEEARAAGFNELSFGKTILR
FT                   AETAGIFAVALVRTQLLEEERIEWF"
FT   gene            324468..325559
FT                   /locus_tag="Ppha_0338"
FT   CDS_pept        324468..325559
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0338"
FT                   /product="protein of unknown function UPF0118"
FT                   /note="PFAM: protein of unknown function UPF0118; KEGG:
FT                   cch:Cag_0203 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42671"
FT                   /db_xref="GOA:B4SC91"
FT                   /db_xref="InterPro:IPR002549"
FT                   /db_xref="UniProtKB/TrEMBL:B4SC91"
FT                   /protein_id="ACF42671.1"
FT                   /translation="MNSIKTNQLILLVLLLVISVTFVAMIRYFLMAIVLAALFSALAMP
FT                   VFNRFERWFKGRKSLSASMTMLTLLLIVFLPFAALLGIVAKQAIRISRIAVPWVQQQIL
FT                   EPGAFDQQLRSLSFYPELLLYRTEIFQKVGEFASSTGTMLFNTISTFTYSAVSDLFLFF
FT                   LFLYTMFFFIRDGKQLLAHFLSYLPLRQTDQNRLLDKFISVTRATIKGTMVVGAVQGSL
FT                   AGLALHFAGIDSALFWGTIMSLFSILPVLGSALVWVPAVIYLAATGQYPQAIGVLLFCS
FT                   IVVGQIDNILRPMLIGRDTQMPELLIFFGTLGGISLFGVFGFILGPIVAALFMTIWEMY
FT                   GETFKEYLSEIKSDKPSGKEDVS"
FT   sig_peptide     324468..324578
FT                   /locus_tag="Ppha_0338"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.995) with cleavage site probability 0.680 at
FT                   residue 37"
FT   gene            complement(325641..326063)
FT                   /locus_tag="Ppha_0339"
FT   CDS_pept        complement(325641..326063)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0339"
FT                   /product="Nucleoside-diphosphate kinase"
FT                   /EC_number="2.7.4.6"
FT                   /note="PFAM: nucleoside diphosphate kinase; KEGG:
FT                   cph:Cpha266_2368 nucleoside diphosphate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42672"
FT                   /db_xref="GOA:B4SC92"
FT                   /db_xref="InterPro:IPR001564"
FT                   /db_xref="InterPro:IPR023005"
FT                   /db_xref="InterPro:IPR034907"
FT                   /db_xref="InterPro:IPR036850"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4SC92"
FT                   /protein_id="ACF42672.1"
FT                   /translation="MERTLTILKPDCVRKQLIGAVIDQIERAGFRVVAMKKIRLTQETA
FT                   GEFYAVHRERPFYGELVEFMSSGPCVPIILEKENAVADFRTLIGATDPAQADAGTVRKL
FT                   YADSKGENIVHGSDSEENAAIEAGFFFSAEEVVRSN"
FT   gene            complement(326459..327826)
FT                   /locus_tag="Ppha_0340"
FT   CDS_pept        complement(326459..327826)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0340"
FT                   /product="transposase IS4 family protein"
FT                   /note="PFAM: transposase IS4 family protein; KEGG:
FT                   cph:Cpha266_2634 transposase, IS4 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42673"
FT                   /db_xref="GOA:B4SC93"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR008490"
FT                   /db_xref="UniProtKB/TrEMBL:B4SC93"
FT                   /protein_id="ACF42673.1"
FT                   /translation="MHSDFLSADRDTLYLLPPSVQDWLPVNHLARFVVDIVAQLDLTPL
FT                   RDAYAGRGCKAYDPEMLLSLLFYGYATGTFSSRKLELASYESIAVRYITGNSHPDHDTI
FT                   ANFRKRFLAELKPFFIQILTLAHEMNILKIGKISLDGTKIKANASKHQALSWGHACKLE
FT                   KQLKAEVDSLLRQAEQADQSAIPDGMSIPEELERREKRLEAIAKAKLEIERRAEERYAK
FT                   EQAEHEEKLAERERKAQESGKKSRGKTPKAPEPGVRDRDQVNLTDEESRIMPVSGGEFM
FT                   QAYNAQASVDLDTMLIVGVHVTQHTNDKLELRPALEELNNLPAKLGTLTEVIADAGYFS
FT                   EKNVELCEKETITPYIAASRESHNQSPANRFSEPEPIAKDADAVTKMKHRLKTKDGKAV
FT                   YAKSKCTVEPVFGVIKSVMGFRQFLLRGIENVRGEWDLVSIAWNLKRLNVLRQIMA"
FT   gene            328641..330440
FT                   /locus_tag="Ppha_0341"
FT   CDS_pept        328641..330440
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0341"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sph:MGAS10270_Spy0033 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42674"
FT                   /db_xref="InterPro:IPR018891"
FT                   /db_xref="UniProtKB/TrEMBL:B4SC94"
FT                   /protein_id="ACF42674.1"
FT                   /translation="MALTDQELTLLKTALDSRFVPHLPALIDQKKSVSERVTKNCSRAL
FT                   SAFVIKHIADLSETDACQYVTDDFDDKGVDAIYYQASSQTLYLIQSKLKLNEEFSLDEA
FT                   NAFCQGVRKIIRQNFDDFNSHIQNRKAEIERDVEDCSNIQLVIAYTGPRISANAKQAIR
FT                   EMLTDISQGEERFVDTIMEYDAEIIKSKLSESNAYPRVDATLWLECQRAVDDGHTSYFG
FT                   LVALKSLVDLHKQHDKALYVKNIRTFLGRTTDVNSAIQKTLREQPSDFWYLNNGVTALC
FT                   ANIEPKNMKDGKKKIQIQGISIINGAQTIASSATVANENVDISSAKVLLTLIKSPPESA
FT                   FGKSVTKARNHQNPVSLFNFSALDEEQERLRRDIANLNIEYLYKDGVSDQSGNSISINE
FT                   AVYALSCLQQDPRFLVWLKKEPGNILDPETENYRLIFPETLTAFRLINAVIVYRTIQKN
FT                   LKQNILSTNGTERLCYKHGNLVLASVLIKRLLKEIDMPSVIRMEVLEEKLSYPFDQARN
FT                   SLWAYVTPVVPPSNEAGPGPLALFKNQAHTISVMKSTMIDNFGLLNDPVIAIKERRQTE
FT                   NQPYPIELFNYLSAKAPQIRFDQ"
FT   gene            330437..332182
FT                   /locus_tag="Ppha_0342"
FT   CDS_pept        330437..332182
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0342"
FT                   /product="DNA methylase N-4/N-6 domain protein"
FT                   /note="PFAM: DNA methylase N-4/N-6 domain protein; KEGG:
FT                   rpe:RPE_0561 DNA methylase N-4/N-6 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42675"
FT                   /db_xref="GOA:B4SC95"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR002295"
FT                   /db_xref="InterPro:IPR002941"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B4SC95"
FT                   /protein_id="ACF42675.1"
FT                   /translation="MTNKKRLELTWIGKDKRPKLEPRILLEDVARSYHAKHLVTDNDIF
FT                   DNRLIFGDNLLALKALEQEFSGKVKCVYIDPPFNTQQAFEHYDDGLEHSIWLGLIRDRI
FT                   DIIRNLISEDGTLFVHIDDNELGYLIVLLDEIFGRQNRITVVSFKQGAATGHKAINPGV
FT                   VSTSNFIVLYAKNKTLWKPNRVFTARNKRDTRYGQFIDNFDAPYAQWRFITLTQAFARS
FT                   LNLPIRGLKKAVGDSYEALLSDFVVANAPRVVRLARPDYDAVSGDARSMIDASHKTSEI
FT                   LRLEREEFSDMFFVAGERILFYSDKLKLIDGKYVAGEPLTTIWDDLLSNNIHNEGGIEF
FT                   PKGKKPEALIKRCFELATIDGDLVLDSFAGSGTTGAVAHKMGRRWIMVELGEHCHTHII
FT                   PRLQKVIDGEDKGGVTEATGWKGGGGFRYYRIAPSLLDKDKWGNWVISKEYNAAQLTEA
FT                   LCKLEGFTYAPSDTLYWQQGHSTERDFIYITTQTLGADQLHALSEDVGTERSLLVLCSA
FT                   FRGNPERFTNLTVKRIPSTVLSKCEWRHDDYSLILQNLPMAQREEETLKKKKSAHPSLF
FT                   DNQDA"
FT   gene            332186..332689
FT                   /locus_tag="Ppha_0343"
FT   CDS_pept        332186..332689
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0343"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42676"
FT                   /db_xref="GOA:B4SC96"
FT                   /db_xref="UniProtKB/TrEMBL:B4SC96"
FT                   /protein_id="ACF42676.1"
FT                   /translation="MNTLTFNSSEIDWTVTGTLFAVVISLISAVIAAMARQDSKKSARE
FT                   VEKARKVSQADLLAEHFHNINYLIPDATLSSYPRPDNFNNIDLGIKSAKIIISLIGDQI
FT                   LKNHLEELVDLHGKFHDKVTEARSLPTESAVIANTETFESLHNKIVAIKNQIDICKPSY
FT                   LEIS"
FT   sig_peptide     332186..332293
FT                   /locus_tag="Ppha_0343"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.831) with cleavage site probability 0.459 at
FT                   residue 36"
FT   gene            332693..335374
FT                   /locus_tag="Ppha_0344"
FT   CDS_pept        332693..335374
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0344"
FT                   /product="type III restriction protein res subunit"
FT                   /note="PFAM: type III restriction protein res subunit;
FT                   KEGG: neu:NE2306 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42677"
FT                   /db_xref="GOA:B4SC97"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B4SC97"
FT                   /protein_id="ACF42677.1"
FT                   /translation="MNRHVNSISGRLSLREPQRRSLEILDRVTEIVPPHKSSDLVAALM
FT                   IIKSEFPAVTDFEREFPSLCFALATGVGKTRLMGAFISYLHLAHGLNNFFVLAPNLTIY
FT                   NKLIADFTPNTSKYVFKGIAEFSIAPPAIITGDDYQQLAGNLFDQTLRCKINIFNISKI
FT                   NSEVRGGSLPRIKRLAEYIGQSYFDYLAALPDLVLLMDESHRYRASAGVRAINELKPVL
FT                   GLELTATPFMETTKGPIPFKNVVLSYPLAKAMEDGFVKEPAVVTRKDFNSAGMPLEALE
FT                   KLKLEDGIRLHEGTKVELETYARESGNRIVKPFVLVIARDTTHAGQLLALIQSADFFEG
FT                   RYKEHVIQVDSSMTGEKEDVMVQRLLAVESTDEPTEIVIHVNMLKEGWDVTNLYTIVPL
FT                   RAANARILIEQSIGRGLRLPYGRRTGVPAVDRLSIVAHDRFQEIVDEAQRPDSVIRLQQ
FT                   IILDPDELRRGAVTVVSQSNLSSQLGIKPQQVSSSTQVAPTSKVSVFSTPEEQKVAQLA
FT                   YEAIRKVGSDVRVLPSISHLQDQKVLDVVSSQVDAAYQPAQYELGVVAEKLDIAAIVKK
FT                   TAILVQEQSIDIPRILVAPKGEVCSGFNSFKLQLESLKYQPPEDELWIQYLRTGEHQVV
FT                   GFGDEESDEVRLEDYIVNGLIDFDDVSYDDHADLLYGLAQQVVAYFKSYLEEAKVEKIL
FT                   RYHQKDVAHFVHAQMQEHYWEGDTDYDIEVKCGFVPLKESAYSVNGKDSALDYRQAPED
FT                   KSNMAKYLFGGFSKCLYPVQKFDSDTERQVSVILEREAAKWFRPARGQFEIYYRSSTGE
FT                   QEYQPDFVAETEDAIYMLEPKARKEMEASDVLAKKAAAVQWCKNASDFAKTHGGKSWIY
FT                   LLIPHDAIAVNMTLKGLLLFRD"
FT   gene            335952..336332
FT                   /locus_tag="Ppha_0345"
FT   CDS_pept        335952..336332
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0345"
FT                   /product="protein-S-isoprenylcysteine
FT                   O-methyltransferase-like protein"
FT                   /note="KEGG: rba:RB11248 similar to
FT                   protein-S-isoprenylcysteine O-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42678"
FT                   /db_xref="GOA:B4SC98"
FT                   /db_xref="InterPro:IPR007318"
FT                   /db_xref="UniProtKB/TrEMBL:B4SC98"
FT                   /protein_id="ACF42678.1"
FT                   /translation="MVAIFFGLFFLLWATYTQWFIGKGTPAPNAPTQTLVVVGPYKLCR
FT                   NPIELGAIFYYTGIGTLFGTLTVGFICGTLGFVFGTLYHKLIEEKELALRFGQDYLAYK
FT                   KEVPFLFPAIRKSKPGGRFLKS"
FT   gene            complement(336400..336694)
FT                   /pseudo
FT                   /locus_tag="Ppha_0346"
FT   gene            336954..337123
FT                   /pseudo
FT                   /locus_tag="Ppha_0347"
FT   gene            337395..337616
FT                   /locus_tag="Ppha_0348"
FT   CDS_pept        337395..337616
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0348"
FT                   /product="addiction module component, TIGR02574 family"
FT                   /note="TIGRFAM: addiction module component, TIGR02574
FT                   family; PFAM: Putative addiction module component CHP02574
FT                   family protein; KEGG: cch:Cag_0032 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42679"
FT                   /db_xref="InterPro:IPR013406"
FT                   /db_xref="UniProtKB/TrEMBL:B4SC99"
FT                   /protein_id="ACF42679.1"
FT                   /translation="MKHITATDTLELSVPERIQLVEDIWDTISNEPEAVKLSHEEKKII
FT                   DERLEAYHRNPTLGAPWKDVYKRIVSKQ"
FT   gene            337613..337849
FT                   /locus_tag="Ppha_0349"
FT   CDS_pept        337613..337849
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0349"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gsu:GSU0055 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42680"
FT                   /db_xref="UniProtKB/TrEMBL:B4SCA0"
FT                   /protein_id="ACF42680.1"
FT                   /translation="MKHQIIIRPEAENDLRESFLWYEEKRLGLGHDFLLQIEAGLKFIQ
FT                   RNPELTTVEYKEARKHIIKKFPYKIIYLTTVRL"
FT   gene            complement(337865..339013)
FT                   /locus_tag="Ppha_0350"
FT   CDS_pept        complement(337865..339013)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0350"
FT                   /product="transposase IS4 family protein"
FT                   /note="PFAM: transposase IS4 family protein; KEGG:
FT                   cph:Cpha266_2339 transposase, IS4 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42681"
FT                   /db_xref="GOA:B4SCA1"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025399"
FT                   /db_xref="UniProtKB/TrEMBL:B4SCA1"
FT                   /protein_id="ACF42681.1"
FT                   /translation="MYTGKTIFAQLQEHLPIHQFRVCVKRYGGNHKVQSFTCLDQYLCL
FT                   FFAQLTYRESLRDITTCLLGMQNKLYHMGIRGTIARSTLADANEKRDWRIYQDFAQILI
FT                   HKARELYCKDSFGVTLDETVYALDSTTIDLCLSLFPWAKFRTHKGAVKIHTLLDLRGSI
FT                   PSFIAITDGKVHDVNILDMLIIEPGSFYIMDRGYIDFERLFHINESQAFFVTRGKSNLS
FT                   FRRQYSHSVNESTNVRCDQTIMLTSVKSAKEYPDKMRRIKYADPETGKLYVFLTNNFIL
FT                   PAQVIAQLYKSRWKIELFFKWIKQHLRIKAFYGTSENAVKTQIWTAISVYVLIALIKKR
FT                   MNLDISLYTFLQILSVSVFEKVDINQLVTNSAGTIENTYASN"
FT   gene            339338..339601
FT                   /locus_tag="Ppha_0351"
FT   CDS_pept        339338..339601
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0351"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tcx:Tcr_1422 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42682"
FT                   /db_xref="UniProtKB/TrEMBL:B4SCA2"
FT                   /protein_id="ACF42682.1"
FT                   /translation="MDSYQDPQHGKTYISPSLDSFGEPKRKVRIATKLIEHPESYAFAQ
FT                   IKNEVVLRHKEDAKTCITAKFFEDDRGIFVPATRRQWLNENF"
FT   gene            339588..340382
FT                   /locus_tag="Ppha_0352"
FT   CDS_pept        339588..340382
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0352"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tcx:Tcr_1422 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42683"
FT                   /db_xref="InterPro:IPR025359"
FT                   /db_xref="UniProtKB/TrEMBL:B4SCA3"
FT                   /protein_id="ACF42683.1"
FT                   /translation="MKISDEELRRVVLSNVQAQALFQDNQELFAEVIRSAVTKEDVVAV
FT                   GYRKRQLQVFQQLLENDEYFKTVKTQKQCNSEAVWQKFFEKNPWIFGYGLSYIQLSTLD
FT                   DRKLEQVVHGHTVSEHGKRVDALLKTRGVISSLCFVEIKTHKTELLKSRPYRVGCWSPS
FT                   DELSGAIAQVQGTVVLATETIKSKLALTDDVGNPTGEEAFNYMPKSFLVVGSLHEFVGD
FT                   HGVNQERYRSFELFRRNTNSPEIVTFDELYERARFIVHQNET"
FT   gene            340485..341726
FT                   /locus_tag="Ppha_0353"
FT   CDS_pept        340485..341726
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0353"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42684"
FT                   /db_xref="UniProtKB/TrEMBL:B4SCA4"
FT                   /protein_id="ACF42684.1"
FT                   /translation="MFRYDLNSLSPELFAKLCNALLIRTVSEKIRPFDTVGSDAGRDSD
FT                   YDGKGNGDYSELEGYWIFQYKHHDVSRLGVKEARNVIRQEISSELRHLFEPKKKQPDIY
FT                   IMITNVPFSGVVTVGTHDWFSKEITKYSLVHAEIWDYTKLESMIDANYEIHKSFFPDLT
FT                   YTQSFFKQVTDRLSSSIFWEGFEQLLNVSSQSVIVFRSRSDLEYAKNLLWELYDNLNII
FT                   IGVFSTISNYVYSWPEFIDVAEIAVQNPEYKISLGEHHWIEHGGGGGSRNIWTVLRVLI
FT                   KKAENHSWSAHQQVMEIAERYSSVAKTIAENSKRFFNESDYDSFYRENDFLVTPLQFIR
FT                   FKTVQDVLDSLNQLIMSKENGHQGSLEGAWKATEAFHNAILLTDGLRRSVKETLKQLDS
FT                   SLIMSESQTKQGNK"
FT   gene            342033..343055
FT                   /locus_tag="Ppha_0354"
FT   CDS_pept        342033..343055
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0354"
FT                   /product="HNH nuclease"
FT                   /note="SMART: HNH nuclease; KEGG: dra:DR_1533 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42685"
FT                   /db_xref="GOA:B4SCA5"
FT                   /db_xref="InterPro:IPR002711"
FT                   /db_xref="InterPro:IPR003615"
FT                   /db_xref="UniProtKB/TrEMBL:B4SCA5"
FT                   /protein_id="ACF42685.1"
FT                   /translation="MNDVLLVNITWNPKNWTNRYINPRAGHEYARQNAGHESLNFKFDK
FT                   RDIDTEKFIHGFVQWTNPPKKFQNGGLIIFYTKNIDYKKGQVVGVYGKSEIIDPQQHFV
FT                   VKGFQNNQYSINIRAEKRFSILFPVPLSADNYKAKSSDRMVPQVGFTYKDNIFAKKILY
FT                   DELVELSNTGILQSDYKKLSDIYEYYVEEKFELPYCSQDEKEQEELAQFYKQAKIKEEI
FT                   LDELNNLQPSDSEEIIVNKKTYKRDNKTIAQIKILRDFKCQICGVTITKKDRSKYIEAA
FT                   HIKAKHQKGRETIDNIILLCPNHHKEFDLGDRIIKSHDSNFIDFVLNGQQYKISLTTGQ
FT                   "
FT   gene            343198..343593
FT                   /locus_tag="Ppha_0355"
FT   CDS_pept        343198..343593
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0355"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42686"
FT                   /db_xref="InterPro:IPR027826"
FT                   /db_xref="UniProtKB/TrEMBL:B4SCA6"
FT                   /protein_id="ACF42686.1"
FT                   /translation="MKLKLHVFLSVALCLACSDVFAQSYRYDVPVTLEGVLVSSIADPE
FT                   ITYDEKSHQFPAVRLHKSISVLCAPTETDCQPELGVTLLHLVLKKPDMAKFKSLKGKPV
FT                   KLNGTLFHSDNGHHFTSVLLDVGSIIP"
FT   sig_peptide     343198..343266
FT                   /locus_tag="Ppha_0355"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.998 at
FT                   residue 23"
FT   gene            343736..344158
FT                   /locus_tag="Ppha_0356"
FT   CDS_pept        343736..344158
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0356"
FT                   /product="phage shock protein C, PspC"
FT                   /note="PFAM: PspC domain protein; KEGG: aby:ABAYE0373
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42687"
FT                   /db_xref="GOA:B4SCA7"
FT                   /db_xref="InterPro:IPR007168"
FT                   /db_xref="UniProtKB/TrEMBL:B4SCA7"
FT                   /protein_id="ACF42687.1"
FT                   /translation="MADLRISRKGIIQGEFTLEQIIDGARTGNFLPSDDVLQKGSSSWT
FT                   KLGNIEGVEFPKPIVPSPLVECEAPPRPPEYSGIYRSSDQKMLTGFCAGIAHRFGIHHG
FT                   VARFAFVILIIITSSILFWIYWLSLLLPKLPTKDVA"
FT   gene            344219..344347
FT                   /pseudo
FT                   /locus_tag="Ppha_0357"
FT   gene            344352..344528
FT                   /locus_tag="Ppha_0358"
FT   CDS_pept        344352..344528
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0358"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mar:MAE_48580 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42688"
FT                   /db_xref="UniProtKB/TrEMBL:B4SCA8"
FT                   /protein_id="ACF42688.1"
FT                   /translation="MWQDPIVKETRELREEYAEKFNHDPDAIFEDILKRQSQTEKRLVS
FT                   LPPRKPLFKPKAA"
FT   gene            344546..344680
FT                   /pseudo
FT                   /locus_tag="Ppha_0359"
FT   gene            345090..346454
FT                   /locus_tag="Ppha_0360"
FT   CDS_pept        345090..346454
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0360"
FT                   /product="putative PAS/PAC sensor protein"
FT                   /note="KEGG: swo:Swol_0601 signal transduction histidine
FT                   kinase-like protein; TIGRFAM: PAS sensor protein; PFAM: PAS
FT                   fold-3 domain protein; SMART: PAS domain containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42689"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:B4SCA9"
FT                   /protein_id="ACF42689.1"
FT                   /translation="MNDERFQDLQGLVKQQSLMMDSVPIQMWFLTDIFTYGRVNQCHAD
FT                   FMGMRKQAIEFKALRYLFPADVAALCEQSNRQVLETRNTVVSEEWLTDSNGVRHLLEIT
FT                   KTPKFDNNGSVQYIVCCAIIITEQRSAAAALKQHEENFRSFIEKTSDIVVIGNCDGKII
FT                   YSNPVTSDKLGYSSDELRTIQILDLHPKSVQQEATSILTDMFTGKRTTCPLPLMHKNGT
FT                   ILPVETRVWFGKWNGADCIYGVSQDLGREQEALQKFDKLFRMNPALMAVSSIPDRIFTD
FT                   VNDAFLRILGYSADEIIGKTGSEIGIFANEEEQERVANTLACYGNIHEVELKVKTKAGV
FT                   VLDGLFSGDIIESQGVKYYLTVMIDITERKQAEAERQHTIKELRHALNEIKTLRGIVPI
FT                   CASCKKIRDDKGYWEQVEAYVAKHTEAHFSHGICPECMTKLYPEFCKKKDIGITG"
FT   gene            346641..346943
FT                   /locus_tag="Ppha_0361"
FT   CDS_pept        346641..346943
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0361"
FT                   /product="ferredoxin, 2Fe-2S"
FT                   /note="KEGG: cph:Cpha266_0282 ferredoxin, 2Fe-2S"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42690"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B4SCB0"
FT                   /protein_id="ACF42690.1"
FT                   /translation="MQKQREMPYVAHVFVCTNDRGGEKKSCADNNSQLTKDKLKQAVDE
FT                   KGWKGKVRISTSGCMGLCGNGSHVMIYPQKVWFSGVLPDDVDEIVSAIERILEDD"
FT   gene            347175..347642
FT                   /locus_tag="Ppha_0362"
FT   CDS_pept        347175..347642
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0362"
FT                   /product="protein of unknown function UPF0066"
FT                   /note="PFAM: protein of unknown function UPF0066; KEGG:
FT                   ppd:Ppro_1968 protein of unknown function UPF0066"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42691"
FT                   /db_xref="InterPro:IPR023370"
FT                   /db_xref="InterPro:IPR036413"
FT                   /db_xref="InterPro:IPR036414"
FT                   /db_xref="InterPro:IPR040372"
FT                   /db_xref="UniProtKB/TrEMBL:B4SCB1"
FT                   /protein_id="ACF42691.1"
FT                   /translation="MNFQIQQIGTIFSPYKTKAECPIQGSVVPDGKGRIELFAEYVEGL
FT                   ETIETFSHLILFYIFDRAEVIQLSRPTFLDDAAHGVFVSRHPCRPNRIGMSIVKLEKRT
FT                   NNILDVSEIDILDNTPLVDIKPYLPRFDYRENANNGWTETKELREKPKHRE"
FT   gene            347675..347962
FT                   /locus_tag="Ppha_0363"
FT   CDS_pept        347675..347962
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0363"
FT                   /product="divergent AAA ATPase"
FT                   /note="KEGG: mbu:Mbur_0507 divergent AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42692"
FT                   /db_xref="UniProtKB/TrEMBL:B4SCB2"
FT                   /protein_id="ACF42692.1"
FT                   /translation="MLCSADAVTEQVTEQVTEQVTEQVGEDKLLAILEFCSAARSREEI
FT                   QAFLGLKHREHFRAEILAPLLKAGFLVPTIPEKPNSPKQKYVAVKELGNQ"
FT   gene            complement(348052..348498)
FT                   /locus_tag="Ppha_0364"
FT   CDS_pept        complement(348052..348498)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0364"
FT                   /product="alkyl hydroperoxide reductase/ Thiol specific
FT                   antioxidant/ Mal allergen"
FT                   /note="PFAM: alkyl hydroperoxide reductase/ Thiol specific
FT                   antioxidant/ Mal allergen; Redoxin domain protein; KEGG:
FT                   cch:Cag_0205 bacterioferritin comigratory protein, thiol
FT                   peroxidase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42693"
FT                   /db_xref="GOA:B4SCB3"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR024706"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B4SCB3"
FT                   /protein_id="ACF42693.1"
FT                   /translation="MIAEQTKAPAFTLPDSAGKQISLSDFAGKKVLIIFYPGDDTPVCT
FT                   AQLCDYRNNVLEFTKRDIVVLGISSDSQASHKSFAERNKLPFSLLSDTEKSVAKAYDAL
FT                   GFLGMSQRAYVLVDENGVVLLAYSDFLPIIYQPMKDLLAKIDAA"
FT   gene            348949..350154
FT                   /locus_tag="Ppha_0365"
FT   CDS_pept        348949..350154
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0365"
FT                   /product="aminotransferase class V"
FT                   /note="PFAM: aminotransferase class V; aromatic amino acid
FT                   beta-eliminating lyase/threonine aldolase; KEGG:
FT                   pvi:Cvib_0301 aminotransferase, class V"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42694"
FT                   /db_xref="GOA:B4SCB4"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR016454"
FT                   /db_xref="InterPro:IPR020578"
FT                   /db_xref="UniProtKB/TrEMBL:B4SCB4"
FT                   /protein_id="ACF42694.1"
FT                   /translation="MAEMKVYFDHNATTPLHPEVKKEMIEAMEMFGNPSSMHSWGREAR
FT                   ANVEDARGKVAAFIGADEREIVFVGSGSEANNTVLSLFVCASSQCIPGGKLRGTIITTK
FT                   IEHPCVLETSECLAHRGARVKYLDVDQYGKIDLDQLAGMLGDDVGLVSVMMANNEIGTL
FT                   QDIETITKMVHESGAFMHTDAVQAVGKMPVDVRKLGVDFLTLSAHKMYGPKGVGALFVK
FT                   KGIPYCPLIRGGHQEFGRRAGTENTLGILGMGRAVEMRTLEMQEEEERLLHLKQVLRRG
FT                   IEERIDDIHVNGHPTDALASTLNVSFMGVEGESILLYLDLQGIAVSTGSACASGSLDPS
FT                   HVLLATGVNAELAHGSIRFSMGRESSMQEVEYLLDVLPPIIQRIRNMSTAYIKGGLHAA
FT                   TR"
FT   gene            350138..350749
FT                   /locus_tag="Ppha_0366"
FT   CDS_pept        350138..350749
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0366"
FT                   /product="nitrogen-fixing NifU domain protein"
FT                   /note="PFAM: nitrogen-fixing NifU domain protein; BFD
FT                   domain protein [2Fe-2S]-binding domain protein; KEGG:
FT                   cph:Cpha266_2362 nitrogen-fixing NifU domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42695"
FT                   /db_xref="GOA:B4SCB5"
FT                   /db_xref="InterPro:IPR002871"
FT                   /db_xref="InterPro:IPR007419"
FT                   /db_xref="InterPro:IPR041854"
FT                   /db_xref="UniProtKB/TrEMBL:B4SCB5"
FT                   /protein_id="ACF42695.1"
FT                   /translation="MLQPGEWAYSDKLKEHFMNPKNILQGENTDDFDGVGMEGNLQCGD
FT                   QMMVVIKVDKEKETITDCQWKTYGCASAIASTSVLSEMVKGRTLDAAFHISPKEVALEL
FT                   GGLPDHKIHCSVLGDKALRSAINNYYTRNGQEEKVKQEQVKVICQCMSITDHDIEDAVL
FT                   EGARTYFELQERTKLGTVCGQCKDEAELLLEKFKHIHFGA"
FT   gene            350790..352112
FT                   /locus_tag="Ppha_0367"
FT   CDS_pept        350790..352112
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0367"
FT                   /product="RNA modification enzyme, MiaB family"
FT                   /EC_number="1.3.1.74"
FT                   /note="KEGG: cch:Cag_0208 tRNA-i(6)A37 modification enzyme
FT                   MiaB; TIGRFAM: RNA modification enzyme, MiaB family;
FT                   tRNA-i(6)A37 thiotransferase enzyme MiaB; PFAM:
FT                   deoxyribonuclease/rho motif-related TRAM; Radical SAM
FT                   domain protein; Protein of unknown function UPF0004; SMART:
FT                   Elongator protein 3/MiaB/NifB"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42696"
FT                   /db_xref="GOA:B4SCB6"
FT                   /db_xref="InterPro:IPR002792"
FT                   /db_xref="InterPro:IPR005839"
FT                   /db_xref="InterPro:IPR006463"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013848"
FT                   /db_xref="InterPro:IPR020612"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR038135"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4SCB6"
FT                   /protein_id="ACF42696.1"
FT                   /translation="MTTGGKNTFYIHTFGCQMNQADSATITSLLQQAGYVAAESEDRAG
FT                   IILLNTCAVRENAVDRIEHYLQHLQGLKKRDKRLIVGILGCIPQHQREEMFATSPAIDL
FT                   LAGPDTYRTLPQLIEQARSGAKPFSLDFNVAETYEGIDPVRQGSISAFVPVMRGCNNMC
FT                   AYCVVPFTRGRERSHPFRAVMGEVQKLVASGYSEITLLGQNVNSYDDPEQGVNFAALLD
FT                   AVSCAAPQARVRFTTSHPKDISGELVRTIANRPNICNHIHLPVQSGSTATLGRMNRGHT
FT                   IEEYLEKIALIRSLLPGVTLSTDIIAGFCGEQEEDHQASLELLSTLRFDSAYMFYYSTR
FT                   PGTFAARTLVDDVPEVVKKRRLQEIIDLQNTISGELFQQAIGSVVEVLAESESKRSAEQ
FT                   LMGRTPGNRAVVFDREGYRPGDLVRVLITAATSATLTGRPV"
FT   gene            352233..353240
FT                   /locus_tag="Ppha_0368"
FT   CDS_pept        352233..353240
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0368"
FT                   /product="bacteriochlorophyll/chlorophyll synthetase"
FT                   /note="TIGRFAM: bacteriochlorophyll/chlorophyll synthetase;
FT                   PFAM: UbiA prenyltransferase; KEGG: cph:Cpha266_2360
FT                   bacteriochlorophyll c synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42697"
FT                   /db_xref="GOA:B4SCB7"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="UniProtKB/TrEMBL:B4SCB7"
FT                   /protein_id="ACF42697.1"
FT                   /translation="MAVSAKPGFTDKVRAHLELLDPVTWISVFPCLAGGVMASGAMKGT
FT                   LHDYLLLFAIFLMFGPLGTGFSQSVNDCFDLELDRINEPTRPIPSGRLSEKEGLWNSII
FT                   ALLLAMGLGIFMGVHIGGYRGWVIVSSIFAALLVAYLYSAPPFKLKKNILTSAPAVGFS
FT                   YGFVSFISANALFGDIRPEAIWLASLNFFMAVALIILNDFKSAEGDKDGGLKSLTVMIG
FT                   AKKTFLVSFIIIDLVFSVLAYLSYSWGFMIPAFFVLIGLVLNLVLQVQLLRDPKGGISF
FT                   LQGAVDDGFGNAIGKSDIQEHNTFLRFQVANNILFLLNNLLVAGMVGLKYITVQ"
FT   gene            353285..353998
FT                   /locus_tag="Ppha_0369"
FT   CDS_pept        353285..353998
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0369"
FT                   /product="phosphatidate cytidylyltransferase"
FT                   /note="PFAM: phosphatidate cytidylyltransferase; KEGG:
FT                   cph:Cpha266_2359 phosphatidate cytidylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42698"
FT                   /db_xref="GOA:B4SCB8"
FT                   /db_xref="InterPro:IPR039606"
FT                   /db_xref="UniProtKB/TrEMBL:B4SCB8"
FT                   /protein_id="ACF42698.1"
FT                   /translation="MDTLQVTFFSLPVVWHNALVTLMTFVYVFSVPPLMDYLVTNHSLP
FT                   RDISRKITHICAGSAIVFLPLFVDGHWSQYLNITVFAVWTLLLIQKGLFAAEDDQAVKT
FT                   MTRTGDKRELLKGTLYFVLVAMICGTLYYKQAAGVMAMAMLGWGDGLAPIIGTRYGKMK
FT                   YHILSDKSVEGSIAFLVGSLCAGLFFVHLIVPESFDAGKILVIALIATIVEGVSPKEVD
FT                   NLTIPFAVIVASAFL"
FT   gene            354008..354754
FT                   /locus_tag="Ppha_0370"
FT   CDS_pept        354008..354754
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0370"
FT                   /product="metallophosphoesterase"
FT                   /note="PFAM: metallophosphoesterase; KEGG: cph:Cpha266_2358
FT                   metallophosphoesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42699"
FT                   /db_xref="GOA:B4SCB9"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:B4SCB9"
FT                   /protein_id="ACF42699.1"
FT                   /translation="MKKGETQPIYFISDLHIGLQDEKSEQLKMENLERLFAIIKAEGRS
FT                   LYMLGDIVDYWMEFRHLIPKGFTRFLCLLSDLVRHNIEVVYVAGNHDFYLGRYFDDELG
FT                   IKTLYGMHELLYDGRKFIFAHGDGLGKGDLGYKLFARLVRNRFNLALLSGFHPDLAIGM
FT                   MKMFSQFSRAHKPPDRVFQTDRLLNFAESLVVEQEFDYFVCGHNHVKGIRELSAARSSY
FT                   VNLGTWIDGSSPYGVFQNGFFQLREL"
FT   gene            354782..355666
FT                   /locus_tag="Ppha_0371"
FT   CDS_pept        354782..355666
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0371"
FT                   /product="ATP phosphoribosyltransferase"
FT                   /EC_number="2.4.2.17"
FT                   /note="KEGG: cph:Cpha266_2357 ATP
FT                   phosphoribosyltransferase; TIGRFAM: ATP
FT                   phosphoribosyltransferase; PFAM: Histidine biosynthesis
FT                   protein HisG domain; ATP phosphoribosyltransferase
FT                   catalytic region"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42700"
FT                   /db_xref="GOA:B4SCC0"
FT                   /db_xref="InterPro:IPR001348"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR013115"
FT                   /db_xref="InterPro:IPR013820"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="InterPro:IPR020621"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4SCC0"
FT                   /protein_id="ACF42700.1"
FT                   /translation="MDSINQVLKLGLPKGSLQDSTIDLFAQAGFHFSVQSRSYFPSIDD
FT                   DELEAILIRAQEMAHYVELGAFDVGLTGKDWIIETDADVVEVADLVYSKASMRPVRWVL
FT                   CVPESSTVRSVKDLEGKHIATEVVNITRKYLAKNGVNAMVEFSWGATEVKPPDLADAIV
FT                   EVTETGSSLRANKLRIVDTILESNTKLIANKASWNDPWKREKIENMAMLLLGAINAQGK
FT                   VGLKMNAPKSAIDKILAIIPALRQPTISSLAEEQWVALEVIVSEKTVRKLIPELKRAGA
FT                   EGIFEYNINKLID"
FT   gene            355721..356866
FT                   /locus_tag="Ppha_0372"
FT   CDS_pept        355721..356866
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0372"
FT                   /product="glycosyl transferase family 2"
FT                   /note="PFAM: glycosyl transferase family 2; KEGG:
FT                   cph:Cpha266_2356 glycosyl transferase, family 2"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42701"
FT                   /db_xref="GOA:B4SCC1"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:B4SCC1"
FT                   /protein_id="ACF42701.1"
FT                   /translation="MVAMLLYQIVVLLSLLLFLGILLRNMIDLPGMPEHCPEQGVLVSV
FT                   LVPARNEALNIERCVRSLMRQEYAPFEILVLDDDSTDATPELLRRLVVESGGKVRIVQG
FT                   EALPDGWHGKSWACSQLGHQAKGELLLFTDADTTHKPDALRRTVGAMQASGADMLSLMP
FT                   HQELGSFWEKLVVPLVHVILMCYLPLRFVRTSRRAAFCFANGQFILFRRECYTRINGHA
FT                   AVREAIVEDVWLCKSVKKAGGTVVAFNGSDIVSCRMYHNFREIWEGFSKNLFAALGYST
FT                   PGLFVLILMISALYLVPCLFFSYALIAGEFTVSLFWLPLMQMMVALLCRIFIARIFRQS
FT                   LAMTLLHVFSQVVLLAIACNSFYAIKFGKGASWKGRNYNFS"
FT   gene            356988..357938
FT                   /locus_tag="Ppha_0373"
FT   CDS_pept        356988..357938
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0373"
FT                   /product="WD-40 repeat protein"
FT                   /note="PFAM: WD-40 repeat protein; KEGG: cch:Cag_0213 WD-40
FT                   repeat"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42702"
FT                   /db_xref="InterPro:IPR000772"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:B4SCC2"
FT                   /protein_id="ACF42702.1"
FT                   /translation="MGFLSKIFGKKEVELKLPKVIEDVNLIKTMEGHLDRVLGVKFSAD
FT                   GKKLVSGSFDETVMLWDVASGQSLFTMKGHETWVECIDFSRNGKLLASGSTDSTVRIWD
FT                   AETGKCLHVCKGHDTAVRMVAFSPDSKVVASCSRDTTIRRWSVETGEELSRLLGHKSYI
FT                   ECLAYSHNGKTIASCGEEPVIKIWDVESGKNSANYRTNDRLSHALAFSPDDRFIAFCGR
FT                   DAMVKILDAASGEITRVFEGHQDAVRSVCFTPDGSRVVSAANDETVRLWDIESGKQLHL
FT                   YRGHVLEVQSVDVSPDGKIIASGSDDRKIKLWAIR"
FT   gene            358167..358376
FT                   /locus_tag="Ppha_0374"
FT   CDS_pept        358167..358376
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0374"
FT                   /product="cold-shock DNA-binding domain protein"
FT                   /note="PFAM: Cold-shock protein DNA-binding; SMART: Cold
FT                   shock protein; KEGG: cph:Cpha266_2354 cold-shock
FT                   DNA-binding protein family"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42703"
FT                   /db_xref="GOA:B4SCC3"
FT                   /db_xref="InterPro:IPR002059"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012156"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019844"
FT                   /db_xref="UniProtKB/TrEMBL:B4SCC3"
FT                   /protein_id="ACF42703.1"
FT                   /translation="MGTQVEGTVKWFNEEKGYGFIEQKGGKDVFVHHSAINGTGRKTLV
FT                   EGQKVMMEVTQGAKGLQAEDVTPL"
FT   gene            358552..359286
FT                   /locus_tag="Ppha_0375"
FT   CDS_pept        358552..359286
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0375"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: plt:Plut_0248 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42704"
FT                   /db_xref="UniProtKB/TrEMBL:B4SCC4"
FT                   /protein_id="ACF42704.1"
FT                   /translation="MASEPDLIPGIYIYCDRWCERCAFTSRCLQFRLEAEEREGVEALQ
FT                   NFDALNLQFWEEMGEALVQAMRLIREIAVREGLESADLQKETVHSEPPETFQHDAREHP
FT                   CASAALLYAGMVNEWFAIADELPDTEESLLIHPPPSLEEPIQVIRHYQYFIYPKLVRAV
FT                   EGRLSGEASSESEMEADGCGTAKVALIAIDRSLAAWSLIYGEYPSEEDSTLSILVHLDR
FT                   LRRSVEVLFPAARAFIRPGFDA"
FT   gene            359279..360226
FT                   /locus_tag="Ppha_0376"
FT   CDS_pept        359279..360226
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0376"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pvi:Cvib_0314 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42705"
FT                   /db_xref="InterPro:IPR029433"
FT                   /db_xref="UniProtKB/TrEMBL:B4SCC5"
FT                   /protein_id="ACF42705.1"
FT                   /translation="MHRCSGDFFLNKTFIPAYMLHTNEQHLVEFLLQCQPGQPRTRGNW
FT                   EVDHQGRPFLLPSIGGITLNVQVGDPAFGWQGDHIEPGVSCTADTQKPFEHPNVGLQMY
FT                   SCAGNIATIATGEAKGSTGRVIGHHGGSEHVIVDFEREAKEKLLYTDTIIIRAKGQGLK
FT                   LMDYPDITLFNLDPALLHAMKIREAEGCVLEVPVTTLVPAVCMGSGIGSAHVAKGDYDI
FT                   MTSDAETVKEYGIDKIRLGDFVALQDHDNRFGRAYRKGAITIGIVVHSDCLEAGHGPGV
FT                   TTLMTSASPLIRPVLDPKANIADLFGIGTIFARG"
FT   gene            360756..360968
FT                   /locus_tag="Ppha_0377"
FT   CDS_pept        360756..360968
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0377"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sit:TM1040_3853 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42706"
FT                   /db_xref="UniProtKB/TrEMBL:B4SCC6"
FT                   /protein_id="ACF42706.1"
FT                   /translation="MPVTKNEEPTLTHNGKTYNVSELSETAQKQLMNVKIADNEIRRLQ
FT                   MQLAIAQTAHNAYQQALIEALPSQE"
FT   gene            361120..362841
FT                   /locus_tag="Ppha_0378"
FT   CDS_pept        361120..362841
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0378"
FT                   /product="type I secretion system ATPase"
FT                   /note="KEGG: cch:Cag_0740 type I secretion system ATPase,
FT                   PrtD; TIGRFAM: type I secretion system ATPase; PFAM: ABC
FT                   transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42707"
FT                   /db_xref="GOA:B4SCC7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010128"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="UniProtKB/TrEMBL:B4SCC7"
FT                   /protein_id="ACF42707.1"
FT                   /translation="MKQNKEKSPLREALASLIPFLKRAFYFSLVVNVLVLAPSAYMMEV
FT                   YDRVVNSRSHTTLLMLTLLVVGAYLLLEALEWVRRQVMHDAGMKLDKGLREQVFGAVFM
FT                   ARIQNIPGVGAQALRDLKTLREFLPSPGFLAFIDTPLALLVLVIIFLMAPALGWFAVAG
FT                   ALVQFMIGVINERRIREPLLAANRNAMRAQTYADGVIRNAQVIESMGMLGHIHKRWMER
FT                   QQEFLWQQAEASDHAGTNSALSKLVQSLLTSLLLGMGCWLTLKGELHGSGMIVASILGG
FT                   RVLAPLVQVIGSWRQVEGALESFSRLEGLLKEFPLQEKGMSLPEPTGFLAVEGVIAGAP
FT                   RSPVQILKGVSFRVAPGGSLAIVGPSASGKTTLARLLVGVWPAMQGKVRLDGNDIYQWD
FT                   KEELGQYIGYLPQNVELFEGTIAENVARFGDPDDEKVHEACRMVGLSDFIETLPKRFDT
FT                   QIGDDGSFLSGGERQRVALARAVYGMPKFVVLDEPNASLDEAGDAALLNAVKLLRARGT
FT                   TVIVITHRLNILGAIEHMLVLVDGQVQRFGTCQEVMEALQSQSAAQQQPLKPKPQG"
FT   gene            362866..364578
FT                   /locus_tag="Ppha_0379"
FT   CDS_pept        362866..364578
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0379"
FT                   /product="type I secretion system ATPase"
FT                   /note="KEGG: cph:Cpha266_1748 type I secretion system
FT                   ATPase; TIGRFAM: type I secretion system ATPase; PFAM: ABC
FT                   transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42708"
FT                   /db_xref="GOA:B4SCC8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010128"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="UniProtKB/TrEMBL:B4SCC8"
FT                   /protein_id="ACF42708.1"
FT                   /translation="MKPEFFNRSALSRQLWEFRREFMWVGIFSMIANILMLTPTIYMLQ
FT                   VYGRVMKSGSELTLLMVTFFLIFFYAVMAFAEWLRSRLLVRAGVRLDEALNSLVFKASF
FT                   EAYLNRTKHNVAEAFSDLTNIRQFLTANGMIAFFDTPWTPVYIAVIFFLSPFLGYLSIF
FT                   FAFIQLGVTWLSNRMSMKEIQIAADAGNNSYRYVQSKLRNIEPIHAMGMAGNLRQRWFM
FT                   LHDASLAKAEDSLDRQHRQQAFAKFVRYSMQSMTLGAGALMVIEGKMSAGSMIAANVLM
FT                   SRALQPLDLVVATWKPFVQARTAFVRLEKLLEDFPERHPGTKHQDPFGEIRLEGLSASA
FT                   EGREAPILDDLTAMFPSGKVTVVLGPSGSGKSTLARCIVGIWPDTKGRVLIDGEPIESW
FT                   DRMELGPHIGYLPQDIELFDGSIADNIARFAEVDSQKVIEAAKRTGIHEMILRFPHGYN
FT                   TQIGDAGGMLSGGQRQRLGLARAMYGNPALLVLDEPNANLDDAGERSLLEAVKDLRKAG
FT                   KTVILVTHRPTVLAAADLIVLMQNGKIVRCGARDEVLSALRAGSARPASGTPG"
FT   gene            364612..365793
FT                   /locus_tag="Ppha_0380"
FT   CDS_pept        364612..365793
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0380"
FT                   /product="secretion protein HlyD family protein"
FT                   /note="PFAM: secretion protein HlyD family protein; KEGG:
FT                   cph:Cpha266_1747 secretion protein HlyD family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42709"
FT                   /db_xref="GOA:B4SCC9"
FT                   /db_xref="InterPro:IPR039562"
FT                   /db_xref="UniProtKB/TrEMBL:B4SCC9"
FT                   /protein_id="ACF42709.1"
FT                   /translation="MSIRDIMAKVKLAPDEKETGNKGEEYRDTRGPVKLGIWILLIGFG
FT                   SFLLWAAFAPLDEGVPCQGLVSIATKRKVVENLRGGRVEKVNVREGQMVKEGDVLIMLD
FT                   SQTARARYDEVHQHYLGMRATADRLIAEMRGAPSITFHKDLLTEPDRQLAQQNMQNQRQ
FT                   LFLSRRVSLQILNKQLEAMTSLAREGYAPLNQQHELELKIAEFKSSTASQLAQVQLEVE
FT                   ADGEKTRALAEELADTEVRSPASGQVVGLQVQTVGAVIQPGQKIMDIVPLHESLLIDTK
FT                   VAPHLIDSIHNGLPVDVSFSSFAHSPQLVVEGVVESLSKDIVTDPQVNPMTPGASYYLA
FT                   RVSVTPEGMTSLGRREMQPGMPVQVVIKTGERSLLTYLVDPLIKRIAVSMKEE"
FT   gene            365832..367169
FT                   /locus_tag="Ppha_0381"
FT   CDS_pept        365832..367169
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0381"
FT                   /product="type I secretion outer membrane protein, TolC
FT                   family"
FT                   /note="TIGRFAM: type I secretion outer membrane protein,
FT                   TolC family; PFAM: outer membrane efflux protein; KEGG:
FT                   cph:Cpha266_1746 type I secretion outer membrane protein,
FT                   TolC family"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42710"
FT                   /db_xref="GOA:B4SCD0"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="InterPro:IPR010130"
FT                   /db_xref="UniProtKB/TrEMBL:B4SCD0"
FT                   /protein_id="ACF42710.1"
FT                   /translation="MKLWICLIAFAGMFIALPLYGDPIDLSTALQKAREYDARLGAAQA
FT                   DNLIYREEVGRARAQLRPSVRMNAARGRNATQYTSLAGRTTASYYNSINYGVSVRQPLL
FT                   NLSNFVGYKQAKAVAVKSDIDLQKEDASLMVRIAEAYCNALYAEDNLDFSQTLVKAAEE
FT                   QLQQAKKRFEKGFGTVTEISEAQAGYDMALADGLEIVNSVEFTRRELEHLTGEYPDELC
FT                   RVVPEKLLLAQPEPGNVQSWIDLALVNNYDVVGGHQEIKIAKKEIEKQKFSRYPTVDLV
FT                   AGRNYSESENNYSIGSIYDTYSVSLQMSMPIYTGGYASASVRQAYAKRLKAEEQLSAQE
FT                   RGVQSDVRKYYNGIVSSIAQIHAYEQAVQSHEIALTGTKKGFEAGLRTNVDVLDAQQKL
FT                   FSSRRNLAKSRYQYILNRLMLKQASGTLSAGDVEEVNGWLATTKRL"
FT   sig_peptide     365832..365897
FT                   /locus_tag="Ppha_0381"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.998 at
FT                   residue 22"
FT   gene            367353..369278
FT                   /locus_tag="Ppha_0382"
FT   CDS_pept        367353..369278
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0382"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter transmembrane region; ABC
FT                   transporter related; SMART: AAA ATPase; KEGG: cch:Cag_1482
FT                   ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42711"
FT                   /db_xref="GOA:B4SCD1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="UniProtKB/TrEMBL:B4SCD1"
FT                   /protein_id="ACF42711.1"
FT                   /translation="MKLFIRLVRYLLPSKGKIVLVVVVSIMSSLLGVVSIYSVLPLLNA
FT                   VFTAESTIDAPVHLEAKAPGEKRVEKKESSGLGAFQGIDTEKLKASVTENFEEIFHAET
FT                   KERTLLNICLFLIASFAVKNLFVYLNGQIIFRIQTKTAKKLRDDVFSNIIEMHLDYFNK
FT                   NRVGNLMNLVYNDVQAVNNTVSSTFVNFLQNPFSVFVYVTVLVVLSWKLTLFASLTSLM
FT                   IFFVIRTIGKQVKGLATSFRNTMGDMNSVLQEKFSGIKVIKSSAFENVELERFQAFTRG
FT                   FRNLDIRIARLRNIIGPLNETLLVAAIALVLWFGGLQVFEGRMTSSELILFAFTLYSTM
FT                   GPIKMFGDVNTQMALGMISAERLFELLDTVPDIKNGTRAIKGFEHDIRFEDVCFKYAKD
FT                   SDAPNVLDHVSFELNKGEMVALVGQSGSGKSTAVDLLLRFYDVDSGRITIDGIDIREYD
FT                   FKQLRRMIGVVSQEVILFNDTIKANIAYGTHDEVGLERVIVAAKMANANQFIEEKPEQY
FT                   DTLIGDRGVQLSGGQRQRLAIARAMVKNPELLIFDEATSALDNESEKVVQQAIDHALEN
FT                   RTALVVAHRLSTIRNADRIIVMDRGRAAESGNHEELLQINGLYKHLYEIQFSGKVVENG
FT                   ASLPVS"
FT   sig_peptide     367353..367451
FT                   /locus_tag="Ppha_0382"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.867) with cleavage site probability 0.578 at
FT                   residue 33"
FT   gene            369281..370270
FT                   /locus_tag="Ppha_0383"
FT   CDS_pept        369281..370270
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0383"
FT                   /product="glycosyl transferase family 2"
FT                   /note="PFAM: glycosyl transferase family 2; KEGG:
FT                   cte:CT0216 glycosyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42712"
FT                   /db_xref="GOA:B4SCD2"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:B4SCD2"
FT                   /protein_id="ACF42712.1"
FT                   /translation="MAASLYNNSLSVSAIIAVYNPDLFYFKQAVASVLSQIFPVQELVL
FT                   VNDGGSETFRSILPDDERIRVFSKQNEGVAAARNFALEQCRGEYIALLDQDDYWYPDKL
FT                   CEQMAMIPVPGEPCMVTSPVDIVVANGSVQNKISRRKSDEYRWKTSQENVLLSLFEGNF
FT                   IYSSTPLIHRAVFEKAGGFDPWTQPHDEWDLYLRIVLAGFSLYCYREKPLSVWRSHDAN
FT                   ESNKLNVMMCSKCRVEKKLLKTVADDVIRRILATNLLIDLLERVNLLYKQREYRRFRAL
FT                   VIIHLFRLLRHKYNFRGVGIELHRAYSDRVRKIALKSARRYVVSYFML"
FT   gene            370487..371641
FT                   /locus_tag="Ppha_0384"
FT   CDS_pept        370487..371641
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0384"
FT                   /product="glycosyl transferase"
FT                   /note="KEGG: cte:CT0219 glycosyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42713"
FT                   /db_xref="GOA:B4SCD3"
FT                   /db_xref="UniProtKB/TrEMBL:B4SCD3"
FT                   /protein_id="ACF42713.1"
FT                   /translation="MPVSGYLLFFISQGGSAAGNNPARESGLSLNTRYYLMLFVMALKI
FT                   LCLHVAEDQASYRYRVEQFLPFWEEYGIEMHTVRITGKSYPEKLRLALGSKKYDYVWLQ
FT                   RKLLALFFITLIARRSRLLYDYDDALYARESYIDGLPKKPTKPGSKQSISRLNSLLKRT
FT                   SMVFAGSDALVNYARQFNPDGTFLVPTAFSKVPELPVRVSCSDDRVTFGWIGNNLNLFF
FT                   LSLIDDAASSLQARYPAVRFSVMSGKPPEGLKTCWNFVSWSKEAEVEWLESIDIGMMPL
FT                   VDDEWSRGKCAFKLLQYMAHGKPVIASAVGANRAAVIDGVSGYLASSSAEWLAAFESLV
FT                   TSPDRRRAMGKESCKHFLQTYERQKVQEQMADLLHRHFNQTQQH"
FT   gene            complement(371651..371980)
FT                   /locus_tag="Ppha_0385"
FT   CDS_pept        complement(371651..371980)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0385"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pvi:Cvib_0686 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42714"
FT                   /db_xref="InterPro:IPR023296"
FT                   /db_xref="UniProtKB/TrEMBL:B4SCD4"
FT                   /protein_id="ACF42714.1"
FT                   /translation="MYMIPECAKSRQIKLYKAAPFPGKWEQCATLIKSNKRYPPLLDPS
FT                   IVLHDGRWYLFSFARKLQNLHLFSSDTLYGPWTEHPKSPVIRATTKKRLPMTLSFSQGK
FT                   SIGIV"
FT   gene            complement(372120..373172)
FT                   /locus_tag="Ppha_0386"
FT   CDS_pept        complement(372120..373172)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0386"
FT                   /product="glycosyl transferase family 9"
FT                   /note="PFAM: glycosyl transferase family 9; KEGG:
FT                   cte:CT0221 heptosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42715"
FT                   /db_xref="GOA:B4SCD5"
FT                   /db_xref="InterPro:IPR002201"
FT                   /db_xref="UniProtKB/TrEMBL:B4SCD5"
FT                   /protein_id="ACF42715.1"
FT                   /translation="MKQRKKKKKRVLRQVFARFLQLTAPKRTSGIPFTGKLRSIAILAQ
FT                   EKLGDSVLLTPLLKNLRIQYPKLAIHIITFSQSSFDFFCCDPNVTAVHQVKKNPLNYFK
FT                   EVLTHRFDLLFNTKDHPSTHFLLQSALIRARYKVGHACEFHEGLFDHLIAIPFHSHMAM
FT                   KNCALLTLFGSHPPNDQCRPSLPPMPVSDAIVMFLQKIAVKTIIGINLSAGEMNRQWLE
FT                   KSWEELLQLYSDETFIVLSGPEGREEKQRIETRFSNVLASPSTQNIYEAGLIIATVKLL
FT                   ITPDTSLIHVASCYDIPVIGLYREAPQDLSRFGPLFIPFELIISATGEVSDISVTAVAE
FT                   KVQLLAKKVE"
FT   gene            complement(373169..374263)
FT                   /locus_tag="Ppha_0387"
FT   CDS_pept        complement(373169..374263)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0387"
FT                   /product="glycosyl transferase group 1"
FT                   /note="PFAM: glycosyl transferase group 1; KEGG:
FT                   cph:Cpha266_0359 glycosyl transferase, group 1"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42716"
FT                   /db_xref="GOA:B4SCD6"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:B4SCD6"
FT                   /protein_id="ACF42716.1"
FT                   /translation="MNILFINSIGREKFGGGEKWMVNAAKGLAERGHHVTLGSKKNSKT
FT                   LNYAASQGVETTVFEIRGDFSPLNTLKIAAFLKVHAIDLIICNLNKDVRVAGLAARLYG
FT                   KTTVLARHGMLLCSKKRKHEFTLTKLADGIITNSTTIREAYHNYGWFDDQFVKVIYNGL
FT                   IIPPHVCAYDFSNCYPDKKIIYSAGRLSEQKGFSYLIEAAAILKKTRNDLIFTISGEGK
FT                   LETELKKQVTDIGLEDSFIFLGYADDIYPYLKGCDLFVLASLFEGMPNVVMEAMAMKKP
FT                   VIATDVNGARELMDEGRTGLIVPPKDPEALASAITSIIDNPVKLAEFGRAGYERVNREF
FT                   TMAAMLNNLEQHLQQKIIEKKSRL"
FT   gene            complement(374332..375384)
FT                   /locus_tag="Ppha_0388"
FT   CDS_pept        complement(374332..375384)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0388"
FT                   /product="glycosyl transferase group 1"
FT                   /note="PFAM: glycosyl transferase group 1; KEGG:
FT                   cch:Cag_1472 glycosyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42717"
FT                   /db_xref="GOA:B4SCD7"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="UniProtKB/TrEMBL:B4SCD7"
FT                   /protein_id="ACF42717.1"
FT                   /translation="MNILFTCSARKWGGNEAWVLHAADVMAKKHHCLLAYRKDEIGERF
FT                   NIKKFQLPFHHEADLYTLARLVSIIKEHHIDIVVPTKRKDYFLAGIACKLTKAKNILIL
FT                   GIVRDLKNKGINELVYHRLADGIMVNAHMIKDVLLQSSYMKSKNIAVIPNGLFIDVNKI
FT                   EAIEKKFDFTITSLGELSERKGFDFLITGFALFVSQNSIDNAGLIIIGTGGQLDALKEL
FT                   TRSLNIERLVTFTGFIKNPYPYLATSDIFALTSRNEGIPYATLEAALLDNAIITTRAGG
FT                   VEEVLTHNQHCLFVEYGEEQSLADHLMHLYRDVPFRKKIACEAKSVAVEQFSLEKMEKE
FT                   MIEFFRFVQQ"
FT   gene            complement(375554..376633)
FT                   /locus_tag="Ppha_0389"
FT   CDS_pept        complement(375554..376633)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0389"
FT                   /product="glycosyl transferase group 1"
FT                   /note="PFAM: glycosyl transferase group 1; KEGG:
FT                   pvi:Cvib_0692 glycosyl transferase, group 1"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42718"
FT                   /db_xref="GOA:B4SCD8"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:B4SCD8"
FT                   /protein_id="ACF42718.1"
FT                   /translation="MNILFMNSARTWGGTEKWTHMAAEAISKKHKTFLVYRRNIVGERF
FT                   TIPGFRLPCLSHIDLYTVVRLVHIIQKKQIDIIIPTKRKDYLMAGLAGKITGKSVILRL
FT                   GADRKLLWPWQRFMYHTLTDGIIVNAKKIKETLLETGYIPQEKIRVIYNGLDTAEIEGR
FT                   ILEPINKPFPFVISALGRITRNKGFDFLIRSFARFLALSGAKNAGLVIIGEGTDRQEFE
FT                   ILTENLGITDKVLFTGFLQNPFPLIAISDIFAMVSTNEGLSNALLEAMYLCCPPLSTYA
FT                   GGVREVITDNKNGFLFDYGDEEALATLLLQLYRDERQRIQLGKNARETVLRKFSIPVMT
FT                   QEIMQFCRETIERHPGKDG"
FT   gene            376815..377780
FT                   /locus_tag="Ppha_0390"
FT   CDS_pept        376815..377780
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0390"
FT                   /product="Abortive infection protein"
FT                   /note="PFAM: Abortive infection protein; KEGG:
FT                   plt:Plut_1789 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42719"
FT                   /db_xref="GOA:B4SCD9"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="UniProtKB/TrEMBL:B4SCD9"
FT                   /protein_id="ACF42719.1"
FT                   /translation="MQTFFSSDPFAARRPSFFANTLFLIVVMLLYPLAGVLLFSFVGSG
FT                   REATFSLLPIERGMLPLIRLVQVVGQLLVLALPVLLLSAWHTGRKNPFSREGFAFLGIG
FT                   KSVDFSVTALAVGGIFLLQPLLYTLIALQDLYLWTALGAAGREVVRQRDLMDSFIKELA
FT                   LVRTIPELFLVAFVLAFTPAVCEELLFRGYIQQNYTRSMSSGSAVLLTGCIFALFHLSA
FT                   ANLLPLVLLGWYIGYIYSLTGNLVIPFFVHFSNNLAALLLLVFFEGSRSAGITGSAALI
FT                   FSPWWWLVVAGSLFLFVLVLWRLFADFSSRDGVVRAGVFH"
FT   gene            377808..378629
FT                   /locus_tag="Ppha_0391"
FT   CDS_pept        377808..378629
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0391"
FT                   /product="phosphatidate cytidylyltransferase"
FT                   /note="PFAM: phosphatidate cytidylyltransferase; KEGG:
FT                   cch:Cag_1470 phosphatidate cytidylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42720"
FT                   /db_xref="GOA:B4SCE0"
FT                   /db_xref="InterPro:IPR000374"
FT                   /db_xref="UniProtKB/TrEMBL:B4SCE0"
FT                   /protein_id="ACF42720.1"
FT                   /translation="MGKLLSVNLLQRIVVALAGIPLLLWLIQLGGLWFFLFFSLLALLA
FT                   VFEFHRLALHKAHPPALWIVLLITALFQANFYLHWAEVWELMLAVVLSLLVMELFLKEG
FT                   SPLLNLGAILPGLLYVNLSFGSLLRLRLDAADGKGEIMVFLMFFCVWSADIFAYFGGSS
FT                   LGGKFIHRKLFERLSPHKTWEGFLSGLAGSVAAAMIYGSFIPQLPVSTALLTGLLIGLA
FT                   SPAGDLIESMFKRDAGVKDSSGLIPGHGGVLDRFDTIMFVSPFIYFITMHL"
FT   gene            378756..379226
FT                   /locus_tag="Ppha_0392"
FT   CDS_pept        378756..379226
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0392"
FT                   /product="putative PTS IIA-like nitrogen-regulatory protein
FT                   PtsN"
FT                   /note="PFAM: phosphoenolpyruvate-dependent sugar
FT                   phosphotransferase system EIIA 2; KEGG: plt:Plut_1787
FT                   putative PTS IIA-like nitrogen-regulatory protein PtsN"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42721"
FT                   /db_xref="GOA:B4SCE1"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR004715"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="UniProtKB/TrEMBL:B4SCE1"
FT                   /protein_id="ACF42721.1"
FT                   /translation="MKIEGLLSEKYVVLNLELALKSQVIEKMLSIVTDHPGVVDIGKLR
FT                   EDVLKREQEMSTGIGKTLALPHAKSSGVTQPVMAFATLSRAINFDSIDNEPVRIVFLLA
FT                   TPEDMLAEHLKLLGRITRLAGRDDVRKRLVLARSAGEVIELFREEEKDFPQI"
FT   gene            379258..380547
FT                   /locus_tag="Ppha_0393"
FT   CDS_pept        379258..380547
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0393"
FT                   /product="histidyl-tRNA synthetase"
FT                   /EC_number="6.1.1.21"
FT                   /note="KEGG: cte:CT0236 histidyl-tRNA synthetase; TIGRFAM:
FT                   histidyl-tRNA synthetase; PFAM: tRNA synthetase class II (G
FT                   H P and S); Anticodon-binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42722"
FT                   /db_xref="GOA:B4SCE2"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR004516"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR015807"
FT                   /db_xref="InterPro:IPR033656"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="InterPro:IPR041715"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4SCE2"
FT                   /protein_id="ACF42722.1"
FT                   /translation="MPQYQAVKGTRDIFPEEAARWKYVEGVVHAIASLYGFSEIRTPVF
FT                   EYTELFQRGIGSTTDIVGKEMFSFLPDPKGRSLTLRPEMTAGVMRAALQNNLLSSAPVQ
FT                   KLYYIGELFRKERPQAGRQRQFSQFGAELLGVSSPAAVAEVITLMMQLFASLGLRSLKL
FT                   RINSLGDTEDRLRYREALQLYFTPFHELLDDASKERLEKNPLRILDTKNPALQELVAGA
FT                   PRLYDYLKDASLQDFEKVLFYLEERDIAYEIDYRLVRGLDYYCNTAFEVTSSELGAQDA
FT                   IGGGGRYDGLARELGSSVDVPASGFAVGMERLLITMEKQGLFATLAPQGPLVYVIVQQQ
FT                   DLADNALQIVWRLRKAGIKTEVDLAARSMKAQMREANKIKAAYALFIGTTEETTGLYAL
FT                   KNLETSEQITLTLEAVLELLREQAVGEQLD"
FT   gene            380547..380798
FT                   /locus_tag="Ppha_0394"
FT   CDS_pept        380547..380798
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0394"
FT                   /product="glutaredoxin 2"
FT                   /note="PFAM: glutaredoxin; glutaredoxin 2; KEGG: cte:CT0237
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42723"
FT                   /db_xref="InterPro:IPR008554"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B4SCE3"
FT                   /protein_id="ACF42723.1"
FT                   /translation="MTIMNHIVILYGKKECCLCDEAMEVLQKVKASLPFELQKIDISTN
FT                   PELLEEFGLTIPVVFVDGIQVFKYRINEKKLRLLLTPV"
FT   gene            380927..381130
FT                   /locus_tag="Ppha_0395"
FT   CDS_pept        380927..381130
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0395"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cch:Cag_1465 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42724"
FT                   /db_xref="UniProtKB/TrEMBL:B4SCE4"
FT                   /protein_id="ACF42724.1"
FT                   /translation="MLKFILLLIVVYLVMRTVVRILRGGLFFINKGSSTQSERPSSSKR
FT                   QIEEADYEVIASDLKNKEHDTK"
FT   gene            381260..381781
FT                   /locus_tag="Ppha_0396"
FT   CDS_pept        381260..381781
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0396"
FT                   /product="protein of unknown function DUF150"
FT                   /note="KEGG: pvi:Cvib_1563 protein of unknown function
FT                   DUF150"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42725"
FT                   /db_xref="GOA:B4SCE5"
FT                   /db_xref="InterPro:IPR003728"
FT                   /db_xref="InterPro:IPR028989"
FT                   /db_xref="InterPro:IPR035956"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4SCE5"
FT                   /protein_id="ACF42725.1"
FT                   /translation="MQERINNCVTQVLAESAGTRGEGAYLIDIKVKGKGSGRKIEILMD
FT                   ADDGIRIHQCAYISRRVRERIEGDDDLLELVGENFDLMVSSPGLGEPIIIPRQYIRHVG
FT                   KLLQVTYADSNGDPVELVGHLQEVSLLDEHGAKIVIMPEQKKKKGQQPKTEAVILYLNQ
FT                   VIRAIPEAEL"
FT   gene            381840..383384
FT                   /locus_tag="Ppha_0397"
FT   CDS_pept        381840..383384
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0397"
FT                   /product="NusA antitermination factor"
FT                   /note="TIGRFAM: transcription termination factor NusA;
FT                   PFAM: KH type 1 domain protein; NusA domain protein; KEGG:
FT                   cph:Cpha266_0368 transcription elongation factor NusA"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42726"
FT                   /db_xref="GOA:B4SCE6"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR010213"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013735"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR025249"
FT                   /db_xref="InterPro:IPR030842"
FT                   /db_xref="InterPro:IPR036555"
FT                   /db_xref="UniProtKB/TrEMBL:B4SCE6"
FT                   /protein_id="ACF42726.1"
FT                   /translation="MVRKKIKDEGQDRRLQIASAFGEIEQSKIFLDKRTESAAVKMDIA
FT                   DLLKDIIQKQLRKDYDPEVESNIFINPERGDFEVYILKKIVEEIDIESIEITLKEVRKI
FT                   DDSLEIGDYYEEGPIRLEDYLSRKSIQIIKQSVQKKVRDLERLVVYEECLEKVGEIVAG
FT                   EVYQVRANEVIFTYNTSKDHRVELVLPKSEMMKKDNPRRTPRMKLYVKRIEREKAKVRL
FT                   DDGSMVEREKADGGMKVIVSRVDDRFLYKLFEHEVPEILDGLIVIKAIARVPGERAKVA
FT                   VESTSARIDPVGATVGYRGKRIQSIVKELNNENIDVIYYADEPQIYISRAMQPAKIDPL
FT                   TVHADVKTRKARVMLKPDQIKYAIGKNGNNIHLAEKLTGYEIDVYRDVIDKSTEDPTDI
FT                   DIIEFREEFGDDMIYQLLDGGLDTAKKVLKAGVDEIELSLLGSSKPEEQTVFGKSYKTG
FT                   VKPRERKVTDEEKRYWKKIAENIYKTVKEQFTEADLEALFDDEIEPETDDLAVEKS"
FT   gene            383447..386407
FT                   /locus_tag="Ppha_0398"
FT   CDS_pept        383447..386407
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0398"
FT                   /product="translation initiation factor IF-2"
FT                   /note="TIGRFAM: translation initiation factor IF-2; small
FT                   GTP-binding protein; PFAM: protein synthesis factor
FT                   GTP-binding; GTP-binding protein HSR1-related; elongation
FT                   factor Tu domain 2 protein; translation initiation factor
FT                   IF-2 domain protein; Miro domain protein; KEGG:
FT                   cch:Cag_1462 translation initiation factor IF-2"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42727"
FT                   /db_xref="GOA:B4SCE7"
FT                   /db_xref="InterPro:IPR000178"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006847"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR015760"
FT                   /db_xref="InterPro:IPR023115"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036925"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4SCE7"
FT                   /protein_id="ACF42727.1"
FT                   /translation="MALEDMEKKYRISDIARELQVSPQEVLLFVKQEGGRVASTSSMVG
FT                   EEIHGLIFGHFSVEKKMVDETKKIRAEKEKRLSRLEEQSRKTYEKEQHLSETLSPPAPP
FT                   LVVVHEPKKEVIVAAPIENIPEPPSKPLEIPVAETPASEEPDAPPAVTELIEQPVVIEQ
FT                   QPLAPVSDAPVPPVIIELPVPSEVPESQVLPESRVLPESQVLSESPLLPEPPVLSEPQE
FT                   QQELPELPELPEIPALPEPAPKKEEPSVNEHLVSFDAPQMMGGLTVLGTLDMQAGRHKK
FT                   NRKKNFQEQADALKDEFEPKPAEESRVEEKVVVAKKPPVKAAADVKPKPVVADSSSSAK
FT                   KKGKKKKKPAVDDKVISANIQKTISGIDDRSSTGSRQKFRKMRRNEREREHEEDEAFRE
FT                   AQRLVVRVTEYASPHELAELMGITAKDIIQKCFALGKFVTINQRLDKESIELIALEFGF
FT                   EAEFISEVEATAVIVTEDAEADMQTRPPVVTIMGHVDHGKTSLLDYIRNSKVVAGESGG
FT                   ITQHIGAYEVTVEGDRKITFLDTPGHEAFTAMRARGAQVTDIVILVVAADDSVMPQTIE
FT                   AINHAKAAGVPIVVALNKIDKVEANPEKIKTQLSEAGVLVEEWGGVYQCQEISAKKGIG
FT                   IAELMEKVLTEAEMRELRGNYSREVPASGIIVESELDKGKGVISTVLVQRGILKVGDPF
FT                   VAGNTMGKVRALMDERGKRIPFANPSQPVRVLGFEDLPQSGDALTVMVTDREARDLAQK
FT                   RQVIRREHDFRRSTRVKLDSIARQIKEGLMKELSVIIKADTDGSIQALADGLMKIQNEE
FT                   VKVQIIHQGVGQITETDVLLAAASDAIIIGFRVRPNVNAKKLAEKEDLDVRFYSVIYHV
FT                   LEDVEKALEGMLSPELHEESLGSLEIRQIFKVPKIGNVGGCYMLEGKMFRDSKVRLLRD
FT                   GVQIYEGQLAALKRFKDDVKEVDAGYECGMSLKNYDDIKVGDIVEAYKIVEKKRKL"
FT   gene            386426..386785
FT                   /locus_tag="Ppha_0399"
FT   CDS_pept        386426..386785
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0399"
FT                   /product="ribosome-binding factor A"
FT                   /note="PFAM: ribosome-binding factor A; KEGG: pvi:Cvib_1560
FT                   ribosome-binding factor A"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42728"
FT                   /db_xref="GOA:B4SCE8"
FT                   /db_xref="InterPro:IPR000238"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR023799"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4SCE8"
FT                   /protein_id="ACF42728.1"
FT                   /translation="MSIRTERVASLLQQELGAILQKELPRSGPIITVVEVKITADLSIA
FT                   RAYVSIIGTPEEQQEAMALLQDKTKSIRKILSSKIRHHFRRIPELEFHEDHLYERANRI
FT                   EQLLSGVRKSSAENV"
FT   gene            386812..387537
FT                   /locus_tag="Ppha_0400"
FT   CDS_pept        386812..387537
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0400"
FT                   /product="tRNA pseudouridine synthase B"
FT                   /note="TIGRFAM: tRNA pseudouridine synthase B; PFAM:
FT                   pseudouridylate synthase TruB domain protein; KEGG:
FT                   cch:Cag_1460 tRNA pseudouridine synthase B"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42729"
FT                   /db_xref="GOA:B4SCE9"
FT                   /db_xref="InterPro:IPR002501"
FT                   /db_xref="InterPro:IPR014780"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/TrEMBL:B4SCE9"
FT                   /protein_id="ACF42729.1"
FT                   /translation="MDEQRIREPLPDEGSFLLIDKPLDWTSFDVVAKIRNTYKQSGLKR
FT                   KVGHCGTLDPKATGLLILATGKKTKEIATLEVLDKVYDGAIKLGAMTESHDVETMEYGQ
FT                   CGVAHLTESEIRIAASTFEGRRQQQPPMHSAAWHNGKRLYEHARKGVVIKERKAKEIVI
FT                   HRFEVIRVELPMVYFSLHVSKGAYIRVIAHELGTLLGVGGYLASLTRVSIGPYALSSAK
FT                   TVSDTVEDILQQASNALPG"
FT   gene            387556..388517
FT                   /pseudo
FT                   /locus_tag="Ppha_0401"
FT   gene            388566..388835
FT                   /locus_tag="Ppha_0402"
FT   CDS_pept        388566..388835
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0402"
FT                   /product="ribosomal protein S15"
FT                   /note="PFAM: ribosomal protein S15; KEGG: cch:Cag_1458 30S
FT                   ribosomal protein S15"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42730"
FT                   /db_xref="GOA:B4SCF0"
FT                   /db_xref="InterPro:IPR000589"
FT                   /db_xref="InterPro:IPR005290"
FT                   /db_xref="InterPro:IPR009068"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4SCF0"
FT                   /protein_id="ACF42730.1"
FT                   /translation="MSLTKEFKADVIKQFGASEKNTGKSEVQVALYTRRISDLTGHLQL
FT                   HPKDKHSRRGLLMLVAKRKKMLNYVKNIDIDRYRKVIAELDLRK"
FT   gene            388926..389813
FT                   /locus_tag="Ppha_0403"
FT   CDS_pept        388926..389813
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0403"
FT                   /product="domain of unknown function DUF1732"
FT                   /note="PFAM: YicC domain protein; domain of unknown
FT                   function DUF1732; KEGG: cch:Cag_1457 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42731"
FT                   /db_xref="InterPro:IPR005229"
FT                   /db_xref="InterPro:IPR013527"
FT                   /db_xref="InterPro:IPR013551"
FT                   /db_xref="UniProtKB/TrEMBL:B4SCF1"
FT                   /protein_id="ACF42731.1"
FT                   /translation="MLESMTGYGSAESVESGVRTLVELRSVNNRFAEISVKLPRQLLSF
FT                   ELEVREMIRAHFQRGKIAAFIQIQLDDAQPIPVSINTAKVKAYKELLDTLNREAGFGTP
FT                   VLLEHLLRFPEIFDNGTTSLDQVDQHWPFVKNLLQEAIERLKAMRRREGEELSIDFRGR
FT                   IAEIENTLKLITLLAADNLEAVRTRLAAKVEAVAGKDLVYSRDRLEMELVLAADKLDIT
FT                   EELTRFASHNKFFIEELQNDESGTGRKLNFLLQEQLREANTIASKSQNAEISQKIVQIK
FT                   EDLEKIREQLQNIE"
FT   gene            389818..390402
FT                   /locus_tag="Ppha_0404"
FT   CDS_pept        389818..390402
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0404"
FT                   /product="Guanylate kinase"
FT                   /EC_number="2.7.4.8"
FT                   /note="KEGG: plt:Plut_1773 guanylate kinase; PFAM:
FT                   guanylate kinase; SMART: guanylate kinase/L-type calcium
FT                   channel region"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42732"
FT                   /db_xref="GOA:B4SCF2"
FT                   /db_xref="InterPro:IPR008144"
FT                   /db_xref="InterPro:IPR008145"
FT                   /db_xref="InterPro:IPR017665"
FT                   /db_xref="InterPro:IPR020590"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B4SCF2"
FT                   /protein_id="ACF42732.1"
FT                   /translation="MVDALQHKGKLIVFSAPSGTGKSTIATMVLERIPNIQFSVSATTR
FT                   TKRAGEQEGVNYYFLTREEFEEKIRNGGFIEHEFFFGNHYGTLLDKTEQIIDRGTHMLL
FT                   DLDVKGAMNVRQLFPGNSLLLFLKPPSIEVLEERLKGRESEDEESLKARLERARLELGY
FT                   ADRFDEVIVNDHLDDAVEAVTAIVSKFLSNT"
FT   gene            390414..390767
FT                   /locus_tag="Ppha_0405"
FT   CDS_pept        390414..390767
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0405"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: plt:Plut_1772 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42733"
FT                   /db_xref="UniProtKB/TrEMBL:B4SCF3"
FT                   /protein_id="ACF42733.1"
FT                   /translation="MPVKPVDLNKLRSAHSNLYETVVAISKKAKRLHDEERAELEDKLL
FT                   PYKEMIRNPSSESESDKIFPEQIAISLEFEVREKSSHKAVADYFAQKYNYTLEKPAEKK
FT                   IIQVEEDDETDGD"
FT   gene            390745..391245
FT                   /locus_tag="Ppha_0406"
FT   CDS_pept        390745..391245
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0406"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; KEGG: cph:Cpha266_0377
FT                   glyoxalase/bleomycin resistance protein/dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42734"
FT                   /db_xref="GOA:B4SCF4"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR018146"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:B4SCF4"
FT                   /protein_id="ACF42734.1"
FT                   /translation="MMKLTGISQITLRVNDLRSAEEFYGGILGLKLDHRVGANITYLRI
FT                   NSDLLVLVKAETPGSPDARDIRVDHFGFRLASDAEVDAAALYLDECGVHMVTRPAHRRE
FT                   GRAFFVMDPDGNLVEFYSMHESGIQGESIKDIDLLAPDSFVTGTRKKTKKETEQQKPRR
FT                   TRK"
FT   gene            complement(391290..392048)
FT                   /locus_tag="Ppha_0407"
FT   CDS_pept        complement(391290..392048)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0407"
FT                   /product="Nucleotidyl transferase"
FT                   /note="PFAM: 4-diphosphocytidyl-2C-methyl-D-erythritol
FT                   synthase; Nucleotidyl transferase; KEGG: pvi:Cvib_1552
FT                   UDP-N-acetylglucosamine pyrophosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42735"
FT                   /db_xref="GOA:B4SCF5"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:B4SCF5"
FT                   /protein_id="ACF42735.1"
FT                   /translation="MALAIIIMAAGKGTRMQSDLPKVLHLANGRPLIEYVLDTASTLDP
FT                   DKTILIVGHQAELVVKATSRYYLTAARQEPQLGTGHAIMQAETHLSNFDGEVLILSGDA
FT                   PLVNPDTLRELITFHRSKNGAATVLTAELHDPTGYGRIIRQESGDSVLKIVEQKDASKE
FT                   ELSVREINSGVYVFNARLLFDALAKINTNNAQNEYYLTDVFGVCFQSGRQVYAFKTDNP
FT                   DEILGINTPEQLLDAERLLLQKMKKNPITE"
FT   gene            complement(392084..392470)
FT                   /locus_tag="Ppha_0408"
FT   CDS_pept        complement(392084..392470)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0408"
FT                   /product="aspartate 1-decarboxylase"
FT                   /EC_number="4.1.1.11"
FT                   /note="KEGG: cch:Cag_1450 aspartate alpha-decarboxylase;
FT                   TIGRFAM: aspartate 1-decarboxylase; PFAM: aspartate
FT                   decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42736"
FT                   /db_xref="GOA:B4SCF6"
FT                   /db_xref="InterPro:IPR003190"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4SCF6"
FT                   /protein_id="ACF42736.1"
FT                   /translation="MKLHILKSKIHNAIVTSGDLEYEGSITIDNELLEMVDMIPNEKVL
FT                   VVNNNNGERFETYIIKGAHGSREIQLNGAAARCALVGDEIIIMTFALMDEAEARNYKPM
FT                   VLIVDKENNPKSRHHVGEQDEPLS"
FT   gene            complement(392487..392993)
FT                   /locus_tag="Ppha_0409"
FT   CDS_pept        complement(392487..392993)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0409"
FT                   /product="protein of unknown function DUF1239"
FT                   /note="PFAM: protein of unknown function DUF1239; KEGG:
FT                   cph:Cpha266_0380 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42737"
FT                   /db_xref="GOA:B4SCF7"
FT                   /db_xref="InterPro:IPR010664"
FT                   /db_xref="InterPro:IPR026265"
FT                   /db_xref="UniProtKB/TrEMBL:B4SCF7"
FT                   /protein_id="ACF42737.1"
FT                   /translation="MLSGCGNPVKERRSPETGFIGLDHPVQESWKVRIALTENGVRRGV
FT                   IEAGHGAEYRKNKSSEHHLDQGVRVDLFDINGHTTTTISAGKAVVHDNQDIEAEGNVII
FT                   TSEGSTVIKTEYVKRTAKDKMIRSERFVTITRPGETIRGEGFETDQALRRYRIFRGSGE
FT                   SFIKQ"
FT   gene            complement(393048..393596)
FT                   /locus_tag="Ppha_0410"
FT   CDS_pept        complement(393048..393596)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0410"
FT                   /product="outer membrane chaperone Skp (OmpH)"
FT                   /note="PFAM: outer membrane chaperone Skp (OmpH); KEGG:
FT                   cch:Cag_1448 outer membrane protein OmpH"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42738"
FT                   /db_xref="GOA:B4SCF8"
FT                   /db_xref="InterPro:IPR005632"
FT                   /db_xref="InterPro:IPR024930"
FT                   /db_xref="UniProtKB/TrEMBL:B4SCF8"
FT                   /protein_id="ACF42738.1"
FT                   /translation="MIHSGKFMKMSRRIVMAVGLSMVLVAPQSFAAQETGKVSVVDSGK
FT                   ILQQLPETKQADLTLQTTAAPLQKELDRLTQEYQKLVAAYSQQAGSLSKAARELKEKEI
FT                   GAKAMAIDKYRQEKFGRGGLVEKKQQELLIPIRQKVLAAVEAIAQKEGFSLVLEKNIAI
FT                   YVAPENDLTFKVMNQLNIK"
FT   sig_peptide     complement(393501..393596)
FT                   /locus_tag="Ppha_0410"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 32"
FT   gene            393950..394669
FT                   /locus_tag="Ppha_0411"
FT   CDS_pept        393950..394669
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0411"
FT                   /product="methyltransferase FkbM family"
FT                   /note="TIGRFAM: methyltransferase FkbM family; KEGG:
FT                   cph:Cpha266_0382 methyltransferase FkbM family"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42739"
FT                   /db_xref="GOA:B4SCF9"
FT                   /db_xref="InterPro:IPR006342"
FT                   /db_xref="InterPro:IPR026913"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B4SCF9"
FT                   /protein_id="ACF42739.1"
FT                   /translation="MGFYSKIKTRVRQLFGHEVTARVELQCECCNIHDWRICPVGIDRN
FT                   SEVFSLGVGDDIGFDKGLIVAYNCNVHAFDPTPRWIEWIKSQDLSPQFHFYPYAIGGRD
FT                   GRMKLFPRMPKGKPSSTMLTVMNEGAKDEGDGIDVTVKRLSTLMAELGVSHIDILKMDI
FT                   EAAEYEVIDDFLAAQLSVYQLLVEFHHRFSSVPLQKTRDTLDKLYKAGYRIFYITEKAR
FT                   EYSFIHLDTYEKYLREA"
FT   gene            complement(394687..395838)
FT                   /locus_tag="Ppha_0412"
FT   CDS_pept        complement(394687..395838)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0412"
FT                   /product="DNA protecting protein DprA"
FT                   /note="TIGRFAM: DNA protecting protein DprA; PFAM: SMF
FT                   family protein; KEGG: cph:Cpha266_0383 DNA protecting
FT                   protein DprA"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42740"
FT                   /db_xref="GOA:B4SCG0"
FT                   /db_xref="InterPro:IPR003488"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR041614"
FT                   /db_xref="UniProtKB/TrEMBL:B4SCG0"
FT                   /protein_id="ACF42740.1"
FT                   /translation="MSLPAAMEERILLLALTLIPGIGPARIKAITTFLHNRLADVLHCD
FT                   VGELIQVSGIGESLARQMHHFLHHAETREKALASAEQQIAELPRHHAELITILDPNYPA
FT                   LLKEIYDPPPCLFVRGKLPDTNQPGLAVVGTRYASQYGKQVTALLCRDLANCGVVVFSG
FT                   LAYGIDMVAHTATVENGGRTVAVLASGVESIYTDPKGKLWPKIVENGALISEEWFGSEL
FT                   TPGKFPKRNRIISGITSGTIVVESDLKGGSLITASSALEQNREVFAVPGSIFSRTSRGT
FT                   NRLIQQGSAKAVMSVDDILTELGPQFAEKCSRPALQDNSQQGTLTPIEQAIMQCMEREP
FT                   IHIDTLAVASGIDVSSLLVHLFELELKAAVVQQAGQFFQKKFL"
FT   gene            complement(395853..396866)
FT                   /locus_tag="Ppha_0413"
FT   CDS_pept        complement(395853..396866)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0413"
FT                   /product="Polyprenyl synthetase"
FT                   /note="PFAM: Polyprenyl synthetase; KEGG: cph:Cpha266_0384
FT                   polyprenyl synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42741"
FT                   /db_xref="GOA:B4SCG1"
FT                   /db_xref="InterPro:IPR000092"
FT                   /db_xref="InterPro:IPR008949"
FT                   /db_xref="InterPro:IPR033749"
FT                   /db_xref="UniProtKB/TrEMBL:B4SCG1"
FT                   /protein_id="ACF42741.1"
FT                   /translation="MSDFTMHEALTQELVENKYRLYLSRINSALGNCFVRESPITLYAP
FT                   ARYILEGKGKRIRPFLTLLASEAVCGSSEHALNVALAVEILHNFTLIHDDIMDQAELRH
FT                   GRPTVHRRWNTNAAILTGDMMIAYAYELALEAQSERHGELVHILNDANITICEGQALDI
FT                   ELEEKNDATIADYLDMIAKKTGRLISAALEAGGVAGDATDEQLRSLVLFGEKIGQAFQI
FT                   QDDYLDIMAEDGKSGKMAGGDIINGKKTYLLLRSLELTSGKERDLLNFIISNKGIEAQR
FT                   VPEVRAIYQQCGVLEETASLINRTTEEALSAIDGLPYAEGREYLKGFANILMKRDF"
FT   gene            complement(396863..397936)
FT                   /locus_tag="Ppha_0414"
FT   CDS_pept        complement(396863..397936)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0414"
FT                   /product="isopentenyl-diphosphate delta-isomerase, type 2"
FT                   /EC_number="5.3.3.2"
FT                   /note="KEGG: cch:Cag_1445 isopentenyl pyrophosphate
FT                   isomerase; TIGRFAM: isopentenyl-diphosphate
FT                   delta-isomerase, type 2; PFAM: FMN-dependent alpha-hydroxy
FT                   acid dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42742"
FT                   /db_xref="GOA:B4SCG2"
FT                   /db_xref="InterPro:IPR000262"
FT                   /db_xref="InterPro:IPR011179"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4SCG2"
FT                   /protein_id="ACF42742.1"
FT                   /translation="MSETANSRTTERKQDHIEICLHGDVVFNGKTTGFERFAFEHAALP
FT                   EISFSDIDLSTSFLGKSIGAPLMISSMTGGYSEAATLNQRLAEAAERFGIPLGVGSMRQ
FT                   ALENRSYRESFAVVRKYAPTVQIFANIGAPEVAKGLTESEINTMLELLRADGLIVHLNA
FT                   AQELFQPEGNTDFRHVLEQLALLSAKIPVPVLVKEVGCGISASAARQLIAAGVKAIDVA
FT                   GAGGISWQKVEEIRYTRQFGQERRFSLQALDELLNWGIPTAQCLIDIGALKKESPGLNG
FT                   IEIVASGGVGSGMDVAKSLALGAQLAASARALLKALHDGVLEETITSWLNDLRAVMFLT
FT                   GTATIAELRHKTLITKP"
FT   gene            complement(398435..401490)
FT                   /pseudo
FT                   /locus_tag="Ppha_0415"
FT   gene            complement(398658..399899)
FT                   /locus_tag="Ppha_0416"
FT   CDS_pept        complement(398658..399899)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0416"
FT                   /product="RNA-directed DNA polymerase"
FT                   /EC_number="2.7.7.49"
FT                   /note="PFAM: RNA-directed DNA polymerase (Reverse
FT                   transcriptase); Group II intron maturase-specific domain
FT                   protein; KEGG: pvi:Cvib_0153 RNA-directed DNA polymerase"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42743"
FT                   /db_xref="GOA:B4SCG3"
FT                   /db_xref="InterPro:IPR000477"
FT                   /db_xref="InterPro:IPR013597"
FT                   /db_xref="InterPro:IPR030931"
FT                   /db_xref="UniProtKB/TrEMBL:B4SCG3"
FT                   /protein_id="ACF42743.1"
FT                   /translation="MTKPYEISKELVLKAYQQVKSNGGAAGVDRESLQAFETKLKDNLY
FT                   KVWNRLSSGSYFPPPVRGVGIPKKSGGVRMLGVPTVADRVAQSVVKMVLEPILEPVFHE
FT                   DSYGYRPGRSAHDAIAVVRKRNWEYDWVVEFDIKGLFDNIDHELLMRALRKHCQTPWVF
FT                   LYVERWLKAPMETPEGELIERTKGTPQGGVVSPLLANLFLHYAFDRWVSENLPGVPFCR
FT                   YSDDGVLHCKSKIQAELVKRKIGERFRECGLELHPDKTQIVYCRDSNRKDEHPVNQFTF
FT                   LGFTFCSREAKKKDGTYFIGFLPGVSRDALRHMRQTIRRWKLQLKNSLELADLSAQFNP
FT                   ILRGWKNYYTRFYGSAMAPVWQHMNYYLAHWMMRKYKQLSGHKTRASRKLRLLAEENPN
FT                   LFAHWKAGYTSMAR"
FT   gene            complement(399896..400279)
FT                   /locus_tag="Ppha_0417"
FT   CDS_pept        complement(399896..400279)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0417"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: eba:ebA7204 predicted transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42744"
FT                   /db_xref="UniProtKB/TrEMBL:B4SCG4"
FT                   /protein_id="ACF42744.1"
FT                   /translation="MSGVSQGRRVQTNCRERVEKIKMTSKLKGVVNSGKVWRKPVYWPS
FT                   GVRHKGSVILVRALVLNYRNLRWRCKGKGASVKSEADNTNAPSRDGATRTSNESLVMRL
FT                   EQRGRVIWSYSHVNCANRRSFSV"
FT   gene            402110..402335
FT                   /pseudo
FT                   /locus_tag="Ppha_0418"
FT   gene            402467..402703
FT                   /locus_tag="Ppha_0419"
FT   CDS_pept        402467..402703
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0419"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42745"
FT                   /db_xref="UniProtKB/TrEMBL:B4SCG5"
FT                   /protein_id="ACF42745.1"
FT                   /translation="MITDTQRRMQILRKVHRIPVDKLKELDEFVSKLEEGIVTKSKALS
FT                   FAGSWRDIDDTVFDELTNNLISNRQRNRRRIDE"
FT   gene            402696..403109
FT                   /locus_tag="Ppha_0420"
FT   CDS_pept        402696..403109
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0420"
FT                   /product="PilT protein domain protein"
FT                   /note="PFAM: PilT protein domain protein; KEGG:
FT                   mar:MAE_40120 PilT-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42746"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:B4SCG6"
FT                   /protein_id="ACF42746.1"
FT                   /translation="MNRVLVDTDILSYYFKGDQVVVGNFEKYLQQYDLIEISLITYYEI
FT                   VGGLLAKSALKQLTVFEDFVVENIVLPMTDKSAKISAELYSLLRQTGKIIDDIDLLIAG
FT                   IAIENDMTLVTNNESHFGRISGLRIENWKKQGQ"
FT   gene            403124..404392
FT                   /locus_tag="Ppha_0421"
FT   CDS_pept        403124..404392
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0421"
FT                   /product="protein of unknown function DUF214"
FT                   /note="PFAM: protein of unknown function DUF214; KEGG:
FT                   cph:Cpha266_0386 protein of unknown function DUF214"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42747"
FT                   /db_xref="GOA:B4SCG7"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR025857"
FT                   /db_xref="UniProtKB/TrEMBL:B4SCG7"
FT                   /protein_id="ACF42747.1"
FT                   /translation="MLKTLFSIAVRHLLGRRRQTLTTILGVAVSTMVLITTNSLTRGLL
FT                   DSFVETIVNVAPHITLKGESMRPMPVNLFEEERSLSVAFVDNNIKKLDPEEVRNYRQIL
FT                   TVFSSPTYEKKILAASPYVLSQVMAVKGSRNQPLVLKGVLIEREDAISGIGKKLTQGNI
FT                   ALFEKTPNALLVGRTVARDMNLKMNDLVVIIPSSGKSRQCKVAGIFFSGVNAVDNSVFV
FT                   SLKLAQIIEGLPANKVTGIALKVADPFVNAALASELERITGYRCLTWQEENASILSLFA
FT                   RIGYIVFSLVAFVGVVSGFGVANILVTTVFEKSRDIAIMKSFGFSARQLVAMFVLEGFM
FT                   VGLAGALVGGVLALGAIDLFASLPVESSQGPLTKTGFSMSYNPLYFLLIIGITVLISTL
FT                   AAILPSARAAKLEPVSVLRDSSL"
FT   gene            complement(404407..406248)
FT                   /locus_tag="Ppha_0422"
FT   CDS_pept        complement(404407..406248)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0422"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter transmembrane region; ABC
FT                   transporter related; SMART: AAA ATPase; KEGG: cch:Cag_0453
FT                   ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42748"
FT                   /db_xref="GOA:B4SCG8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:B4SCG8"
FT                   /protein_id="ACF42748.1"
FT                   /translation="MSNSPGRRASFRPQQDETLQKGKKRSVDFYIVSRLLGYIKPYRTL
FT                   VAWAIAITIAGSFLGPLRPYLTKIAIDDYIAHGNLKGLTVISIFLAGAILLDGIKQFIT
FT                   TWMTQIIGQKAVLDIRMDIFRHLQKLPARFYDRNPIGRLITRTTGDVESLNEMLSSGII
FT                   TILGDLLQLFFIVVLMAWIDWQLTLIVLSILPLMIWATIAFKNRVRIAFQDVLTHQARL
FT                   NTFFQEHLTGMSIVQLFNREEREGRKYASINADHRDANIRTVLYFSIYYPLIETLSSAA
FT                   AGLVIWYSGVRLLKADLSIGVVISFVQYIWLFFRPLQHLSDRFNVIQTAIASSDRIIRL
FT                   LDEKEGIEEPAGKREIECFKESIAFKNVWFAYESENWILKDISFTIRHGEKIAIVGATG
FT                   SGKTTLINILSRLYPFAKGSVSIDSIELSDIAEHSVRKLIGVVMQDVFLFSGTIRENLA
FT                   FGKPDVTDEEMREAARIVGADRFIDQLPGGYQYRVLENGTGLSSGQKQLIAFVRALLYN
FT                   PEILVLDEATSSVDTETESLIDAATARLMSERTSIIIAHRLSTVQKADRIIVLHKGVIR
FT                   ESGNHQELLAKRGLYYKLYLLQHPEQTLHIGENGAPA"
FT   gene            complement(406241..407677)
FT                   /locus_tag="Ppha_0423"
FT   CDS_pept        complement(406241..407677)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0423"
FT                   /product="phosphoglucomutase/phosphomannomutase
FT                   alpha/beta/alpha domain I"
FT                   /note="PFAM: phosphoglucomutase/phosphomannomutase;
FT                   phosphoglucomutase/phosphomannomutase alpha/beta/alpha
FT                   domain I; phosphoglucomutase/phosphomannomutase
FT                   alpha/beta/alpha domain II;
FT                   phosphoglucomutase/phosphomannomutase alpha/beta/alpha
FT                   domain III; KEGG: cch:Cag_0454
FT                   phosphoglucomutase/phosphomannomutase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42749"
FT                   /db_xref="GOA:B4SCG9"
FT                   /db_xref="InterPro:IPR005841"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR016066"
FT                   /db_xref="InterPro:IPR024086"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="UniProtKB/TrEMBL:B4SCG9"
FT                   /protein_id="ACF42749.1"
FT                   /translation="MSLMISVSGIRGIVGESLTPKNLTAFAMAFASLVFRQKERCGKNH
FT                   SGKKPTIVIGRDTRPTGKAIGDLVSSTLLLCGCDVVDLGIATTPTVELAVTGEGADGGL
FT                   IITASHNPVAWNALKMLNHKGEFLGAEEVDELLAIAEKELFVHAHWDRIGTLSQNEQYD
FT                   ELHIKKVLDLPCIDTTTIEKEQFRVLVDCVEGAGASIIPRLCTELGIKNIVEVACGGSG
FT                   LFPRNPEPIEENLSTTIAALKESGCDFALIVDPDVDRLALLCEDGSLFGEEYTLVACAD
FT                   FYLKHKIGAVVNNLSSSRALRDIAAKHGVACYSAKIGEANVSEMMKEVGAVIGGEGNGG
FT                   VILPELHYGRDALVGIALIVQAFTLWRSENGGGSLSEFRRTFPDYFMSKQKIVLGSTSR
FT                   AALEKLFTDIASHYHSAAANRLDGLKLDFADSWVHLRPSNTEPIIRIYAEAPSKTGADE
FT                   LASELKHEIEQRVAGIESHE"
FT   gene            407969..408244
FT                   /locus_tag="Ppha_0424"
FT   CDS_pept        407969..408244
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0424"
FT                   /product="ribosomal protein S20"
FT                   /note="PFAM: ribosomal protein S20; KEGG: cph:Cpha266_0389
FT                   30S ribosomal protein S20"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42750"
FT                   /db_xref="GOA:B4SCH0"
FT                   /db_xref="InterPro:IPR002583"
FT                   /db_xref="InterPro:IPR036510"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4SCH0"
FT                   /protein_id="ACF42750.1"
FT                   /translation="MPLHKSAEKRLRQSERRNARNRSRKKELKVLVKTMQKLIDTSAEK
FT                   AVVEVAYRSAVQKLDRLGVKNYIHANKASRKKSQLTRLMNSYVKAD"
FT   gene            408365..408967
FT                   /locus_tag="Ppha_0425"
FT   CDS_pept        408365..408967
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0425"
FT                   /product="Holliday junction DNA helicase RuvA"
FT                   /note="TIGRFAM: Holliday junction DNA helicase RuvA; PFAM:
FT                   RuvA domain protein; DNA recombination protein RuvA domain
FT                   I; KEGG: cph:Cpha266_0390 Holliday junction DNA helicase
FT                   RuvA"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42751"
FT                   /db_xref="GOA:B4SCR7"
FT                   /db_xref="InterPro:IPR000085"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR011114"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013849"
FT                   /db_xref="InterPro:IPR036267"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4SCR7"
FT                   /protein_id="ACF42751.1"
FT                   /translation="MFAYFRGKLTSVLPEEVVVEVSGIAYQFLISAATHRQLPEQGSEV
FT                   FLFSHLVVREDLLQLYGFSGEEERQLFRLLLLTTGVGPKLALALLSGLSVQDIHDAILT
FT                   NTPERLYGITGVGKKTAARIILELRDKVLKLSPVSALASPARLSSTLLRDDAVNALVTL
FT                   GFSRIIVQKAVVAILEQNPGLTVEEVIKAALVSIHNS"
FT   gene            408977..410245
FT                   /locus_tag="Ppha_0426"
FT   CDS_pept        408977..410245
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0426"
FT                   /product="FolC bifunctional protein"
FT                   /note="TIGRFAM: FolC bifunctional protein; PFAM:
FT                   cytoplasmic peptidoglycan synthetase domain protein; Mur
FT                   ligase middle domain protein; KEGG: cph:Cpha266_0391 FolC
FT                   bifunctional protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42752"
FT                   /db_xref="GOA:B4SCR8"
FT                   /db_xref="InterPro:IPR001645"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR018109"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:B4SCR8"
FT                   /protein_id="ACF42752.1"
FT                   /translation="MTYQEALDFLYPLHRFGIKPGLERVRTLLDLHGSPQKRLGLLVHI
FT                   AGTNGKGSVAAALASIFQAAGKKCALYTSPHLVDFTERIRINGSRIPQERVAHYCTRFR
FT                   DAVVENHSTFFEATTAIAFAWFADEGVDVTILETGMGGRLDATNVVHSDYVVITTIALD
FT                   HTDWLGGTLPLIAAEKAAIIKKGSRVFTAVSRQEALLPIQTMAELCDAPLFVYGKDALS
FT                   TIISAQPGVLELEVTTASRKYRGLKVPLTGSFHAANVSLAVMVAEDTGIAAEQISSGLE
FT                   RLLQTGYRARLEQIGMNPAILLDVSHNPDGMRETVNTLLSFRKKYRRISVVLGLASDKD
FT                   ARAVIRELHRLECSFVLVNIPSERSVSAEVLSSICQEEGSAATVCATGREGLAYLLSRA
FT                   GADDLILVTGSFYLAGEIIATGR"
FT   gene            410565..411854
FT                   /locus_tag="Ppha_0427"
FT   CDS_pept        410565..411854
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0427"
FT                   /product="transcription termination factor Rho"
FT                   /note="KEGG: cph:Cpha266_0393 transcription termination
FT                   factor Rho; TIGRFAM: transcription termination factor Rho;
FT                   PFAM: H+transporting two-sector ATPase alpha/beta subunit
FT                   central region; Rho termination factor domain protein; Rho
FT                   termination factor RNA-binding; Ribonuclease B OB region
FT                   domain; SMART: AAA ATPase; Cold shock protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42753"
FT                   /db_xref="GOA:B4SCR9"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004665"
FT                   /db_xref="InterPro:IPR011112"
FT                   /db_xref="InterPro:IPR011113"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036269"
FT                   /db_xref="InterPro:IPR041703"
FT                   /db_xref="UniProtKB/TrEMBL:B4SCR9"
FT                   /protein_id="ACF42753.1"
FT                   /translation="MSNNSVCKGLDINMLQKKKVSELHVLAKELGVMAAGLRKEELIFK
FT                   IIEAQSQKNTDSESGNVMVNTGVLQVIPEGYGFLRSANYNYLSSPDDIYVSPSQIKRFN
FT                   MRTGDTVSGQVRAPKEGERFFALLKINTIDGNDPEITRERPYFENLTPLFPRERLKLET
FT                   KQSEACGRIMDIFTPIGKGQRGLIVAQPKTGKTMLLQMIANAIIKNHPEVYLIVLLIDE
FT                   RPEEVTDMARSVPAEVVSSTFDEDPERHVLVADMVLEKAKRLVEVGRDVVVLLDSITRL
FT                   ARAHNTIIPHSGKILSGGIDANALTKPKRFFGAARNIEEGGSLTIIATALIDTGSRMDD
FT                   VIFEEFKGTGNMELLLDRRLSERRIFPSIDILRSSTRKEELLFTQEELSRTWLLRKYLA
FT                   DKNPIECMEFMREKMADTKDNKDFFKYMNA"
FT   gene            complement(411835..412212)
FT                   /locus_tag="Ppha_0428"
FT   CDS_pept        complement(411835..412212)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0428"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42754"
FT                   /db_xref="GOA:B4SCS0"
FT                   /db_xref="UniProtKB/TrEMBL:B4SCS0"
FT                   /protein_id="ACF42754.1"
FT                   /translation="MVLEYRNLLILVSLALLVPILTAHLFALVYRHFMTFSLFSAGHIV
FT                   SVFPLVLKADNIETFFRTANNYSYSFHKMLSQERLSTGNTPMHERKRVSSLHQEVECCP
FT                   ARISLVVSLIGGNTLFRHSCI"
FT   sig_peptide     complement(412141..412212)
FT                   /locus_tag="Ppha_0428"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.927) with cleavage site probability 0.500 at
FT                   residue 24"
FT   gene            412224..412296
FT                   /locus_tag="Ppha_R0015"
FT                   /note="tRNA-Lys1"
FT   tRNA            412224..412296
FT                   /locus_tag="Ppha_R0015"
FT                   /product="tRNA-Lys"
FT   gene            412331..412412
FT                   /locus_tag="Ppha_R0016"
FT                   /note="tRNA-Leu1"
FT   tRNA            412331..412412
FT                   /locus_tag="Ppha_R0016"
FT                   /product="tRNA-Leu"
FT   gene            412511..413260
FT                   /locus_tag="Ppha_0429"
FT   CDS_pept        412511..413260
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0429"
FT                   /product="Electron transfer flavoprotein
FT                   alpha/beta-subunit"
FT                   /note="PFAM: Electron transfer flavoprotein
FT                   alpha/beta-subunit; KEGG: plt:Plut_1755 electron transfer
FT                   flavoprotein beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42755"
FT                   /db_xref="GOA:B4SCS1"
FT                   /db_xref="InterPro:IPR012255"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014730"
FT                   /db_xref="InterPro:IPR033948"
FT                   /db_xref="UniProtKB/TrEMBL:B4SCS1"
FT                   /protein_id="ACF42755.1"
FT                   /translation="MDIAVCLCQVPDTASVITVLDGAVDLSRVHEVMNPFDEYALEEAV
FT                   RLKERFEGSVVTLFCVAPPSAKEMLRKALALGGDRAVLISGTKEPSDPFQTALLLSRAI
FT                   SACYATALPDLIFCGKHSTDFQSAQVPLMLAELLDLASVSAIIKLNASTEGIQVEREIE
FT                   GGIELLDLHYPALFSVEKGLNVPRKTTIKAVIEARKKPIDHLSLTLSESPFVAITAMKP
FT                   LIRKKQCRFVSDAKELIRLLGHEEALF"
FT   gene            413292..414275
FT                   /locus_tag="Ppha_0430"
FT   CDS_pept        413292..414275
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0430"
FT                   /product="Electron transfer flavoprotein alpha subunit"
FT                   /note="PFAM: Electron transfer flavoprotein
FT                   alpha/beta-subunit; Electron transfer flavoprotein alpha
FT                   subunit; KEGG: cch:Cag_0461 electron transfer flavoprotein
FT                   alpha-subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42756"
FT                   /db_xref="GOA:B4SCS2"
FT                   /db_xref="InterPro:IPR001308"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014730"
FT                   /db_xref="InterPro:IPR014731"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="UniProtKB/TrEMBL:B4SCS2"
FT                   /protein_id="ACF42756.1"
FT                   /translation="MKRCLVFLEQREGVVKQASIDTWNRVQELATLRPDITVSALLAGP
FT                   ADLRQLEGRMAGTGVLYLASDARFSRYNPEHYQRLITDIMKREACSDLFFADTVLSRDL
FT                   APRLSVRLKASLLSGCSIIEDIASEASCTRALYSGSVIASFAPRRPLSIYTTSSRPTHP
FT                   IIPSETHISLVLLEPPGFIEATLLPVVCGMVMRESGSDVTEAGIIVAGGRGMGSAEDFE
FT                   QLEELARLLGGVVGASRPVVDEGWRPHAEQIGQTGKTVAPALYVACAISGAPQHLAGIG
FT                   SSRKVVAINSDPHAPIFDVADYGIVGDVHLVLPKLIEGLQEFLKKR"
FT   gene            414350..414943
FT                   /locus_tag="Ppha_0431"
FT   CDS_pept        414350..414943
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0431"
FT                   /product="protein of unknown function DUF151"
FT                   /note="PFAM: UvrB/UvrC protein; protein of unknown function
FT                   DUF151; KEGG: cph:Cpha266_0395 protein of unknown function
FT                   DUF151"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42757"
FT                   /db_xref="GOA:B4SCS3"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="InterPro:IPR003729"
FT                   /db_xref="InterPro:IPR036104"
FT                   /db_xref="InterPro:IPR036876"
FT                   /db_xref="UniProtKB/TrEMBL:B4SCS3"
FT                   /protein_id="ACF42757.1"
FT                   /translation="MRKLQVDILGLSTSPHTNGAYALILYELEGKRKLPIIIGGFEAQA
FT                   IALKLENIKPPRPFTHDLFKNIADAFHLHVNEIIIDELHNETFYAKVVCEVNGEVHEID
FT                   ARPSDAIAIAVRFNAPLFVTEEIMNEAGIKEEQKEEGEEDGIPLETEERVAGLLNPEAL
FT                   LDELQAALNDAISNENYEEAARLRDEISRMKRRS"
FT   gene            complement(415053..417557)
FT                   /locus_tag="Ppha_0432"
FT   CDS_pept        complement(415053..417557)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0432"
FT                   /product="outer membrane protein assembly complex, YaeT
FT                   protein"
FT                   /note="TIGRFAM: outer membrane protein assembly complex,
FT                   YaeT protein; PFAM: surface antigen (D15); surface antigen
FT                   variable number repeat protein;
FT                   Polypeptide-transport-associated domain protein ShlB-type;
FT                   KEGG: cph:Cpha266_0397 surface antigen (D15)"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42758"
FT                   /db_xref="GOA:B4SCS4"
FT                   /db_xref="InterPro:IPR000184"
FT                   /db_xref="InterPro:IPR010827"
FT                   /db_xref="InterPro:IPR023707"
FT                   /db_xref="InterPro:IPR034746"
FT                   /db_xref="InterPro:IPR039910"
FT                   /db_xref="UniProtKB/TrEMBL:B4SCS4"
FT                   /protein_id="ACF42758.1"
FT                   /translation="MKQTRKLITLVLLALALDAAGKTVEAKNLPVAKPAAAEQTKITTP
FT                   KKEIYTVTAISFSGLESLSEQELTTSLPLKVMDKISVPGMELSGALQYLWKLQLFSDIK
FT                   VEKSDLGQNNIALKFTVNELPVLADIAFKGNSKLENDELKRTAALVTGKKISEQELLTA
FT                   SNKIEKFYASKGYLTAGATFRLVENGKNQVKAIFSITEGAKVSIERITFHGNSAFSQNK
FT                   LRGVFKETTQNSWWRKIFGTPKLDTDKFGDDKNLLIEFYRNNGYRDARIIRDAISYTDD
FT                   KKGLFLDIYLEEGQKYRIGKITWKGNTKEFATTEILEKTFRIKPGDIYSPKLIQERLNY
FT                   SQDNSDISSIYLDRGYLAFRANIDEKIVKPDLVDLVLSLREGEQFQLNTIKIKGNTKTK
FT                   DHVIRRELYTVPGDMFSRKNVVRSIRELSMLNYFDPEQITPDIQPNPENNTVDLIYSVN
FT                   EKQTDTFNASVGYSGSGFTGAIGVTFNNFSLQDIFNRDAYRPLPHGDGQQLGLQWQFGS
FT                   YDYNTLSLSFTEPWAFGGPTALGFSAFKTHRAYDYTDDSIDNPNTIDQTGTTLSIGRRL
FT                   AWPDDYCSVNWKLKYLHSEGGFLSFVDYTDPNAPVKADEFSISQTIGRNSIDSPIYPRR
FT                   GSKNSITAQLAGGPLPGTVDFYKFTGTSSWFFPITKKFVLNLSTQHGYLSTFNENDYIP
FT                   YTEYFYMGGSGMSSLPTVSLRGYDDRSLGTKLGGSSASSSLYAGNIYSKFTSEMRYPIT
FT                   LSSSVSIYGLAFVEAGNLWENAEAVDFSDLKKSAGLGLRLYLPIIGQIGLDYGYGFDAV
FT                   ESVPDKTKQGWSFMFSFGTTME"
FT   sig_peptide     complement(417492..417557)
FT                   /locus_tag="Ppha_0432"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.589 at
FT                   residue 22"
FT   gene            complement(417580..418428)
FT                   /locus_tag="Ppha_0433"
FT   CDS_pept        complement(417580..418428)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0433"
FT                   /product="undecaprenyl diphosphate synthase"
FT                   /EC_number="2.5.1.31"
FT                   /note="KEGG: plt:Plut_1750
FT                   di-trans-poly-cis-decaprenylcistransferase; TIGRFAM:
FT                   undecaprenyl diphosphate synthase; PFAM:
FT                   Di-trans-poly-cis-decaprenylcistransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42759"
FT                   /db_xref="GOA:B4SCS5"
FT                   /db_xref="InterPro:IPR001441"
FT                   /db_xref="InterPro:IPR018520"
FT                   /db_xref="InterPro:IPR036424"
FT                   /db_xref="UniProtKB/TrEMBL:B4SCS5"
FT                   /protein_id="ACF42759.1"
FT                   /translation="MALIKIMDFTATPKTSWFSSDTDDDDKRIQADLKATCQLPNHIAI
FT                   IMDGNGRWARLKGKTRIEGHVAGVESVRDVVESCSQLGIRYLTLFTFSTENWKRPEKEV
FT                   SALMQLLVKVIGRETRKLHDNNIRLNVIGEMEILPEKVRSVLTKTMELTKNNSKLMLNI
FT                   ALSYSGQWDLTQACQAIAFDVQAGRINAESVDEHLLASYLSTSSIPDPDLLIRTSGEFR
FT                   ISNFMLWQCAYSEIFFTNTYWPDFHRSQLYEAVREFQSRERRFGQTSEQVQKKNIPTNK
FT                   L"
FT   gene            418650..420077
FT                   /locus_tag="Ppha_0434"
FT   CDS_pept        418650..420077
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0434"
FT                   /product="glutamyl-tRNA(Gln) amidotransferase, A subunit"
FT                   /note="TIGRFAM: glutamyl-tRNA(Gln) amidotransferase, A
FT                   subunit; PFAM: Amidase; KEGG: plt:Plut_1749
FT                   glutamyl-tRNA(Gln) amidotransferase A subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42760"
FT                   /db_xref="GOA:B4SCS6"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="InterPro:IPR004412"
FT                   /db_xref="InterPro:IPR020556"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4SCS6"
FT                   /protein_id="ACF42760.1"
FT                   /translation="MQFSSYEDLRSRLVSHAITCEEVVRFYLERIENHRGDNIYITVFH
FT                   DQALERARTLDRKLREGGNPGKLFGMPMAIKDNIAMKNCRLTCASKILENYESVYDATA
FT                   VLRLEEADAIFLGKTNMDEFAMGSSNENSAFGNVPNPFDKTRVPGGSSGGSAAAVANGL
FT                   ALVALGSDTGGSVRQPAGFCDIVGLKPTYGRISRYGLVAFASSFDQIGVLGLNCDDVAL
FT                   VLGVMAGKDEGDATSSRHPVADYASEMATLSVDGLKIGVPKEYFPETLNPEVSRMVKGK
FT                   LEELRAQGAELVPVTLPDSAYAIAAYYILVTAEASSNLARFDGARYGYRSEMSEDLAAM
FT                   YVNSRTEGFGREVKRRIMLGTYVLSAGYYDTYYKKAQQVRRVFQDRYREALDKVDVIAG
FT                   PTSPFPPFGIGDKTENPLEMYLADVFTVPASIVGMPAISVPLGFDSMNLPVGMHLICNF
FT                   FEEGKLLGIARHMQRSL"
FT   gene            420124..421023
FT                   /locus_tag="Ppha_0435"
FT   CDS_pept        420124..421023
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0435"
FT                   /product="succinyl-CoA synthetase, alpha subunit"
FT                   /note="TIGRFAM: succinyl-CoA synthetase, alpha subunit;
FT                   PFAM: CoA-binding domain protein; ATP-citrate
FT                   lyase/succinyl-CoA ligase; KEGG: plt:Plut_1748 succinyl-CoA
FT                   ligase, alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42761"
FT                   /db_xref="GOA:B4SCS7"
FT                   /db_xref="InterPro:IPR003781"
FT                   /db_xref="InterPro:IPR005810"
FT                   /db_xref="InterPro:IPR005811"
FT                   /db_xref="InterPro:IPR016102"
FT                   /db_xref="InterPro:IPR017440"
FT                   /db_xref="InterPro:IPR033847"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B4SCS7"
FT                   /protein_id="ACF42761.1"
FT                   /translation="MSVLVNKDTRLLVQGITGGEGTFHTSQILEYGTNVVAGVTPGKGG
FT                   ILYHGNEKDKFCRPVPVFDTVREAVQKAEANATVIFVPAAFAADAVMEAADAGLKVIIC
FT                   ITEGIPVNDMMKAYAFVKQKGAVLVGPNCPGVITPGEAKVGIMPGFIHKKGTIGVVSRS
FT                   GTLTYEAVHQLTEVGLGQSTCIGIGGDPIIGTQFIDAIKLFAMDDETEGLVMIGEIGGS
FT                   AEEEAAAYIKEYFKKPVIGFIAGRTAPPGRRMGHAGAIVSGGKGTAEDKITAMEAAGIH
FT                   VVKSPADIGEAMLKALGR"
FT   gene            complement(421183..422163)
FT                   /locus_tag="Ppha_0436"
FT   CDS_pept        complement(421183..422163)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0436"
FT                   /product="KpsF/GutQ family protein"
FT                   /EC_number="5.3.1.13"
FT                   /note="KEGG: cch:Cag_0467 KpsF/GutQ; TIGRFAM: KpsF/GutQ
FT                   family protein; PFAM: CBS domain containing protein; sugar
FT                   isomerase (SIS)"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42762"
FT                   /db_xref="GOA:B4SCS8"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR004800"
FT                   /db_xref="InterPro:IPR035474"
FT                   /db_xref="UniProtKB/TrEMBL:B4SCS8"
FT                   /protein_id="ACF42762.1"
FT                   /translation="MSIPSQKQEITALGKIILDQEARAIHLIAERLDESFSAAVELLAS
FT                   CQGKIIISGMGKSGIIAQKIAATMSSTGSTALFLHPADAAHGDLGIVGHTDTVICLSKS
FT                   GTTEELNFIIPALRQIGAKIIAMTGNPRSFLAQKADITLDTGIAKEACPYDLAPTTSTT
FT                   AMLAMGDALAIALMQVKNFTQRDFALTHPKGSLGRRLTVKVSDIMAKGDAVPIVSESAS
FT                   VTGLILEMTSKRYGVSAVITDDGKLCGIFTDGDLRRLVQSGREFLNLSAGSVMTANPKT
FT                   VTGDTMAKECLDILETWRITQLLVCDDEQHPVGMVHIHDLIVLGL"
FT   gene            422289..422636
FT                   /locus_tag="Ppha_0437"
FT   CDS_pept        422289..422636
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0437"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cph:Cpha266_0402 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42763"
FT                   /db_xref="UniProtKB/TrEMBL:B4SCS9"
FT                   /protein_id="ACF42763.1"
FT                   /translation="MSWLVLLGISLLLFFLLVFLLTRFLGYMKKEQNLQIESFRDSIID
FT                   KDNPVGLYGDELEKLKQQQNEAQRHLQEVISKIPVIQKDGRFQIDEEAIRQRRAAAQAN
FT                   GTSATANDGTV"
FT   gene            422660..424174
FT                   /locus_tag="Ppha_0438"
FT   CDS_pept        422660..424174
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0438"
FT                   /product="polysaccharide biosynthesis protein"
FT                   /note="PFAM: polysaccharide biosynthesis protein; KEGG:
FT                   cch:Cag_0469 polysaccharide biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42764"
FT                   /db_xref="GOA:B4SCT0"
FT                   /db_xref="InterPro:IPR002797"
FT                   /db_xref="InterPro:IPR029303"
FT                   /db_xref="UniProtKB/TrEMBL:B4SCT0"
FT                   /protein_id="ACF42764.1"
FT                   /translation="MFSKLKLLFKDTVIYGSSTILARSLNYLLVPLYANKLSTFDNGVQ
FT                   TIIYANIALANVLFSYGLETSYLKVVSDSADHERDETQLFSTAFLTLFLTSTLFAVGIA
FT                   LFAPLLAQLIGLSAGDYLFVRYAALILWLDTLLVIPFAELRLKRKALQFAIARVAGVVA
FT                   VVISAVILIVPLNAGLPGVFIAEAFGSLISLLLVIPVLRQFRLFFSADQLRSMLRIGLP
FT                   YVPTGIAGLLIHLIDRNILIRISPSTIERIYGKGYQPSDIVGIYGRIAAFGVVLQLFIQ
FT                   VFRFAWQPFFLQHSKDPDAKQLFRHILSISTLFTMFLALAATFFVPDLVRYHYGGSFYL
FT                   LPPRYWIGLSILPWIFLSYVFDMISTNLSAGLLITGNTRYLPVVTFAGAAVTAFFCWWL
FT                   IPLRGMDGAAYAIVAGTAVMSVVMAWYSLKVFPLRHDWLKLFLLLVTAVAMASVQFLAG
FT                   SELPQAGVVFAFKIGLLTLYLLIAAALFRHEARLVAVKAGQKFRRR"
FT   gene            complement(424187..424696)
FT                   /locus_tag="Ppha_0439"
FT   CDS_pept        complement(424187..424696)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0439"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pvi:Cvib_1524 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42765"
FT                   /db_xref="InterPro:IPR025961"
FT                   /db_xref="UniProtKB/TrEMBL:B4SCT1"
FT                   /protein_id="ACF42765.1"
FT                   /translation="MNLLDSRRLVTTALVLLAVLNVTLLATLWWRESCRLIPGTESVIH
FT                   NKKRLSFSRQLDLDESQRISFDKLRKEHFHNVGAEMKAIALLKKQLIQEALQEKPDTIK
FT                   IESIAGNIGSRHAAVERQLAFHFHELAKVCTPGQRDSLRIILERIAARKRPDRSERWGE
FT                   NPSPGR"
FT   sig_peptide     complement(424616..424696)
FT                   /locus_tag="Ppha_0439"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.962) with cleavage site probability 0.901 at
FT                   residue 27"
FT   gene            complement(424781..425164)
FT                   /locus_tag="Ppha_0440"
FT   CDS_pept        complement(424781..425164)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0440"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pvi:Cvib_1523 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42766"
FT                   /db_xref="GOA:B4SCT2"
FT                   /db_xref="UniProtKB/TrEMBL:B4SCT2"
FT                   /protein_id="ACF42766.1"
FT                   /translation="MKKCDENIEARVVETMALLDELQPLEVHHLFRVRLMERVEREFGE
FT                   GARVRRGDRLDFRLAFMALLLVVNLGSALVSVFDGNRQVTGGAVSELLDSQNDDYSSQE
FT                   FAYYEQTAATTSPATETGGEEYP"
FT   gene            complement(425231..425773)
FT                   /locus_tag="Ppha_0441"
FT   CDS_pept        complement(425231..425773)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0441"
FT                   /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
FT                   /note="TIGRFAM: RNA polymerase sigma factor, sigma-70
FT                   family; PFAM: sigma-70 region 2 domain protein; sigma-70
FT                   region 4 domain protein; Sigma-70 region 4 type 2; KEGG:
FT                   cph:Cpha266_0408 RNA polymerase, sigma-24 subunit, ECF
FT                   subfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42767"
FT                   /db_xref="GOA:B4SCT3"
FT                   /db_xref="InterPro:IPR000838"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:B4SCT3"
FT                   /protein_id="ACF42767.1"
FT                   /translation="MRAREELFKGLVAEHQEMVVNTCYRFVFNREDAEDLAQDVFVEVF
FT                   RSLEQFREEAKLSTWIYRIAVTKSLDHLRRLKRKKRFSSLKRIIGVSDPSEEIAAPTTD
FT                   NPAEALAGSEQARILQNALNSLPDSQKTAFLLSKQEGYSNQEIADLLKTSVSAVESLVH
FT                   RAKKNLHDKLYAYYSEQ"
FT   gene            complement(425791..427173)
FT                   /locus_tag="Ppha_0442"
FT   CDS_pept        complement(425791..427173)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0442"
FT                   /product="Phosphoglucomutase"
FT                   /EC_number="5.4.2.2"
FT                   /note="PFAM: phosphoglucomutase/phosphomannomutase;
FT                   phosphoglucomutase/phosphomannomutase alpha/beta/alpha
FT                   domain I; phosphoglucomutase/phosphomannomutase
FT                   alpha/beta/alpha domain II;
FT                   phosphoglucomutase/phosphomannomutase alpha/beta/alpha
FT                   domain III; KEGG: plt:Plut_1740 phosphoglucomutase"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42768"
FT                   /db_xref="GOA:B4SCT4"
FT                   /db_xref="InterPro:IPR005841"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR016066"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="UniProtKB/TrEMBL:B4SCT4"
FT                   /protein_id="ACF42768.1"
FT                   /translation="MQVKFGTDGWRAIIAKDYTFDNLKLAALASARYFLGHPNRAKGVC
FT                   VGYDTRFMSREFAEYTAEVFSSQGLKVFLSDSFASTPAVSLYTKAKQLAGGIVITASHN
FT                   PAIYNGFKVKASYGGPAHPEVIAEIESHLLEIDPQTLLVPDKKLIELVDMKGFYLNYLK
FT                   SSINLPLIRESRIKIAHNAMHGAGQDLLTSLFDESMLSCYHCSINPGFGGINPEPMPQY
FT                   IGEFIEFFKEVEPDVAIINDGDADRIGMLDEHGAFVDSHKLFAIILKDLVEEKHQTGEV
FT                   AKTFALTDVIDKICEKHHLLMHELQVGFKHVSKLMTTNNILMGGEESGGIGITAFLPER
FT                   DGVYTGLLILEMMTRREKTLSELVQELYDEYGFFCYNRHDLHVSDAKKQAIIDRASKGD
FT                   LATIAGYKVLKFSNLDGYKYHFEGGWMLIRPSGTEPILRLYCEADSQEKVDKVLAFAAK
FT                   LA"
FT   gene            427262..428404
FT                   /locus_tag="Ppha_0443"
FT   CDS_pept        427262..428404
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0443"
FT                   /product="lipid-A-disaccharide synthase"
FT                   /note="TIGRFAM: lipid-A-disaccharide synthase; PFAM:
FT                   glycosyl transferase family 19; KEGG: cph:Cpha266_0411
FT                   lipid-A-disaccharide synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42769"
FT                   /db_xref="GOA:B4SCT5"
FT                   /db_xref="InterPro:IPR003835"
FT                   /db_xref="UniProtKB/TrEMBL:B4SCT5"
FT                   /protein_id="ACF42769.1"
FT                   /translation="MSKKLFVLAGELSGDMHAAGVITELLKARPELKVFGIGGEKLRTL
FT                   GAELLYDTAQMSIMGFLDVLKHAGFLRRVIRELKEAIRREKPQAAFLVDYPGMNLMMAR
FT                   FFHQLGIPVIYYISPQVWAWKEGRVKAIRRDVDRLLVIFDFEVEFFRRHGINAEFVGHP
FT                   VIEQLAELSLPSRELFVQRYNLAPDTLLIGLLPGSRKQEIAHILPEMLKAARLLSQNYR
FT                   VVFLFGRAPHLDEEVYHAWSAYPDLSVINCSAYEVMQYSDLALVTSGTATLESLCFGVP
FT                   MVVVYRTGWLNYLIGRQLVKLTSISLANIVAKGLGSSERAVPELIQHEASGTEIYQTAC
FT                   TILDDPEKAGTMRRELLAARERLASDSPSHKIAAILQEYL"
FT   gene            428511..428798
FT                   /locus_tag="Ppha_0444"
FT   CDS_pept        428511..428798
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0444"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cch:Cag_0476 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42770"
FT                   /db_xref="GOA:B4SCT6"
FT                   /db_xref="UniProtKB/TrEMBL:B4SCT6"
FT                   /protein_id="ACF42770.1"
FT                   /translation="MEKAVAYLVGHPVLFIIAVIISIMILFSFLRRVMRLFFVVAAMLI
FT                   LYAAWLHFTGGNIHQSFHHIEQGFQSVIHVVGELFKFLLDFLKSPQKGGV"
FT   gene            complement(428802..429140)
FT                   /locus_tag="Ppha_0445"
FT   CDS_pept        complement(428802..429140)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0445"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cph:Cpha266_2281 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42771"
FT                   /db_xref="UniProtKB/TrEMBL:B4SCT7"
FT                   /protein_id="ACF42771.1"
FT                   /translation="MKICGNDDSCRLVKALLLTSVGTVSLAVCSSGAPQKIGDEYGGGI
FT                   IAAIFNPGDPGYSDMAEQFMIASKTDVSESEILSSNLAASDKMEQYGYYDRLLQSEEVL
FT                   RHVAASGN"
FT   gene            complement(429219..431876)
FT                   /locus_tag="Ppha_0446"
FT   CDS_pept        complement(429219..431876)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0446"
FT                   /product="Tetratricopeptide TPR_2 repeat protein"
FT                   /note="PFAM: TPR repeat-containing protein;
FT                   Tetratricopeptide TPR_3; Tetratricopeptide TPR_4;
FT                   Tetratricopeptide TPR_2 repeat protein; SMART:
FT                   Tetratricopeptide domain protein; KEGG: ter:Tery_3497
FT                   peptidase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42772"
FT                   /db_xref="GOA:B4SCT8"
FT                   /db_xref="InterPro:IPR002151"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:B4SCT8"
FT                   /protein_id="ACF42772.1"
FT                   /translation="MCVFGCNGLTPCQSPEGSSQKAPSSLFTSGVILAIFVRLFIFFTI
FT                   ECNETLHAAVNSDADRLYSAKSYEQEIIKAKKALEVSDSSLAQTDLTLCLNNLAALYFV
FT                   EGRYAEAEPLYLRALDIRTKLLGPDHADVAVSLNNLAMLYNAEGKYAEAEPLLTRALAI
FT                   QERMFGSLNAEFALILNNMSELYYMQGHYAEAESLCKRSLAIREQLFGENHPDIAQSLN
FT                   NLARVFYDRGRYAEAEPLYLRALDIWENNPGSAEPDAARALNNLSELYRSEGRYAEAEP
FT                   LSLRALALRERAFGLEHPLVATNLNNLALLYNNQGRYAKAEPLCRRALAIREKLLGPLH
FT                   PEVATSLSNLALICKSEGKYAEALPLSMRALAIREKNFGLQHPYVAKSMHNLAELYVSM
FT                   GRMAEALPLHEVALATLTKLLGTEHHDTGLSMNHLAGLYFTLGQYQKAEPLYRQALAIH
FT                   DKLVGPLHPDHPEVATTLNNLAELMRIQGRYAEADSCNRRALAMRERLFGPEHPDVALS
FT                   LCNTGVLKKNQGKYAEAAPLFIRSLKIREKLFGAVHPDVATSLSNLAALYKSEGRYAEA
FT                   LPLSQRALAIRKKVLTPEHPDLATSLNNLGVLYTILGKYTQAEALLTRSLALREKLFAP
FT                   LHPDIATSLNNMAELFRIQARYREAAPLYRRSLDIREKLFPPLHPDIALTLNNFALLYS
FT                   DQGEYAVAEPLYLRALDITKRLFGPKSLDTAISMNNLAALYSAGGRHAEAAPLYSDAMA
FT                   IMENVDATHHDSHMVALNNHAEGYLASKDDHEAEDCVKRSLAIREKNFGTLHPSVATCL
FT                   NNLAVILDAKGQHAEAEPLYLRSIAIVECALSPDHPVIAQILQNLALLYRKTGRDGAAG
FT                   ELEKRALLITGKTR"
FT   gene            complement(432043..434013)
FT                   /locus_tag="Ppha_0447"
FT   CDS_pept        complement(432043..434013)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0447"
FT                   /product="ferredoxin"
FT                   /note="PFAM: ferredoxin; FAD-dependent pyridine
FT                   nucleotide-disulphide oxidoreductase; KEGG: cch:Cag_0580
FT                   putative NADPH-dependent glutamate synthase small subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42773"
FT                   /db_xref="GOA:B4SCT9"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR028261"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B4SCT9"
FT                   /protein_id="ACF42773.1"
FT                   /translation="MKQLSLIIDQQAVTTAQGTSILEAAAEAGITIPTLCFLNSLHETG
FT                   SCWMCIVEIKGKNRFVPACDTLASEGMVIETDNAEISAMRRQSLERIIEEHGGDCMGPC
FT                   ELSCPAGCNIPDFVAAIARHDEREAIRIIKQSIPLPGILGRICPAPCEDECRRHGVDQP
FT                   VSICALKRYAADRDSAQPERFIPEIAPKTGKKVAIVGAGAAGLSAAWFLLSKGHGVTIL
FT                   ESSEEAGGMLRYGIPRFRLPETVIDSDIAPLLEMGLEFRFNTTFGQEVTLETLQAQFDA
FT                   VFLAIGAQKASKMHIAGEDEPGVTSGIAFLRRVALDDQPHLEGRVVVTGGGNTAIDAAR
FT                   SAMRLGASTVTILYRRSRKEMPANASEIDEALSEGISLVEWAAPTAIRRLNDALEITAI
FT                   MMKPGAPDQSGRRRPVPVEGSEFTIMADTVISAIGQQIDRSVADHAGIGSTEHGEVLVH
FT                   PETLQSARPWLFAGGDCVTGADTAIQAVEQGKRAAYAINLFLGDEAVTVPKASFNSSYG
FT                   ARDEAPGAFYDKAEPAERVALAELLPTDRTNSFCEVVTGYTETQAREEALRCLQCRCNA
FT                   VNDCRLRVLASRYLPVEAAQKHDHQGFYRAENADMGMEREKCVDCGICVRMLEEFDGAI
FT                   DIAVMAESCPTGALSRPPGLS"
FT   gene            complement(434059..435024)
FT                   /locus_tag="Ppha_0448"
FT   CDS_pept        complement(434059..435024)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0448"
FT                   /product="hydroxymethylbutenyl pyrophosphate reductase"
FT                   /EC_number="1.17.7.4"
FT                   /note="KEGG: cch:Cag_0579 4-hydroxy-3-methylbut-2-enyl
FT                   diphosphate reductase; TIGRFAM: hydroxymethylbutenyl
FT                   pyrophosphate reductase; PFAM: LytB protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42774"
FT                   /db_xref="GOA:B4SCU0"
FT                   /db_xref="InterPro:IPR003451"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4SCU0"
FT                   /protein_id="ACF42774.1"
FT                   /translation="MNINLDRTSSGFCIGVQGTIYAAEEKLQQEGGLYSFGDIVHNEVE
FT                   VKRLEALGLVTVDERAFRELRDAHVLIRAHGEPPSTYRIARENNLTVTDTTCPVVSRLQ
FT                   RTTRLLFELGYQIIIYGKQSHPEVIGINGQCNNQAVIIKHADLSDPDELKGLDLAKKSA
FT                   LISQTTMDVPGFYELKALLEARFAQYLSSEKSAWMAIRDIDITAAMTGVLSMPSLLFKD
FT                   TICRQVSSRNQKLHDFSLANDVVIFVAGKKSSNGQVLYHICKEANPRSYFIEEIEEIEE
FT                   RWLRNSDGRAVATVGVCGATSTPMWHLEKVALHLEKNFAQ"
FT   gene            complement(435101..435922)
FT                   /locus_tag="Ppha_0449"
FT   CDS_pept        complement(435101..435922)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0449"
FT                   /product="glutamate racemase"
FT                   /EC_number="5.1.1.3"
FT                   /note="KEGG: cch:Cag_0573 glutamate racemase; TIGRFAM:
FT                   glutamate racemase; PFAM: Asp/Glu/hydantoin racemase"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42775"
FT                   /db_xref="GOA:B4SCU1"
FT                   /db_xref="InterPro:IPR001920"
FT                   /db_xref="InterPro:IPR004391"
FT                   /db_xref="InterPro:IPR015942"
FT                   /db_xref="InterPro:IPR033134"
FT                   /db_xref="UniProtKB/TrEMBL:B4SCU1"
FT                   /protein_id="ACF42775.1"
FT                   /translation="MMLHHKVTTEAPIGIFDSGIGGLTVVKAVQAALPFERILYFGDTA
FT                   RVPYGPKSQVTIRKYAADDTAMLMRYQPKIIIVACNTVSALALDVVQKSCGVIPVTGVL
FT                   RAGARLATEVTRNNRIGVIGTRATVSSNAYGIAINEFNSEIEVVSRACPLFVPLAEEGF
FT                   IDHLATRLIAEEYLAEITREGIDTLVLGCTHYPILRKVIEEIVGPEIRIIDSAEAVALR
FT                   TRELLEESGHLSSSLKVSAPHLLVSDLPQKFSMLYQLFMGSELPDVELVEV"
FT   gene            complement(436042..437133)
FT                   /locus_tag="Ppha_0450"
FT   CDS_pept        complement(436042..437133)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0450"
FT                   /product="GTP-binding protein YchF"
FT                   /note="TIGRFAM: GTP-binding protein YchF; PFAM: GTP-binding
FT                   protein HSR1-related; Protein of unknown function DUF933;
FT                   KEGG: cch:Cag_0572 translation-associated GTPase"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42776"
FT                   /db_xref="GOA:B4SCU2"
FT                   /db_xref="InterPro:IPR004396"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR012676"
FT                   /db_xref="InterPro:IPR013029"
FT                   /db_xref="InterPro:IPR023192"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031167"
FT                   /db_xref="InterPro:IPR041706"
FT                   /db_xref="UniProtKB/TrEMBL:B4SCU2"
FT                   /protein_id="ACF42776.1"
FT                   /translation="MSLRCGIVGLPNVGKSTLFNAITAKQAEAANYPFCTIEPNVGTVL
FT                   VPDERMQQIADVVKTPTLVPATLEIVDIAGLVKGASKGEGLGNQFLSHIREVDAIVHVV
FT                   RCFEDDNIIHVEGRIDPADDIVTIETELMLADLDSMERRIDRLRKNARKDKELLLQLDV
FT                   AEKIISGLSDGIPVRKIIETPEEQAIARQFFLLSSKPILFAANVAETDLPDGNHFTRKV
FT                   AEIAEASGSKMLIISAKTEAEIAELPEEERPEFLESLGLHLSGLDRLIKTAYDLLGLQT
FT                   YFTAGEKEVHAWTIRKGAAAPEAAGAIHSDFEKGFIRAEVMYYRDLIELGSEQKVKVAG
FT                   KLRSEGKEYIVRDGDVIVFRFNV"
FT   gene            437251..437946
FT                   /locus_tag="Ppha_0451"
FT   CDS_pept        437251..437946
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0451"
FT                   /product="cytidylate kinase"
FT                   /EC_number="2.7.4.14"
FT                   /note="KEGG: pvi:Cvib_1515 cytidylate kinase; TIGRFAM:
FT                   cytidylate kinase; PFAM: cytidylate kinase region"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42777"
FT                   /db_xref="GOA:B4SCU3"
FT                   /db_xref="InterPro:IPR003136"
FT                   /db_xref="InterPro:IPR011994"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4SCU3"
FT                   /protein_id="ACF42777.1"
FT                   /translation="MKQETGKKRIIIAIDGPAASGKSTTARKVAHLLGYTYIDTGAMYR
FT                   SVTLKALKQGVLDSLHHSPESVSGLLHDIVIHFEGDHVFLDGEDVTAEIRSNQVSREVS
FT                   FISSLKPVRDRLREMQQHLGRQRGVVMDGRDIGTVVFPDAELKIYLVADARERAKRRHA
FT                   ELTAKSAEGVELPDLDSLEQEITKRDRDDAEREHAPLKKHPEAYEIDTSAMTIERQVEM
FT                   VCQLARARE"
FT   gene            438070..439848
FT                   /locus_tag="Ppha_0452"
FT   CDS_pept        438070..439848
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0452"
FT                   /product="RNA binding S1 domain protein"
FT                   /note="PFAM: RNA binding S1 domain protein; KEGG:
FT                   cch:Cag_0570 30S ribosomal protein S1"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42778"
FT                   /db_xref="GOA:B4SCU4"
FT                   /db_xref="InterPro:IPR000110"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/TrEMBL:B4SCU4"
FT                   /protein_id="ACF42778.1"
FT                   /translation="MAEAFTQEKKVKERPARKKLKFFAHYEPAELALMEQLYSSTLNEI
FT                   TEDEIIKGRIVSISNKDVTIDVGFKSEGIVSLLEFRAEDEVQVGDDVEVYLENIEDKMG
FT                   QLILSKKKADVLRIWDKIYDSIENDTIINGKIINRVKGGMTVSLSGVEAFLPGSQIDVK
FT                   PVRDFDALVGQTMDFRVVKINPVTQNIVVSHKVILEEAYAARREEMLANIKVGMVLEGT
FT                   VKNITDFGIFVDLGGLDGLVHITDITWGRINHPSEVVDLDQPIKVVVVGFDENTKRVSL
FT                   GMKQLESHPWENIEVKYPVTSKAQGRVVSITDYGAFVEIEKGIEGLVHISEMSWTQHIK
FT                   HPGQFVTLGQEVECVILNIDKDHTKLSLSMKRVNEDPWIALSEKYIEGSLHKGTVSNIT
FT                   DFGVFVELEPGVDGLVHISDLSWTKKIRHPSELVKKNQDLEVKVLKFDVHARRIALGHK
FT                   QINQDPWDEFEQKYAVGAETPGEISQIIEKGVIVILPGDVDGFVPVSHLLQGGVKDIHS
FT                   SFKIGDALPLRVIEFDKENKRIILSALEYFKDKNKEEIEAYLAAHPNEKKEIEAATAEL
FT                   EPPVKSSEKKVSESVK"
FT   gene            complement(440029..441846)
FT                   /locus_tag="Ppha_0453"
FT   CDS_pept        complement(440029..441846)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0453"
FT                   /product="peptidase S8 and S53 subtilisin kexin sedolisin"
FT                   /note="PFAM: peptidase S8 and S53 subtilisin kexin
FT                   sedolisin; KEGG: pmo:Pmob_0755 peptidase S8 and S53
FT                   subtilisin kexin sedolisin"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42779"
FT                   /db_xref="GOA:B4SCU5"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR015500"
FT                   /db_xref="InterPro:IPR022398"
FT                   /db_xref="InterPro:IPR023827"
FT                   /db_xref="InterPro:IPR023828"
FT                   /db_xref="InterPro:IPR036852"
FT                   /db_xref="UniProtKB/TrEMBL:B4SCU5"
FT                   /protein_id="ACF42779.1"
FT                   /translation="MNATADTQHGNPLPPAANLFFKTIFLLDEARSVATGDGIVTFERV
FT                   FFSPARLTAFSKGEFDKKIDDESSIKESYENMIPEEQKLHRCFQVVFKTQELRNAFIHK
FT                   YKNNNALESVTEEVEVKLFNFQIPPNDTMNSQLWGHQKTNVEAVWDCSRGCGPVVAIVD
FT                   TGIDTTHPELQHQLWEVYPGVHGINLNNGPISDITDYHPLGHGTHVAGIVAARGNNLYG
FT                   VIGAAPAAQLMGIRIYGSLPTGSAMAASGIYWAIGLGADVINCSWGVQVPFDPVISLAI
FT                   GAALAQTPPPVIVAAAGNDGVDAINYYPASDPQVICVAATDINDARAIFSSSLSSNWGS
FT                   VVDVAAPGKDIWSTVPVSVNSSGFMQLSGTSMAAPHVSAMVAIIRSRLSGLTQPEYLEI
FT                   VQTYVSTIYPDRYIGTGRIDFTFLKEILCGCGCSPCRYRVILEERRLYYASIRKKFTIA
FT                   GNSNPPACTLHECTEVTISPSLEPCFKLHWGDSPQDQIETHDTEIIYITACNPYCNITF
FT                   KGLKIIAIRIIPNYVLPNNEMAVELAASSLICYGTLGPSRCTTREYALITSDTAPGTYS
FT                   LEFEYCIEEIEYHGYNRGKNSFTLTLVDS"
FT   gene            442003..442476
FT                   /locus_tag="Ppha_0454"
FT   CDS_pept        442003..442476
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0454"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_A1213 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42780"
FT                   /db_xref="UniProtKB/TrEMBL:B4SCU6"
FT                   /protein_id="ACF42780.1"
FT                   /translation="MVLCHGCAHVRFLLTLFDNCYYEVKVQKMQTLEYLHLLYPLYNNE
FT                   GNNALRVRIAFVQKTLAERLGVCEVLGSKCQGKLLLWSIRTQLNFEAFFWGESGESGLM
FT                   TEKLSWLKSMQRKSGGCEGKDCVLTWGDLALCLKGRRSNVGQEVSRGHNSPML"
FT   gene            complement(442525..442740)
FT                   /locus_tag="Ppha_0455"
FT   CDS_pept        complement(442525..442740)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0455"
FT                   /product="protein of unknown function UPF0150"
FT                   /note="PFAM: protein of unknown function UPF0150; KEGG:
FT                   noc:Noc_0168 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42781"
FT                   /db_xref="InterPro:IPR031807"
FT                   /db_xref="InterPro:IPR035069"
FT                   /db_xref="UniProtKB/TrEMBL:B4SCU7"
FT                   /protein_id="ACF42781.1"
FT                   /translation="MRHKYETILYWSEEDSAFIAEIPELPGCMAHGASQEEALANVNEA
FT                   MLLWIDTATEFGDPIPEPNGRRLMYA"
FT   gene            complement(442761..443681)
FT                   /locus_tag="Ppha_0456"
FT   CDS_pept        complement(442761..443681)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0456"
FT                   /product="GTP-binding protein Era"
FT                   /note="TIGRFAM: small GTP-binding protein; GTP-binding
FT                   protein Era; PFAM: GTP-binding protein HSR1-related; KH
FT                   type 2 domain protein; KEGG: plt:Plut_1731 GTP-binding
FT                   protein Era"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42782"
FT                   /db_xref="GOA:B4SCU8"
FT                   /db_xref="InterPro:IPR004044"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005662"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030388"
FT                   /db_xref="UniProtKB/TrEMBL:B4SCU8"
FT                   /protein_id="ACF42782.1"
FT                   /translation="MSSSPFSCGFAIIIGPPNAGKSTLLNELLDYKLSIVTPKPQTTRK
FT                   KITGIYHNEKCQIIFLDTPGIMKPQQKLHESMLGVIRDTLKDADVVIALLPFSGKKDFF
FT                   DRPFAEELFGNWLKPAGKPVIAVLNKCDLVSAERQEEAEAFVRKSWNPAAVLSVSALKA
FT                   TNLPQLIETIQPFLPLDYPLYPEDTLSTAPERFFVSEIIREKIFLLYGREVPYSTEVVI
FT                   DEFREQYENDPTRKDLIRCSVIVERETQKQILIGSKGAALKKLGQTARKDIEEMLGRPV
FT                   FLELFIKVRPDWRKNQNFLKSYGYH"
FT   gene            443787..445025
FT                   /locus_tag="Ppha_0457"
FT   CDS_pept        443787..445025
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0457"
FT                   /product="rod shape-determining protein RodA"
FT                   /note="TIGRFAM: rod shape-determining protein RodA; PFAM:
FT                   cell cycle protein; KEGG: plt:Plut_1730 rod
FT                   shape-determining protein RodA"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42783"
FT                   /db_xref="GOA:B4SCU9"
FT                   /db_xref="InterPro:IPR001182"
FT                   /db_xref="InterPro:IPR011923"
FT                   /db_xref="InterPro:IPR018365"
FT                   /db_xref="UniProtKB/TrEMBL:B4SCU9"
FT                   /protein_id="ACF42783.1"
FT                   /translation="MEKQSKLDLSLLLSMSGLIVFGLMAIYSATNGTGDTTLFYRQLVW
FT                   AIVGVVALLFVYYNDVRFIRDNSYIFYAVGLLLLVAVLIFGKKIAGQTSWMKIGFLSFQ
FT                   PSEIAKMATILALARFLSDDETDISSIPHLLVALAIPFFPVLLIMLQPDMGTMLTFLPL
FT                   IASMLILAGFDIYVLMLIVFPVILMISGFFNIYFIFVLALLLMTILRLQHTKFNVHQLF
FT                   VIGSGLAASLFTHNFASEILKPHQIKRIQTFIDPMSDPRGAGYNALQAKIAISSGGFFG
FT                   KGFLEGTQTQLRFIPAQWTDFIFCVIAEELGFIGASLLIALFLALILRIIWAIHSINNK
FT                   FVELTLAGFVSLLCVHVIINIGMTLGMIPVIGVPLPFVSYGGSSLVGNMIMVGLAMNFL
FT                   RNKRTLGYSGRLG"
FT   sig_peptide     443787..443876
FT                   /locus_tag="Ppha_0457"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.957) with cleavage site probability 0.281 at
FT                   residue 30"
FT   gene            complement(445083..445538)
FT                   /locus_tag="Ppha_0458"
FT   CDS_pept        complement(445083..445538)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0458"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: plt:Plut_1729 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42784"
FT                   /db_xref="UniProtKB/TrEMBL:B4SCV0"
FT                   /protein_id="ACF42784.1"
FT                   /translation="MSAIIKESGSPDKYDLFIQRIDYFQSLVEEKKNLQAEINLIQKEF
FT                   NEKVRPLEDELANVIKKLETNLSRLEGAASVPTASSKFARGQLGASIKELLRTNPDKSF
FT                   KPRDIAEALNIKGTTVSLWFNKYGVADPEIDRVPTGKEGKRFVYRIR"
FT   gene            445711..447072
FT                   /locus_tag="Ppha_0459"
FT   CDS_pept        445711..447072
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0459"
FT                   /product="MiaB-like tRNA modifying enzyme"
FT                   /EC_number="1.3.1.74"
FT                   /note="KEGG: cph:Cpha266_0422 RNA modification enzyme, MiaB
FT                   family; TIGRFAM: RNA modification enzyme, MiaB family;
FT                   MiaB-like tRNA modifying enzyme; PFAM: Radical SAM domain
FT                   protein; Protein of unknown function UPF0004; SMART:
FT                   Elongator protein 3/MiaB/NifB"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42785"
FT                   /db_xref="GOA:B4SCV1"
FT                   /db_xref="InterPro:IPR005839"
FT                   /db_xref="InterPro:IPR006467"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013848"
FT                   /db_xref="InterPro:IPR020612"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR038135"
FT                   /db_xref="UniProtKB/TrEMBL:B4SCV1"
FT                   /protein_id="ACF42785.1"
FT                   /translation="MKEHSNKKVAAVTLGCKLNYAETSTILDQLSKKGWLLSSIGERAD
FT                   LIIIHTCAVTKQAEQKCRQKIRAIKRKNPSSKIAVIGCYSQFNPEALSAIDGIDAILGS
FT                   NDKFDIKRYEDILLGTEPSPLVRVTPANTIEKVYPGYSLPAAASCERTRAFLKIQDGCD
FT                   NGCSYCAIPLIRGGSRSLPAAHIVERAHLLASSGYREIVLTGVNTGDYRSGGLKLKELL
FT                   RMLEEVSISRIRISSIEPDIVDRELIALVAGSKKIVPHFHIPLQSGSDRILRAMRRHYD
FT                   TALYRDRVLMSVENIADCAIGADVMVGYPGETEEDFLKMYHFIEELPLASLHVFSCSIR
FT                   PGTRLALQITNSERKPVESAEIARRYSELAELGRRHEARFKARYTGKECMVLIERSKPV
FT                   EAGQPAYSGYTRNYLRVLVESNESQLQHTLPGNEVPVRIDSLDEDLNLKGRVLS"
FT   gene            447124..447657
FT                   /locus_tag="Ppha_0460"
FT   CDS_pept        447124..447657
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0460"
FT                   /product="adenine phosphoribosyltransferase"
FT                   /EC_number="2.4.2.7"
FT                   /note="KEGG: cch:Cag_0565 adenine
FT                   phosphoribosyltransferase; TIGRFAM: adenine
FT                   phosphoribosyltransferase; PFAM: phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42786"
FT                   /db_xref="GOA:B4SCV2"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005764"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4SCV2"
FT                   /protein_id="ACF42786.1"
FT                   /translation="MPIKSRIRSIPDYPKKGILFRDITTLIKDPVGFRLVIDSLTQHYL
FT                   QEGMDFDVIVGIEARGFIIGGALSYALGKGFIPVRKPGKLPADVVSQEYQLEYGSDTIE
FT                   IHVDALVAGQKVLLVDDLLATGGTALAAAALVEKVGGIVAEMAFIVNLPDIGGERKILE
FT                   KGYSIYSLTDFEGE"
FT   gene            complement(447920..448228)
FT                   /locus_tag="Ppha_0461"
FT   CDS_pept        complement(447920..448228)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0461"
FT                   /product="histone family protein DNA-binding protein"
FT                   /note="PFAM: histone family protein DNA-binding protein;
FT                   KEGG: cph:Cpha266_0424 histone family protein DNA-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42787"
FT                   /db_xref="GOA:B4SCV3"
FT                   /db_xref="InterPro:IPR000119"
FT                   /db_xref="InterPro:IPR010992"
FT                   /db_xref="InterPro:IPR020816"
FT                   /db_xref="UniProtKB/TrEMBL:B4SCV3"
FT                   /protein_id="ACF42787.1"
FT                   /translation="MGKTTTKADLVNVIAHKTGLTKNETESVVDSLFESIIDSLKTGKR
FT                   IEIRGFGSFNIRHKNFRQARNPRTGEKVTVEPKNVPTFKISKEFKHAVSESLKSDTE"
FT   gene            complement(448266..448637)
FT                   /locus_tag="Ppha_0462"
FT   CDS_pept        complement(448266..448637)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0462"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: plt:Plut_1723 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42788"
FT                   /db_xref="GOA:B4SCV4"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:B4SCV4"
FT                   /protein_id="ACF42788.1"
FT                   /translation="MPMHIAALLFLGVSAGILSGMFGVGGGIIIVPALVLLFGMTQQSA
FT                   IATSLVALLLPVGLLGVIEYYHSGKISTTNIWIALLIAAGLFTGAYFGAKIAIHLSSDT
FT                   LRKAFAVFMGIVALHLWFK"
FT   sig_peptide     complement(448557..448637)
FT                   /locus_tag="Ppha_0462"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.871) with cleavage site probability 0.493 at
FT                   residue 27"
FT   gene            complement(448656..450644)
FT                   /locus_tag="Ppha_0463"
FT   CDS_pept        complement(448656..450644)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0463"
FT                   /product="ATP-dependent metalloprotease FtsH"
FT                   /EC_number="5.6.1.1"
FT                   /note="KEGG: pvi:Cvib_1504 ATP-dependent metalloprotease
FT                   FtsH; TIGRFAM: ATP-dependent metalloprotease FtsH; PFAM:
FT                   peptidase M41; AAA ATPase central domain protein; peptidase
FT                   M41 FtsH extracellular; ATPase associated with various
FT                   cellular activities AAA_5; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42789"
FT                   /db_xref="GOA:B4SCV5"
FT                   /db_xref="InterPro:IPR000642"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR005936"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037219"
FT                   /db_xref="InterPro:IPR041569"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4SCV5"
FT                   /protein_id="ACF42789.1"
FT                   /translation="MSENPVKRPGKDGSRNKFKPVQEEGGTPGWFRSKGESPQGKFPGF
FT                   LLFLMAGLLMLFVFLRFFSGTDAPEITYNEYKSVLSRALVTEVTVKTYEDKSAILSGKL
FT                   NAPAQLQLIDKTTLQTNRFAVRVPSFTLEQADMLTEKGVRLKVEKGSSDLNTFLALFAP
FT                   WIIFAALYFFLFRRMSGQNGAQAKNIFSFGKSRAKMVSEFEVKTTFKDVAGVDEAIEEL
FT                   QETVEFLTNPEKFQKIGGKIPKGVLLLGPPGTGKTLLAKAIAGEAKVPFFSISGADFVE
FT                   MFVGVGAARVRDLFEQAKKNAPCIIFIDEIDAVGRSRGAGLGGGHDEREQTLNQLLVEM
FT                   DGFTTNENVILIAATNRPDVLDSALLRPGRFDRQITIDKPDIRGREAILKIHTRNTPLD
FT                   GDVDITVLAKSSPGFSGADLANLVNEAALLAARHEQVLITAVNFEQARDKILMGPERRS
FT                   MFISDEQKKLTAYHEAGHVLVSIHTKGSDPIHKVTIIPRGRSLGLTAYLPLEDRYTHNR
FT                   EYLLAMITYALGGRVAEELVFQECSTGAANDIEKATDIARRMVRQWGMSESLGPINYGD
FT                   SHKEVFLGKDYSHIREYSEETALQIDVEVRNIIMGCMENAKTVLSEQLAVLHRLAGILI
FT                   EKESLNAREIQEITGPGQGALPNPVTA"
FT   gene            450892..452400
FT                   /locus_tag="Ppha_0464"
FT   CDS_pept        450892..452400
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0464"
FT                   /product="glutamyl-tRNA synthetase"
FT                   /EC_number="6.1.1.17"
FT                   /note="KEGG: cch:Cag_0392 glutamyl-tRNA synthetase;
FT                   TIGRFAM: glutamyl-tRNA synthetase; PFAM: glutamyl-tRNA
FT                   synthetase class Ic"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42790"
FT                   /db_xref="GOA:B4SCV6"
FT                   /db_xref="InterPro:IPR000924"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR004527"
FT                   /db_xref="InterPro:IPR008925"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020058"
FT                   /db_xref="InterPro:IPR020751"
FT                   /db_xref="InterPro:IPR033910"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4SCV6"
FT                   /protein_id="ACF42790.1"
FT                   /translation="MVGQRVRTRFAPSPTGYLHVGGLRTALYNYLFAKKMHGDFIIRIE
FT                   DTDQTRKVEGAQQNLIKALEWAGIVADESPEKGGNYGPYVQSERLDLYGRYCQQLLDDQ
FT                   HAYYCFATHEELEENRQLQIKQGLQPKYNRKWLPEEMGGSMPPSVIRKKLDEGGPYVIR
FT                   MKVPDYVSVWFEDIIRGPVEFDSATIDDQVLMKSDGFPTYHFASVIDDHLMEFTHIIRG
FT                   EEWLSSMPKHLLLYEFFGWEPPKVAHLPLLLNADRSKLSKRQGDVAVEDYIRKGYSNDA
FT                   IINFVAMLGWNEGEGSEQEVYSMEQLIEKFSLERVGKAGAVFNIDKLNWLEKQYIKNRP
FT                   TEQLVPVIKPILLAELERKETMMPVDLITSEAYLEKVIELMRERVGFEHEFVTFSSYFF
FT                   FEPDSYDEEAVKKRWAPDTNSLLQEFTEILATLEEFSAENIEAHLKEFVAPKGLKAAAL
FT                   IHPLRIVSSGVSFGPSLYHMLEVLGKETVLRRILKGREKITFSA"
FT   gene            452501..452576
FT                   /locus_tag="Ppha_R0017"
FT                   /note="tRNA-Phe1"
FT   tRNA            452501..452576
FT                   /locus_tag="Ppha_R0017"
FT                   /product="tRNA-Phe"
FT   gene            452724..453854
FT                   /locus_tag="Ppha_0465"
FT   CDS_pept        452724..453854
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0465"
FT                   /product="hydroxyneurosporene synthase"
FT                   /note="PFAM: hydroxyneurosporene synthase; KEGG:
FT                   cph:Cpha266_0428 hydroxyneurosporene synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42791"
FT                   /db_xref="UniProtKB/TrEMBL:B4SCV7"
FT                   /protein_id="ACF42791.1"
FT                   /translation="MKITTKLDQERWHEMQDPGAYEWWYFDAEDKESGFSFVLIWFSGF
FT                   PFSPYYTSHYEKWKNRSRADAPSPSNYSGFSFQLYENQREIINFIREGRRELFESSRTD
FT                   IGVRFEKNRFTYNALRDEYTLDIDFTFPARHKALKATLLFKSCKRLVYEKKDNNNNGRV
FT                   PLHQWLLSVPGADVEGAITITETSDHTVRTIPVKAKGYHDHNLGAVPMQEYISRWYWGR
FT                   AFSAHFDIIYYVVFFKNNDYQPLSLLLLHDNQSETFTIYDTVQFHESNFRRGLFSPLHS
FT                   RDLYLHFEHANLKIHHNTVLDAGPFYLRFASSITLQTEDQQIENITGISEFLNPLRLES
FT                   RFMRVFTRSRIWRDGEASIMYGIYNRFKRSLDWNNR"
FT   gene            454026..454574
FT                   /locus_tag="Ppha_0466"
FT   CDS_pept        454026..454574
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0466"
FT                   /product="Plastoquinol--plastocyanin reductase"
FT                   /EC_number="7.1.1.6"
FT                   /note="PFAM: Rieske [2Fe-2S] domain protein; Cytochrome
FT                   b6-f complex Fe-S subunit; KEGG: cph:Cpha266_0429
FT                   Plastoquinol--plastocyanin reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42792"
FT                   /db_xref="GOA:B4SCV8"
FT                   /db_xref="InterPro:IPR005805"
FT                   /db_xref="InterPro:IPR014349"
FT                   /db_xref="InterPro:IPR014909"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:B4SCV8"
FT                   /protein_id="ACF42792.1"
FT                   /translation="MAQQGNFKSPSRMGGLGDSASPSSAGSVSGGKPRDQGIKEADFER
FT                   RSFLGKIVGGVGAAVAISTLYPVVRYLIPPPLKEVASVNELNVGKATEVPENTGKIYQF
FT                   NKDKVIVINDNGKLTACSAVCTHLGCSVSWDNAQNLIFCPCHGAKYQQTGEIISGPQPL
FT                   PLAPYKVRVEGENLIISKA"
FT   gene            454610..455875
FT                   /locus_tag="Ppha_0467"
FT   CDS_pept        454610..455875
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0467"
FT                   /product="Cytochrome b/b6 domain"
FT                   /note="PFAM: Cytochrome b/b6 domain; KEGG: cph:Cpha266_0430
FT                   cytochrome b/b6, N-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42793"
FT                   /db_xref="GOA:B4SCV9"
FT                   /db_xref="InterPro:IPR005797"
FT                   /db_xref="InterPro:IPR005798"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="InterPro:IPR027387"
FT                   /db_xref="InterPro:IPR036150"
FT                   /db_xref="UniProtKB/TrEMBL:B4SCV9"
FT                   /protein_id="ACF42793.1"
FT                   /translation="MAENNKNAMAGSAPAKPKPAAPVAAKPAAPGTAKPAAPGAAKPAA
FT                   STGGVYKPPVERAASNPYKDSRVSDLGAWFQERFYVVLPVIDYLKKKEVPKHRLSFWYY
FT                   FGGLTLFFFIIQILTGLLLLQYYKPTEAEAFTSFVFIQQEVPFGWLLRQMHAWSANAMV
FT                   MMAFIHMFSTFFMKSYRKPRELMWVSGFVLLVLSLGFGFTGYLLPWNELAFFATQVGTE
FT                   VPKVAPGGAFLVTLLRGGEEVSGETLTRMFSLHVVLLPGLLMLVLSAHLLLVQVLGTSA
FT                   PIGYKESGMIKGYEKFFPTFLAKDAIGWLIGFALLVYLAVVSPWEIGVKADALASAPLG
FT                   IKPEWYFWAQFQLLKDFTFPNGELVAIILFTVGAILWILVPFIDTKSSKEEKSPIFTII
FT                   GLLVLAFLLINTYRVYLESAAL"
FT   gene            complement(455997..459557)
FT                   /locus_tag="Ppha_0468"
FT   CDS_pept        complement(455997..459557)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0468"
FT                   /product="alpha amylase catalytic region"
FT                   /note="PFAM: alpha amylase catalytic region; SMART: alpha
FT                   amylase catalytic sub domain; KEGG: plt:Plut_1717 alpha
FT                   amylase, catalytic subdomain"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42794"
FT                   /db_xref="GOA:B4SCW0"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:B4SCW0"
FT                   /protein_id="ACF42794.1"
FT                   /translation="MQKFHTSPIKQNPPALQNKEHFYVNRNARELFHLTDPEFLSLPSS
FT                   GQESIITSERQTAVINNFLKKLKGADAKPVLPAQFLGMKLLHALFHSIMTKAIALRQPD
FT                   FLERLSGTLKEMLSEEESEEYLKRFVASFPAQNVYAGTETPSEWLRLQENRKHVLEESF
FT                   LVWLNNQNPALEQFSDLLNDEKLTRESSYRKVIMTMRSSMQAMGPVGPDHIDLAELLTR
FT                   PIKHAPTSILEQLRYIRLNWGDLLDESPLWGLLGGAIDFIEDEDKYLFFEKIAQERALR
FT                   NDGHVFEKEVHVPEYSSLDDANAPANYSIDSSWMPEVVMLAKSTYVWLDQLSKIYRRPV
FT                   HRLQDIPDAELDLIAERGFTALWLIGLWQRSFASQKIKQLQGNPEAKASAYALENYTIS
FT                   DDIGGYEGYHNLFQRAKQRGIRLASDMVPNHTGMDSELVRNNPDWFLSSHTAPYYNYSY
FT                   NGPNLSSDSRYGIYLEDGYWNRSDAAVTFKRVDYLTGDTRYIYHGNDGTIMPWNDTAQL
FT                   NFLSAEVREGVIQQILQVARMFPIIRFDAAMVLAKRHIQRLWFPLHGHSAGVPSRSANA
FT                   MSMSEFDAAIPEEFWREVVDRIHQKVPDTLLLAEAFWMLEGYFVRTLGMHRVYNSAFMH
FT                   MLKKEDNANYRYLIKNTLEFDAEILKRYVNFMNNPDEDTAIAQFGRGDKYFGVCMMMLT
FT                   MPGLPMFGHGQVEGFTEKYGMEYAKAYYDEQPDENLVGRHYREIFPIMKKRPLFAEVRN
FT                   FFLYDVYSPEGAVNENIFAYSNRLGEETALVVFNNCFEQATGWIKTSVGYLQDHEIRQS
FT                   SLSEGLNIGRQENAFVIFRDHASGMEFLRSCREIADNGLLVALDGYKYNVFLDFRVVTP
FT                   SKLRPYDRLAAELNGRGLESIERAALAMSLSPLHRIITAALTGELLPAVDECGVESDAI
FT                   GLFESAVASLLNRAGATFSEIMEKPLAVPSALASKAAELYGRALLFPDLLKGDAHSGKL
FT                   QLALGLGSEGGLEYATLVRQWVMLDAVQQMVAAAGEIHSNLIDDWLMSDALRAIYPESG
FT                   MIGIPAENLPDLLVCMLTPQPAAAGADEAAEASLLAPVKALSTLNQLHLGRMLQFDERH
FT                   GKRWFREHRFSVLVAWLTLQELLKERYGVASDDEVEVEVEVEVEQMERVVARWVEASGA
FT                   LDMEAFLSGYEIGELMRLKV"
FT   gene            complement(459615..460010)
FT                   /locus_tag="Ppha_0469"
FT   CDS_pept        complement(459615..460010)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0469"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cph:Cpha266_0432 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42795"
FT                   /db_xref="UniProtKB/TrEMBL:B4SCW1"
FT                   /protein_id="ACF42795.1"
FT                   /translation="MTTTNEPLTGIQARIEELQNTIAEKETQIKARGHQLKEEIGAELS
FT                   PVELVRKHPFPATALLFVAGLQLGKTLRSGMTSSASAPAAVTISPSVEHAPSPRKGALS
FT                   TFGLEVLRSAKDLGFTYLQRYIDKKFK"
FT   gene            complement(459997..460395)
FT                   /locus_tag="Ppha_0470"
FT   CDS_pept        complement(459997..460395)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0470"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cph:Cpha266_0433 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42796"
FT                   /db_xref="GOA:B4SCW2"
FT                   /db_xref="UniProtKB/TrEMBL:B4SCW2"
FT                   /protein_id="ACF42796.1"
FT                   /translation="MMNRKAGKEQGSASSKSRRSGIAKLLDDTAVSTYEDVRAIIDAKF
FT                   ELLKIELTEKLSVIASAAVVAVILVVGMTYLLTTVALLIGELLGHPFLGYLIVSLLFLS
FT                   CFLFFTRFKPLLLRNLIQKILLSLHDYN"
FT   gene            complement(460419..460694)
FT                   /locus_tag="Ppha_0471"
FT   CDS_pept        complement(460419..460694)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0471"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cph:Cpha266_0434 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42797"
FT                   /db_xref="GOA:B4SCW3"
FT                   /db_xref="UniProtKB/TrEMBL:B4SCW3"
FT                   /protein_id="ACF42797.1"
FT                   /translation="MEQEVEVTIHRSKPADPVEEPQHETKIPEQLKELSETISDTFSSF
FT                   RESDSYEWLLKKADKATDYVKKNPMPAILVSLGAGTLFGLLFKKRR"
FT   gene            complement(460798..461535)
FT                   /locus_tag="Ppha_0472"
FT   CDS_pept        complement(460798..461535)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0472"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   plt:Plut_1713 3-oxoacyl-(acyl-carrier-protein) reductase,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42798"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B4SCW4"
FT                   /protein_id="ACF42798.1"
FT                   /translation="MTLSGKKVCFMTGASGVLGSEIALAVAGQGYTVFFTWNASESRAT
FT                   EVLEKIRWISPLSQMVRCDVSKSGDIVRAFATFREQFDRLDLLITSASNFFRTPLPNVT
FT                   EEQWDSLVDTNLKGTFFTMQEAAAIMCKQPFVSRIITMTDISADLVWRNFAPYTVSKCG
FT                   IQHLTRIFAKEFAPTILVNSIAPGTITLNPQKEMDSEEEMVRKIPLQRLGDPLDIVKCI
FT                   TFLLESDYITGQVLNVEGGRLLQ"
FT   sig_peptide     complement(461458..461535)
FT                   /locus_tag="Ppha_0472"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.991) with cleavage site probability 0.941 at
FT                   residue 26"
FT   gene            complement(461618..462673)
FT                   /locus_tag="Ppha_0473"
FT   CDS_pept        complement(461618..462673)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0473"
FT                   /product="molybdate ABC transporter, ATPase subunit"
FT                   /note="KEGG: cph:Cpha266_0452 molybdate ABC transporter,
FT                   ATPase subunit; TIGRFAM: molybdate ABC transporter, ATPase
FT                   subunit; PFAM: ABC transporter related; TOBE domain
FT                   protein; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42799"
FT                   /db_xref="GOA:B4SCW5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005116"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR011868"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B4SCW5"
FT                   /protein_id="ACF42799.1"
FT                   /translation="MNLRIDAEKKQGSFLLQLKADVSGDRIGIFGQSGSGKSTLVHLIS
FT                   GLLQPDRGEIYLNDECMFSSVKGIDLSPERRRIAIVFQQAMLFPHLSVKANLLYGYRRC
FT                   HAENRRIKPEALIALLKLQPLMQRGVHNLSGGEKQRVALGRAVLANPRLLLMDEPLSAL
FT                   DDTLRFQIIPYLKSVSEEFGIPYLFISHSILEMQLMTDRILVIRNGRMDETTTPDQLAR
FT                   NSMADNPKGYLNLLHLADPVLQNGLYAYSWGRNSLLISGGGADRASLFELSSREIILFK
FT                   KHPEAISARNLLHCTVTEMFESDGRVGIVLSVNGEKLVAEIVRSAADELDITIDSPLFA
FT                   AIKASSFRKLA"
FT   gene            complement(462670..463356)
FT                   /locus_tag="Ppha_0474"
FT   CDS_pept        complement(462670..463356)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0474"
FT                   /product="molybdate ABC transporter, inner membrane
FT                   subunit"
FT                   /note="TIGRFAM: molybdate ABC transporter, inner membrane
FT                   subunit; PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: cph:Cpha266_0453 molybdate
FT                   ABC transporter, inner membrane subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42800"
FT                   /db_xref="GOA:B4SCW6"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR011867"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B4SCW6"
FT                   /protein_id="ACF42800.1"
FT                   /translation="MTLTPEDISAIWLSLKVALTATLLALPFGFALAWLMVFRKFRGKV
FT                   VLEVLVNLPLTLPPVVIGFFLLLLLGKNGWIGKVLDASGMPIIFTWKAAVLASATVGFP
FT                   LLVRSIRLGMESIDQQLIEASRSLGAAWYDTLVTIILPLSLRGIMAGSSLMFARSLGEF
FT                   GATIIVAGNIPGMTQTIPLAIYDYASSPSSVTMALSLCLVSIIISVVVLLVHELLGKKL
FT                   DRRSAL"
FT   sig_peptide     complement(463255..463356)
FT                   /locus_tag="Ppha_0474"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.906) with cleavage site probability 0.897 at
FT                   residue 34"
FT   gene            complement(463403..464152)
FT                   /locus_tag="Ppha_0475"
FT   CDS_pept        complement(463403..464152)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0475"
FT                   /product="molybdenum ABC transporter, periplasmic
FT                   molybdate-binding protein"
FT                   /note="TIGRFAM: molybdenum ABC transporter, periplasmic
FT                   molybdate-binding protein; PFAM: extracellular
FT                   solute-binding protein family 1; KEGG: cph:Cpha266_0454
FT                   molybdenum ABC transporter, periplasmic molybdate-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42801"
FT                   /db_xref="GOA:B4SCW7"
FT                   /db_xref="InterPro:IPR005950"
FT                   /db_xref="UniProtKB/TrEMBL:B4SCW7"
FT                   /protein_id="ACF42801.1"
FT                   /translation="MIRSMKRIALLCFVLLSLALPAVAGELNLSVAASMKEVINELTAS
FT                   YTAKHPSTVFLKNFGPSGTLAGQIENGAPVDLFIAANNQWMDYLKEKNLVDGANAKMFA
FT                   YNSLVFAGRTTKKVSSMKELLKLDKIAIGSPKSVPAGEYAMTAFKNAGIEMQLAGKLVM
FT                   AKDVRECLMYAELGEVDGSFVYRTDALLAQKAGLLFVVPQKLYPRVTYPMALTVKAAKN
FT                   GEAKAFYLFLQGAEAQSVLRKYGFVLK"
FT   sig_peptide     complement(464078..464152)
FT                   /locus_tag="Ppha_0475"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 25"
FT   gene            complement(464166..465020)
FT                   /locus_tag="Ppha_0476"
FT   CDS_pept        complement(464166..465020)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0476"
FT                   /product="modD protein"
FT                   /note="TIGRFAM: modD protein; PFAM: Quinolinate
FT                   phosphoribosyl transferase; KEGG: cph:Cpha266_0455 ModD
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42802"
FT                   /db_xref="GOA:B4SCW8"
FT                   /db_xref="InterPro:IPR002638"
FT                   /db_xref="InterPro:IPR006242"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022412"
FT                   /db_xref="InterPro:IPR027277"
FT                   /db_xref="InterPro:IPR036068"
FT                   /db_xref="InterPro:IPR037128"
FT                   /db_xref="UniProtKB/TrEMBL:B4SCW8"
FT                   /protein_id="ACF42802.1"
FT                   /translation="MLYQLPDSDIERFIEEDMPYGDLTTFLLGIGSLQGEITFTSRELT
FT                   TLCCTEEAARLLERCGATVTSLLPSGTTIEAGVTFLSATGSAESLHAGWKVALNILEYA
FT                   SGIATRTRKIVTRVKEVHASITVVTTRKSFPGTKKVAIKAIMAGGALPHRLGLSESLLI
FT                   FRQHTAFCGGLEPFLQTVTELKLKAPEQKIIVEAFNLEEALAIAAAGADVVQLDKMQPE
FT                   ALSRLVQQLREVAPGVTISAAGGINAENAAAYAETGVDMLVLSSVYFGKPSDIAVAITS
FT                   SEP"
FT   gene            complement(465397..466113)
FT                   /locus_tag="Ppha_0477"
FT   CDS_pept        complement(465397..466113)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0477"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: cph:Cpha266_1685 ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42803"
FT                   /db_xref="GOA:B4SCW9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B4SCW9"
FT                   /protein_id="ACF42803.1"
FT                   /translation="MLKVENLRAGYSGDDAVRGISIEVAERSCVALVGANGAGKSTLVK
FT                   SVCGLLTPRGGKVLFGGEEIMGLPASQVARRGLSLCPEGRRLFAPLSVEENLLLGAYPR
FT                   LPSFGPFRRAASGDLQRIYEMFPRLGERRSQQAGSLSGGEQQMLAIGRLLMARPRLMIL
FT                   DEPSMGLAPMLVKEVFLAISSLRASGMTILLSEQFAKSALAVSDRAYIIEQGRVVLEGS
FT                   SAALAKDPAVMAAYLG"
FT   gene            complement(466107..468011)
FT                   /locus_tag="Ppha_0478"
FT   CDS_pept        complement(466107..468011)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0478"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: inner-membrane translocator; ABC transporter
FT                   related; SMART: AAA ATPase; KEGG: cph:Cpha266_1684 ABC
FT                   transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42804"
FT                   /db_xref="GOA:B4SCX0"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032823"
FT                   /db_xref="UniProtKB/TrEMBL:B4SCX0"
FT                   /protein_id="ACF42804.1"
FT                   /translation="MFAALDVGVREKTAERIVRAAMFIALAALPTFWHGQYALGLLTLM
FT                   AVYGVLLIGLDATVGYLGQVNLAQAALFALGAYGAALAVQAGAPLPLALVAGIAAALIP
FT                   GAALALPALRLEGPQFALSTLSFATLSVIVLNEFESVTNGALGLSVTRPRLFGLILDST
FT                   GFYWLCLATLFVAWEASQSLLKSRFGLAIEALRDSPTATDALGIGALRHKVLAFAWGST
FT                   LAGLAGGLHTMNFGYLQPGAFGYELMVILLLGVVFGGRRSQWGAFLGAAVVAMLPNLLS
FT                   NRTLFSVLVSAGCILTFVPTFRALLSRRAPVFREVAPASAMALAVALSFFVQNVEDWRK
FT                   GIFALFLFAVVVGFPNGIAGAMTTTLQRLIRFAPLPLPPAAGGIGSSRRAKGIALRLTD
FT                   LCKSFGGVRAVESVSLEIREGETLGLIGPNGSGKTTLVNLISGLYAPDSGSVTIAGRSP
FT                   VPGSLMSACAAGASRTFQNLQSFSGLTALESVLVCLKEGGEREALGWLLAVGLGEKARV
FT                   RCSEMAYGDLRFLEIARALATRPHLLMLDEPAAGMSKPDIARLVLLIASIKEAGVPILL
FT                   IEHHQDVVAELCDRVAVMDGGRLIALGTPNQVRRDPKVIEAYLGSDDTETGNNELLPC"
FT   gene            complement(468022..468906)
FT                   /locus_tag="Ppha_0479"
FT   CDS_pept        complement(468022..468906)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0479"
FT                   /product="inner-membrane translocator"
FT                   /note="PFAM: inner-membrane translocator; KEGG:
FT                   cph:Cpha266_1683 inner-membrane translocator"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42805"
FT                   /db_xref="GOA:B4SCX1"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:B4SCX1"
FT                   /protein_id="ACF42805.1"
FT                   /translation="MNGDLLALAQMAVGGGLMGMAYALVAYGFQLTHAAGKAVNFGQGE
FT                   LVMLGAFVGLTLSDSALPYWASVAGAMVAGAALGWFVERSAVRLALQQQNEGWILLTII
FT                   VGLFGVSAAENIWGRDDRAFPAPWPDGVLEFFGISVTWPELAIAGGALGIMALIELAKR
FT                   YTMIGIAVQAVSADQDAAELCGIRSQSAISLSWALSGMAAAFAGTIIAPVTTVGPTMAA
FT                   ALTLKAFSVAVVAGLSSGFGLLLTGVVFGATENISGFLLGSGWREAPALVLLILALAIR
FT                   PQGLFGKKIIRKV"
FT   sig_peptide     complement(468835..468906)
FT                   /locus_tag="Ppha_0479"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.916) with cleavage site probability 0.757 at
FT                   residue 24"
FT   gene            complement(468929..470152)
FT                   /locus_tag="Ppha_0480"
FT   CDS_pept        complement(468929..470152)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0480"
FT                   /product="Extracellular ligand-binding receptor"
FT                   /note="PFAM: Extracellular ligand-binding receptor; KEGG:
FT                   cph:Cpha266_1682 extracellular ligand-binding receptor"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42806"
FT                   /db_xref="GOA:B4SCX2"
FT                   /db_xref="InterPro:IPR000709"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:B4SCX2"
FT                   /protein_id="ACF42806.1"
FT                   /translation="MNAFRSILPFLVATCFSSAALAANVVKIAITGPFSGGSAPMGASM
FT                   RDGAKLAFSQINQKGGINVGGTMMRVELIERDDEGKNDRGALIAQEISSMSDVSAVIGT
FT                   VNTGIAVMGDKYYVEKGIVKIITPAAGSASMTQWSSAGNRELPIFRFAAHDGIQSQMVV
FT                   EQAVKMGCRKVAILHDATNYGVSGRDDLIRQVNRQGGRLKVVAIEKFGIGDKDMTGQLI
FT                   KAKAAGAQAILIWGIGPELAAVASGKQKLGFRVPLIGGWPLSMSNFIDTAGAAGNGALM
FT                   PQTFIEDESIARAKPFIQAYRRAYGVARIPSPVSAAQGYDAALLLAEAIHEAGSTKPSS
FT                   IKSALENLKVTVRGSIADWKKPWSKWNPANVETHEAFRRSNTVMGKVQNSRVVLANPAD
FT                   RSVLEGKR"
FT   sig_peptide     complement(470084..470152)
FT                   /locus_tag="Ppha_0480"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.998 at
FT                   residue 23"
FT   gene            470429..471154
FT                   /locus_tag="Ppha_0481"
FT   CDS_pept        470429..471154
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0481"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: cch:Cag_0264 ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42807"
FT                   /db_xref="GOA:B4SCX3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR015854"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B4SCX3"
FT                   /protein_id="ACF42807.1"
FT                   /translation="MAETILRLEKIRKELGLSKAIRQTIIPNLSLEIMAGEFVAITGPS
FT                   GSGKSTLLYIMGGLDKPTSGTVWLDGEAITEKNETEMNHIRNEKIGFIYQFHFLLPEFN
FT                   AVENVSMPMMINGRRTKKEIRERAMKLLDMVDMQNKYTNKPSQLSGGQQQRVAIARALA
FT                   NEPKVLLGDEPTGNLDSRSANNVYQLFDRLNRELNQTVIVVTHDEEFANRAGRRIHLVD
FT                   GQIESDRPLRTMAEPLSGS"
FT   gene            471197..472735
FT                   /locus_tag="Ppha_0482"
FT   CDS_pept        471197..472735
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0482"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cph:Cpha266_0474 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42808"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B4SCX4"
FT                   /protein_id="ACF42808.1"
FT                   /translation="MTLLLDNIRLTHPHLFQAFSLLPDAEQHLQRIMELDRYWERLKQP
FT                   LRQVIMPGDTLPKDALISGEYDLIYAGGTLSLLHAAVMAGKYGRKVLIFDRQTPAKSTR
FT                   DWNISRNELMNLSAIGLFTEREVDSTIGRRYKNGWVEFYQPDGKQKRLVMENVLDCAVD
FT                   ADRLLNLAKERILGAPGNALLAETSFVRCYQFDDHIIVQVEDRQGNPFFYKSKVLVDVM
FT                   GILSPIAMQLNEGIPQTHVCPTVGTIASGFENAVFDIGEILASIGPADTSAEKGRQLIW
FT                   EGFPAEGRNYITYLFFYDEADSPNDKSLLSLFESYFITLPDYKKPGKDFQIHRPVYGII
FT                   PAYCHDGFNRSREIADSHIILFGDAASLGSPLTFCGFGSMVRNLHHLTADLDRALTENN
FT                   LAKKHLEKISAYEPNVASMANLMKYMCFNKATDEPNFVNDLMNEVMIVLDDLPQRYRQA
FT                   MFRDEMKIEELAVVMLRLAWRYPKVLAATWEKLGIQGSLSFFKNLAGWAFSALR"
FT   gene            472750..474774
FT                   /locus_tag="Ppha_0483"
FT   CDS_pept        472750..474774
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0483"
FT                   /product="DNA ligase, NAD-dependent"
FT                   /EC_number="6.5.1.2"
FT                   /note="KEGG: cch:Cag_0275 NAD-dependent DNA ligase;
FT                   TIGRFAM: DNA ligase, NAD-dependent; PFAM:
FT                   helix-hairpin-helix motif; BRCT domain protein; zinc-finger
FT                   NAD-dependent DNA ligase C4-type; NAD-dependent DNA ligase
FT                   OB-fold; NAD-dependent DNA ligase adenylation; SMART:
FT                   Helix-hairpin-helix DNA-binding class 1; NAD-dependent DNA
FT                   ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42809"
FT                   /db_xref="GOA:B4SCX5"
FT                   /db_xref="InterPro:IPR001357"
FT                   /db_xref="InterPro:IPR001679"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR004149"
FT                   /db_xref="InterPro:IPR004150"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013839"
FT                   /db_xref="InterPro:IPR013840"
FT                   /db_xref="InterPro:IPR018239"
FT                   /db_xref="InterPro:IPR036420"
FT                   /db_xref="InterPro:IPR041663"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4SCX5"
FT                   /protein_id="ACF42809.1"
FT                   /translation="MTDIIRAAEAIAQLRREIERHTHLYYVEAKPELSDFEFDQLLDQL
FT                   ITLERQFPQLLTPDSPSQRVGGAITREFPAVQHREPMLSLSNSYSITEVEEFYNRVRKL
FT                   LALEGVVEQEMVAELKFDGVAISLIYQDGILVRGATRGDGRQGDDITANLKTVATIPLR
FT                   LEETLVAALQGEERAIEVRGEVFMRKEDFERLNESRPDEDRFANPRNATAGSLKLQDSG
FT                   EVARRSMSFVAYYLKGLKDESTPHIHRLELLARLGFFTGDHYRLCNTLEEINTYIAEWA
FT                   EKRWQLPYETDGVVLKLNDVPFREKLGATAKSPRWAIAYKYPAQQARSVLQNVLFQVGR
FT                   LGTITPVAELEPVLLAGSTVSRSTLHNFDEIERLGLMLRDRVIIEKSGEVIPKVVRTLF
FT                   EERPADAMPILPPTHCPSCGAPLVRPENEVSYSCPNEEECPAQIKGRLLHFASRNAMDI
FT                   QTLGDALVEQLVAKGLVKDPGDLYFLQEPQLEKLERMGPKSAQNILRALEKSREKSYER
FT                   LLYALGIRHVGRATARELSQACPSIDLLREASEEQLATIPDIGPVVARSIIDYFAKPSW
FT                   PHLLEKLRTAALQLSASEPKEQVNRNFEGVTVLFTGSLERYDRQKASELVLERGGRVVG
FT                   SVSKKTGMVVAGQDPGSKLQKANKLGVRVVSEDEFEAML"
FT   gene            474844..475203
FT                   /locus_tag="Ppha_0484"
FT   CDS_pept        474844..475203
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0484"
FT                   /product="VanZ family protein"
FT                   /note="PFAM: VanZ family protein; KEGG: cph:Cpha266_0477
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42810"
FT                   /db_xref="GOA:B4SCX6"
FT                   /db_xref="InterPro:IPR006976"
FT                   /db_xref="UniProtKB/TrEMBL:B4SCX6"
FT                   /protein_id="ACF42810.1"
FT                   /translation="MIAVRLILLVTIAVISWQATILNGIEPPPFTNGDKVLHFLAFGTL
FT                   AFLVDFAFPRSRFGAVKIILLILYGLAIEVVQSWLPYRSASAADLLTDIGGICTYALSI
FT                   PLLKRLQLYRGHWQQ"
FT   gene            complement(475244..475993)
FT                   /locus_tag="Ppha_0485"
FT   CDS_pept        complement(475244..475993)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0485"
FT                   /product="ubiquinone/menaquinone biosynthesis
FT                   methyltransferase"
FT                   /note="TIGRFAM: ubiquinone/menaquinone biosynthesis
FT                   methyltransferase; PFAM: UbiE/COQ5 methyltransferase;
FT                   Methyltransferase type 11; Methyltransferase type 12; KEGG:
FT                   cph:Cpha266_0478 demethylmenaquinone methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42811"
FT                   /db_xref="GOA:B4SCX7"
FT                   /db_xref="InterPro:IPR004033"
FT                   /db_xref="InterPro:IPR023576"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B4SCX7"
FT                   /protein_id="ACF42811.1"
FT                   /translation="MAKKAEVSARQARESAQSLNQTKSRASIKRMFDEVAPTYDFLNHL
FT                   LSLGIDNYWRAMATKRAKEVLGTNRAPRILDVATGTGDLANSMSKIEGAKVSALDLSPE
FT                   MLVLARKKYPQISFIEGYAEKLPFDNASFDVVSAGFGVRNFENLNEGMREFYRVLKPGG
FT                   HALIIEPMIPRNALMKKLYLVYFKKVLPKIAGLFSKSTFAYDYLPHSVEKFPQAEAFTA
FT                   ILKKSGFKQANFFPMTFETSILYVAKK"
FT   gene            complement(475977..476390)
FT                   /locus_tag="Ppha_0486"
FT   CDS_pept        complement(475977..476390)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0486"
FT                   /product="Phosphoribosyl-AMP cyclohydrolase"
FT                   /EC_number="3.5.4.19"
FT                   /note="PFAM: phosphoribosyl-AMP cyclohydrolase; KEGG:
FT                   cte:CT0463 phosphoribosyl-AMP cyclohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42812"
FT                   /db_xref="GOA:B4SCX8"
FT                   /db_xref="InterPro:IPR002496"
FT                   /db_xref="InterPro:IPR026660"
FT                   /db_xref="InterPro:IPR038019"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4SCX8"
FT                   /protein_id="ACF42812.1"
FT                   /translation="MGDNQDMGKSFLETVKFDDRGLVPAIVQDQETGKVLMMAWMNLES
FT                   LQMTLDKKRACYWSRSRNKLWLKGESSGNMQVVHDILIDCDGDTLLLKVSQTGGACHVG
FT                   YHSCFYRKATEALSMEICDTLMFNPEDVYGKKS"
FT   gene            476562..477644
FT                   /locus_tag="Ppha_0487"
FT   CDS_pept        476562..477644
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0487"
FT                   /product="efflux transporter, RND family, MFP subunit"
FT                   /note="TIGRFAM: efflux transporter, RND family, MFP
FT                   subunit; KEGG: cph:Cpha266_0480 efflux transporter, RND
FT                   family, MFP subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42813"
FT                   /db_xref="GOA:B4SCX9"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:B4SCX9"
FT                   /protein_id="ACF42813.1"
FT                   /translation="MQSLQKFLPKYTIALALLFLATVIFLMTRGNTVDIEVDQVTNAEL
FT                   VQAIYATGFVEAEAVANLSAETSGTVRSVGALEGEHVTAGQKILQFSSPQPEFAVREAK
FT                   AALAEQQAQTHDNKLRRTRKENLFREGAISRQELDEAEKMSIQGEELLRQKALQLQMRE
FT                   DDLKKLTVSAPFAGILTLQSVKEGDYVAANSLVARVVDPSAYVVTVEVDELDIPRIRFG
FT                   QATTVAFDAWPDKRFKATVSRIVQQTDRVTKTSRIYLKLDHPATDIQAGMTATANIIYN
FT                   IRPNALLVRKSSLFEENAQSTVWKIANGKLKKQPVRTGASDLTFVEILQGLKKGDKIAL
FT                   APAKNLREGMEVNTISPRKN"
FT   sig_peptide     476562..476654
FT                   /locus_tag="Ppha_0487"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.973) with cleavage site probability 0.714 at
FT                   residue 31"
FT   gene            477663..478670
FT                   /locus_tag="Ppha_0488"
FT   CDS_pept        477663..478670
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0488"
FT                   /product="ferrochelatase"
FT                   /note="PFAM: ferrochelatase; KEGG: cph:Cpha266_0481
FT                   ferrochelatase"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42814"
FT                   /db_xref="GOA:B4SCY0"
FT                   /db_xref="InterPro:IPR001015"
FT                   /db_xref="InterPro:IPR033644"
FT                   /db_xref="InterPro:IPR033659"
FT                   /db_xref="UniProtKB/TrEMBL:B4SCY0"
FT                   /protein_id="ACF42814.1"
FT                   /translation="MRQREKIAVILAAHGEAETTRFIENYRVASHTLAHAALVMPIPKP
FT                   LQRAIALTSSLKKKLRATADTQASPQNSITRDQAAALQRQLNHSPAAALFDFEVHAAFS
FT                   ASPPYVEHVMEQTRSSDAQVIVSMAPIDSSLSCGLICSCLANSRKAEELGKVKVLSRFW
FT                   NDEQLYSIYCDHLFEQRSLRQAPGSEAQTLLLLFHGTLVADTKGNTPQFRTGLDETRHF
FT                   ARRLQQLIEEDPRNPYSRIETVYLNHNVGGEWTKPSFEESCAKLRQNGAGSVDLFAGGY
FT                   FADGNETIHRAAELAATASVKNVTSIPCINSTPAFTAWLTARVIEAARQLRGLR"
FT   gene            478747..479610
FT                   /locus_tag="Ppha_0489"
FT   CDS_pept        478747..479610
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0489"
FT                   /product="protein of unknown function DUF88"
FT                   /note="PFAM: protein of unknown function DUF88; KEGG:
FT                   cph:Cpha266_0482 protein of unknown function DUF88"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42815"
FT                   /db_xref="GOA:B4SCY1"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR021139"
FT                   /db_xref="UniProtKB/TrEMBL:B4SCY1"
FT                   /protein_id="ACF42815.1"
FT                   /translation="MKKREIIMGRAAVFIDGANLFYTQRHLGWQIDFSRLMAFFISGYA
FT                   TVEANYYVPASEPVSEENAAFTRVLMAHGYHITSKPVKKIVNKETGVIVMKGNLDVELV
FT                   VDALSRADQYDTFILFSGDSDFIPLLRALKEKGKEVLVYSTQGLSARELLAEPGIAYHD
FT                   LALLKERIEQLRSGEGMRTDGSASGNDQEFSLPLPDIGVTFTGSVLKIQPYGIFLSNPY
FT                   HVKCLLPLSFLGISKYISDLTAIVRMTDLFDVVVFHVNTTRAIAEITVKLADKKMVEEL
FT                   TSRLEG"
FT   gene            complement(479616..480335)
FT                   /locus_tag="Ppha_0490"
FT   CDS_pept        complement(479616..480335)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0490"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: cph:Cpha266_0484 ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42816"
FT                   /db_xref="GOA:B4SCY2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B4SCY2"
FT                   /protein_id="ACF42816.1"
FT                   /translation="MIAIEGLCFSWPDGTKAIDHISLAVGEGDSVGIVGANGAGKSTLV
FT                   NHLNGYFLPQKGSISIGGVDLNKKNLDRIHRMVGLLFQNPDDQLFTARLYDDVAFGPEN
FT                   LGMDAAEVAMVVEARLRELNLWELRNRAPSQLSQGQKRFASFAAVLVMKPEVMVMDEPT
FT                   ADLDPKNRRKLINLVNGLGITRITVSHDLDFIQDTCQRVCIMKQGRITADGPTEEILGN
FT                   RELLEANDLELPLRLQR"
FT   gene            complement(480347..481114)
FT                   /locus_tag="Ppha_0491"
FT   CDS_pept        complement(480347..481114)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0491"
FT                   /product="cobalt transport protein"
FT                   /note="PFAM: cobalt transport protein; KEGG:
FT                   cph:Cpha266_0485 cobalt transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42817"
FT                   /db_xref="GOA:B4SCY3"
FT                   /db_xref="InterPro:IPR003339"
FT                   /db_xref="UniProtKB/TrEMBL:B4SCY3"
FT                   /protein_id="ACF42817.1"
FT                   /translation="MYARLPSAASLPEGRGAPPRPLPFLGSDRSALLVTVLFLFSLLSI
FT                   PKFNMAEVLAFGAFPLFLMSAAQADVKLIVKRLLLISPFVLFMAAGNLLLDRNPVLLIS
FT                   GLRISGGMISGTVIVAKTIISVAALLSVTQSIPFYRICRALEALHLPDVLVTQLLLLDR
FT                   YRSVLQEEAQSIQKARDIRSFGRKGKGLFRTAPLIGSLLLRTITRAERIYRSMSARGFQ
FT                   GRLVNRPAEKISRSDWRTIGLWALLFLALRLIF"
FT   gene            complement(481114..482127)
FT                   /locus_tag="Ppha_0492"
FT   CDS_pept        complement(481114..482127)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0492"
FT                   /product="cobalamin (vitamin B12) biosynthesis CbiM
FT                   protein"
FT                   /note="PFAM: cobalamin (vitamin B12) biosynthesis CbiM
FT                   protein; KEGG: cph:Cpha266_0486 cobalamin (vitamin B12)
FT                   biosynthesis CbiM protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42818"
FT                   /db_xref="GOA:B4SCY4"
FT                   /db_xref="InterPro:IPR002751"
FT                   /db_xref="InterPro:IPR025937"
FT                   /db_xref="UniProtKB/TrEMBL:B4SCY4"
FT                   /protein_id="ACF42818.1"
FT                   /translation="MHMADALLSPVVGGGFWIVSGALIGYSAKKITEERDNSKTALMGV
FT                   LGAFVFAAQMINFTLPGTGSSGHLGGGLLLAVLLGPYRAFITLASVLIIQCLFFADGGL
FT                   LALGCNVFNLAFFPSFIAFPFLYRVIAGNAPTPGKLAVGSLTAATAALLMGALSVVLET
FT                   LFSGITELPFGTFVLFMLPVHLAIGVVEGLVTWGVLAFVARTEPGLLVPAKAAVHPRFT
FT                   FALFAILALFVGGVGSWFASSQPDGLEWSIAKVSGSKEFSPAGGAVHEALEAFQQKVAF
FT                   LPDYGFKSAPEFLANPESPVDAGSSLSGIVGSLSVLAAAGTVGLLLGRKQKGEKQR"
FT   gene            complement(482307..483740)
FT                   /locus_tag="Ppha_0493"
FT   CDS_pept        complement(482307..483740)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0493"
FT                   /product="glutamate synthase (NADPH), homotetrameric"
FT                   /note="TIGRFAM: glutamate synthase (NADPH), homotetrameric;
FT                   PFAM: FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; KEGG: cch:Cag_0537 putative oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42819"
FT                   /db_xref="GOA:B4SCY5"
FT                   /db_xref="InterPro:IPR006004"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR028261"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B4SCY5"
FT                   /protein_id="ACF42819.1"
FT                   /translation="MDAQHITTKERLAIPRQQMPSQDPVIRSHNFQEVNLGYTIEQAQR
FT                   EAQRCIQCKDPVCIKGCPVNIKIDQFIKLIADGNFLGAARKIKEDNVLPAICGRVCPQE
FT                   DQCEKTCVLAKKYTPVAIGNLERFAADYERENGSVELPTVQPATGKKVAVIGSGPAGLS
FT                   CANDLVQLGHAVTVFEALHELGGVLMYGIPEFRLPKEIVQAEIEGMKKLGVVFITNSVA
FT                   GRSVTIDELLEEEGFDAIFIGVGAGLPWFMGIPGENLLGVYSANEFLTRVNLMKSYQFP
FT                   DNDTPVFNCTGKNVAVFGGGNTAMDAVRTAKRLGAEHAYIVYRRSEAEMPARLEEVHHA
FT                   KEEGIEFLMLMNPLEFVGNEEQWLTGAKCLRMELGEPDDSGRRRPVPIKGSEFILPVDM
FT                   AIISIGNGSNPLIQQTTPDIEVSKRDTIVVDINTMATSKESVYAGGDIVTGGATVILAM
FT                   GAGRTAAAAIHEKLMAAGE"
FT   gene            complement(483844..484689)
FT                   /locus_tag="Ppha_0494"
FT   CDS_pept        complement(483844..484689)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0494"
FT                   /product="oxidoreductase FAD/NAD(P)-binding domain protein"
FT                   /note="PFAM: oxidoreductase FAD/NAD(P)-binding domain
FT                   protein; KEGG: cph:Cpha266_0490 ferredoxin--NADP(+)
FT                   reductase subunit alpha"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42820"
FT                   /db_xref="GOA:B4SCY6"
FT                   /db_xref="InterPro:IPR012165"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR019480"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:B4SCY6"
FT                   /protein_id="ACF42820.1"
FT                   /translation="MYKIVSAIFLAENIKKIEIEAPRIAKKRKAGQFVMIRVGESSERI
FT                   PLTIADSDPEKGTISLIVQGMGKSTRELNCKAEGDSIHDIVGPLGTPSHIEKFGTAVSI
FT                   GGGVGTAIAYPTAVALKEAGNYVITINGARSKELVILEPEMRAVSDEAYITTDDGSYGF
FT                   HGFVTQKLQELLDSGKTIDYVLAIGPIPMMRAVAEVTRPYGIKTVVSLNPIMVDGTGMC
FT                   GGCRVTVDNQTKFACVDGPEFDAHLVDFKNLSDRNKMYLPEERKSADLFAHKCNLNTLK
FT                   "
FT   gene            484841..485446
FT                   /locus_tag="Ppha_0495"
FT   CDS_pept        484841..485446
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0495"
FT                   /product="imidazole glycerol phosphate synthase, glutamine
FT                   amidotransferase subunit"
FT                   /note="TIGRFAM: imidazole glycerol phosphate synthase,
FT                   glutamine amidotransferase subunit; PFAM: glutamine
FT                   amidotransferase class-I; CobB/CobQ domain protein
FT                   glutamine amidotransferase; KEGG: pvi:Cvib_1476 imidazole
FT                   glycerol phosphate synthase subunit HisH"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42821"
FT                   /db_xref="GOA:B4SCY7"
FT                   /db_xref="InterPro:IPR010139"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:B4SCY7"
FT                   /protein_id="ACF42821.1"
FT                   /translation="MVFIADYGAGNLRSVLKAFDYIGVKAIVSSDPAKLAGYKKVILPG
FT                   VGAFGSATESLNASGFTGALLEHVDKGGQLLGICLGMQLLLTDSEEMGAHKGLDLIPGR
FT                   VLRFRSETDKIPQIGWNSVDQQKESTLFRGIEDHSFFYFVHSYYCDPLCTDDVAATTWF
FT                   AGKNFCSAIEKNGIFAVQFHPEKSSDAGLQVLKNFAGC"
FT   gene            485470..486240
FT                   /locus_tag="Ppha_0496"
FT   CDS_pept        485470..486240
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0496"
FT                   /product="phosphoribosylformimino-5-aminoimidazole
FT                   carboxamide ribotide isomerase"
FT                   /EC_number="5.3.1.16"
FT                   /note="KEGG: cch:Cag_0540
FT                   phosphoribosylformimino-5-aminoimidazole carboxamide
FT                   ribotide isomerase; TIGRFAM:
FT                   phosphoribosylformimino-5-aminoimidazole carboxamide
FT                   ribotide isomerase; PFAM: histidine biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42822"
FT                   /db_xref="GOA:B4SCY8"
FT                   /db_xref="InterPro:IPR006062"
FT                   /db_xref="InterPro:IPR006063"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR023016"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4SCY8"
FT                   /protein_id="ACF42822.1"
FT                   /translation="MLIIPAIDIKEGKCVRLTRGDFSQKKIYLDNPNDMAIIWRKQNAK
FT                   MLHIVDLDAALTGEMVNFEKIREIVTNLDIPVQVGGGIRSADAVKRYLDIGVGRVVIGS
FT                   AAVTNPKLVEELLHTYTSSQIVVGIDAENGIPKIKGWTESSMIQDYDLALQMKEMGIER
FT                   IIYTDISRDGMMQGFGYESTRRFAERAGMKITASGGVTNAEDLHRLNELQPFGVDSVII
FT                   GKALYECNFPCQELWYNFEEEISLDHNFSTARKK"
FT   gene            486311..487054
FT                   /locus_tag="Ppha_0497"
FT   CDS_pept        486311..487054
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0497"
FT                   /product="pseudouridine synthase"
FT                   /note="PFAM: RNA-binding S4 domain protein; pseudouridine
FT                   synthase; KEGG: cch:Cag_0542 pseudouridine synthase, Rsu"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42823"
FT                   /db_xref="GOA:B4SCY9"
FT                   /db_xref="InterPro:IPR000748"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR018496"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="InterPro:IPR042092"
FT                   /db_xref="UniProtKB/TrEMBL:B4SCY9"
FT                   /protein_id="ACF42823.1"
FT                   /translation="MKKSNKDDEVRINRYLASCGIASRRAADQLVLDGRVMVNGTVITT
FT                   PGIKVSPTRDEVIVDGEKFAQPEHRKVYILFNKPRNVITTNSDEKNREMVLDFIDVEER
FT                   VFPVGRLDRKTTGVILLTNDGTLAHKLMHPSSNVKKEYIAELSEKFTPNLLPQLTGGMR
FT                   LKDTGEKVSPCRAKILEDGMQVLVSIHEGKNHQVRRMFETLGFEVKRLERVAYAGLLAG
FT                   ELRRGEWRYLSRNEVQALYKLTESP"
FT   gene            487091..489127
FT                   /locus_tag="Ppha_0498"
FT   CDS_pept        487091..489127
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0498"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pvi:Cvib_1472 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42824"
FT                   /db_xref="UniProtKB/TrEMBL:B4SCZ0"
FT                   /protein_id="ACF42824.1"
FT                   /translation="MVMKQQHSFCKRHAGRELMTFVFLLLLLIASSPARCADSSDIEDL
FT                   LSNAESEINIEQLLDLVEQLKKERILLNEADAADLRQLPWLTTADVETILIHRRNQGPI
FT                   LTLQQLETLIGKEKTALIAPYIRLTKEPSSRLPAKTDAIEGTLYSRLFWETTARKGILN
FT                   GNYAGENYKLYHRLQVAAPHLKATLLQEKDIGEPDVADFTSLSISASDIGIMKQGLLGN
FT                   YRVNLAQGLLIGQGRYFSKGSDPTGSIRLPSRQLLPYTSSSEYGFLQGAATTLKLAPFE
FT                   VTLFYSSNHRDALISDEGVITSFSSSGYHRSELEISRKDNVTETISGANLLYHYQSGSF
FT                   SGRAGGSLLNYRYPLPFDELDPFAAISRHSSATLYSLETDLSLGHASLFAEAAFSTRPD
FT                   DASWTAGTEYQIRQGLSAVAALRRYGARYYSPFAGAFAERGSGASNEEGYYVGLNARVS
FT                   KSLALAAYHDRFTFPLLDDHCPYPSDGNDSRLFITWKQSPLLTWNLQFQHKYREEQSNQ
FT                   GTSSHPLWRALPQITNRCRLDCDVTPSRALHLRSRGEVKKVVKEYLAGDQRFYGWLLSQ
FT                   QAGYSAGKFSLKGRITVFNTEDFDAALYAYEDDLPLTSSLGMYDGRGKSLFLVAAWQAL
FT                   PQMKLAARYEKSWYSDREVYSSGNDERATSAPGSFHLGCFLTF"
FT   sig_peptide     487091..487204
FT                   /locus_tag="Ppha_0498"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.990) with cleavage site probability 0.973 at
FT                   residue 38"
FT   gene            complement(489148..490101)
FT                   /locus_tag="Ppha_0499"
FT   CDS_pept        complement(489148..490101)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0499"
FT                   /product="Sua5/YciO/YrdC/YwlC family protein"
FT                   /note="TIGRFAM: Sua5/YciO/YrdC/YwlC family protein; PFAM:
FT                   SUA5 domain protein; SUA5/yciO/yrdC domain; KEGG:
FT                   cph:Cpha266_0496 translation factor SUA5"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42825"
FT                   /db_xref="GOA:B4SCZ1"
FT                   /db_xref="InterPro:IPR005145"
FT                   /db_xref="InterPro:IPR006070"
FT                   /db_xref="InterPro:IPR010923"
FT                   /db_xref="InterPro:IPR017945"
FT                   /db_xref="InterPro:IPR038385"
FT                   /db_xref="UniProtKB/TrEMBL:B4SCZ1"
FT                   /protein_id="ACF42825.1"
FT                   /translation="MQTILTDSPEEAAAILNSGGVVAFPTETVYGLGAGICHPEAILQL
FT                   FRAKGRPSDNPLIVHLGSIDQLDEVAEALHADARALIEHFFPGPLTLVLQKKSSVPFSV
FT                   TAGLETVGVRCPSNPVAQEFLRLCGCPVAAPSANRSGLPSATSWEAVMEDLEGRIECVL
FT                   RGRPSTIGLESTIVECSGAKPLLLRAGAITLEQLREVVPEITVNAVTNKPEESPKCPGL
FT                   KYPHYAPKASIILWSGEKSPVADSPSSASIGLSAPPEGVTLCKVCSTLEEYGRELFGFF
FT                   RLCDAEGIGVIYCELPSNEGLGRAIRDRLLRAAALE"
FT   gene            complement(490125..490760)
FT                   /locus_tag="Ppha_0500"
FT   CDS_pept        complement(490125..490760)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0500"
FT                   /product="phosphatidate cytidylyltransferase"
FT                   /note="PFAM: phosphatidate cytidylyltransferase; KEGG:
FT                   pvi:Cvib_1470 phosphatidate cytidylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42826"
FT                   /db_xref="GOA:B4SCZ2"
FT                   /db_xref="UniProtKB/TrEMBL:B4SCZ2"
FT                   /protein_id="ACF42826.1"
FT                   /translation="MLMEEIDRLELRYEVARKAIHLSSLSIPVIYWFISRDLALLILVP
FT                   LFSGFFLIDLLKNFFTPVSAWYHRTFGAMLRAHELKRAKGHLNGATYIMMAALLLVLFF
FT                   PKVIAVAAFSMVAVSDTLAAIIGKSFGKHRFGQKSVEGSVAFFLSALVVVSLVPGLHPV
FT                   IGIIMAITGTLTEAFLVRIGKFKVDDNLSIPLASASVATLFTLLSIFR"
FT   gene            490931..492490
FT                   /locus_tag="Ppha_0501"
FT   CDS_pept        490931..492490
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0501"
FT                   /product="Ppx/GppA phosphatase"
FT                   /EC_number="3.6.1.40"
FT                   /note="PFAM: Ppx/GppA phosphatase; KEGG: cch:Cag_0423
FT                   exopolyphosphatase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42827"
FT                   /db_xref="GOA:B4SCZ3"
FT                   /db_xref="InterPro:IPR003695"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR030673"
FT                   /db_xref="UniProtKB/TrEMBL:B4SCZ3"
FT                   /protein_id="ACF42827.1"
FT                   /translation="MKHENLRVAAIDLGTNSFHMIIVEESPQKGIVEIDRVKDMICIGR
FT                   GSISTKMLDEEAMQSGIAALKNFLVLASHHGVASENVIAFATSAIREAKNSGDFIRRVK
FT                   EETGLKIKIISGKEEAEFIYYGVRNAVKIGNSSDLLFDIGGGSVEFVLVNQKGLQLLES
FT                   RKIGVARMCERFVASEPIASHDIKMLEQYFTAEMVTAVEKASQLKVTRAIASSGTAQNI
FT                   ARMIQSMKGSQSETSLNNSTFTRTEFQALYQAILPLGAAERKKITGLDEKRVDLIVPGL
FT                   ILVDMIFRLFNLTEIVISDSALREGMVLHYLKHRLQSGTKRSSDDDLDIRRESVYELAF
FT                   RCGWTRNHAEHVARLSLQLFDKLALLHHLDESYRELLEYASLLHNIGAFIAISSHHKHS
FT                   QYIILNGELRGFSPLETEIIAHVARYHRKSPPTERHAAYSMLPSASKRAVDLLSGILRL
FT                   ANGLERGHRQNVQKINVQVTANTIILHLKTRFEPDIEIWAADLLKPWLEKLLNKSIILE
FT                   AL"
FT   gene            492492..494624
FT                   /locus_tag="Ppha_0502"
FT   CDS_pept        492492..494624
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0502"
FT                   /product="para-aminobenzoate synthase, subunit I"
FT                   /note="TIGRFAM: para-aminobenzoate synthase, subunit I;
FT                   PFAM: Chorismate binding-like; KEGG: cph:Cpha266_0499
FT                   para-aminobenzoate synthase, subunit I"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42828"
FT                   /db_xref="GOA:B4SCZ4"
FT                   /db_xref="InterPro:IPR001544"
FT                   /db_xref="InterPro:IPR005801"
FT                   /db_xref="InterPro:IPR005802"
FT                   /db_xref="InterPro:IPR015890"
FT                   /db_xref="InterPro:IPR019999"
FT                   /db_xref="InterPro:IPR036038"
FT                   /db_xref="UniProtKB/TrEMBL:B4SCZ4"
FT                   /protein_id="ACF42828.1"
FT                   /translation="MKGESLFERLAATLATEGTLWLESAFCNEPEGGALLFSDPLEVVT
FT                   LPTLNDIELFFRRIEEQSAAGFHLAGWLTYEAGYAFEERLLHGLSPDDPHLPPSPLGWF
FT                   GVYREPERFSAAEVQELFAEPGPRSDLIITDLSFNLSEEEYGRKIERIKEQIAAGNLYQ
FT                   VNFTGRYRFTSNSEPTALFAALRGRQPSSYTACINSGGRTILSCSPELFFRRRGSLIET
FT                   MPMKGTAPRGRTIEEDNRLREGLAGCQKNRAENLMIVDLLRNDLGRICKPGTVEAGDLF
FT                   TIETWPTLHQLLSTIRGELREGIKLSELFRALYPSGSITGAPKISAMKLIQSLEPTSRG
FT                   IYTGTIGYITPDSEMVFSVAIRTIELSGKQGTYGSGGGIVWDSDPQDEYRECQLKAKIL
FT                   TNPGRSRSAAATETGIAPGSDRAAQQPEEHRIQLIAPASAEDVVLGCNFGQTDAHHQPP
FT                   GGVSGSEAGQHFGLFESLLWNGNYLWLDEHLQRLAASAATLGFPCDTAAATHLLHQLEE
FT                   EMRHHGSQNSNPQPGQQQEHLRTEEQCRGAARCKVRLSLTREGSCSASYEPITVQGSTT
FT                   PLRLCIAAEPTHSSNPLLRHKTTKRELYDHYFTLARQQGYDEILFHNERGEITEGAIST
FT                   IFIRKGQQLCTPPLHCGLLNGIFRHYILATRPTATEKIITINDLATADAIFIANSVRGL
FT                   RPATMCKNPPTMGPDT"
FT   gene            494690..495151
FT                   /locus_tag="Ppha_0503"
FT   CDS_pept        494690..495151
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0503"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pvi:Cvib_1467 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42829"
FT                   /db_xref="UniProtKB/TrEMBL:B4SCZ5"
FT                   /protein_id="ACF42829.1"
FT                   /translation="MRDHTPDFKMHELTAQNKTLIRQTVQQLLEKLATDGKLTSDTLLE
FT                   FWVEVPAIKRSRGTFPGGFLMPDSFVYISDYFQPDAPDSLIPGEAYADGEVTLDKVWDD
FT                   LLDELYYQVEIFTSPVSSGKGITLELWAGNRQRPEGEWIYAVDRKVELG"
FT   gene            complement(495148..495786)
FT                   /locus_tag="Ppha_0504"
FT   CDS_pept        complement(495148..495786)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0504"
FT                   /product="endonuclease III"
FT                   /EC_number="4.2.99.18"
FT                   /note="KEGG: pvi:Cvib_1466 endonuclease III / DNA-(apurinic
FT                   or apyrimidinic site) lyase; TIGRFAM: endonuclease III;
FT                   PFAM: helix-hairpin-helix motif; HhH-GPD family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42830"
FT                   /db_xref="GOA:B4SCZ6"
FT                   /db_xref="InterPro:IPR000445"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR004036"
FT                   /db_xref="InterPro:IPR005759"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="InterPro:IPR023170"
FT                   /db_xref="UniProtKB/TrEMBL:B4SCZ6"
FT                   /protein_id="ACF42830.1"
FT                   /translation="MKQTPEEKIVFLNELLGAAYPNPKSELNYESPFQLLIATIMAAQA
FT                   TDRQVNVITRELFRCAPDAETMSRMELDEVRSLVRSINYCNNKAKNILAVSRILVERWQ
FT                   GVVPGTREGLESLPGVGRKTANVVLSNAFDQPVMPVDTHVHRVSNRIGLVHTEKPEETE
FT                   AGLMTIIPEAWVIPFHHYLLLHGRYTCKAKKPDCAHCTVSGICDYPAKN"
FT   gene            complement(495793..496308)
FT                   /locus_tag="Ppha_0505"
FT   CDS_pept        complement(495793..496308)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0505"
FT                   /product="NusB antitermination factor"
FT                   /note="TIGRFAM: transcription antitermination factor NusB;
FT                   PFAM: NusB/RsmB/TIM44; KEGG: cph:Cpha266_0502 NusB
FT                   antitermination factor"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42831"
FT                   /db_xref="GOA:B4SCZ7"
FT                   /db_xref="InterPro:IPR006027"
FT                   /db_xref="InterPro:IPR011605"
FT                   /db_xref="InterPro:IPR035926"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4SCZ7"
FT                   /protein_id="ACF42831.1"
FT                   /translation="MKTYRRQIREKILQALYTIEIRDTDIDSAAGWLLTEEILADPNAM
FT                   KFFNMLLKNIKEHMEEIDRYIVKHTFNWDMSRIAIIDKNIIRMALTEILYCEDIPPKVS
FT                   INEAIEIAKKFNSTDKSSKFVNGILDAIFNDLKNEGKVHKNGRGLIDQSVTKLQKVEGE
FT                   GENPESAS"
FT   gene            complement(496319..497020)
FT                   /locus_tag="Ppha_0506"
FT   CDS_pept        complement(496319..497020)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0506"
FT                   /product="Haloacid dehalogenase domain protein hydrolase"
FT                   /note="PFAM: Haloacid dehalogenase domain protein
FT                   hydrolase; KEGG: pvi:Cvib_1463 haloacid dehalogenase domain
FT                   protein hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42832"
FT                   /db_xref="GOA:B4SCZ8"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:B4SCZ8"
FT                   /protein_id="ACF42832.1"
FT                   /translation="MLKKLVLFDIDGTLLSVNKINRSVLVDALTEVYGTAGSAGTHNFA
FT                   GKMDSTIFYEVLRNAGLSEGDIAAKFELAKKTYIEMFRAHAKPSDVLLMEGIRELLEEL
FT                   SGHSDVMLALLTGNFEASGRHKLLLPEINHYFPFGAFADDAPSRNELPAIAVEKAYQLS
FT                   GIKFFNHDIIIIGDTEHDIACARVLNAKSIAVATGTYSMEDLKQHHPHVLYENLGRTAV
FT                   VLDEILQSSIN"
FT   gene            complement(497041..497193)
FT                   /pseudo
FT                   /locus_tag="Ppha_0507"
FT   gene            497681..498274
FT                   /locus_tag="Ppha_0508"
FT   CDS_pept        497681..498274
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0508"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gur:Gura_0825 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42833"
FT                   /db_xref="GOA:B4SCZ9"
FT                   /db_xref="InterPro:IPR002686"
FT                   /db_xref="InterPro:IPR036515"
FT                   /db_xref="UniProtKB/TrEMBL:B4SCZ9"
FT                   /protein_id="ACF42833.1"
FT                   /translation="MYDPKIHHRHSIRLPGYDYSQACVCFVTICTQNRQMRFGNIVGGK
FT                   MKLNDTGRIVQDIWHQIPVHFLAVTTDEFVVMPNHIHGIIITGSYGNSPETGAKICSGP
FT                   KTERVVSLCPEALHSSNDGQWDKNRVPTVGQIIGYFKYQSTKKINEIRHHGIQRIWQRN
FT                   YYEHIVRDESDLNRICKYIQNNPLKWGMDKLHGI"
FT   gene            complement(498299..498577)
FT                   /locus_tag="Ppha_0509"
FT   CDS_pept        complement(498299..498577)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0509"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42834"
FT                   /db_xref="UniProtKB/TrEMBL:B4SD00"
FT                   /protein_id="ACF42834.1"
FT                   /translation="MERDCDFWREGCNCVGGGGTPPLRAFDVMGRDWDYWGEGCNCVGG
FT                   GVTPPLRAFDVMGRDCVFLGRGMQLFGGGGTPPLRVFGLMGGIVMDP"
FT   gene            complement(498615..499496)
FT                   /locus_tag="Ppha_0510"
FT   CDS_pept        complement(498615..499496)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0510"
FT                   /product="dihydropteroate synthase"
FT                   /EC_number="2.5.1.15"
FT                   /note="KEGG: cph:Cpha266_0505 dihydropteroate synthase;
FT                   TIGRFAM: dihydropteroate synthase; PFAM: dihydropteroate
FT                   synthase DHPS"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42835"
FT                   /db_xref="GOA:B4SD01"
FT                   /db_xref="InterPro:IPR000489"
FT                   /db_xref="InterPro:IPR006390"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="UniProtKB/TrEMBL:B4SD01"
FT                   /protein_id="ACF42835.1"
FT                   /translation="MGGMINCGGRMLDLSGGAVIMGILNTTPDSFYDGGVLQAGPGGVD
FT                   LERALACALGMIREGASIIDIGGESSRPGAAKISEQEEIARTAPLIALLRQRSDILISI
FT                   DTYKAGVAEAALQAGAHMVNDISGFTFDGQLPAVCRKYRAGVVLMHTPVKPESMQWSTV
FT                   TNSGEVDIVERVRLFLARSIAVAEEHGIEGIVIDPGFGFGKSVTENFRLLDQLDALLSL
FT                   GYPVLAGLSRKSFLGHAISPPNGAIPPPSERLAATIAAQTIALMRGASILRVHDVQAAT
FT                   QSAAIIHAMQFP"
FT   gene            complement(499496..500488)
FT                   /locus_tag="Ppha_0511"
FT   CDS_pept        complement(499496..500488)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0511"
FT                   /product="peptidase M50"
FT                   /note="PFAM: peptidase M50; KEGG: cph:Cpha266_0506
FT                   peptidase M50"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42836"
FT                   /db_xref="GOA:B4SD02"
FT                   /db_xref="UniProtKB/TrEMBL:B4SD02"
FT                   /protein_id="ACF42836.1"
FT                   /translation="MKQNYPLHLTLFFLTLLTTLWAGAFWGGHPVSFSSLPLFISSLGT
FT                   GIPYSLSLLLFLTVHEFGHFFAAMRHRVQATLPYYIPMPPLPFLLSLGTMGAVIKVKER
FT                   IPGTNSLFDIGIAGPIGGFAVSVGLLVYGFLHLPPADFIYSIHPEYLQSGGLEVAVPSG
FT                   TLVLGKNLLWMGLEYLIAPKELPPMTEIYHYPFLFAGWLGSLVTALNLLPVGQLDGGHI
FT                   TYAMFGRRGHALAAKAFLLFIMLLGFPSFVELLLSWLMPEALALIPAVMLRWSWSGWIL
FT                   WSFILSRFIGLNHPPTVHDHSLSTGRVVYGWVAIAIFVITFTPVPFGVT"
FT   sig_peptide     complement(500420..500488)
FT                   /locus_tag="Ppha_0511"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.892) with cleavage site probability 0.574 at
FT                   residue 23"
FT   gene            complement(500495..500938)
FT                   /locus_tag="Ppha_0512"
FT   CDS_pept        complement(500495..500938)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0512"
FT                   /product="cytochrome c, putative"
FT                   /note="KEGG: cph:Cpha266_0507 cytochrome c, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42837"
FT                   /db_xref="InterPro:IPR025992"
FT                   /db_xref="UniProtKB/TrEMBL:B4SD03"
FT                   /protein_id="ACF42837.1"
FT                   /translation="MQLVKILAGAAIALAAIQLVPYGRDHSNPPVSGEPKWDSPRTVEL
FT                   FDRACKNCHSNETVWPWYASVAPASWLAQLDVSLGRSKFNVSEWGRSEENEGDEAAAEV
FT                   RKGKMPPFFYLPAHPEAKLSVVEQEELAKGLAATFGEDKPEQK"
FT   gene            501080..502909
FT                   /locus_tag="Ppha_0513"
FT   CDS_pept        501080..502909
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0513"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: cobalamin B12-binding domain protein; Radical
FT                   SAM domain protein; SMART: Elongator protein 3/MiaB/NifB;
FT                   KEGG: cch:Cag_0114 elongator protein 3/MiaB/NifB"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42838"
FT                   /db_xref="GOA:B4SD04"
FT                   /db_xref="InterPro:IPR006158"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR034466"
FT                   /db_xref="UniProtKB/TrEMBL:B4SD04"
FT                   /protein_id="ACF42838.1"
FT                   /translation="MAYFNHLCFVEAPQTVIAPFPRFITDCIGICYLAAAVEHDVESLV
FT                   MPDNYYNDGIFESLRTLLKKQPVDLVAISSMTGAFNQAARLAKIAKEAGAFVVMGGFHP
FT                   TALPEEVLKLSCVDVVVIGEGEESFRELVLKGPSRDIRGIAYRGGGGIIYTEPRTTIAD
FT                   VDSIRFPLRTLRPNRYGEKGDAYSIDTIYTSRGCPWSCSFCANDQMHKGWRGRSAENVV
FT                   EEIALLHDPKNKKLLKIWDANFLTNIKRAERICDLMIERGLTNFRIVTETRAKDLVRAE
FT                   RILGKLRRVGLSKVGLGIESPNEATLALMNKKNSLNDVARAIALCREHSIGAEGYFIIG
FT                   HYTENMKETMVYPEFARSLGLRQALFMVMTPYPGTAIFNEYKSEGKIRSYDWDLYNNYC
FT                   PVIETRTMNGDTLVAMLAYCNISFNRFRSIMKRNSKNALLLNFMIDLFQLCFLLRVNKN
FT                   ISTPQIADLLFNALQLLLDNEGGEIEQPAASSCKRLPKPMTLRIRHSSGKSITYSLHER
FT                   GANRVMSMTAQQEGREATSTPDLEISLDRLVESACSLSMDTLMSALYRNEWLRNNPGRM
FT                   TGQIIAILADPEILRFGGKLATLYLRAYLKSAR"
FT   gene            502923..504722
FT                   /locus_tag="Ppha_0514"
FT   CDS_pept        502923..504722
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0514"
FT                   /product="ATP-dependent DNA helicase RecQ"
FT                   /note="KEGG: cph:Cpha266_0053 ATP-dependent DNA helicase
FT                   RecQ; TIGRFAM: ATP-dependent DNA helicase, RecQ family;
FT                   ATP-dependent DNA helicase RecQ; PFAM: helicase domain
FT                   protein; HRDC domain protein; DEAD/DEAH box helicase domain
FT                   protein; Helicase superfamily 1 and 2 ATP-binding; SMART:
FT                   DEAD-like helicases"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42839"
FT                   /db_xref="GOA:B4SD05"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR002121"
FT                   /db_xref="InterPro:IPR004589"
FT                   /db_xref="InterPro:IPR006293"
FT                   /db_xref="InterPro:IPR010997"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR018982"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B4SD05"
FT                   /protein_id="ACF42839.1"
FT                   /translation="MFDTLRKVFGFHEFRPNQERVVRAILDKRDVLAIMPTGGGKSLCY
FT                   QLPAVMMEGTCMVISPLIALMKDQVDGARANGIRAAFLNSSQNPDERDEVLQRLLSGKL
FT                   DLLYLAPERFILSHFREILGQVQLSMAVIDEAHCISEWGHDFRPDYLSLSDLVTLFAGI
FT                   PVAAFTATATTRVQQDILDKLALRNPLIVRASFDRPNLLYDVRFKDNVEAQLLSLLKSN
FT                   PGKAGIIYRTSRKSVSDTATMLQKKGIRALPYHAGLSDAERKGNQEAFIRDEAEVIVAT
FT                   IAFGMGIDKSNIRFVIHADLPKSIENYYQETGRAGRDGEPAQCTLLFAQGDIPKVRFFI
FT                   DSIIDETERERALGALSKVITFASTSVCRRRTLLDYFGESYPHDNCNSCDICLGSREVV
FT                   DATLEAQMLLSAIVRTEERFGAGHIVDIVTGSQNKKIIDFGHDRLKTWGVGKAHDKKYW
FT                   RQLIDELLAQQVIQKAEGLYPTLFLLPKASRILKREEQLNIVRILEKKKEQPPAKESAA
FT                   PYETRLFEFFRSLRKQIADEQGIPPYVVFSDRTLRDMAAHQPRSAEAMLSISGIGEVKL
FT                   QRYGGQFLRLIDRYCSDHAAANV"
FT   gene            504816..505064
FT                   /locus_tag="Ppha_0515"
FT   CDS_pept        504816..505064
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0515"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cph:Cpha266_2644 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42840"
FT                   /db_xref="InterPro:IPR022453"
FT                   /db_xref="UniProtKB/TrEMBL:B4SD06"
FT                   /protein_id="ACF42840.1"
FT                   /translation="MNTNITISCCPLCGGEKTEGKTTITVDLGYGLVVIRDVPATVCAL
FT                   CGADWVDDDVADKIERIVEEARKKHSQMEVISLKASC"
FT   gene            505220..505486
FT                   /locus_tag="Ppha_0516"
FT   CDS_pept        505220..505486
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0516"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: scl:sce5011 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42841"
FT                   /db_xref="InterPro:IPR005368"
FT                   /db_xref="UniProtKB/TrEMBL:B4SD07"
FT                   /protein_id="ACF42841.1"
FT                   /translation="MKSNMQSTIPVTCPQEILLGLHMDVQQFATLLKEQSAMALFREGR
FT                   FSSGMAASWLGVPRAHFLIKAMQEGATLLENTQDDFRRETALL"
FT   gene            505548..505649
FT                   /pseudo
FT                   /locus_tag="Ppha_0517"
FT   gene            506081..506626
FT                   /locus_tag="Ppha_0518"
FT   CDS_pept        506081..506626
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0518"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cph:Cpha266_2650 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42842"
FT                   /db_xref="UniProtKB/TrEMBL:B4SD08"
FT                   /protein_id="ACF42842.1"
FT                   /translation="MSIFKIFTVVAVSLSCLLLSTVKVQAAGESASALFSGPQQTNYNP
FT                   LSGPNYPLVQDSYFTDDNGNILMIVNVLGEVNRQGQLVVRENVDFATILALSGGLKSQV
FT                   NLKKVLVARQEPDKNGVQAYVVDLKEYYKHGDRSAFIALKPNDTIIFPEKGFNFQKFTS
FT                   LIGGVVYPWVYIYQNLTN"
FT   sig_peptide     506081..506161
FT                   /locus_tag="Ppha_0518"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 27"
FT   gene            506645..509104
FT                   /locus_tag="Ppha_0519"
FT   CDS_pept        506645..509104
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0519"
FT                   /product="capsular exopolysaccharide family"
FT                   /EC_number="2.7.10.2"
FT                   /note="KEGG: cph:Cpha266_2649 lipopolysaccharide
FT                   biosynthesis; TIGRFAM: capsular exopolysaccharide family;
FT                   PFAM: lipopolysaccharide biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42843"
FT                   /db_xref="GOA:B4SD09"
FT                   /db_xref="InterPro:IPR003856"
FT                   /db_xref="InterPro:IPR005702"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032807"
FT                   /db_xref="UniProtKB/TrEMBL:B4SD09"
FT                   /protein_id="ACF42843.1"
FT                   /translation="MMVEKETTLSTQSNNEQTQGSEISLGEILKIILRRKYGILLILIA
FT                   SLVMAWIYNKAQTPEYHAVSVMMINENKAPGDLLATLLGPSAGVDTKSARKDVELLQSH
FT                   PIAELTVKELYKTTRKDSLEFFGKRKYVSPIDFLFSAIDVFHPLNADQKAEAWHYSDAL
FT                   LRFHAMQLKDRIRVIPLRDTNLLQVSVASPFADEAVFLTNILCQTYKNADIIRNSEKYT
FT                   QANKFIAEMIQDQQQKVGEADNALSQYMQANKIYEVSGNTGAILAKVVDADARYNDIKA
FT                   ESRIASNSLAFLEKKLSDTDREISSRIAKNVNSQLGAIMDELRTLESDYIKMVREKGID
FT                   NPEVKIKRQQLDVVKTRYEQLSRSKIAGEIGYAGKAQKFSFDMVSEKLQIERKLNDLNF
FT                   SASEFSLLKQYYESQLSMLPIKQQEFIKLQRDKEVVGKTYLYLKEKLDETRIMLGSEVG
FT                   GVSIIGSAFKPFSPEKPVLSRDLLAGFILGGLLAVLYTFGAEMADNTVKDDLFFRDLGL
FT                   TVLSVIPLVGQKGQTPFLDNKESFIKRFLYSKSQAFREKVLSEASVKGALPMPMITDSL
FT                   SSAFAESFRTLRTALDYSRVDFSRIDSSLKFILVSGTAMTEGKSTVCANLGMAYAISGK
FT                   KTLIIDCDLRRASQHKKLNVKREPGLTDFLYSQQANIDESFFQPTHIENLFVLSAGKKV
FT                   PNPNEILGSQKMIRLLKELDGKFDKVVFDSPPLFLSDAAQLAHSVDGVLLAARMHFTNK
FT                   DPIRNFAVDHFLRPLILGVAMIESRDSQRYGYGYGKYGYGKYGYGKYGYGKYGYGKYGY
FT                   GQYEEEA"
FT   gene            509135..511078
FT                   /locus_tag="Ppha_0520"
FT   CDS_pept        509135..511078
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0520"
FT                   /product="polysaccharide biosynthesis protein CapD"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase;
FT                   short-chain dehydrogenase/reductase SDR; 3-beta
FT                   hydroxysteroid dehydrogenase/isomerase; polysaccharide
FT                   biosynthesis protein CapD; dTDP-4-dehydrorhamnose
FT                   reductase; Male sterility domain; KEGG: cph:Cpha266_2635
FT                   polysaccharide biosynthesis protein CapD"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42844"
FT                   /db_xref="GOA:B4SD10"
FT                   /db_xref="InterPro:IPR003869"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B4SD10"
FT                   /protein_id="ACF42844.1"
FT                   /translation="MGRRALASSRYVKLLVVVAFDIFAALLTVWMAFSFTRQLLHQPEG
FT                   LEWLLYLLAPALMLPIFALSGIYGTIQRYNSFEGFITVFKSVFFYGAAFVCLLLLLPLP
FT                   KISIVVGILQPLLLLLMTGGSRAMVRYLSTTVTTTPEKRCEAPNKLLIYGAGSAGVEIV
FT                   NSINRSNKFTLAGFIDDNPDLQGRTINRMKVFSPAEAEELIQSEGINNILLAMPSATRT
FT                   RRNEIVEQYRKYPVRIQMLPGVEELAEGKVTISDIKTVDIEDLLGRDPAPLDHALVKQV
FT                   ITGRVVMVTGAGGSIGSELCRQLLQAQPSTLLLLDNAEHNLYTIHSDLTQRHARLSSAT
FT                   RIVPLLCDVTNAIRITEIFRVFQPEVIYHAAAYKHVPMVEHNPAEGIRNNVFGTHTVAE
FT                   AALQQGVTSVVLVSTDKAVRPTNVMGASKRLCEMILQALAEEPGHTTCFSMVRFGNVLG
FT                   SSGSVVPLFRSQINSGGPFTITHKEITRYFMTIPEAAQLVIQAGAMASPGDLHLLEMGD
FT                   PVKIIDLARKMVELSGLTIRDHENPEGDIEIRVTGLRPGEKLYEELLIGNHSSPSANPR
FT                   IFKAKEHFIPWSELQEELEQLTTAIHSNDIKSIKKILKKIVPEYSPGITTSDLLSMEKQ
FT                   SKNGKNHHIPAQ"
FT   gene            511180..511437
FT                   /locus_tag="Ppha_0521"
FT   CDS_pept        511180..511437
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0521"
FT                   /product="DNA polymerase beta domain protein region"
FT                   /note="PFAM: DNA polymerase beta domain protein region;
FT                   KEGG: cch:Cag_1383 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42845"
FT                   /db_xref="GOA:B4SD11"
FT                   /db_xref="InterPro:IPR002934"
FT                   /db_xref="UniProtKB/TrEMBL:B4SD11"
FT                   /protein_id="ACF42845.1"
FT                   /translation="MISKQIHQYFGESADIWLFGSRIDDHKKGGDVDLYVEAPPHNLLD
FT                   EIRCKIKLEENIDMPVDLIVREQADSSLIGNIAKSQGQKL"
FT   gene            511434..511919
FT                   /locus_tag="Ppha_0522"
FT   CDS_pept        511434..511919
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0522"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mmw:Mmwyl1_0818 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42846"
FT                   /db_xref="UniProtKB/TrEMBL:B4SD12"
FT                   /protein_id="ACF42846.1"
FT                   /translation="MSANVQLIWKKIEHLRRMRNYLDYSHEQVLRLIPISDWHQLTPEN
FT                   HETLAAFRVRFSEFQEHLGKVMRAIAREEEQSTEPFSFVLLYMEKLGILDSVEQWKMIR
FT                   ELRNAVNHEYEENEQRLSEFFLALTQAAPDLYKCYTRIIEFCTSSYPAAEDLSAGTS"
FT   gene            512122..513837
FT                   /locus_tag="Ppha_0523"
FT   CDS_pept        512122..513837
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0523"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: pvi:Cvib_0616 ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42847"
FT                   /db_xref="GOA:B4SDA8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:B4SDA8"
FT                   /protein_id="ACF42847.1"
FT                   /translation="MVCASFAEILSIGAVLPFLAVLTAPERIFQLPAAQPFIRAIGMTS
FT                   ASQLLFPLTITFGIAALISGAMRLLLLWASTRLSFATGADLSISIYRRTLYQPYSVHVA
FT                   RNSSEVISGISGKANGVIYTTIVPSLTLISSSIMLVTILIALLVVDPVIALSAFSGFGL
FT                   IYAVIIRLTRKQQLINSKCVAKESTQVIKSLQEGLGGIRDVLIDGSQAAYCQIYRNADQ
FT                   PLRKAQGNNAFIGTSPRFGIEALGMMLIAVLAYVLAMQPDGIAKAIPVLGALALGAQRM
FT                   LPVLQGAYGSWSSIQGGQISLRDTLDLLDQPLPDYVDQPVAKPLPFNMHIGLHNLSFRY
FT                   TEQTPWVLQNLDLTIPKGSRIGFIGITGSGKSTLLDIVMGLLAPTDGTLEIDSQPIVTG
FT                   NNRAWQAHIAHVPQAIYLADSTIEENIAFGVPKGKIDQSRVKQAAQKAQIADIIESWPK
FT                   KYQTYVGERGIRLSGGQRQRIGIARALYKQADVIIFDEATSALDNETEQAVMQAIESLG
FT                   DDLTVLIIAHRLTTLKNCTKIVELADGGIKQTGTYQEIISPVRSGSSRPLSLTT"
FT   gene            513879..514877
FT                   /locus_tag="Ppha_0524"
FT   CDS_pept        513879..514877
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0524"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase;
FT                   short-chain dehydrogenase/reductase SDR; 3-beta
FT                   hydroxysteroid dehydrogenase/isomerase; polysaccharide
FT                   biosynthesis protein CapD; dTDP-4-dehydrorhamnose
FT                   reductase; Male sterility domain; KEGG: lic:LIC12176
FT                   UDP-glucose 4-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0524"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42848"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR026390"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B4SDA9"
FT                   /protein_id="ACF42848.1"
FT                   /translation="MQSVLITGADGFIGSHLTEALVRQGYNVRAFVFYNSFNSWGWLDQ
FT                   CATDIKGKFEVFAGDIRDPHGVKEAMKGCDVVLHLAALIAIPYSYHSPYTYVDTNIKGT
FT                   LNVLQAARELGVKKIVHTSTSEVYGTARFVPITEEHPLQGQSPYSATKIAADQLAYSFF
FT                   ASFGLPVIIARPFNTYGPRQSARAVIPTIITQIANGNRQIKLGAVRPTRDFNYVQDTVA
FT                   GFIAAMKSNQGLGEVVNFGSNFEISIGDTVQLIAEVMNTKIEIITDEDRLRPANSEVER
FT                   LWADNSKASQLFGWEPSYGGREGFKRGLAETAEWFLNPTNLASYKSDIYNL"
FT   gene            514874..516061
FT                   /locus_tag="Ppha_0525"
FT   CDS_pept        514874..516061
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0525"
FT                   /product="DegT/DnrJ/EryC1/StrS aminotransferase"
FT                   /note="PFAM: DegT/DnrJ/EryC1/StrS aminotransferase; KEGG:
FT                   lic:LIC12175 aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42849"
FT                   /db_xref="GOA:B4SDB0"
FT                   /db_xref="InterPro:IPR000653"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR026385"
FT                   /db_xref="UniProtKB/TrEMBL:B4SDB0"
FT                   /protein_id="ACF42849.1"
FT                   /translation="MKDLNSPSLLADQVVAALRSVIGQKAAVLHEPSFSGNEWLYLKEC
FT                   LDSTFVSSVGKFVDRFEADLVAYTGARYVVAVVNGTAALHIALKLAGVKAEDEVLIPAL
FT                   TFIATANAVTYCGATPHFVDSEERTLGVDAVKLRDYLEQHTEQRAGQCINRTTGRVIRA
FT                   FVPMHTFGHPVDLDGVMAVAHDFNLALVEDAAESLGSYYQGRHTGTFGLMGTLSFNGNK
FT                   TITTGGGGAILTDDEELARHAKHVTTTAKLPHAWEYRHDEIGYNYRMPNINAALGCAQL
FT                   EQLPTMLAAKRELFQRYQAAFATVSGIRLMVEPAQCQSNNWLQTLVLEHEQANQRDALL
FT                   KVTNDSGIMTRPAWILMHELAPFQECPRMDLAGAQSLVQRLINIPSSSSLLQVVS"
FT   gene            516058..516687
FT                   /locus_tag="Ppha_0526"
FT   CDS_pept        516058..516687
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0526"
FT                   /product="transferase hexapeptide repeat containing
FT                   protein"
FT                   /note="PFAM: transferase hexapeptide repeat containing
FT                   protein; KEGG: lic:LIC12174 acetyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42850"
FT                   /db_xref="GOA:B4SDB1"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR020019"
FT                   /db_xref="InterPro:IPR041561"
FT                   /db_xref="UniProtKB/TrEMBL:B4SDB1"
FT                   /protein_id="ACF42850.1"
FT                   /translation="MSKPDIILIGAGGHAHSCIDVIEQQGQYHIAGLVGMPHEVHDKHL
FT                   GYEVIATDDDLPQLAKEYGHALISLGQILSPGSRIRLYQQAIKLGFQLPVIVAPTAYVS
FT                   RHATLGAGTIIMHGAIVTAGVRVGDNCIINNRSLLEHDTTVEDHCHISTGAILNGGVTI
FT                   GAGSFVGSGTVIKEGVIIGKDCVIGMGLSLRHNQLDHSRYTGKSTS"
FT   gene            516684..517691
FT                   /locus_tag="Ppha_0527"
FT   CDS_pept        516684..517691
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0527"
FT                   /product="N-acylneuraminate-9-phosphate synthase"
FT                   /EC_number="2.5.1.57"
FT                   /note="PFAM: N-acetylneuraminic acid synthase domain; SAF
FT                   domain protein; KEGG: syw:SYNW0448 putative
FT                   N-acetylneuraminic acid synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42851"
FT                   /db_xref="GOA:B4SDB2"
FT                   /db_xref="InterPro:IPR006190"
FT                   /db_xref="InterPro:IPR013132"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR013974"
FT                   /db_xref="InterPro:IPR020007"
FT                   /db_xref="InterPro:IPR036732"
FT                   /db_xref="UniProtKB/TrEMBL:B4SDB2"
FT                   /protein_id="ACF42851.1"
FT                   /translation="MRQRTLIIAEAGVNHNGDMELAKKLIDVAAEAGADYVKFQTFIAD
FT                   RLVTHAANKADYQIKSTNCSESHHEMLRRLELTPAMHKELIAHCASRNIGFFSTGFDIE
FT                   SVDLLVSLGHNLFKIPSGEITNLPYLRHIGQLGKPVILSTGMAILGDIEAAIEVLEQAG
FT                   TARSNLTVLHCTTEYPTPMSEVNLRAMQSMHSAFGVAVGYSDHTQGIEVAIAAVALGAT
FT                   VIEKHFTLDRNLPGPDHKASLQPAELKAMVSAIRNIEVALGDGIKSLTPGEAKNKPVAR
FT                   KSLVASHAIKAGELFSAQNITTKRPGTGISPMRWDEVMGRVAQRDFLADELITL"
FT   gene            517688..518851
FT                   /locus_tag="Ppha_0528"
FT   CDS_pept        517688..518851
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0528"
FT                   /product="UDP-N-acetylglucosamine 2-epimerase"
FT                   /EC_number="5.1.3.14"
FT                   /note="PFAM: UDP-N-acetylglucosamine 2-epimerase; KEGG:
FT                   syw:SYNW0449 putative N-acetylglucosamine-6-phosphate
FT                   2-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42852"
FT                   /db_xref="GOA:B4SDB3"
FT                   /db_xref="InterPro:IPR003331"
FT                   /db_xref="InterPro:IPR020004"
FT                   /db_xref="InterPro:IPR029767"
FT                   /db_xref="UniProtKB/TrEMBL:B4SDB3"
FT                   /protein_id="ACF42852.1"
FT                   /translation="MTRKICVITGTRAEYGLLRWVMQGIKDDPELTLQIIATGMHLSPE
FT                   FGLTYRNIEQDGFQIDRKVEMLTSSDTAVGIAKSMGLGLIGFADVLNELKPDLIVVLGD
FT                   RFEIFSAVSAALVARIPVAHLHGGELTEGAFDDAIRHSITKMSHLHFVAAEEYRQRVIQ
FT                   LGEQPDHVFLVGGLGIDNIKRLKLLDREELEASIDLRLGPKNLLITFHPVTLETATAAE
FT                   QMAELLAALAEFEDTQLIFTMPNADNGGRVMIRMVEEFVAQHTNARAYTSLGQLRYLSC
FT                   VSNVDGVVGNSSSGLAEVPSFCKGTVNIGDRQRGRLQAESVINCEPTRKSIAGAINKLY
FT                   STDFQLILSKLANPYGDGGASEKVVEILKNHALCGMIKKIFYDLCNE"
FT   gene            518867..519925
FT                   /locus_tag="Ppha_0529"
FT   CDS_pept        518867..519925
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0529"
FT                   /product="Nucleotidyl transferase"
FT                   /note="PFAM: CBS domain containing protein; Nucleotidyl
FT                   transferase; KEGG: tdn:Tmden_0598 nucleotidyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42853"
FT                   /db_xref="GOA:B4SDB4"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:B4SDB4"
FT                   /protein_id="ACF42853.1"
FT                   /translation="MTITEEIWRQAILPMSASLEEVITNLTKVSIKIVLVVNEAGELQG
FT                   TISDGDIRRGLLRGLNLISPIESIIHHNPLVVTEELGREAVRKLMVVNKIQQVPVVDDQ
FT                   HHIVGLYLWDEIAKPILRPNLMVIMAGGMGTRLRPHTENCPKPMLSVSGKPMLEHIIER
FT                   AKQEGFSHFVLAINYLGHVIENYFGDGTCLQVRIDYLKEKSPLGTAGALGLLNPWPTLP
FT                   FAVTNGDVMTDIHYGELLDFHTRHNAAATMAVRVHEWQHPFGVVQTDGIDIIGFEEKPV
FT                   HRSHINAGVYVLEPEALCFLEKNVRCDMPALFERLQAKEKRTAAYPIHEPWLDVGRQED
FT                   LTRANMDNKIKP"
FT   gene            519935..521257
FT                   /locus_tag="Ppha_0530"
FT   CDS_pept        519935..521257
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0530"
FT                   /product="LPS biosynthesis protein, PseA-like protein"
FT                   /note="KEGG: lpc:LPC_2544 LPS biosynthesis protein,
FT                   PseA-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42854"
FT                   /db_xref="InterPro:IPR020022"
FT                   /db_xref="UniProtKB/TrEMBL:B4SDB5"
FT                   /protein_id="ACF42854.1"
FT                   /translation="MDKIKYPQPIDLAPFNKKNAKPDAFYGLPQEVIYCKKCVISNQRP
FT                   NSAVEYKHTRETKKATINFDENGVCDACNFTERKRHSIDWIDREKQLRELCDVHRKSDG
FT                   SYDCITPGSGGKDSFYASHILKTKYGMHPLTVTWAPHVYTDWGWKNFQSWIHAGHDNYL
FT                   MTPNGRVHRILTRLSTELLFHPFQAFMFGQKSLAPKMALLFNIPLVFYGENEAEYGNPI
FT                   GDTDTAKRDWSYFTSADQSRIYLGGVSVADLKSQFGVDQNDLQPYLPADPNRIAEQKIE
FT                   VHYLGYYLKWHPQACYYYAVEHGGFQASPERTPGTYSKYNSIDDRIDDLHYYTTGTKFG
FT                   IGRASYDAAQEIRSGDINREEGVALVKRFDHEFPERFADELFKYLCLPEKEFPVASQMF
FT                   EQNMMDREYFRLLTDHFRSPHLWVNENGKWKLRNADLLDNQ"
FT   gene            521267..522037
FT                   /locus_tag="Ppha_0531"
FT   CDS_pept        521267..522037
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0531"
FT                   /product="histidine biosynthesis protein"
FT                   /note="PFAM: histidine biosynthesis protein; KEGG:
FT                   lpc:LPC_2543 imidazole glycerol phosphate synthase, cyclase
FT                   subunit HisF"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42855"
FT                   /db_xref="GOA:B4SDB6"
FT                   /db_xref="InterPro:IPR004651"
FT                   /db_xref="InterPro:IPR006062"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:B4SDB6"
FT                   /protein_id="ACF42855.1"
FT                   /translation="MRNIRLIARLDIKGPNLIKGIHLEGLRVIGSPNEYALRYYQQGVD
FT                   ELIYMDCVASLYDRNHLGDIIRSAAKDIFVPMTVGGGIRSVEDATQILRSGADKVAVNT
FT                   AAVANPKLINEISRRFGSQCMVLSIEAKEVGKDRWEVYTDNGRERTGLDVIAWVKKGVA
FT                   MGAGEVLLTSVDREGTRKGFDTALVKAVTAEVSIPVIASGGMGKPEDLVGVVSVGGADA
FT                   VAMADILHYNRAGIGEIRNVAKETGMGVRYYEGY"
FT   gene            522024..522671
FT                   /locus_tag="Ppha_0532"
FT   CDS_pept        522024..522671
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0532"
FT                   /product="imidazole glycerol phosphate synthase, glutamine
FT                   amidotransferase subunit"
FT                   /note="TIGRFAM: imidazole glycerol phosphate synthase,
FT                   glutamine amidotransferase subunit; PFAM: glutamine
FT                   amidotransferase class-I; KEGG: lpc:LPC_2542 imidazole
FT                   glycerol phosphate synthase subunit HisH"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42856"
FT                   /db_xref="GOA:B4SDB7"
FT                   /db_xref="InterPro:IPR010139"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:B4SDB7"
FT                   /protein_id="ACF42856.1"
FT                   /translation="MRGTNVTVIDYGVGNLLSVQRGLEHCGAKVTITADSNEILASNKV
FT                   VLPGVGAFGNAMNALEMLGLVTVLREIAYRQTPLLGICLGMQLLMMESEEFGITPGLGL
FT                   IPGRVIPVPVETISGELQKIPHIGWSALYPSIVLNDWNGTLLQENRPGEAAYFVHSFMA
FT                   VPFASEDRIADCIYGGHQIPAVIGRNNIVGCQFHPEKSGEVGLKILRRFCLD"
FT   gene            522685..523698
FT                   /locus_tag="Ppha_0533"
FT   CDS_pept        522685..523698
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0533"
FT                   /product="oxidoreductase domain protein"
FT                   /note="PFAM: oxidoreductase domain protein; KEGG:
FT                   pmf:P9303_01161 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42857"
FT                   /db_xref="GOA:B4SDB8"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B4SDB8"
FT                   /protein_id="ACF42857.1"
FT                   /translation="MGLGSIGTRHLTIARNLFPEADIRVLRHQVCLSIPEYADGCFSII
FT                   DEAIAFLPQIAVIANPAPFHVTVAQQLAVKGVHLLIEKPLSSSIGGVTQLIETCHKKRT
FT                   VLQIGYNLRFLPSLQRFSNFLLDNVIGRVLSVRCEIGQYLPSWRPDTDYRQRVSARREL
FT                   GGGALLELSHELDYLRWIFGEVEWVNATLSHQSTLEIDVEDTAHLILGFVSADDNFQLI
FT                   GAVNLDFIRHDTTRSCTAIGENGTLRWNGLTGVVELYEAGGKEWRELFHYPHQRDYSYQ
FT                   AEWQNFIDCINEHNTPLVTGEDGLKILEIIEAARISAASGRLVTVAAMAATDHIIS"
FT   gene            523695..524399
FT                   /locus_tag="Ppha_0534"
FT   CDS_pept        523695..524399
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0534"
FT                   /product="acylneuraminate cytidylyltransferase"
FT                   /note="PFAM: acylneuraminate cytidylyltransferase; KEGG:
FT                   dvl:Dvul_2588 N-acylneuraminate cytidylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42858"
FT                   /db_xref="GOA:B4SDB9"
FT                   /db_xref="InterPro:IPR003329"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:B4SDB9"
FT                   /protein_id="ACF42858.1"
FT                   /translation="MKAIAFIFARGGSKGLPGKNIRPLGGKPLIAWSIEHALTVNRIKR
FT                   VLVSTDSEEIAAVAREYGAEVPFIRPAELAHDNSPEWLAWRHALNYLLETTGVLPEIMV
FT                   TVPTTAPLRMVLDIENCLNEYEKGDADMVITVTEAHRSPYFNMVKTNTDGTVGLVNPPQ
FT                   SAIAHRQEAPVVYDMATVCYVASPKFIMTHNAMFDGRVKAVQVPAERAIDIDTLLDFQI
FT                   AECLLKIREQKQ"
FT   gene            524396..525199
FT                   /locus_tag="Ppha_0535"
FT   CDS_pept        524396..525199
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0535"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   nwi:Nwi_2393 short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42859"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B4SDC0"
FT                   /protein_id="ACF42859.1"
FT                   /translation="MSTIKELMNLRGRRALITGATGCLGKMMADTLAELGADLVLVDRP
FT                   KSDFETLCTTLTERWGVNVEHYFCDLELQEQRKELIALLKSEGKGLNILINNAAFVGTS
FT                   DLQGWAVPFEEQTVETWRRALEVNLTAIFDLCQGLMSLLKAAEGASIINIASIYGVYGP
FT                   DWSLYEGTSMSNPAAYGVSKGGLIQFTRWLATTIAPSVRVNAISPSGVFRNQPEAFVQR
FT                   YKAKTPLGRMATEDDFRGVVAYLASDMSKYVAGQNIAVDGGWGVW"
FT   gene            525193..525756
FT                   /locus_tag="Ppha_0536"
FT   CDS_pept        525193..525756
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0536"
FT                   /product="transferase hexapeptide repeat containing
FT                   protein"
FT                   /note="PFAM: transferase hexapeptide repeat containing
FT                   protein; KEGG: vvy:VV0322 acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42860"
FT                   /db_xref="GOA:B4SDC1"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="UniProtKB/TrEMBL:B4SDC1"
FT                   /protein_id="ACF42860.1"
FT                   /translation="MVTITELLKRIRYWSYADRIGPDILLTHWRLYFKSSMKKLCKNKF
FT                   KSFGDSAEFRPGAYAEACSKIEIGNHVVIRPGTFLFADPTVGGGGIIIEDKVLIGCGVH
FT                   FYTNNHKFSDVNKPIFDQGYPESNTSNSIILRSGCWIGAGVIILPNVVIGENAVVGAGS
FT                   VVTKSIPPRVVVGGNPAKILKNLY"
FT   gene            525781..527061
FT                   /locus_tag="Ppha_0537"
FT   CDS_pept        525781..527061
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0537"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: aeh:Mlg_2331 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42861"
FT                   /db_xref="InterPro:IPR030906"
FT                   /db_xref="UniProtKB/TrEMBL:B4SDC2"
FT                   /protein_id="ACF42861.1"
FT                   /translation="MELKILLVINKPNRELSIMDSIKKEIILFSPKTSVEIIERYRTGF
FT                   VSFVFSYRPDVILTFPFTGIGLSEMFYLFKVLLGSKIICFRTEGVIDVESEYNLKLATG
FT                   ADTYGKNLVDLEIFWGNKVRLAVASELVKQRKLSSIDRALVVGYPRIEKYFDVASNKRV
FT                   LPERIKFKFSAYDKSNIVLFVTGFHLANYSRNDLINAGDLHTDTMIDLLVKSVEVLKEY
FT                   RSEWIENIIHTAEKYPDLLFVVKKHPIEKKEDYCKFQEIKNILHVYEDIQVNDIIEFVG
FT                   LFVHYGSTSLIDAYLSNTPSLYVYSKKNNEWFSELSWFSDLGWPSSAKVSVSNITQAIK
FT                   NYIEGKIIFKVTPEIKKIMKDYFNIEYGYRYEPSKEIAKILLSNNSVQKINIFDKYLYK
FT                   SLISIIPRALYNYLVGLLKLRIGINYD"
FT   gene            527054..527740
FT                   /locus_tag="Ppha_0538"
FT   CDS_pept        527054..527740
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0538"
FT                   /product="methyltransferase FkbM family"
FT                   /note="TIGRFAM: methyltransferase FkbM family; KEGG:
FT                   ava:Ava_1043 methyltransferase FkbM"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42862"
FT                   /db_xref="GOA:B4SDC3"
FT                   /db_xref="InterPro:IPR006342"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B4SDC3"
FT                   /protein_id="ACF42862.1"
FT                   /translation="MIKRLVNRIKQRKYNSLNQLDRQLEKYVDYDDGYFVEIGANDGVA
FT                   QSNSLYFEKYRGWHGMLIEPSQNNFIKCRKNRSLQSTIYCAACVAFDYKEEFVRMVYSN
FT                   LMSTALSIDSDILDPEAHAKSGLRHLQESEILFEYGAIARKLNDLLNESHAPKVIDFLS
FT                   LDVEGSELDVLKGVDFKEYRFKYILVECRDFDRMNQYLSLMNYRFLKTMSIHDYLFTSE
FT                   TKSELQ"
FT   gene            528006..528479
FT                   /locus_tag="Ppha_0539"
FT   CDS_pept        528006..528479
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0539"
FT                   /product="transposase"
FT                   /note="KEGG: cph:Cpha266_2625 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42863"
FT                   /db_xref="GOA:B4SDC4"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:B4SDC4"
FT                   /protein_id="ACF42863.1"
FT                   /translation="MKKYKVTLTQEERKELEALSNKGKRAAQTMLNALILLACDEGEYQ
FT                   IERSINETIASVLNISMKTIDRVKKRFIEEGFDVALTGKASTRVYCRKADGDFEAHLVA
FT                   LSCSAAPEGHKRWTLRLLADKVVELDYVDNISYETVRRVLKKTSLSLGKRMDG"
FT   gene            528575..529138
FT                   /locus_tag="Ppha_0540"
FT   CDS_pept        528575..529138
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0540"
FT                   /product="transposase"
FT                   /note="KEGG: cph:Cpha266_2626 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42864"
FT                   /db_xref="InterPro:IPR038717"
FT                   /db_xref="UniProtKB/TrEMBL:B4SDC5"
FT                   /protein_id="ACF42864.1"
FT                   /translation="MDESAKQLIAETRTLIPARAGQLARYDYEYSRNGTCNIFMANEPL
FT                   VGKRMVQITTNRKRPDWAKFLEEIANQYQHAERITLVLDNLNTHESGSLYHTFKPNKAK
FT                   ELLDRFEFVYTPKHGSWLNMAEIELRVLTTQCLNRRIETITEVKSEVAAWEMERNNKNS
FT                   KINWRFTNEKARIKLLRLYPTIEE"
FT   gene            complement(529165..529591)
FT                   /pseudo
FT                   /locus_tag="Ppha_0541"
FT   gene            529717..531084
FT                   /pseudo
FT                   /locus_tag="Ppha_0542"
FT                   /note="transposase, IS4 family protein"
FT   gene            complement(531329..531614)
FT                   /pseudo
FT                   /locus_tag="Ppha_0544"
FT   gene            531733..533437
FT                   /pseudo
FT                   /locus_tag="Ppha_0545"
FT   gene            complement(533468..533647)
FT                   /pseudo
FT                   /locus_tag="Ppha_0546"
FT   gene            533895..535049
FT                   /locus_tag="Ppha_0547"
FT   CDS_pept        533895..535049
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0547"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cau:Caur_2124 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42865"
FT                   /db_xref="GOA:B4SDC6"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:B4SDC6"
FT                   /protein_id="ACF42865.1"
FT                   /translation="MNNLCESGDFLGMNNLLGKNSVDSVRITFGMIVLNGEPFTRYNLL
FT                   SLYPWAHQIIVVEGACRTAKAVATPDGHSIDGTLETLRCFQGGEDLEHKVILVSAYDEG
FT                   YKDGFWPEKTEMCRAFARRATGNYLWQVDSDEFYRELDMENIIKLLEQGVGRITFPQHS
FT                   FWGGIDYINKGIGLAIFDRGISGARVFAWGEGFQYKEHRPPTVVDKEGENVSLRGDVSS
FT                   AIMTKKGIYRYHYCLVFPSQVFSKVNYYSVQSQEKTNQGGGFSSTILSWHELNFKQITH
FT                   PFKLHNLPEHLSWIRPFRGIQPVQVVKMMADIRDGFISNELRQTVDINILLRSKYYRIA
FT                   TLVLDRIVILVMSPLCYPLFRIGMSVKYRLKNYSNKLYRKLIKY"
FT   gene            complement(535594..535767)
FT                   /pseudo
FT                   /locus_tag="Ppha_0548"
FT   gene            complement(535772..537005)
FT                   /pseudo
FT                   /locus_tag="Ppha_0549"
FT   gene            complement(537077..537648)
FT                   /pseudo
FT                   /locus_tag="Ppha_0550"
FT   gene            537667..538184
FT                   /pseudo
FT                   /locus_tag="Ppha_0551"
FT   gene            538251..538532
FT                   /pseudo
FT                   /locus_tag="Ppha_0552"
FT   gene            538890..540155
FT                   /locus_tag="Ppha_0553"
FT   CDS_pept        538890..540155
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0553"
FT                   /product="glycosyl transferase group 1"
FT                   /note="PFAM: glycosyl transferase group 1; KEGG: bfr:BF2784
FT                   putative glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42866"
FT                   /db_xref="GOA:B4SDC7"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="UniProtKB/TrEMBL:B4SDC7"
FT                   /protein_id="ACF42866.1"
FT                   /translation="MRILWITNTLFPEPSIALSLPVPVVGGWMYGLAENLVAKKDISLA
FT                   VATVYNDDGLKRMDLNGIVYYMLPSKKQNSYQKSLEPLWKDIVSSFMPDLVHIHGTEYQ
FT                   HALACMRSCPNAQYLVSMQGLVSVYARYYYADLNAIDIIMNISIRDILRLDTIFHGKNN
FT                   FINRGIYEKEYINRTKHVIGRTTWDLAHTKAINTTVNYHHCNEILRKSFYEAPKWSCKK
FT                   KNDYTIFLSQASYPIKGLHQVLKAIALLIKEFPQIRLRVAGHSIINRGTLINRLKIDGY
FT                   GSYIRQLINTLKLYDRIVFTGPLVEEEMIREYLHAHLFICPSSIENSPNSLGEAQILGV
FT                   PTIGSYVGGIPDMITHGETGLLYRFEEVEILAENIRRVFTDHKFSQRISQQEIIEAEKR
FT                   HSRTANCDETINIYENIILKNV"
FT   gene            540310..541503
FT                   /locus_tag="Ppha_0554"
FT   CDS_pept        540310..541503
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0554"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dps:DPPB82 related to polysaccharide transport
FT                   proteins"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42867"
FT                   /db_xref="GOA:B4SDC8"
FT                   /db_xref="UniProtKB/TrEMBL:B4SDC8"
FT                   /protein_id="ACF42867.1"
FT                   /translation="MYWIQDACWVLFLIFLMCESVKVVALFRLVPIAAGIGLYLMGSQI
FT                   SRYDYRRLIIFLYLNVAVLLAVIQSGRYEILLFSFVRAFLVPFYVIVYLSQRGIRRQTL
FT                   IVIALSVLPQLFVYFTGITFSDYQPYTFALQFCGLAGDPNYLSSYLVISLGAQLALLRE
FT                   PESRVNLFIWIIMAFITVFLILISVSRAGTMAMILSLVIFAFSFKYKNPYRQFLIISAI
FT                   LYATINMSPFVLEQASSDSIFSKLYNRFTVEGDSSLQENSRYGVMERGFKQIFQRGPIE
FT                   YTDESIILAQEGTLIHNTLIRLGISYGWLSAITHIIVWVLGLLSLIILFIREFFLYKKY
FT                   AYHVNMALLPVMLLVLPYFFVIMSIPALEQNLYWAQFGMIFTFFSNKKSSLYNYKNV"
FT   gene            541664..542602
FT                   /locus_tag="Ppha_0555"
FT   CDS_pept        541664..542602
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0555"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0555"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42868"
FT                   /db_xref="UniProtKB/TrEMBL:B4SDC9"
FT                   /protein_id="ACF42868.1"
FT                   /translation="MLYCKTQFGQGLLGRGMGFGNRLFPWARCRIFAFVNSAQMISPVW
FT                   LRPAISQIFRGGIDYNSYVRQLILFGLFRRRSNDLSVIKGLMTTSRISVFHEPDSLESQ
FT                   YPVQTEKKNVTIIFSGYENYFLPLNNWHNFLYDELQLITKVKYLNIVDSVGCIPIGICV
FT                   RCGNDFGEPVIINGKLQKGQKTPIKWFVRCLNIIRSEINYPCRAVVISDGTHRQLDELL
FT                   SLENVQLLRPASAISDLLVLAKTSLLIGSGSSSFVAWGCYLGQMPSISHPGQSLLDWGI
FT                   APKKGQYIGEFDPNNPSEEFLSQVRVVLNKS"
FT   gene            542618..543958
FT                   /locus_tag="Ppha_0556"
FT   CDS_pept        542618..543958
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0556"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: syn:slr2118 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0556"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42869"
FT                   /db_xref="UniProtKB/TrEMBL:B4SDD0"
FT                   /protein_id="ACF42869.1"
FT                   /translation="MVSSEYPRVLLVLMAKIKIEEPINLIIRKQFGQWPSDHLAQIYSG
FT                   ESKGSGEFCDYYYHLQANDRVFGSIYNKIRRGIVDIVAIHSENNHSNIKRTYSFKSFIA
FT                   VIKKHFGEWLIASGLWEMIFRVRLSSSMATFVSEFKPDLIYCQGYSLGFVTLPMLIAKR
FT                   FSIPICFQTTDDWPSYTYNSFPMGSILRHRTRQLVSRATLRMAFGEKMQRLYKRRYGES
FT                   FDVTYHLDDPMRFLMSSGSKIEQEIIIKQHRIVYTGSLALRRYEALQDLLAAVKIMKNN
FT                   SIEIQIDVYCSGIPKDLPIELLDASEIVFYPLPSHEEIPKVLSTASVLFLPESFNVAQK
FT                   MIEYSISSKAHLYMMSGQPILVYGPEYSGTVEYAVRMGWGVVVSKRSVLLLKAALRELL
FT                   DSEQRKCQIRLNAQECIQRYHNMKDGQDKFLKMLKSIEHIEEKSIVK"
FT   gene            543955..545154
FT                   /locus_tag="Ppha_0557"
FT   CDS_pept        543955..545154
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0557"
FT                   /product="glycosyl transferase group 1"
FT                   /note="PFAM: glycosyl transferase group 1; KEGG:
FT                   sus:Acid_4655 glycosyl transferase, group 1"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0557"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42870"
FT                   /db_xref="GOA:B4SDD1"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="UniProtKB/TrEMBL:B4SDD1"
FT                   /protein_id="ACF42870.1"
FT                   /translation="MIKLGQQMLLSKNPSLVFISNGITPYGTHFLERIAGELFDFKLHT
FT                   IYSYEFSMGKWQITLKPILNAVVLGKDEYAIQHYNLSAIRHSYSRYLQLVKEIKTISPI
FT                   AVIVLGYGNIAHYLLIEWCYKNDIACLILGDSNILGDCNSGLRSFIKSIIVKRVVSCCS
FT                   AFLPCGTLGSQYFEKYGARPEQIFFSPVEPDYSLIEEISTDTVKSLTMQFKFDPDRYRL
FT                   IYSGRLVAIKRLDLLIDAFAKIAEQRSEWDLLIVGGGSLEAELKMRIPDWLRHRVYWTG
FT                   FVSSQEHMSALYQFADILVLPSDYEPWALVVNEAVCAGLALVCSDAVGAAFELLCDGEN
FT                   GRYFHAGDVESLIEALLDVTKAENLLKYKIASKQILSLWRKKADPVDGLRCALEYCFRT
FT                   "
FT   gene            545187..546209
FT                   /locus_tag="Ppha_0558"
FT   CDS_pept        545187..546209
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0558"
FT                   /product="polysaccharide biosynthesis protein CapD"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase; 3-beta
FT                   hydroxysteroid dehydrogenase/isomerase; polysaccharide
FT                   biosynthesis protein CapD; dTDP-4-dehydrorhamnose
FT                   reductase; Male sterility domain; Polysaccharide
FT                   biosynthesis domain protein; KEGG: gur:Gura_1672
FT                   polysaccharide biosynthesis protein CapD"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0558"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42871"
FT                   /db_xref="GOA:B4SDD2"
FT                   /db_xref="InterPro:IPR003869"
FT                   /db_xref="InterPro:IPR013692"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B4SDD2"
FT                   /protein_id="ACF42871.1"
FT                   /translation="MFKDKKLFITGGTGTFGNAVLRRFLQTDIAEIRVFSRDEKKQDDM
FT                   RKHYAHTKLKFYIGDVRNADSVRDAMEGVDFIFHAAALKQVPSCEFFPVEALRTNAMGT
FT                   HNVLTQATAVGVKRVVVLSTDKAVYPINAMGISKAMMEKIAVAQSRVSGSRTVINVTRY
FT                   GNVMASRGSVIPLFLKHIQEGRPMTITDPKMTRFMMTIDDAVDLVLYAFTHGQPGDTFV
FT                   QKAPSATIEVLALALKKLMKSDVSVSIIGTRHGEKLYESLLTREELTVAQDLGGYYRVP
FT                   ADNRDLNYAAFFSEGREEVSLKEDYNSHNTARVDVDGMCELLLKLDCVNAAMRGERVEV
FT                   "
FT   gene            546226..547344
FT                   /locus_tag="Ppha_0559"
FT   CDS_pept        546226..547344
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0559"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase; KEGG:
FT                   drm:Dred_3032 NAD-dependent epimerase/dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0559"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42872"
FT                   /db_xref="GOA:B4SDD3"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR010551"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B4SDD3"
FT                   /protein_id="ACF42872.1"
FT                   /translation="MNVLVTGSKGFVGRNLCSVLRTMESIQLVEFDCDNTSAELEPMLG
FT                   EAEVVFHLAGVNRPKNDEEFRSGNTGLTEELCAILQRLERTPKIILASSIQAELDNPYG
FT                   SSKLQAEQVLRGFAEITSARAVVYRFKNLFGKWCRPNYNSVTATFCHNIAHGLPVTISD
FT                   PGRSLELTYIDDVVAALVGEIPAEEGVKESGFAFGADLSAYSITLGELAGLITSFRESR
FT                   QTLVLPGFDSLFVKALYATYLSYLEGDDFAYPLQIRSDERGSLAEMLKSNAFGQIFVSR
FT                   TKPGITRGNHYHHTKTEKFMVVEGDAVIRFRQIDGVEVIEHRVSGKEFRVVDIPPGYTH
FT                   HISNIGENELVTLFWASEIFNPEKPDTYFLQV"
FT   gene            547393..548505
FT                   /locus_tag="Ppha_0560"
FT   CDS_pept        547393..548505
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0560"
FT                   /product="UDP-N-acetylglucosamine 2-epimerase"
FT                   /EC_number="5.1.3.14"
FT                   /note="PFAM: UDP-N-acetylglucosamine 2-epimerase; KEGG:
FT                   gur:Gura_1696 UDP-N-acetylglucosamine 2-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0560"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42873"
FT                   /db_xref="GOA:B4SDD4"
FT                   /db_xref="InterPro:IPR003331"
FT                   /db_xref="InterPro:IPR029767"
FT                   /db_xref="UniProtKB/TrEMBL:B4SDD4"
FT                   /protein_id="ACF42873.1"
FT                   /translation="MTIVGTRPEIIRLSRVLAKLDEHTEHVLVHTGQNYDYELNQIFFD
FT                   DLDIRKPDHFLDAAGSTAAETVGLIIAKADVVMATVMPDVLLILGDTNSCLAVYPAKRR
FT                   KIPVFHMEAGNRCFDYRVPEEINRKIVDHTADINLTYSDIAREYLLREGLFADRIIKTG
FT                   SPMFEVLMHYHDKIDRSDVLERLSLSDGEYFVVSAHREENIESDLNFMKLVTILNGLAE
FT                   KYGKRVIVSTHPRTRKRIDVSGVVFNPLVELLKPLGFLDYVHLQVHARAVLSDSGTITE
FT                   ESSILNFPALNIREAHERPEGMEEASVMMVGLEVDRVMQALGILETQPRGELRSLRQVE
FT                   DYSMLNVSDKVVRLILSYTDYVNRVVWKKY"
FT   gene            548632..549132
FT                   /locus_tag="Ppha_0561"
FT   CDS_pept        548632..549132
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0561"
FT                   /product="putative acetyltransferase"
FT                   /note="KEGG: bxe:Bxe_C1079 putative acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0561"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42874"
FT                   /db_xref="GOA:B4SDD5"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="UniProtKB/TrEMBL:B4SDD5"
FT                   /protein_id="ACF42874.1"
FT                   /translation="MWFRCIKYGLKFVDKTFYMAPGSHVSKDLIAGKYSFIGSECMIGP
FT                   KVKLGNYVMFAPRVAVVGADHIFNKSGRPIIFSGRPEMPLTIIEDDAWVGYGSILMAGI
FT                   RIGRGAIVAAGAVVTKDVPAYEIHGGVPAKKIGIRFQTIEDCQFHDKMLALPPKRGLYC
FT                   SNT"
FT   gene            549369..549920
FT                   /locus_tag="Ppha_0562"
FT   CDS_pept        549369..549920
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0562"
FT                   /product="putative acetyltransferase"
FT                   /note="KEGG: pna:Pnap_3182 putative acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42875"
FT                   /db_xref="GOA:B4SDD6"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="UniProtKB/TrEMBL:B4SDD6"
FT                   /protein_id="ACF42875.1"
FT                   /translation="MAKKLQHSSLPLKNKLARILWQIVWRFFYRPTPRLFHSWRSFLLR
FT                   IFGAKIGKSVHPYPSARIWAPWNLEMGDHSCLSENVDCYCVDKICIGAHSTVSQYSFLC
FT                   SASHDYTLDAMPLVTAPITIGERVWITADVFVGPGVTIGDGAVVTARSSVFRDLPPWMV
FT                   ACGNPAVPVKKRKSNDICDE"
FT   gene            549913..550173
FT                   /locus_tag="Ppha_0563"
FT   CDS_pept        549913..550173
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0563"
FT                   /product="methyltransferase domain protein"
FT                   /note="KEGG: mca:MCA1164 methyltransferase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0563"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42876"
FT                   /db_xref="GOA:B4SDD7"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B4SDD7"
FT                   /protein_id="ACF42876.1"
FT                   /translation="MNKNEISGYRWGSAELSNIHDDLIPEVLLELNRLQLTLVGKARVF
FT                   ELGCGNGSVANLLTKHGWDVTGIDPSTEGIVRALESYPSLT"
FT   gene            550291..551695
FT                   /pseudo
FT                   /locus_tag="Ppha_0564"
FT   gene            551811..552362
FT                   /locus_tag="Ppha_0565"
FT   CDS_pept        551811..552362
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0565"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ret:RHE_CH03209 putative methyltransferase
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0565"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42877"
FT                   /db_xref="GOA:B4SDD8"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B4SDD8"
FT                   /protein_id="ACF42877.1"
FT                   /translation="MPCCSENGQAIGSGIIFFGIKSGFFRLFGYNLSQLFFFSVFLTLD
FT                   GLLFYESLSLGLKLFPGSAYDNLYECYGAFPVVTSFEVVEHVYFPREYAATLFSLCEHG
FT                   GTVILSTPYHGYWKNLALAFTGKMDAHFTALWDYGHIKFWSMKTLTQLLLEAGFENIRF
FT                   KRVGRIPVLAKSMIAIATKK"
FT   gene            552359..553261
FT                   /locus_tag="Ppha_0566"
FT   CDS_pept        552359..553261
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0566"
FT                   /product="glycosyl transferase family 2"
FT                   /note="PFAM: glycosyl transferase family 2; KEGG:
FT                   bvu:BVU_2654 glycosyltransferase family 2"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0566"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42878"
FT                   /db_xref="GOA:B4SDD9"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:B4SDD9"
FT                   /protein_id="ACF42878.1"
FT                   /translation="MKITAIILTFNEERHLARCIASLKGIVSEIIVADCFSTDATLDIA
FT                   CANGARVIQHEWVSHAAQFNWALTQLAADTDWVLRVDADEYLTPNLIAEIKSTLPGIGT
FT                   KIDGVYCSRRMTFQGRLIRHGGVFPARVLRLFRYGRGQCENRWMDEHIKVAGPTVDFNG
FT                   EMIDDSLNSLTWWTEKHNKYASREAVDLLNLEYGFMPHDSVASLRNGKQTGVKRWLKEE
FT                   VYARLPGGFRAFTYFFYRYVIRMGFLDGQAGTAFHFLQGFWYRYLVDAKVFEVKRYMRD
FT                   TNANIVMAIDKVLGVKLES"
FT   gene            553277..554035
FT                   /locus_tag="Ppha_0567"
FT   CDS_pept        553277..554035
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0567"
FT                   /product="glycosyl transferase family 2"
FT                   /note="PFAM: glycosyl transferase family 2; KEGG:
FT                   rma:Rmag_0889 glycosyl transferase, family 2"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0567"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42879"
FT                   /db_xref="GOA:B4SDE0"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:B4SDE0"
FT                   /protein_id="ACF42879.1"
FT                   /translation="MLSMSIVTVVRNNETTIADCISSVAGQSLPPFEHIIIDGKSTDGT
FT                   LSEIKKHQHSAVKLVSESDKGIYDAMNKGILLATGDIIGILNSDDIYAHSQVLENVTKL
FT                   FQESCADALFADLVYVKSDNVNQVVRYYSGAGFTPEKFAWGWMPPHPTFFVRREIYERY
FT                   GLFATDYRISADYELMARFMARHRVNYLYMSDVIVRMRTGGVSTRNLKSNWILNREILR
FT                   ACTDNGIDTNIFKVYSKYFRKVSQLFARPA"
FT   gene            554032..555000
FT                   /locus_tag="Ppha_0568"
FT   CDS_pept        554032..555000
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0568"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase; 3-beta
FT                   hydroxysteroid dehydrogenase/isomerase; polysaccharide
FT                   biosynthesis protein CapD; dTDP-4-dehydrorhamnose
FT                   reductase; Male sterility domain; KEGG: cph:Cpha266_2616
FT                   NAD-dependent epimerase/dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0568"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42880"
FT                   /db_xref="GOA:B4SDE1"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B4SDE1"
FT                   /protein_id="ACF42880.1"
FT                   /translation="MNVWLTGSTGFLGTSLVKQLILQNVKFVAVLLDEKDVARLPSSEI
FT                   EWVIVPPLSNSANYQNTLNDVDVVVHLAARVHVMRDEAADPLTEFRRVNVSGTLNLAKQ
FT                   AALAGVRRFVFVSSIKVNGESTLLGHPFSDGDALDPQDPYGISKYEAEQGLLELASETC
FT                   MEVVIIRPPLVYGPGVKANFASMMSWLERGVPLPLGAVHNQRSFVALDNLVDLIVTCID
FT                   HPKAVNQTFLVSDGEDLSTTELLQRMGRALGKPARLIPVPVGVMQFAANLLGKGAVAQR
FT                   LFGSLQVDSSKARDLLGWKPVVTVDEALQKTADAFNAVHKK"
FT   gene            555033..555593
FT                   /locus_tag="Ppha_0569"
FT   CDS_pept        555033..555593
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0569"
FT                   /product="sugar transferase"
FT                   /note="PFAM: sugar transferase; KEGG: cph:Cpha266_2615
FT                   sugar transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0569"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42881"
FT                   /db_xref="GOA:B4SDE2"
FT                   /db_xref="InterPro:IPR003362"
FT                   /db_xref="UniProtKB/TrEMBL:B4SDE2"
FT                   /protein_id="ACF42881.1"
FT                   /translation="MKRLFDITMSLLALLVFGMPMLIVALFIKLTSRGPVLYWSDRVGK
FT                   NNALFRMPKFRTMLVETPAVATHLMSDPDRFLTPIGKFLRKTSIDELPQLWSILIGDMS
FT                   IVGPRPALFNQDDLIALRTEKGVHILTPGLSGPAQINGRDELPIPVKVEFDEYYLKNRS
FT                   FLFDLKIIVQTIFKAVKGDGVTH"
FT   sig_peptide     555033..555107
FT                   /locus_tag="Ppha_0569"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.942) with cleavage site probability 0.516 at
FT                   residue 25"
FT   gene            555599..556579
FT                   /locus_tag="Ppha_0570"
FT   CDS_pept        555599..556579
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0570"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase; KEGG:
FT                   cph:Cpha266_2610 NAD-dependent epimerase/dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0570"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42882"
FT                   /db_xref="GOA:B4SDE3"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR028614"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B4SDE3"
FT                   /protein_id="ACF42882.1"
FT                   /translation="MHKKIYIAGHRGMVGSAIVRNLLAGGLSSDNLLFRTHAELDLTSQ
FT                   AAVRAFFEGEKPDQVYLAAAKVGGIHANNSYPAEFIYQNLMMEANIIHEAWRVGVQKLL
FT                   FLGSSCIYPKLAPQPMPESALLTGPLEPTNEPYAIAKIAGIKLCESYNRQYGESDGTDF
FT                   RSVMPTNLYGPGDNYHPENSHVIPALIRRFHEAMVSGDAVVTLWGTGTPLREFLYVDDM
FT                   AAACIHVMNLDKATFDANTTPMLSHINVGSGKEVTIRELADTIAMVIGFQGGIAFDASK
FT                   PDGSPRKLMDSSRLNNLGWQPKVGLEEGLRLAYNDFLLHEHASHF"
FT   gene            556586..557728
FT                   /locus_tag="Ppha_0571"
FT   CDS_pept        556586..557728
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0571"
FT                   /product="GDP-mannose 4,6-dehydratase"
FT                   /note="TIGRFAM: GDP-mannose 4,6-dehydratase; PFAM:
FT                   NAD-dependent epimerase/dehydratase; KEGG: cph:Cpha266_2608
FT                   GDP-mannose 4,6-dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0571"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42883"
FT                   /db_xref="GOA:B4SDE4"
FT                   /db_xref="InterPro:IPR006368"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B4SDE4"
FT                   /protein_id="ACF42883.1"
FT                   /translation="MKVALITGITGQDGSYLAELLLEKGYEVHGIKRRASSFNTQRIDH
FT                   LYRDRHDIENEGSPVSHHSSLFLHYGDLTDSSNLTRIISEVQPDEVYNLGAQSHVAVSF
FT                   ESPEYTADVDAMGTLRLLEAIRFLGLEKKSRFYQASTSELFGLVQEIPQRESTPFYPRS
FT                   PYAVAKLYAYWITVNYREAYGMYACNGILFNHESSRRGETFVTRKITRSLANITQGLEE
FT                   CLYVGNMNALRDWGHAKDYVRMQWMMLQQEQPKDFVIATGVQYSVRQFIEKSAAQLGIT
FT                   IRWEGTGINEVGIVDSLSIQHSALSTGSVIVRVDPRYFRPAEVETLLGDPAKAKADLGW
FT                   VPEITLDETVEEMVAYDLDLARRHALLKANGYTVEVSKES"
FT   gene            558478..559071
FT                   /locus_tag="Ppha_0572"
FT   CDS_pept        558478..559071
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0572"
FT                   /product="putative acetyltransferase"
FT                   /note="KEGG: cph:Cpha266_2607 putative acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0572"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42884"
FT                   /db_xref="GOA:B4SDE5"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR020019"
FT                   /db_xref="InterPro:IPR041561"
FT                   /db_xref="UniProtKB/TrEMBL:B4SDE5"
FT                   /protein_id="ACF42884.1"
FT                   /translation="MERILIVGAGGHGRSVAESIELRGNFQIAGFIDDSYPEKKQVWDY
FT                   PVLGAVEDISVFSDRAESLVVAIGNNRVRKALFGKAKASGFMLPSIIHPAAFVSSRAVI
FT                   GEGCCIMAGAVVGTEAVLGSGCVVNVNASADHHCRLEDFAHLGVGVQLAGGVIVGDSAW
FT                   LQAGSSAGYGVVVPDEANVLPCIGLLKDCVTCKV"
FT   gene            559230..560444
FT                   /locus_tag="Ppha_0573"
FT   CDS_pept        559230..560444
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0573"
FT                   /product="glycosyl transferase group 1"
FT                   /note="PFAM: glycosyl transferase group 1; KEGG:
FT                   eba:ebA5893 predicted glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0573"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42885"
FT                   /db_xref="GOA:B4SDE6"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:B4SDE6"
FT                   /protein_id="ACF42885.1"
FT                   /translation="MRILLLTQWFDPEPTYKGLYFAKELQKQGFEVEVLTGFPNYPGGK
FT                   IYPGYKIQLYKKEVIEGVLVTRVPLYPSHDQREIGRVLNYVSFAVSALVYGVLRAKRPD
FT                   VVYAYHPPLTVGIAVSLIRLFRRVPVVYDIQDMWPDTLRATGMVSNSRALDIVGRICKL
FT                   VYRSVDRIVVLSPGFRKLLVERGVPERKVDVIYNWCDEASMGNPAGEIPKDFFGSGSFA
FT                   IVFAGNMGKAQALDAVLVAAEIVQKKAPEICFVFIGGGVEVDNLKSLAHEKNLHNVRFL
FT                   QPVPMAEIGGVLAKADALLIHLRKDPLFTITIPSKTQAYMAVGKPLLMAVEGDVADLVK
FT                   AAGCGVIAEPENPESIADAALKLFSLSSAERNAMTERSKEYYKSKLSLNVGVEKFAAIF
FT                   RQSAK"
FT   gene            560453..561055
FT                   /locus_tag="Ppha_0574"
FT   CDS_pept        560453..561055
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0574"
FT                   /product="Undecaprenyl-phosphate galactose
FT                   phosphotransferase"
FT                   /EC_number="2.7.8.6"
FT                   /note="PFAM: sugar transferase; KEGG: rrs:RoseRS_4262
FT                   undecaprenyl-phosphate galactose phosphotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0574"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42886"
FT                   /db_xref="GOA:B4SDE7"
FT                   /db_xref="InterPro:IPR003362"
FT                   /db_xref="UniProtKB/TrEMBL:B4SDE7"
FT                   /protein_id="ACF42886.1"
FT                   /translation="MVKRLFDLLLTIPGTLVILPFLLVLALLVRIFHGSPLFFTQVRPG
FT                   RHGKPFRMCKFRTMTDARDDIGNLLPDQERLTSLGRFLRATSLDEFPELINVLKGDMSL
FT                   VGPRPLLMEYLSRYSPEQNRRHDVKPGMTGWAQINGRNAISWDEKFILDVWYVDNRSLW
FT                   LDVRILAITMLNVVLRKGINHNSTETMPFFQGSENQK"
FT   gene            561120..561362
FT                   /locus_tag="Ppha_0575"
FT   CDS_pept        561120..561362
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0575"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pat:Patl_3073 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0575"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42887"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/TrEMBL:B4SDE8"
FT                   /protein_id="ACF42887.1"
FT                   /translation="MKEKIVAIIREMAAEYGWSVVSDFSDDTVLLESGLDSLGFAILVA
FT                   RLEEELQYDPFSMMDEPVYPRTLGEFVAVYERYAS"
FT   gene            561359..562684
FT                   /locus_tag="Ppha_0576"
FT   CDS_pept        561359..562684
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0576"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /note="PFAM: AMP-dependent synthetase and ligase; KEGG:
FT                   pat:Patl_3072 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0576"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42888"
FT                   /db_xref="GOA:B4SDE9"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:B4SDE9"
FT                   /protein_id="ACF42888.1"
FT                   /translation="MKAEALSSILEGFDGGQTVVLSAEARLTVDQLLENADALFRRSSV
FT                   TSGSRIALCGLAVFDLITALAAFDGRAGAMLLLPASADSASGDRLVLAAGCTHRMDGEG
FT                   IRALPDCREGCGSADADATQWLLATSGTTGVPKLIGHTLASLSRTVKRDVAKGRGFIWG
FT                   LLYDPCRFAGLQVILQALLSGSMLSVSSSHDFNRQVEGLVAGGVNALSATPSLLRKLLM
FT                   AGDIKECPLRQITLGGEIADQQILDGLRHCFPSARIVHIYASTEAGVGFSVHDGMAGFP
FT                   AAWLEDERKSVPMKVRGDGHLLVRPTTVPEGEEVAGRLDADGYLDTGDLVCVAGDRVFF
FT                   SGRASGSLNVGGNKVMPEYVEEHIRRVDGVFDVYVYGKKSSMMGQIVAADIVLDPGVDK
FT                   AVIRGNILSYCRSALENWQIPGVLRFVSGLEETAAGKRERLI"
FT   gene            562681..563406
FT                   /locus_tag="Ppha_0577"
FT   CDS_pept        562681..563406
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0577"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase;
FT                   short-chain dehydrogenase/reductase SDR; KEGG:
FT                   pat:Patl_3071 short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0577"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42889"
FT                   /db_xref="GOA:B4SDF0"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B4SDF0"
FT                   /protein_id="ACF42889.1"
FT                   /translation="MMKVVVVTGATRGLGFAIARQCIADGYKVVAVGRTMTEPLASLLQ
FT                   SFPERIVFEPYDFFNTAGIHAFAVGIVKRHGRPWGLVNNAAIGTDGVLATLHEQDIADL
FT                   ITINLQAPVLLTKYLLRPMLLNRGGRIINVSSIIASTGFNGLSVYGATKAAMAGLTKSL
FT                   AREVGRANITVNTLAPGFMETDMTSSLQGEKLESVRRRSPLGHLATVEDAAHAVSFLLS
FT                   EKASSVTGTTLTVDAGATA"
FT   gene            563424..564026
FT                   /locus_tag="Ppha_0578"
FT   CDS_pept        563424..564026
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0578"
FT                   /product="transferase hexapeptide repeat containing
FT                   protein"
FT                   /note="PFAM: transferase hexapeptide repeat containing
FT                   protein; KEGG: bxe:Bxe_A2414 putative O-acyltransferase,
FT                   CysE/LacA/LpxA/NodL family"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0578"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42890"
FT                   /db_xref="GOA:B4SDF1"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="UniProtKB/TrEMBL:B4SDF1"
FT                   /protein_id="ACF42890.1"
FT                   /translation="MSDKQRHTDNPFYKGFFESEELMNMGFMSVGKNVKIAKNCTIVGL
FT                   ENISLGNNIQIDEQVFIAVNKGYLDIGDHVHIGGGCHVSGTGGVTISDFCGLSQGVRIY
FT                   SVTDDYTGYSLTNATVPERFKSVKVAPVNLGRHVLIGSGSVVLPGVTIGEGSAVGALSL
FT                   VSISLDEWGVYFGSPAKRIKARSKKLLEMEKLLREGG"
FT   gene            564100..565284
FT                   /locus_tag="Ppha_0579"
FT   CDS_pept        564100..565284
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0579"
FT                   /product="DegT/DnrJ/EryC1/StrS aminotransferase"
FT                   /note="PFAM: DegT/DnrJ/EryC1/StrS aminotransferase; KEGG:
FT                   rme:Rmet_2724 DegT/DnrJ/EryC1/StrS aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0579"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42891"
FT                   /db_xref="GOA:B4SDF2"
FT                   /db_xref="InterPro:IPR000653"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:B4SDF2"
FT                   /protein_id="ACF42891.1"
FT                   /translation="MLNTSFPPWPSFSVDEAEAVSRVVLSNRVNYWTGQECREFEREFA
FT                   LWAGCEYAVALANGTLALEVALKALGIGLGDEVVVTPRTFIASASCVVATGAVPVFADV
FT                   DRDTQNIAADTVAQVLSPRTKAVICVHLAGMPCDMDPIIDLARERGLLVIEDCAQAHGA
FT                   IYKGRPVGSIGHIGAWSFCQDKIMTTGGEGGMVTTNDRALRDAMWAYKDHGKSWRAVNE
FT                   MYENTEQSSFQWLHESFGSNYRMLEMQAAIGRIQLRRMPEWSAKRRGYAGMIWNTARLF
FT                   PWLRVPDVPDWAEHAAYKCYVFVVPSALPDGWDRDRVMAEINAQGVPCYSGSCSEIYLE
FT                   KAFEGTGWRPAERLPVAKELGETSLMFLVHPTLEQEHIEKTCKVLQEVMSEAKR"
FT   gene            complement(565295..565987)
FT                   /locus_tag="Ppha_0580"
FT   CDS_pept        complement(565295..565987)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0580"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hch:HCH_03424 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0580"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42892"
FT                   /db_xref="InterPro:IPR014263"
FT                   /db_xref="UniProtKB/TrEMBL:B4SDF3"
FT                   /protein_id="ACF42892.1"
FT                   /translation="MRITRYSALAIATGLLLLSSLLLVEAREHLTFKGAPPDLERLIRE
FT                   HPDGWAPLSGHSVDSEWSKSLKSDYDLVTTRTYQYPDGKTVSMLMTWSRDGIRRAGHLQ
FT                   QVCYQVGGSEIGTPKQASVTTKMGKQEVITFTAQQGNRVEDVMYWRITGGKLDLGTNQS
FT                   LFSATRIDKMTRLIRSMLGTMPDNIMIRVSSERPAPDQPATAHIDYIREYLESLPANDR
FT                   DLIMGTHD"
FT   sig_peptide     complement(565913..565987)
FT                   /locus_tag="Ppha_0580"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.571 at
FT                   residue 25"
FT   gene            complement(565968..566843)
FT                   /locus_tag="Ppha_0581"
FT   CDS_pept        complement(565968..566843)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0581"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tbd:Tbd_1792 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0581"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42893"
FT                   /db_xref="GOA:B4SDF4"
FT                   /db_xref="InterPro:IPR019127"
FT                   /db_xref="InterPro:IPR026392"
FT                   /db_xref="UniProtKB/TrEMBL:B4SDF4"
FT                   /protein_id="ACF42893.1"
FT                   /translation="MNIRPHASWFPWLLFALMAFHSAARYTLFNPSFGNSDEPLLYVIL
FT                   VVVLWIERSSITVSLLGQGRGNLLSGLALLGFGWVLYTAGRLYPAMILEIWGLFVIAAG
FT                   LLGTLAPEQYRRSAFFIALSGTIIVLIGWIAPQLLSSNLALAIATVSAKMISATLFPVV
FT                   ANGVILYFGPYSAEVTKACSGMNSIFSLTALSVLYLRESAQRKPWHILVLVACVLPVAI
FT                   LTNLFRVISLVLATQYIGENFAQGLFHDMTGIFVFIVALLILALIDRFLFQASKGYKQT
FT                   GNKAHADNQV"
FT   sig_peptide     complement(566769..566843)
FT                   /locus_tag="Ppha_0581"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.649) with cleavage site probability 0.603 at
FT                   residue 25"
FT   gene            complement(566843..567772)
FT                   /locus_tag="Ppha_0582"
FT   CDS_pept        complement(566843..567772)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0582"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cte:CT0711 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0582"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42894"
FT                   /db_xref="GOA:B4SDF5"
FT                   /db_xref="UniProtKB/TrEMBL:B4SDF5"
FT                   /protein_id="ACF42894.1"
FT                   /translation="MLVYEEVIIQGVNVPFLQSLNASVGKGASLTALLDNVKNKSIPFR
FT                   RTTRTLASDQIEPAILKILSTARANVPVVMRVEDKFSMMLMLHTIVPIPLEGQAAEQAA
FT                   ANLINAQQRNIVFTQKMTEVVDASKISYFGEFKPDAPGTKGKQQAITLPTPDPARATSK
FT                   MYRQIRFAALLSFSFTVAMLLLTASMCIQRGTLWLPRLWPARKKETPMPYDYDVYMTSH
FT                   IVELTLIAIAVSVLSALGYHLYLLWSIIPFWMMAVAIITGILVGTGSSRIFALQFVQRT
FT                   MERFHWIPVVVFSLLIAATVFGTMRIVH"
FT   gene            complement(567839..569553)
FT                   /pseudo
FT                   /locus_tag="Ppha_0583"
FT   gene            complement(569731..570120)
FT                   /locus_tag="Ppha_0584"
FT   CDS_pept        complement(569731..570120)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0584"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cte:CT0711 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0584"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42895"
FT                   /db_xref="InterPro:IPR027304"
FT                   /db_xref="UniProtKB/TrEMBL:B4SDF6"
FT                   /protein_id="ACF42895.1"
FT                   /translation="MKSFFVFFLFAFVIAGCSPHAGDGSDGRVAAVVNGVEITQREVDF
FT                   LYQRASAPGASESVKRDQRRSILAGLVRAELLAQQAAKMKLDQSPEFPIALYNARRGVL
FT                   AGLAEAKIVSTAKPLSQETIQTVVA"
FT   sig_peptide     complement(570055..570120)
FT                   /locus_tag="Ppha_0584"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.991 at
FT                   residue 22"
FT   gene            complement(570117..570605)
FT                   /locus_tag="Ppha_0585"
FT   CDS_pept        complement(570117..570605)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0585"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: noc:Noc_0212 protein of unknown function
FT                   DUF1555"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0585"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42896"
FT                   /db_xref="InterPro:IPR013424"
FT                   /db_xref="UniProtKB/TrEMBL:B4SDF7"
FT                   /protein_id="ACF42896.1"
FT                   /translation="MSHSESAFYTGTNPADDNLMGSYMYYTGAHPLDHMTFGGLVAGEN
FT                   YELYIYTQSENNVEIPEQLIFRVNDGSYVTSTANNGKTGTFTPGLNYVLGTYSANSSGQ
FT                   LVIDYAATGTSNRVVINGLQLRGPATPEPASLVLLGIGGLLGARRLKKKSGKTSVPAV"
FT   gene            complement(570953..571891)
FT                   /locus_tag="Ppha_0586"
FT   CDS_pept        complement(570953..571891)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0586"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pol:Bpro_1359 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0586"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42897"
FT                   /db_xref="GOA:B4SDF8"
FT                   /db_xref="UniProtKB/TrEMBL:B4SDF8"
FT                   /protein_id="ACF42897.1"
FT                   /translation="MALILNCSYHEENTCIYPDLPINRDDVRHLADICFGSTCIRSLCS
FT                   FWKRKCVGYTSDTATAAATAAATTTATTAASTSAAAAGTCADACTSSTGAGSQRWSSRL
FT                   IGTQKYMFRVYFCTLNLALWLVTFLNAAFASEIPVSDASFVAMWVTKVGDNKKYPFIIL
FT                   DKKNAHLFVYSPEGKLIGDAPTLLGMSTGDILPDGIAGKPLSKIPEKDRITQAGRFFAR
FT                   KGYDSHDKVVLWVDFATQLAIHEVINVPGQHRLERLDSPTAKDNRVSWGCINVPVVFFQ
FT                   STLMGTFSSGKGYVYILPENFPVAEFFGIKE"
FT   gene            complement(571882..572676)
FT                   /locus_tag="Ppha_0587"
FT   CDS_pept        complement(571882..572676)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0587"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cch:Cag_0645 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0587"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42898"
FT                   /db_xref="UniProtKB/TrEMBL:B4SDF9"
FT                   /protein_id="ACF42898.1"
FT                   /translation="MLMKHFNLKKLAMLGVLLSFWPCSAKAFEYSTLSFPNSHPKSFLT
FT                   PTGWGASDGTIFFAVGGTSPAPYSDKNDGGVMAGIGIGNPYENAGFHVGVVNYDLSDWN
FT                   RIGLVMQLHRYLGSGSSIAVGAEHIMLTGDDLSDADESYYIVFSQGLLDKVQVNQETSR
FT                   TKLHYSIGVGNGRFSEKSPADVANGKGEDGTWVFGNVAYELFDNFNVICEWNGINLSAA
FT                   VGKTFFINNSVPVAVTVGLADLTENSGDGVRLIAGVSTAIWR"
FT   sig_peptide     complement(572593..572676)
FT                   /locus_tag="Ppha_0587"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.820 at
FT                   residue 28"
FT   gene            573012..573955
FT                   /pseudo
FT                   /locus_tag="Ppha_0588"
FT   gene            573962..575104
FT                   /locus_tag="Ppha_0589"
FT   CDS_pept        573962..575104
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0589"
FT                   /product="GDP-mannose 4,6-dehydratase"
FT                   /note="TIGRFAM: GDP-mannose 4,6-dehydratase; PFAM:
FT                   NAD-dependent epimerase/dehydratase; KEGG: cph:Cpha266_2608
FT                   GDP-mannose 4,6-dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0589"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42899"
FT                   /db_xref="GOA:B4SDG0"
FT                   /db_xref="InterPro:IPR006368"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B4SDG0"
FT                   /protein_id="ACF42899.1"
FT                   /translation="MKVALITGITGQDGSYLAELLLEKGYEVHGIKRRASSFNTQRIDH
FT                   LYRDRHDIENEGSPVSHHSSLFLHYGDLTDSSNLTRIISEVQPDEVYNLGAQSHVAVSF
FT                   ESPEYTADVDAMGTLRLLEAIRFLGLEKKSRFYQASTSELFGLVQEIPQRESTPFYPRS
FT                   PYAVAKLYAYWITVNYREAYGMYACNGILFNHESSRRGETFVTRKITRSLANITQGLEE
FT                   CLYVGNMNALRDWGHAKDYVRMQWMMLQQELPRDYVIATGVQYSVRQFIEKSAAQLGIS
FT                   IRWEGEGREEIGVIENLSTPYASLREGSVIVRVDARYFRPAEVETLLGDPAKAKADLGW
FT                   VPEITLDEMVEEMVAHDLDLARRHALLKANGYIVEVSKES"
FT   gene            575171..575425
FT                   /locus_tag="Ppha_0590"
FT   CDS_pept        575171..575425
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0590"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cph:Cpha266_2602 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0590"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42900"
FT                   /db_xref="UniProtKB/TrEMBL:B4SDG1"
FT                   /protein_id="ACF42900.1"
FT                   /translation="MLTGCICWAGCAIFGAGLGLLPGGWVLRAFNDPDYIESYDDGTRH
FT                   YLKKIVENENRWLRVVVNVDVIPNKGVTAFFDRRLRGKA"
FT   gene            575422..575622
FT                   /locus_tag="Ppha_0591"
FT   CDS_pept        575422..575622
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0591"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cph:Cpha266_2601 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0591"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42901"
FT                   /db_xref="InterPro:IPR019270"
FT                   /db_xref="UniProtKB/TrEMBL:B4SDG2"
FT                   /protein_id="ACF42901.1"
FT                   /translation="MKITVDKETDTLYFRLDENKIVESEEVRPGVIFDYDENDAVIGVE
FT                   FLNVSSRTTKEDLSNMQFESA"
FT   gene            575752..575931
FT                   /pseudo
FT                   /locus_tag="Ppha_0592"
FT   gene            complement(576182..576508)
FT                   /locus_tag="Ppha_0593"
FT   CDS_pept        complement(576182..576508)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0593"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="PFAM: helix-turn-helix domain protein; KEGG:
FT                   cch:Cag_0084 transcriptional regulator, XRE family"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0593"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42902"
FT                   /db_xref="GOA:B4SDG3"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:B4SDG3"
FT                   /protein_id="ACF42902.1"
FT                   /translation="MDDLQYQPVPYNVEEEIRKNLQDENFRREYEALEPKYALIRELLS
FT                   ARQHSGMTQEAVALKIGTTKSAISRLESGSKHSPSLTTLRKYAKAVNCELEIKLKPKQQ
FT                   PKTI"
FT   gene            complement(576511..576735)
FT                   /pseudo
FT                   /locus_tag="Ppha_0594"
FT   gene            577008..577115
FT                   /pseudo
FT                   /locus_tag="Ppha_0595"
FT   gene            577171..578376
FT                   /locus_tag="Ppha_0596"
FT   CDS_pept        577171..578376
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0596"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cch:Cag_1240 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0596"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42903"
FT                   /db_xref="InterPro:IPR010106"
FT                   /db_xref="UniProtKB/TrEMBL:B4SDG4"
FT                   /protein_id="ACF42903.1"
FT                   /translation="MEEGGGLLTVRLGGGGTLLTECIYWGGVPFLVQDWDCCLVAGFTD
FT                   FGEEMLYYFRHYFFMFLKAASMSIRSPRKLITFDWAMKRLLRSKANFEILEGFLSELLG
FT                   EDITILEILESESNKESKLDKFNRVDLKVKNGKDEIIIIEVQYERELDYLQRMLYGTSR
FT                   VITEHQQEGEPYATLVKVISVNILYFNLGHGSDYIYHGTTTFVGIHDNDKLQLDIRQQK
FT                   QYGKMQINHIYPEYYLIRLNNFNSIAKTSLDEWIYFLKNEEIKDEFQAKGIQKAKRSFS
FT                   LLSMSEAEQAAYARYQDDLRYQASLVESNYGLGLREGREAGITEGRVEGRVEGRVEGRV
FT                   EGLVEGRVEGQARLLRKLLERRFGVLPEWATGRLSCATEQELEAWAEAILTAQTLEAVF
FT                   TP"
FT   gene            578711..579703
FT                   /locus_tag="Ppha_0597"
FT   CDS_pept        578711..579703
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0597"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cch:Cag_1240 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0597"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42904"
FT                   /db_xref="InterPro:IPR010106"
FT                   /db_xref="UniProtKB/TrEMBL:B4SDG5"
FT                   /protein_id="ACF42904.1"
FT                   /translation="MNIRSPRKLITFDWAMKRLLRSKANFEILEGFLSELLGEDITILD
FT                   ILESESNKESKLDKFNRVDLKVKNGKDEIIIIEVQYERELDYLQRMLYGTSRVITEHQQ
FT                   EGEPYSKLVKVISVNILYFDLGHGSDYIYHGTTTFVGIHDNDKLQLDIRQQKQYGKMQI
FT                   NHIYPEYYLIRLNNFNSIAKTSLDEWIYFLKNEEIKDEFQAKGIQKAKRSFSILSMSEA
FT                   EQAAYARYQDDLRYQASLVESNYGLGLREGREAGITEGIEKGIEQGLKKGIEQGIEQGI
FT                   EQGIERGIERGKLEVAKRLLDKGMSVEEAAEAAGISANMLKRYIVSPDV"
FT   gene            579782..580672
FT                   /locus_tag="Ppha_0598"
FT   CDS_pept        579782..580672
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0598"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cch:Cag_1091 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0598"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42905"
FT                   /db_xref="InterPro:IPR010106"
FT                   /db_xref="UniProtKB/TrEMBL:B4SDG6"
FT                   /protein_id="ACF42905.1"
FT                   /translation="MFLKDRYINPFTDFGFKKIFGSEVNKELLIAFLNTLLPPEAGTVA
FT                   DLSFLPNEQVGRSEYDRRAIFDLYCENEKGEKFIVEMQRAKQNYFKDRSVFYATFPIQQ
FT                   QAQSGDWNFCLKAVYMVGILDFVFDVDKADDAVVHHEVRLIDRSTGAVFYDKLTFIYLE
FT                   LPKFLKTIDELVTDFDKWCFLLRHLPELTDRPARLQEKVFLKVFELAEIAQYSSVEAAA
FT                   YEESLKVYRDLKNVVDTAFDEGIAEGIVKGKAEGIAEGIQQKALEDAKRFKDAGVDIET
FT                   IARCTGLPVTLVEGL"
FT   gene            580881..581840
FT                   /locus_tag="Ppha_0599"
FT   CDS_pept        580881..581840
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0599"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cch:Cag_1240 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0599"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42906"
FT                   /db_xref="InterPro:IPR010106"
FT                   /db_xref="InterPro:IPR025587"
FT                   /db_xref="UniProtKB/TrEMBL:B4SDG7"
FT                   /protein_id="ACF42906.1"
FT                   /translation="MNIRSPRKLITFDWAMKRLLRSKANFEILEGFLSELLGEDITILE
FT                   ILESESNKESKLDKFNRVDLKVKNGKDEIIIIEVQYERELDYLQRMLYGTSRVITEHQQ
FT                   EGEPYATLVKVISVNILYFNLGHGSDYIYHGTTTFVGIHDNDKLQLDIRQQKQYGKMQI
FT                   NHIYPEYYLIRLNNFNSIAKTSLDEWIYFLKNEEIKDEFQAKGIQKAKRSFSILSMSEA
FT                   EQAAYARYQDDLRYQASLVESNYGLGLREGREAGITEGRVEGRVEGQTRLLRKLLERRF
FT                   GVLPEWATKRLSCASEQELEAWAEAILTAQTLEAVFTP"
FT   gene            582027..582229
FT                   /pseudo
FT                   /locus_tag="Ppha_0600"
FT   gene            complement(582398..582724)
FT                   /locus_tag="Ppha_0601"
FT   CDS_pept        complement(582398..582724)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0601"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="PFAM: helix-turn-helix domain protein; KEGG:
FT                   cch:Cag_0084 transcriptional regulator, XRE family"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0601"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42907"
FT                   /db_xref="GOA:B4SDG8"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:B4SDG8"
FT                   /protein_id="ACF42907.1"
FT                   /translation="MDDLKYQPVPYNVEEEICKNLQDENFRREYEALEPKYALIRELLS
FT                   ARQLSGMTQEAVALKIGTTKSAISRLESGSKHSPSLTTLRKYAEAVNCELEIKLKPKQQ
FT                   PKTI"
FT   gene            complement(582717..584810)
FT                   /pseudo
FT                   /locus_tag="Ppha_0602"
FT   gene            complement(583088..584350)
FT                   /locus_tag="Ppha_0603"
FT   CDS_pept        complement(583088..584350)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0603"
FT                   /product="transposase IS4 family protein"
FT                   /note="PFAM: transposase IS4 family protein; KEGG:
FT                   cph:Cpha266_0352 transposase, IS4 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0603"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42908"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:B4SDG9"
FT                   /protein_id="ACF42908.1"
FT                   /translation="MLLLHETESQLGIISMLTKCISDSRRSSSITHSVNELNTLRVFQI
FT                   ACGYEDCNDSNSLRIDPAMKIALGRLPETGLDLASQPTFSRLENMITRRDLYRIADGIV
FT                   DHFLASYVEPPEVIVLDFDDTEDVVHGHQQLALFSGYYQETCYQPLHVYEGFSGKLITT
FT                   ILRPGKRPGSREIVSYVKRIVERIRQKWPDTILVYRGDSHYSAPEVFAFIDQQNDCYSV
FT                   TGLTRNALLLKHVETLIKHVKQQPAGFKRYHSFMYKAESWSKPRKVVAKVEMTDIGKLN
FT                   VRFISTDMPEAKAKALYEEIYCARGNDELCIKDHKTYTKSDRTSCHRFLANQFRLFLHS
FT                   AAYVLLHSFRSNMLKGTSMATATFESIRLKILKIGARVIERKTKISVQLPTAYPYQSIF
FT                   SKCLAIFEHLRRQPWPPPTIS"
FT   gene            584953..585196
FT                   /pseudo
FT                   /locus_tag="Ppha_0604"
FT   gene            585353..585643
FT                   /locus_tag="Ppha_0605"
FT   CDS_pept        585353..585643
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0605"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="SMART: helix-turn-helix domain protein; KEGG:
FT                   mmw:Mmwyl1_3898 helix-turn-helix domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0605"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42909"
FT                   /db_xref="GOA:B4SDH0"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:B4SDH0"
FT                   /protein_id="ACF42909.1"
FT                   /translation="MEEILFSELLKSLKEANDIAEGMSEASRRFEITLPDVQSVREQIG
FT                   LSQDEFASMMRVSVRTLQNWEKHRRNPTGSAAALLKIVVAAPDVALKSLHS"
FT   gene            585678..586085
FT                   /pseudo
FT                   /locus_tag="Ppha_0606"
FT   gene            586419..586634
FT                   /locus_tag="Ppha_0607"
FT   CDS_pept        586419..586634
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0607"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cph:Cpha266_2604 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0607"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42910"
FT                   /db_xref="UniProtKB/TrEMBL:B4SDH1"
FT                   /protein_id="ACF42910.1"
FT                   /translation="MLQSYEAFYDHGAMKWLGDKPPVKQAYVIVTILAEKEATVMPLQK
FT                   KHQPSPLIAGKGKILGDIISPVSPAE"
FT   gene            586649..587044
FT                   /locus_tag="Ppha_0608"
FT   CDS_pept        586649..587044
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0608"
FT                   /product="PilT protein domain protein"
FT                   /note="PFAM: PilT protein domain protein; KEGG:
FT                   cch:Cag_1292 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0608"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42911"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="InterPro:IPR041705"
FT                   /db_xref="UniProtKB/TrEMBL:B4SDH2"
FT                   /protein_id="ACF42911.1"
FT                   /translation="MIVLDTHIWVKWIIDGNPALSEKIVNAMRVDCHWTVSAISCFEVS
FT                   LLVKRGKLQLLLPVEDWIKEVLENSGIDSLPVTCDIMHKAAMLSEIHRDPADRIIIAAA
FT                   LVYDAKLASIDSVFPDYMELQGRLFGK"
FT   gene            587047..587214
FT                   /pseudo
FT                   /locus_tag="Ppha_0609"
FT   gene            587428..587940
FT                   /locus_tag="Ppha_0610"
FT   CDS_pept        587428..587940
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0610"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0610"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42912"
FT                   /db_xref="UniProtKB/TrEMBL:B4SDH3"
FT                   /protein_id="ACF42912.1"
FT                   /translation="MTAISQKRGIQPSEIKVTKMWFAKIKFLFAVFVLAFFISPQPAVA
FT                   VVDVITVSFSETLSPASYSGAIDPAVSDKLININNASGSSSISEMVGVTDSALVQWNSR
FT                   EILNSTGTDLLEGCLGTNTLSQNGNSLWFTGLTPKSMYTIYVYSQSSTNGYKTQIKYSS
FT                   NVAPGSS"
FT   sig_peptide     587428..587565
FT                   /locus_tag="Ppha_0610"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.996 at
FT                   residue 46"
FT   gene            complement(588301..588483)
FT                   /locus_tag="Ppha_0611"
FT   CDS_pept        complement(588301..588483)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0611"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0611"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42913"
FT                   /db_xref="UniProtKB/TrEMBL:B4SDH4"
FT                   /protein_id="ACF42913.1"
FT                   /translation="MIVGYAFHVRNLRSLISAGYNQHFHNNTLSGAKTEIMTAYRFDEV
FT                   HPRVYNRTKEYLLVY"
FT   gene            complement(588690..589520)
FT                   /locus_tag="Ppha_0612"
FT   CDS_pept        complement(588690..589520)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0612"
FT                   /product="legume lectin beta domain"
FT                   /note="PFAM: legume lectin beta domain; KEGG: dar:Daro_1504
FT                   legume lectin, beta domain:protein of unknown function
FT                   DUF1555"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0612"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42914"
FT                   /db_xref="GOA:B4SDH5"
FT                   /db_xref="InterPro:IPR001220"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="InterPro:IPR013424"
FT                   /db_xref="UniProtKB/TrEMBL:B4SDH5"
FT                   /protein_id="ACF42914.1"
FT                   /translation="MKKKLIAFSALLAWLFLSGSAEAGTVLTYNDFSSTSGYTRYGTAV
FT                   NSGNDLQLTSINVEKRAGSVFFHTPVDVTSFNSSFSFSFDGTSTNGADGLVFVIKNKES
FT                   SNLGGTGGLLGYDGINRSVGVEIDTHRNDPGVKYNDIDHNHIGIDINGNIRSESQASVS
FT                   QTFNSNGIWYTWLDYDGAILSVYLNQLNSKPGSATLTYGSSATPFVISREIGSSSGLVG
FT                   FTAATGAVTQTALLKSFNHNSPNPEPSTYVLMGVGALIAGIAARKKIVSRQVIE"
FT   sig_peptide     complement(589449..589520)
FT                   /locus_tag="Ppha_0612"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.994 at
FT                   residue 24"
FT   gene            complement(589667..590449)
FT                   /locus_tag="Ppha_0613"
FT   CDS_pept        complement(589667..590449)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0613"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: nar:Saro_0424 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0613"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42915"
FT                   /db_xref="InterPro:IPR013424"
FT                   /db_xref="UniProtKB/TrEMBL:B4SDH6"
FT                   /protein_id="ACF42915.1"
FT                   /translation="MTFIRWFRSVVRHKFISYLAGFAIVLAVHPCQGIAATEVITFYVS
FT                   DNNISDPSALFGALPSDGYSVSSSYRLSEGSTSTSFTDLYSSSSATFTVGGDSGLKEGY
FT                   RDAPELLKHDASTSKSGVGEAKISFDGLMANEQYSVVVYSQGQNDVRHTFITNLSIRVG
FT                   SGTYSSIGTLTTDHLTTYRANGNYLTYDFTTDETGKAYVAFYTNPGNTLNRAGINAVQL
FT                   VYGKSPTPEPSTYVLMGVGALIAGMVAWKKNLLIAKGK"
FT   sig_peptide     complement(590342..590449)
FT                   /locus_tag="Ppha_0613"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.984) with cleavage site probability 0.646 at
FT                   residue 36"
FT   gene            complement(590660..591166)
FT                   /locus_tag="Ppha_0614"
FT   CDS_pept        complement(590660..591166)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0614"
FT                   /product="transposase family protein"
FT                   /note="KEGG: cph:Cpha266_1384 transposase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0614"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42916"
FT                   /db_xref="InterPro:IPR038717"
FT                   /db_xref="UniProtKB/TrEMBL:B4SDH7"
FT                   /protein_id="ACF42916.1"
FT                   /translation="MFQDEARFGRISDPRKCWAPAPLRPIVKLALVREYVYAYAAVSPQ
FT                   DGVIDWMLGGKMDTVSMGAFLRQVSHKHPEEFVMMVVDGAPSHRAEHLRVPKNMVLVKL
FT                   PPYSPELNPVEHLWDELREKEFANRVFETLGAVIAQAARGLKKMEEHPDGLRSLTGWDW
FT                   ILKSI"
FT   gene            591471..592373
FT                   /locus_tag="Ppha_0615"
FT   CDS_pept        591471..592373
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0615"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cch:Cag_1091 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0615"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42917"
FT                   /db_xref="InterPro:IPR010106"
FT                   /db_xref="UniProtKB/TrEMBL:B4SDH8"
FT                   /protein_id="ACF42917.1"
FT                   /translation="MFIKDRYINPFTDFGFKKIFGSEVNKELLIAFLNTLLPPEAGTVA
FT                   DLSFLPNEQVGRSEYDRRAIFDLYCENEKGEKFIVEMQRAKQNYFKDRSVFYATFPIQQ
FT                   QAQSGDWNFCLKAVYMVGILDFVFDVDKADDAVVHHEVRLIDRSTGAVFYDKLTFIYLE
FT                   LPKFLKTIDELVTDFDKWCFLLRHLPELTDRPARLQEKVFLTVFELAEIAQYKSVEAGV
FT                   YKESHKVYRDLKNVVDTAFDEGIAEGIVKGKAEGIAEGIAEGIQQKALEDAKRFKDAGV
FT                   DIETIARCTGLPVTLVEGL"
FT   gene            592374..593528
FT                   /locus_tag="Ppha_0616"
FT   CDS_pept        592374..593528
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0616"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cch:Cag_1240 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0616"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42918"
FT                   /db_xref="GOA:B4SDH9"
FT                   /db_xref="InterPro:IPR010106"
FT                   /db_xref="UniProtKB/TrEMBL:B4SDH9"
FT                   /protein_id="ACF42918.1"
FT                   /translation="MVISEEGGETPPVLLGGRGTLLTGCICWAGCAVFGAWLGRCLAAG
FT                   FTDFGEEMLYYFRHYFFMFLKAASMSIRSPRKLITFDWAMKRLLRSKANFEILEGFLSE
FT                   LLGEDITILEILESESNKESKLDKFNRVDLKVKNGKDEIIIIEVQYERELDYLQRMLYG
FT                   TSRVITEHQQEGEPYATLVKVISVNILYFNLGHGSDYIYHGTTTFVGIHDNDKLQLDIR
FT                   QQKQYGKMQINHIYPEYYLIRLNNFNSIAKTSLDEWIYFLKNEEIKDEFQAKGIQKAKR
FT                   SFSLLSMSEAEQAAYARYQDDLRYQASLVESNYGLGLREGREAGITEGRVEGQTRLLRK
FT                   LLERRFGVLPEWATGRLICASEQELEAWAEAILTAQTLEAVFTP"
FT   gene            593560..593835
FT                   /locus_tag="Ppha_0617"
FT   CDS_pept        593560..593835
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0617"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cch:Cag_0661 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0617"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42919"
FT                   /db_xref="UniProtKB/TrEMBL:B4SDI0"
FT                   /protein_id="ACF42919.1"
FT                   /translation="MQVVKNKEGKIEETGSVVTPCRPIEVNSEHDFKALGLASFFDTQE
FT                   DNNVDWEEIFQAGSNVCPGLVPRVSPDQQDVSTLPADCGICYRKER"
FT   gene            593837..594001
FT                   /locus_tag="Ppha_0618"
FT   CDS_pept        593837..594001
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0618"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0618"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42920"
FT                   /db_xref="UniProtKB/TrEMBL:B4SDI1"
FT                   /protein_id="ACF42920.1"
FT                   /translation="MAVACVHVMELEERLRLAYEDFLKKEHLWITRIILLVPEHSYHGK
FT                   VFFHYHSIS"
FT   gene            594004..594195
FT                   /locus_tag="Ppha_0619"
FT   CDS_pept        594004..594195
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0619"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cch:Cag_0684 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0619"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42921"
FT                   /db_xref="InterPro:IPR013406"
FT                   /db_xref="UniProtKB/TrEMBL:B4SDI2"
FT                   /protein_id="ACF42921.1"
FT                   /translation="MDKLLINKAMKMPPIQRVALAELLLASIDYEEGDIREAWISEVHE
FT                   RMKAVNEGRSTLLDFDAL"
FT   gene            594389..595904
FT                   /pseudo
FT                   /locus_tag="Ppha_0620"
FT   gene            596142..596246
FT                   /pseudo
FT                   /locus_tag="Ppha_0621"
FT   gene            596537..596827
FT                   /locus_tag="Ppha_0622"
FT   CDS_pept        596537..596827
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0622"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0622"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42922"
FT                   /db_xref="UniProtKB/TrEMBL:B4SDI3"
FT                   /protein_id="ACF42922.1"
FT                   /translation="MMLQNYAAFYDHGVIELAGCRYSLKIALKEGLENSGIDSVLVTCN
FT                   ITIMKDGRKVLVWSAEVFKVGAGVLFNPSPLFRKWRIVLSGIGIGCGVNLI"
FT   gene            596939..598237
FT                   /locus_tag="Ppha_0623"
FT   CDS_pept        596939..598237
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0623"
FT                   /product="nucleotide sugar dehydrogenase"
FT                   /note="TIGRFAM: nucleotide sugar dehydrogenase; PFAM:
FT                   UDP-glucose/GDP-mannose dehydrogenase;
FT                   UDP-glucose/GDP-mannose dehydrogenase dimerisation;
FT                   UDP-glucose/GDP-mannose dehydrogenase; KEGG: cte:CT0227
FT                   UDP-glucose/GDP-mannose dehydrogenase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0623"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42923"
FT                   /db_xref="GOA:B4SDI4"
FT                   /db_xref="InterPro:IPR001732"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR014026"
FT                   /db_xref="InterPro:IPR014027"
FT                   /db_xref="InterPro:IPR017476"
FT                   /db_xref="InterPro:IPR028359"
FT                   /db_xref="InterPro:IPR036220"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B4SDI4"
FT                   /protein_id="ACF42923.1"
FT                   /translation="MNSIRIAVVGLGYVGLPLAVEFAKKYPVVGFDIKQERVGELGQGY
FT                   DATLEVTSEELKSVLCESNYNGEEGSPGLFVSSDSSDLGAVNYYIVTVPTPTDKNNRPD
FT                   LSPLLKASETIGRVLKMGDIVIYESTVYPGATEEDCVPVLERFSGLTFNRDFFAGYSPE
FT                   RINPGDKEHTVTKIKKVTSGSTPDIATKVDSLYRSIIVAGTHLASSIRVAEAAKVIENS
FT                   QRDINIAFVNELSVIFNRMGIDTHEVLAAAGTKWNFLPFKPGLVGGHCIGVDPYYLAQK
FT                   AQEYGYHPEIILAGRRLNDNMGKYIASQVIKLMIARDHKIKGAKILMLGITFKENCPDI
FT                   RNTRAVDIVNELKQYGAEVDIHDPWANPEEVMHEYGFECLHELNGNHYEAIILAVAHDA
FT                   FAALDIRSLSSGINAVIYDVKGVLPIDKVSGRL"
FT   gene            599107..599499
FT                   /locus_tag="Ppha_0624"
FT   CDS_pept        599107..599499
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0624"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cph:Cpha266_2183 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0624"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42924"
FT                   /db_xref="UniProtKB/TrEMBL:B4SDI5"
FT                   /protein_id="ACF42924.1"
FT                   /translation="MRYITSIERIGYDKGSIEGQAEGRVIGRLEGKRRFLCMQLECRFG
FT                   ALPAWALEMVSCASEEDLHSWDDAVLTAPTLEAVFHQKKFFREEPDWIETIISQSYEAC
FT                   YENGTLRWLGDKPSVKQASVIVTILS"
FT   gene            600029..600775
FT                   /locus_tag="Ppha_0625"
FT   CDS_pept        600029..600775
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0625"
FT                   /product="protein of unknown function DUF218"
FT                   /note="PFAM: protein of unknown function DUF218; KEGG:
FT                   cte:CT0624 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0625"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42925"
FT                   /db_xref="GOA:B4SDI6"
FT                   /db_xref="InterPro:IPR003848"
FT                   /db_xref="UniProtKB/TrEMBL:B4SDI6"
FT                   /protein_id="ACF42925.1"
FT                   /translation="MINKILPLLVLPSGFSLLCLLAGLLLRNSFFLWLGTLLLLAFSMP
FT                   VMSDFLMRSVEVGEGRVPVSSVGKADAIVVLSGMIVTVDGAPLGEWGGAVDRFDGGVEL
FT                   FKAGRAPVVVFTRGQVPWQPGVVPEGELLAKRALLLGVPQSAIRLTGKAGNTADEAAAA
FT                   SVLLGASKKGVPRRIILVTSAFHMRRARFLFERAGFAVEPFLVDYQTSEKSPLTVLSFL
FT                   PNAEALAQSDRALREVIGLLFYWVTK"
FT   sig_peptide     600029..600175
FT                   /locus_tag="Ppha_0625"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.964) with cleavage site probability 0.257 at
FT                   residue 49"
FT   gene            601035..601625
FT                   /locus_tag="Ppha_0626"
FT   CDS_pept        601035..601625
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0626"
FT                   /product="NusG antitermination factor"
FT                   /note="PFAM: KOW domain protein; NGN domain protein; KEGG:
FT                   cch:Cag_0149 NusG antitermination factor"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0626"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42926"
FT                   /db_xref="GOA:B4SDI7"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR006645"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR036735"
FT                   /db_xref="UniProtKB/TrEMBL:B4SDI7"
FT                   /protein_id="ACF42926.1"
FT                   /translation="MDDVRNLLWYAVYVRSRYEKKVYQLLLEQGVVSFLPLLDTWKQWS
FT                   DRKKRVSEPLFRGYVFVNIDLVREKIRVLDTEGVVKFIGIGRVPSVIVQRDIDWLKQLV
FT                   REPDAIHRHVVSLPAGQRVKVLAGPFKDFEGVVVKQGRESRLVVFFESIMQGVEVTIFP
FT                   DVLAPIAVAPSPVQGVAPLSGKLASVEKHLLRL"
FT   gene            601745..602998
FT                   /locus_tag="Ppha_0627"
FT   CDS_pept        601745..602998
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0627"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: General substrate transporter; major
FT                   facilitator superfamily MFS_1; KEGG: cph:Cpha266_0514 major
FT                   facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0627"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42927"
FT                   /db_xref="GOA:B4SDI8"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B4SDI8"
FT                   /protein_id="ACF42927.1"
FT                   /translation="MEGFVQKGEHASIRDVFSLPVIVAALGYFVDIYDLVLFSIVRVPS
FT                   LKSFGLSGKELIDYGVYLLNMQMIGMLVGGILWGWLGDRKGRLKIMFASILLYSLANIA
FT                   NGFVSSLPAYAVLRFVAGVGLAGELGAGITLVSEVLHTRIRGYGTMLVASIGVSGAILA
FT                   NIVANTYEWHNAFFIGGGLGLLLLVARVRVAESGMFKAMEAKSGMSRGNMLALFTDRGR
FT                   FFRYINSIMIGVPIWFVVGVLITFSPEFGVELGISGPVSAGNAVMYCYLGLVFGDLSSG
FT                   LLSQLLQSRKKVILLFMLLTVGAVALYFLQGHQSPQFFYVVCAVLGFAGGYWAIFVTVA
FT                   AEQFGTNLRATVATTVPNLVRGMVVPITMLFQFFRGLFGLESGALLVGAICVTAAFLSL
FT                   SALEETFHKDLDYYEEFL"
FT   gene            complement(603068..605908)
FT                   /locus_tag="Ppha_0628"
FT   CDS_pept        complement(603068..605908)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0628"
FT                   /product="excinuclease ABC, A subunit"
FT                   /note="TIGRFAM: excinuclease ABC, A subunit; PFAM: ABC
FT                   transporter related; KEGG: plt:Plut_1662 excinuclease ABC,
FT                   A subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0628"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42928"
FT                   /db_xref="GOA:B4SDI9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR004602"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041102"
FT                   /db_xref="InterPro:IPR041552"
FT                   /db_xref="UniProtKB/TrEMBL:B4SDI9"
FT                   /protein_id="ACF42928.1"
FT                   /translation="MEFSHINIRGARVHNLKNISLDIPRNKFVVITGLSGSGKSSLAFD
FT                   TIYAEGQRRFMETLSPYARQYIGSIERPDVDYIEGLSPVISIDQKSTNRSPRSTVGTIT
FT                   EIHDFIRLLYAKAGRRYDPVTGAMLQQQSEESIGEAILALPQGTKIQILSPLVTGRKGH
FT                   YRELFERLLLKGFLRVRIDGKYREMEKEMQIERYKSHSIELVVDRLVISPDCEDRLRDA
FT                   ISMAITMSEHRSTVICDPMESQLKELTFSTRYAYSDGSVPVDTLAPNHFSFNSPYGACP
FT                   ECNGLGELMQLSGELMTPDLTLSLNDGGLDPFGKSGKRNLWQVIRAIAREFNFTLDTPL
FT                   TDIPQEAMKILLEGSGTRTFDVSYSYSGHDTLYPQPFPGALPYVEEILKNASSSKIREW
FT                   AENYMLRKPCPSCKGARLRKESLLVKINEINIAQAESLTLPESLAFFKALPGNLSTKEQ
FT                   LVATPILHEIVKRLEFLLNVGLSYLSIDRSSQTLSGGEAQRIRLASQLGSQLSGVLYVL
FT                   DEPSIGLHQRDNHKLITSLKRLRDLGNTVLVVEHDKETMLEADEIIDLGPGAGEYGGEI
FT                   VAQGAAATLDPNSLTAGYLNGERQVYCKKEEKTDPEEQQFLRLKGCRGNNLKNIDITIP
FT                   LRSLVSITGVSGSGKSTIINETLYPILARHFYRSKLHTYPYDSIEGIKQLDKVVNVDQS
FT                   PIGRTPRSNPATYTGAFTFIRDFFTRMPEAQIRGYKAGRFSFNVKGGRCEVCQGAGTRK
FT                   IEMNFLPDVYVQCENCKGERYNRETLLVKYRGKSIADVLEMTITEAAEFFTDFPRILRI
FT                   LTTMQSVGLGYLKLGQPSPMLSGGEAQRIKLSAELAKIQTGNTLYILDEPTTGLHFQDI
FT                   QHLLEVLRKLVDKGNSVIIIEHNLDIIKNSDWIIDIGPEGGNEGGNIIAEGTPEQIAQT
FT                   EHSYTGQFLKAEMGIV"
FT   gene            complement(606154..608904)
FT                   /locus_tag="Ppha_0629"
FT   CDS_pept        complement(606154..608904)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0629"
FT                   /product="pyruvate, phosphate dikinase"
FT                   /EC_number="2.7.9.1"
FT                   /note="KEGG: cph:Cpha266_0518 pyruvate phosphate dikinase;
FT                   TIGRFAM: pyruvate, phosphate dikinase; PFAM: PEP-utilizing
FT                   protein; pyruvate phosphate dikinase PEP/pyruvate-binding;
FT                   PEP-utilising protein mobile region"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0629"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42929"
FT                   /db_xref="GOA:B4SDJ0"
FT                   /db_xref="InterPro:IPR000121"
FT                   /db_xref="InterPro:IPR002192"
FT                   /db_xref="InterPro:IPR008279"
FT                   /db_xref="InterPro:IPR010121"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018274"
FT                   /db_xref="InterPro:IPR036637"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:B4SDJ0"
FT                   /protein_id="ACF42929.1"
FT                   /translation="MPQSEITNEKAGSKQYIYSFSGGSSEGDASMKNLLGGKGANLAEM
FT                   ANIGLPVPPGFTISTEVCTYYYENQKNYPKNLFEQGIPDALRKIEETLGKKFGDPENPL
FT                   LVSVRSGARASMPGMMDTILNLGLNAQTVDGLAKKSGNPRFAWDCYRRFVQMYGDVVLD
FT                   LKPTDKKQIDPFEKILEAKKHELGIELDTEFTVEDLQSIVADYKTAILEKTGKTFPEDP
FT                   HEQLIGAIGAVFNSWNNERAIVYRKLNHIPGYWGTACNVQAMVFGNMGLDCGTGVAFTR
FT                   DAATGDNIFYGEFLMNAQGEDVVAGTRTPLKIEQLKAENPGIYDQLEEIRSILEHHYHD
FT                   MMDIEFTIENNILFMLQCRVGKRTGMAAVKIAVDMFNEKLIDEKEALLRIEPEQLNQLL
FT                   RPVFDMKEKQAAIQEGRLLATGLNAGPGAATGKIYFNAVDAYEAGKRGEAVILVRIETS
FT                   PEDIKGMDASEGILTERGGMTSHAALVARQMGKVCVAGCGALSIDYQRGELRVQGNDIV
FT                   LHEGDYISIDGSTGEVIAGKVATKNSEIIEVLVDKSLKPEDAPTWPIYQQLMEWADKYR
FT                   KLNIRTNADQPDQAEIAITFGAEGIGLCRTEHMFFGGERIDAMREMILADDVDGRKIAL
FT                   EKLLPYQRDDFYGLFKAMGSRPVTIRLLDPPLHEFLPHTDDEIRALSIKIGRSFEEIKE
FT                   RIGDLHEFNPMLGLRGCRLGILHPEITVMQVRAIIEAACKLKKEGLEVVPEIMVPLVST
FT                   VKELEITSEVIHKTARSVIAEQGTGVKYLVGTMIEVPRAAITSDQIATAADFFSYGTND
FT                   LTQMGLGMSRDDSGQFLPIYQQHEIFARNPFESIDKDGVGRLMSISAKEGRAVKPELKL
FT                   GICGEHGGDPSTVEFCHQLGLNYVSCSPYRVPIARLAAARAALKG"
FT   gene            609055..609936
FT                   /locus_tag="Ppha_0630"
FT   CDS_pept        609055..609936
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0630"
FT                   /product="inner-membrane translocator"
FT                   /note="PFAM: inner-membrane translocator; KEGG:
FT                   pvi:Cvib_1448 inner-membrane translocator"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0630"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42930"
FT                   /db_xref="GOA:B4SDJ1"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:B4SDJ1"
FT                   /protein_id="ACF42930.1"
FT                   /translation="MEIDPLVIFLQILRLAVPYVLTSVGATFSERGGVVNLALEGMMLV
FT                   GAFGAAFGQYRSGSALAGILLALVCGLCVALLFAFVTVTLKADQIVAGIAINILVMGAT
FT                   RFGLSLLFGSSMNSERIAGIAVPSLLLDPLFLAAVLSVVAGYLVLFRTPYGLRLRATGE
FT                   SAETADSAGINVDRMRYSGVLVSGALAALGGAFLVFQQHTFTDNMSAGRGYIALAAMII
FT                   GKWNPAGAALASLFFATTESMEIWLQTGWIPSQLVQSLPYVITLVVLAGFVGRASAPRD
FT                   AGTAFEKNRKSD"
FT   gene            complement(609928..610282)
FT                   /pseudo
FT                   /locus_tag="Ppha_0631"
FT   gene            610441..632142
FT                   /locus_tag="Ppha_0632"
FT   CDS_pept        610441..632142
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0632"
FT                   /product="outer membrane adhesin like protein"
FT                   /note="TIGRFAM: outer membrane adhesin like protein; KEGG:
FT                   cph:Cpha266_1846 putative outer membrane adhesin like
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0632"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42931"
FT                   /db_xref="InterPro:IPR019959"
FT                   /db_xref="UniProtKB/TrEMBL:B4SDJ2"
FT                   /protein_id="ACF42931.1"
FT                   /translation="MSIDNTISLATVSEIIGKVWAELEDGTSRLLQAGDMVYEGEVIHT
FT                   ETGSLVVLRTTNGAVLRVTEGKEVVLGAGLFAPADKDIAGLVAEAGSDAPPVGLETSDS
FT                   PEPPVVIENNPQSGNRLHGFVRVERAVESVNTPPYLLWAYTGKYNASTSRRSAGYSPLL
FT                   EGRGTFDERLVIPVEPVTFAAVEPMVPLAPISMTYSSLPFDDVPKNNTAEVTASVQEDA
FT                   LLEGNRDTPEDTMVATGSVAPLIDTGADVPVTFSLQTTGLDAFGWTSNGVPLSFTVSGN
FT                   TLTASVPSGPVFTLVLDPSTGAFTFTLSAPFDQPPGSGEEGTITLDLSSAIVVTDRDGD
FT                   AITVDNGFTIIVENDVPIGVGGIAGSVDEDELPFGIPDGDGVTTVATGNISSLFSAGAD
FT                   QPLTYGLLTNTGGLPQGLTSAGDPVTYVVTGNTLTATAGGGTVFTLVLDPATGDYTFTL
FT                   SDRLDHPLTNGDDNEILPLDLTSILQATDSDGDHSASAGTFTINVEDDVPVGSGLVTGN
FT                   VDEDELPLGITDSDAFNTVATGNISGLFSAGADQPGRYGLSSETGGLRQDLTSAGVAVT
FT                   YSVKNNILTASSGSIPVFTLELDSVTGVYTFTLLAQLDHPLANGDDNEILPLNLTSILE
FT                   VTDSDGDPLITTGTFIINVEDDVPVGSGTIVGNVDEDELPDGITDGDTVTTVARGNVAA
FT                   LFRIGADQRGNFGLSGNTSGLPVLYSSGMSVVYTFTDNTLTATAGGNPVFTLVVDSVTG
FT                   DYTFTLIDHIDHPRADGDDTEILQLNLTGILQVTDEDGDPLMTAGTFTINIEDDVPIGT
FT                   GAIVGEVQEDALLDGNRETASQTVVAQGNLAALFQIGADNPGTYGLTGDTSGLPELRSV
FT                   GIRVDYAVTVNTLTATAGGNPVFTLVIDPATGDYTFTLLDQLDHPRGDGDDSETLSLDL
FT                   TGLLRVTDSDGDTLNTSGTFTISIEDDVPVGVGILQRTVHEDALNGGNRETPSQVISVN
FT                   GSIAGLVSIGADQPGTYLFTLSADTSHLPILKSAGLPVLYDVTPDGNILTAYVDSDGIA
FT                   GYNSQTDRPVFKLVVDTSTGNYVFTLLDQLDHPLNNGNDSETLSIDFSSILRVSDQDGD
FT                   PLATFGAFTINVEDDIPVQTTATVVGSVQEDALSGGNLDNTAADTTIATGNISGLVSVG
FT                   ADASATYSVQASGLPTLTSNGNTVTYSAVDTNSDTITDKLVASASGSTVFTLELNQTSG
FT                   AYTFTLLDQLDHPVSNSDDTEIMTLDLSGGLVATDKDGDAITINSGSLLIEVEDDIPVQ
FT                   TTATVVGSVQEDALSGGNLDNTAADTTIATGNISGLVSVGADASATYSVQASGLPTLTS
FT                   NGNTVTYSAVDTNSDTITDKLVASASGSTVFTLELNQTSGAYTFTLLDQLDHPVSNSDD
FT                   TEIMTLDLSGGLVATDKDGDAITINSGSLLIEVEDDIPVQTTATVVGSVQEDALSGGNL
FT                   DNTAADTTIATGNISGLVSVGADASATYSVQASGLPTLTSNGNTVTYSAVDTNSDTITD
FT                   KLVASASGSTVFTLELNQTSGAYTFTLLDQLDHPVSNSDDTEIMTLDLSGGLVATDKDG
FT                   DAITINSGSLLIEVEDDIPVQTTATVVGSVQEDALSGGNLDNTAADTTIATGNISGLVS
FT                   VGADASATYSVQASGLPTLTSNGNTVTYSAVDTNSDTITDKLVASASGSTVFTLELNQT
FT                   SGAYTFTLLDQLDHPVSNSDDTEIMTLDLSGGLVATDKDGDAITINSGSLLIEVEDDIP
FT                   VQTTATVVGSVQEDALSGGNLDNTAADTTIATGNISGLVSVGADASATYSVQASGLPTL
FT                   TSNGNTVTYSAVDTNSDTITDKLVASASGSTVFTLELNQTSGAYTFTLLDQLDHPVSNS
FT                   DDTEIMTLDLSGGLVATDKDGDAITINSGSLLIEVEDDIPVQTTATVVGSVQEDALSGG
FT                   NLDNTAADTTIATGNISGLVSVGADASATYSVQASGLPTLTSNGNTVTYSAVDTNSDTI
FT                   TDKLVASASGSTVFTLELNQTSGAYTFTLLDQLDHPVSNSDDTEIMTLDLSGGLVATDK
FT                   DGDAITINSGSLLIEVEDDIPVQTTATVVGSVQEDALSGGNLDNTAADTTIATGNISGL
FT                   VSVGADASATYSVQASGLPTLTSNGNTVTYSAVDTNSDTITDKLVASASGSTVFTLELN
FT                   QTSGAYTFTLLDQLDHPVSNSDDTEIMTLDLSGGLVATDKDGDAITINSGSLLIEVEDD
FT                   IPVQTTATVVGSVQEDALSGGNLDNTAADTTIATGNISGLVSVGADASATYSVQASGLP
FT                   TLTSNGNTVTYSAVDTNSDTITDKLVASASGSTVFTLELNQTSGAYTFTLLDQLDHPVS
FT                   NSDDTEIMTLDLSGGLVATDKDGDAITINSGSLLIEVEDDIPVQTTATVVGSVQEDALS
FT                   GGNLDNTAADTTIATGNISGLVSVGADASATYSVQASGLPTLTSNGNTVTYSAVDTNSD
FT                   TITDKLVASASGSTVFTLELNQTSGAYTFTLLDQLDHPVSNSDDTEIMTLDLSGGLVAT
FT                   DKDGDAITINSGSLLIEVEDDIPVQTTATVVGSVQEDALSGGNLDNTAADTTIATGNIS
FT                   GLVSVGADASATYSVQASGLPTLTSNGNTVTYSAVDTNSDTITDKLVASASGSTVFTLE
FT                   LNQTSGAYTFTLLDQLDHPVSNSDDTEIMTLDLSGGLVATDKDGDAITINSGSLLIEVE
FT                   DDIPVQTTATVVGSVQEDALSGGNLDNTAADTTIATGNISGLVSVGADASATYSVQASG
FT                   LPTLTSNGNTVTYSAVDTNSDTITDKLVASASGSTVFTLELNQTSGAYTFTLLDQLDHP
FT                   VSNSDDTEIMTLDLSGGLVATDKDGDAITINSGSLLIEVEDDIPVQTTATVVGSVQEDA
FT                   LSGGNLDNTAADTTIATGNISGLVSVGADASATYSVQASGLPTLTSNGNTVTYSAVDTN
FT                   SDTITDKLVASASGSTVFTLELNQTSGAYTFTLLDQLDHPVSNSDDTEIMTLDLSGGLV
FT                   ATDKDGDAITINSGSLLIEVEDDIPVQTTATVVGSVQEDALSGGNLDNTAADTTIATGN
FT                   ISGLVSVGADASATYSVQASGLPTLTSNGNTVTYSAVDTNSDTITDKLVASASGSTVFT
FT                   LELNQTSGAYTFTLLDQLDHPVSNSDDTEIMTLDLSGGLVATDKDGDAITINSGSLLIE
FT                   VEDDIPVQTTATVVGSVQEDALSGGNLDNTAADTTIATGNISGLVSVGADASATYSVQA
FT                   SGLPTLTSNGNTVTYSAVDTNSDTITDKLVASASGSTVFTLELNQTSGAYTFTLLDQLD
FT                   HPVSNSDDTEIMTLDLSGGLVATDKDGDAITINSGSLLIEVEDDIPVQTTATVVGSVQE
FT                   DALSGGNLDNTAADTTIATGNISGLVSVGADASATYSVQASGLPTLTSNGNTVTYSAVD
FT                   TNSDTITDKLVASASGSTVFTLELNQTSGAYTFTLLDQLDHPVSNSDDTEIMTLDLSGG
FT                   LVATDKDGDAITINSGSLLIEVEDDIPVQTTATVVGSVQEDALSGGNLDNTAADTTIAT
FT                   GNISGLVSVGADASATYSVQASGLPTLTSNGNTVTYSAVDTNSDTITDKLVASASGSTV
FT                   FTLELNQTSGAYTFTLLDQLDHPVSNSDDTEIMTLDLSGGLVATDKDGDAITINSGSLL
FT                   IEVEDDIPVQTTATVVGSVQEDALSGGNLDNTAADTTIATGNISGLVSVGADASATYSV
FT                   QASGLPTLTSNGNTVTYSAVDTNSDTITDKLVASASGSTVFTLELNQTSGAYTFTLLDQ
FT                   LDHPVSNSDDTEIMTLDLSGGLVATDKDGDAITINSGSLLIEVEDDIPVQTTATVVGSV
FT                   QEDALSGGNLDNTAADTTIATGNISGLVSVGADASATYSVQASGLPTLTSNGNTVTYSA
FT                   VDTNSDTITDKLVASASGSTVFTLELNQTSGAYTFTLLDQLDHPVSNSDDTEIMTLDLS
FT                   GGLVATDKDGDAITINSGSLLIEVEDDIPVQTTATVVGSVQEDALSGGNLDNTAADTTI
FT                   ATGNISGLVSVGADASATYSVQASGLPTLTSNGNTVTYSAVDTNSDTITDKLVASASGS
FT                   TVFTLELNQTSGAYTFTLLDQLDHPVSNSDDTEIMTLDLSGGLVATDKDGDAITINSGS
FT                   LLIEVEDDIPVQTTATVVGSVQEDALSGGNLDNTAADTTIATGNISGLVSVGADASATY
FT                   SVQASGLPTLTSNGNTVTYSAVDTNSDTITDKLVASASGSTVFTLELNQTSGAYTFTLL
FT                   DQLDHPVSNSDDTEIMTLDLSGGLVATDKDGDAITINSGSLLIEVEDDIPVQTTATVVG
FT                   SVQEDALSGGNLDNTAADTTIATGNISGLVSVGADASATYSVQASGLPTLTSNGNTVTY
FT                   SAVDTNSDTITDKLVASASGSTVFTLELNQTSGAYTFTLLDQLDHPVSNSDDTEIMTLD
FT                   LSGGLVATDKDGDAITINSGSLLIEVEDDIPVQTTATVVGSVQEDALSGGNLDNTAADT
FT                   TIATGNISGLVSVGADASATYSVQASGLPTLTSNGNTVTYSAVDTNSDTITDKLVASAS
FT                   GSTVFTLELNQTSGAYTFTLLDQLDHPVSNSDDTEIMTLDLSGGLVATDKDGDAITINS
FT                   GSLLIEVEDDIPVQTTATVVGSVQEDALSGGNLDNTAADTTIATGNISGLVSVGADASA
FT                   TYSVQASGLPTLTSNGNTVTYSAVDTNSDTITDKLVASASGSTVFTLELNQTSGAYTFT
FT                   LLDQLDHPVSNSDDTEIMTLDLSGGLVATDKDGDAITINSGSLLIEVEDDIPVQTTATV
FT                   VGSVQEDALSGGNLDNTAADTTIATGNISGLVSVGADASATYSVQASGLPTLTSNGNTV
FT                   TYSAVDTNSDTITDKLVASASGSTVFTLELNQTSGAYTFTLLDQLDHPVSNSDDTEIMT
FT                   LDLSGGLVATDKDGDQITINASSLLITVEDDIPIARNDSTLYIKEGSEMATSVGNLAWN
FT                   LLTSTNPSGGATSWRDYSGADESITITRVDYVDSLGASQFKILSGGTTGELDTKYGKLT
FT                   VFSDGEWQYTPDPWVNHSTEPVSETITYTITDRDGDTATATKTLVVEDTATTISDPLDN
FT                   SVYERNLSTGSDPNPVLLVKTGTLGVNKQADPINVVFNGAPPPTGITSNKKTIFYHESP
FT                   DGHTLTATDLEADGGNVIFTIEIKNYDSKDASYEFTLYRAVDHLYEDQNTGATISHDPI
FT                   EFPIRYKVLEPYDNDTVLNFPSGVNGGGLAEFTVTIYDDTALVEPLLTFQEDEPDPGER
FT                   TMTVNADARSTNLSITGTPAAHGTVQVNDGTISGLPDGTITYTPFPNTNYSGTDTFEYT
FT                   LEIENTSTTEIRTVTVTVIPVSDAPGVTALDYTLSTLEDTQIDLRLYAPTVGDKTDQNG
FT                   IGTAGDDPERLGAITLSGIPVGAKIFKADGTTLVFEATTGHTSFTVMLVSGGTTPVTGT
FT                   DSKSLFLAETTANSYLTVLEYEGLKLLPPPNSGNNFSPAITVSVTEYEVDAAGYQKEVS
FT                   GVAVPGVTTTATIAVEVLAVTDIPPAPGLLIDGFDTPYTANFEEDTVFDLGALLSTTSF
FT                   DDTTDGSEHREIVLSGLLKDTIVTSNALPGPVTIGATGTVTIPLINSTVPAGIQNVLPG
FT                   ITITPPPNFSGEMNGITVTLQALDTDPNLPAASPVPVSWTDSVTLNLLVLPVADDIAAP
FT                   DVSTSEDQSVRFLKDLRVTDISSGLTTGGTEIITAITVSDLALGWVIKNPSGTVVFTGD
FT                   GTADFSIPVGDYTNYTVTPPPHSSADTTVKVLVTTTDTATIQGIDITDNSKIDQLHNIK
FT                   VTVTPVAEAVAGSAVHNGTSVTVTAAEADSDVSGTADLAINPHHTYTTHGTEGQFVSLT
FT                   EAGSSPFAIGSFWHNEDADGSERTYALFTPTYLVGGVLTDMIEAEFQYTDGSGVHTEIF
FT                   KGTPIAVEMPYLHTVSFKAKPGYSGAVTIDVQAKTVDHGPDDTTTDVFNVSGLAHLDFI
FT                   VDPVPNQVTLAVTSPVPIDEDLLRTLSIRPTSTDTDGSESFTITITGIPNGSEMIYDGS
FT                   TIYAITDTSGTVTINHFDSSKTFTIQPPHNSNEDITLHVTGHTVEVLDPTNPGTICQPL
FT                   DIIVDVRGVADPVDVVTTVAGFSEQRLDSLPPSDLISMSSLISVTRQDTDGSETLSFYF
FT                   TGLANGFDISGVNVSFLGGTGTERRWLLTPGDFAGTTMTVPKNFSGTVTFQGVPVTSEN
FT                   DGNSWTGDTWDPVGLRWTNNTSTGDPIPLSLTVSPSPEATIVDHTVFNEDQWILTDPLN
FT                   PVMGAYARVNFDLLPQPLVDTNEVLTSVWIKAADVDGRVFTLSYDADDAGAGSPIVLGA
FT                   VGGILADDGYYKLTAEQSKHIYVQNTHDLHGSYTFEVQYAITDPTSDGTTVRIINPATG
FT                   GWTGVTANSVTTQSTIAAYTLTVNAVTDPITDPLGTISAADETSSHTVISGDVVTVYGS
FT                   TVLTVPVVVTQSNYLAENPDGQDLDGSEMLERFIIDGVPDGITVVGATYVGDTGTTPNT
FT                   GRWILDVNPDLPFTSTIPRNIAFDFDGVASQFIGWSKTITITAESRDTGSGIRSASVSF
FT                   TIDNSLVVSFDDSGRATNIPAAITPWGLNTVSMTEDTASMLADLATVAISSITDSSPFS
FT                   ITLKNVQAGTIVTGMERMVLPGDEVIYTASGSGGDATLQTLLHNITLTPPPDSNENNHN
FT                   DLFVFDLALTTYAPGGQQNTEKFHGQIEVLPDSDPTTSVITPRAGSEYEDDTTRPSKVD
FT                   SGAGVLFTVAFENAADGSSNQLLGNVMLVIDERSMDSYLGGLVLTDDGTGKVLTLESSG
FT                   GGFANYSISGVLASDVLTLTYFPVPNASGSIEITASVNSRETGSVQISGTPGSLTIDVI
FT                   PVIDGYNPTSIVATGPEDTRIQLAITGGGLIDLDGSESVQSILLKKLHNCCLVYIGDDA
FT                   ASAVLALNAGSDASGHNTWSIGKLSTITGKIELPNYVAIVPPNNLSGTVEGLELVVITT
FT                   ETHLPGELLEQTFLFDTVVTPVSDGLTTISPTHSFGPEGQMVPINLNVSMADFDGSETA
FT                   TVTLRGFRQYASFYGASGTELTLAQFNPATDYNSGTDTYTLHGLTVEDTNALSVIQSAT
FT                   NGTSTVYVAAYTVDGAAPQSVTTPEKSFTLNISPIVPTTSNDTLLYDGVADLANTRSFD
FT                   GLAGTDTLVLRKGEDIDFADSPVDRSIFNIEYIDLTVNGNHSLSNITSAGVAAMTDPST
FT                   HDLYILGDGGDHVAFTGADWSTATRIGDYNVYTSSTDPTVKVSVYKDIL"
FT   gene            632142..633596
FT                   /locus_tag="Ppha_0633"
FT   CDS_pept        632142..633596
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0633"
FT                   /product="type I secretion outer membrane protein, TolC
FT                   family"
FT                   /note="TIGRFAM: type I secretion outer membrane protein,
FT                   TolC family; PFAM: outer membrane efflux protein; KEGG:
FT                   cph:Cpha266_1845 type I secretion outer membrane protein,
FT                   TolC family"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0633"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42932"
FT                   /db_xref="GOA:B4SDJ3"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="InterPro:IPR010130"
FT                   /db_xref="UniProtKB/TrEMBL:B4SDJ3"
FT                   /protein_id="ACF42932.1"
FT                   /translation="MDNLKTSISKVMKQTTNKNLKTLAVAVLLLCLGSPQTVEAKAVTA
FT                   SEAVTAALNTNPEVQAKFHAFRDVYEEQGVANGGYMPKLDFSAGVGRHWLKSESNGDEN
FT                   YWRKGLRLELSQMLFDGFYTRNQVHRLKHSGQARYLEFMDSMENIGLESFRAYMDVLRY
FT                   REMVNLSRRNYEYHQEIYKQISSRVRAGVAAGVDMEQITARLSLAQSNLVTELSNQHDV
FT                   SARYQRYIGELPEENLAPAVLPDKGIPATKVATLKEAYQYNFGFLATLSDIRAAQYAVN
FT                   VQKAKYYPRIDFKARHDRSWNLDGVDGRRDESVAELVLNYNIINGGADQAALHQYREKM
FT                   YRSVDLKDKAARDLRQTIEIAYNEREMIKEQLQYFDRHYKSMEKVREAYHEQFNIGKRT
FT                   LLDLLDTENEYYQARRAFYNGFFDLTIANARTLAGLGRLLTTMGVVRGEMPSLKDINIP
FT                   MPEVKDEDLPPFDVPVRGKLDLPEVK"
FT   sig_peptide     632142..632264
FT                   /locus_tag="Ppha_0633"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.974 at
FT                   residue 41"
FT   gene            633655..634368
FT                   /locus_tag="Ppha_0634"
FT   CDS_pept        633655..634368
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0634"
FT                   /product="PpiC-type peptidyl-prolyl cis-trans isomerase"
FT                   /note="PFAM: PpiC-type peptidyl-prolyl cis-trans isomerase;
FT                   KEGG: cph:Cpha266_1844 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0634"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42933"
FT                   /db_xref="GOA:B4SDJ4"
FT                   /db_xref="InterPro:IPR000297"
FT                   /db_xref="UniProtKB/TrEMBL:B4SDJ4"
FT                   /protein_id="ACF42933.1"
FT                   /translation="MSVAVTVGKRELVVDDVVSLLAGHNLWPQLMEGVVVDRVLRTLGC
FT                   SEEEIGVYYTTELAADAVFLEKKRAQLLLDGAKEEDVDFFISRPVLLELFKRRRFEPLV
FT                   GSAFLKLKAGMDKVLFSLLRNKDHELTRELFFRLESGEESFASLAARYAEGREALSGGR
FT                   LGPIEMQQLNPALAAVLSTARPGVVNPPVVIDGLGVITLLHEKIPAKFDEPMKQHLLNH
FT                   LFREWVKAEVLAFFY"
FT   gene            634425..637475
FT                   /locus_tag="Ppha_0635"
FT   CDS_pept        634425..637475
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0635"
FT                   /product="cyclic nucleotide-regulated ABC
FT                   bacteriocin/lantibiotic exporter"
FT                   /note="PFAM: cyclic nucleotide-binding; ABC transporter
FT                   transmembrane region; ABC transporter related; SMART: AAA
FT                   ATPase; KEGG: cph:Cpha266_1843 cyclic nucleotide-regulated
FT                   ABC bacteriocin/lantibiotic exporters"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0635"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42934"
FT                   /db_xref="GOA:B4SDJ5"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005074"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:B4SDJ5"
FT                   /protein_id="ACF42934.1"
FT                   /translation="MSHTIADSDADICKVIGGIPLFSGLAEGKIRMLAGVCSVERYTIG
FT                   KPVISAGMPPDSLYVIISGRVRSLYKEGSNGVVQTLRLLGAGELFGWVALMRRQPTEIV
FT                   TASEETLCLKIPLSSLSMVINELPLLYDLLFSKTDPSEICALLETLFSKDPRVEARIGE
FT                   SGFSGIRDLSLHLYPSAVVVDTGFSRVIPQKKLQWFVSRSDDPAYPPGSEYRPSSGELA
FT                   GSFSLRLVGLDLSCLKESAVEVKPIVAEPLRGEPLAGIASSERPQGEPVREQPREEFSC
FT                   QTEEEQVSGRSKGFYFCKGRGVVEETTACFQMFGKHMNVPVKKDLIQSIIGNQYARNGQ
FT                   ISLQDCGGVGVVLGLKAQVVSFSEEAMLRLKVPALIGWEKSFAVLYKVTAKEVTLAVPS
FT                   ASGIKVLAVKEFWEKWDRRGEALVLDAREDTPEKKFGFDWFAPSIKKYRNVLGEVMIAS
FT                   FFTQIMTLVNPLLFMVIIDQVIVKNSYSTLHVLGTFMLIIAILQAVLNSLRTYLFVDTT
FT                   NRIDVALGAEVIDHLLRLPLRFFEKRPVGELSSRIGELEHIRQFLTGTALGVVLDAVFS
FT                   FVYVVVLFAFSWKLAVMALSVVPVIGLITFLLSPVIRKQLREKAVKHSLTNAYLIEVLS
FT                   GIQTVKSQNIELRARWNWQEKYASYVKEGFKPVVSGTIANSANSFLSQASGLIVIWAGA
FT                   ALVLNNELTLGQLIAFRIIAGYITSPVMRLAQLWQNFQETGMSLERLADIVDTPQEGGK
FT                   DQLAQIPLPLVKGEIFCENVSFRFRDNSPMVLKNVTVTIPEAAFVGIVGESGSGKSTFA
FT                   KLIQRLYRLEEGRIFIDHYDIAKVELNSLRSQIGIVPQDPMLFNVSVKENIALTNPDAT
FT                   DADIIRAARIAEAHDFIMALPTGYNTPVGEKGSSLSGGQRQRIAIARTILQNPGLIILD
FT                   EATSALDSDTESRLTANLITAFRGKTVLFITHRLNSVKAASLILCFHDGCIDEAGTHDD
FT                   LMGRKGRYYSLFQKQSFSIPVMEGSLG"
FT   gene            637472..638461
FT                   /locus_tag="Ppha_0636"
FT   CDS_pept        637472..638461
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0636"
FT                   /product="secretion protein HlyD family protein"
FT                   /note="PFAM: secretion protein HlyD family protein; KEGG:
FT                   cph:Cpha266_1842 secretion protein HlyD family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0636"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42935"
FT                   /db_xref="GOA:B4SDJ6"
FT                   /db_xref="InterPro:IPR039562"
FT                   /db_xref="UniProtKB/TrEMBL:B4SDJ6"
FT                   /protein_id="ACF42935.1"
FT                   /translation="MKNPFADDLIGQGEVFTQSVMVPRAILWVLVLAFFGFIVWASVAE
FT                   IDVSIPATGKLEPTGEVKKVQAAIEGEVSALRVDDGQRVKKGEVLLELVPVLSVGEESK
FT                   LKSLQINLDNTRQQYATESVLLGKLRSLLSTAAVSQFEVEQKKLDVLKLQAQVADLTEQ
FT                   ISKQQYMTGQATGYESITAPVSGTVFDLQVKKGAIVSSGQVMLKVVPDDNLTTKAFISN
FT                   QDIGFVYEGLPVDVKLDAFPSSEFGDIKGRVLQVGSDVLAPDDIIKYYHFPVKVTLERQ
FT                   FLEVNGRKIFLQSGMSVTMNIKVRKRTVMSIFTDLFTQQADAISHIRK"
FT   gene            638569..652038
FT                   /locus_tag="Ppha_0637"
FT   CDS_pept        638569..652038
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0637"
FT                   /product="TPR repeat-containing protein"
FT                   /note="PFAM: TPR repeat-containing protein;
FT                   Tetratricopeptide TPR_3; Tetratricopeptide TPR_4;
FT                   Tetratricopeptide TPR_2 repeat protein; SMART:
FT                   Tetratricopeptide domain protein; KEGG: cph:Cpha266_1841
FT                   TPR repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0637"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42936"
FT                   /db_xref="GOA:B4SDJ7"
FT                   /db_xref="InterPro:IPR001440"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR013105"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR029489"
FT                   /db_xref="InterPro:IPR037919"
FT                   /db_xref="UniProtKB/TrEMBL:B4SDJ7"
FT                   /protein_id="ACF42936.1"
FT                   /translation="MKHRIPKKEKSKQLGGFRVEHQTETSDPSDAPVARLQAALTFHQQ
FT                   GRLDEAEAVYREILVTEPDQFDAFRLLAIIAAQRKQFHEAIALFERAFEINSEHANSLN
FT                   NYGIVLCEVKRYNDAVLSFDKAIALNPDYGEAALNREAVLKILKRYDEVVLSCGLAFKG
FT                   NNAAVCSDYGNVLQELSRYEESLLYYDRALALEPDYVAAYFNRGLALKKLKRYDEAVLS
FT                   YDKAIALEPDYAEAHSNRGNALTELKRYHDAVLSYDRALALKPDYAKAHANRGVALQEL
FT                   KQYDEAVLSYGRALACKPDYDFLFAEQLFLSVRICDWRSFEHQVFLLREKISRHENVST
FT                   PFPVLALVDSPLLQQEAARIYVNAKHVINAPLPLIAKRERHEKIRIGYYSADFQNHATT
FT                   YLMAELFERHDRRRFELTAFSFGPDKQDEMRTRVACAFDRFIDVRTRSDREVALLSREL
FT                   EIDIAVDLKGFTTDSRTGIFALRAAPIQVSYLGYPGTMGMDSMDYLIADQTLIPVYSRQ
FT                   YYTEKIVFLPDSYQVNDTKRTIAEKDFTRKECGLPEKGFVFCCFNNNYKITPFVFDSWM
FT                   RILRQVEGSVFWIFEDNPKAAENLRKEATRRGVDSNRLIFSKRIPLAEHLARHRLADLF
FT                   LDTHPCNAHTTASDALWAGLPLLTLAGETFVARVAASLLNAIQLPELITCTQEEYEALA
FT                   IELATNPDRLKLIRLKLEKNRLTTPLFDTERFTHHLEEAYGVMYERYQDGLLPEHIVSL
FT                   PSAEERKELLTMALESSGERHGQKAALVCDAASDHASRFPEALTLHQQGRINEAEALYR
FT                   EILCANPKHFDALQLLATVAAQKRNFSEAAALFEQAFAINSDCPELLNNWGNTLKELKR
FT                   YDEALHCFDRATELNPYYVEAYYNRGITLKELQRYDEALLSYDAVIALKPDYPEVYVNR
FT                   GNVLKELLRCDEALLSYNSALVLKPDYTQAYFNQALALQHLKQYEEAVLSYDKAILLNP
FT                   EYVAAYSNRGSALKELKRYDEALSNYGEAIARNPQFAEAYVNRGNALTDLKRYQDALLD
FT                   YDRAIAVKLDYAIAYFNRGVIQQKLKLYEDAVLSYDNAYTFEPTFDFLYGLRLYARMQI
FT                   CDWSIFYNNVRELREKIGRCEKVSIPFPVIALLDSLVLQKEVAKLYVQEKYPANHELPV
FT                   MVNYPQHERIRIGYYSADFHNHATTYLMAELFERHDRSRFELTAFSFGPDKQDEMRARV
FT                   ASAFDYFIDVRTRSDREVALLSRELEIDIAIDLKGFTQDSRPGIFALRAAPIQVSYLGF
FT                   PGTMGAGYIDYLIADRTLIPERSQYGYTEKIVYLPDSYQINDTKRLIAKKLFTRKELGL
FT                   PEIGFVFCCFNNNYKITPLIFDGWMRILRQVEGSVLWLFEDTQRAAQNLRREAIEKGVD
FT                   AERLIFAKRMPLAEHLARHRIADLFLDTFPCNAHTTASDALWAGLPLLTLAGETFAARV
FT                   AASLLNAIQLPELITFTQEKYEALAIELATNPEKLIAIRQKLEKNRMTTPLFDTERFTH
FT                   HLEEAYGVIYERYQEGLPPGHIVSLPSAEGSEPLLTMAFALPKARSEQDVSAVAETAAR
FT                   SGPAYFATLQSALALHQQGCLDDAEVLYREVVHSNPDYFEAVQLLATVAAQKQSFHEAL
FT                   ELFDHALAIKPDHPITLNNRGNTLIALKRYGDALSSYERAFLLKPDYAEAFYNRALALQ
FT                   ELERHEEAVSSYEKAICIKPDYAEAYYKRGVALQRLQRYDDALLCYDKVIALKPDYADA
FT                   HYSRGLALQELQRYDEALISYDAVIALKPDYPLVYGICLHMRMHSCDWANFDHYLSVII
FT                   EKIECHKYVAPPFIFFASVDSLSLQKKVSTIFMQGIFPANHELPLIERHSRHERIRIGY
FT                   YSADFHNHATANLMAELFERHDRSRFELTAFSFGADAQDEMRRRVATAFDRFIDVRTQS
FT                   DREVALLSRELEIDIAIDLKGVTQYARPGIFTLRAAPIQVSYLGFPATMGAEYIDYLIA
FT                   DRTLIPESSRYGYTEKIVYLPDSYQVNDTKRLIAERVFTRKECGLPEKGFVFCCFNNNY
FT                   KITPVTFDGWMRILKRVEGSVLWLLGGNPKAVENLRKESTERGVDAERLIFAKRMPLAE
FT                   HLARHRIADLFIDTFPCNAHTTASDALWAGLPLLTLAGETFVARVAASLLNAIQLPELI
FT                   TSTQEEYEALAIELATNPEKLIAIRQKLEKNRLTTPLFDTERFTHHLEEAYGVIYERYQ
FT                   EGLPPGHIVSLPSAEGRKELLMKGTVPGVRAEQDVSVASETTAQYRPAHSTRLHSALAL
FT                   HQQGCLDDAEVLYRKILREDPEHFDALQLLATIAAQKKNFSEAVELFDQAFTINSNHPN
FT                   SLNNWGNALKELKRYDEAISSYDKAVTIKADYAEAYVNRGIVFEELKLYDMALSSYDKA
FT                   FAVNAGYDFLPGMRFAIRMLFCDWVDFDNHVSLLREKIGHHERVSSPFTLFAISDSLSQ
FT                   QKEAALIYVDAKQALDHLLPVITKCLRHDKIRVAYYSADFHNHATAYLMAELFERHDRS
FT                   NFEFTAFSFGADAQDEMRRRVATAFDRFIDVRTQSDREVALLSRELEIDIAIDLKGFTQ
FT                   HSRPGIFALRAAPIQVSYLGYPGTMGAEYIDYLIADRTLIPESCWYGYTEKIVYLPDSY
FT                   QVNDTKRLIAERVFTRKELGLPEIGFVFCCFNNNYKITPVTFEGWMRILKRVEGSVLWL
FT                   LEDNPKAAANLRKEATERGVDAERLIFAKRMPLAEHLARHRIADLFLDTFPCNAHTTAS
FT                   DALWAGLPLLTLAGETFAARVAASLLNAIQLPELITFTQEKYEALAIELATNPEKLIAI
FT                   RQKLEKNRLTTPLFDTERFTHHLEEAYGVMYERYQEGLPPGHIVSLPSAEGSEPLLTMA
FT                   LALPKARSEQDVSAVAETAARSGPAYFATLQSALALHQQGCLDDAEVLYREVVHSNPDY
FT                   FEAVQLLATVAAQKQNFHEALELFDHALAIKPDHPITLNNRGNTLIALKRYGDALSSYE
FT                   RAFLLKPDYAEACYNRALALQELERHEEALSGYEKAIGIKPDYVEALYKRGVALKRLQR
FT                   YDDALLCYDKVIALKPDYADAHYSRGLALQELQRYDEALSNYGEAIARNPQFAEAYVNR
FT                   GNALTDLKRYQDALLDYDRAIAVKLDYAIAYFNRGVIQQKLKLYEDAVLSYDNAYTFEP
FT                   TFDFLYGLRLYARMQICDWSIFYNNVRELREKIGRCEKVSIPFPVIALLDSLVLQKEVA
FT                   KLYVQEKYPANHELPVMVTYPQHERIRIGYYSADFHNHATANLMAELFERHDRSRFELT
FT                   AFSFGPEVQDEMRARVAIAFDRFIEVRTLSDREVALLSRELEIDIAIDLKGVTQYARPG
FT                   MFALRAAPIQVSYLGFPATMGAEYIDYLIADRTLIPESSRYGYTEKIVYLPDSYQVNDT
FT                   KRLIAERVFTRKECGLPEKGFVFCCFNNNYKITPVTFDGWMRILKRVEGSVLWLLGGNP
FT                   KAVENLRKESTERGVDAERLIFAKRMPLAEHLARHRLADLFIDTFPCNAHTTASDALWA
FT                   GLPLLTLAGETFAARVAASLLNAIQLPELITSTQEEYEALAIELATNPEKLTVIRQKLE
FT                   KNRLTTPLFDTERFTHHIEEAYGVIYERYQEGLPPGHIVSLPSAEGRKESLMKGTVPGV
FT                   RAEQDVSVASETAAQYRPAHSIRLHSALALHQQGCLDDAEVLYREILRANPEHFDALRL
FT                   LATVAAQRKNFPEAEELFDQALKINPAHATVWNNRGIALQELKRYDEALQCYDNALERK
FT                   ADYAAAFFYRGLVLTKLHRYDEAVLSYNRALILKPDYAAACYNLGNTLQKLNRYDEALV
FT                   CYDKVLVIKPGDAEACSNRGITLKELQRYDEAVLSYEKALALRPDYADAYYNLGNVLQD
FT                   LKRYREALDNYDKVLAIRPGDAHVYSNRGIALQELKRYDEALVSYEKALALKPDYAKAY
FT                   SNRGSVLQALNRNDEALLSYERAIAIKQDYAEAYRNRGVVLKELKRYDEALLSYERAIA
FT                   FKPDSADGYFNLGIALRELKRYDEALINFDKTLFINPGYEFLFGVRLYTMMHICDWSTF
FT                   KHHVSQLREKLERHEKASTPFPLLALIGSLLLQKQVSSDYVQEKYSANPELPLLVKRSR
FT                   HDKIRIGYYSADFHNHATAYLMAELFEMHDRSRFEIIAFSFGPDRQDEMRKRVAIAFDC
FT                   FVDVRTQSDREVALLSRELEIDIAVDLKGFTQDSRCGIFALRAAPIQVSYLGYPGTMGA
FT                   DYIDYLIADPTLIPESCRYGYTEKIAYLPDSYQVNDTKRTIAERVFTRKECGLPEKGFI
FT                   FCCFNNNYKITPVTFDGWMRLLRQVEGSVLWLLEDNVTAADNLRKEAIKRGIDAARIVF
FT                   AQRMPLAEHLARQRLGYLFLDTFPCNAHTTASDALWVGLPVLTLAGESFASRVAASLLN
FT                   AMQLPELITSTQEEYEALAIDVATNPEKLGNIRRKLEQNRLTTPLFDTELFTRNIEAAY
FT                   DAMYERYQRGFLPDHIKIA"
FT   gene            652082..652864
FT                   /locus_tag="Ppha_0638"
FT   CDS_pept        652082..652864
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0638"
FT                   /product="glycosyl transferase family 2"
FT                   /note="PFAM: glycosyl transferase family 2; KEGG:
FT                   mrd:Mrad2831_1547 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0638"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42937"
FT                   /db_xref="GOA:B4SDJ8"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:B4SDJ8"
FT                   /protein_id="ACF42937.1"
FT                   /translation="MQKKTLTVIIPSRFQPKQLSFLEKAVQSIKKQTAIDNYDLTVLVS
FT                   VDKGKMLEKNAIEQLKVRCIESSGGSQASALNAAIDLVDTQFAAFLEDDDEWYPKYLEA
FT                   AAQAILFAPFVSSTQLEYDENNVLLRINDFPTPSGWFMSSDVLKSVGKFNEEYRFHLDN
FT                   EWLGRLSLAKVSRIHLVEATAPVDARYIAAVRPWLDNVLKSSKGSVRLARHSEALPLVR
FT                   RLRHSEAGMEKIATLPDYRARSQSECRSLVERFGRIPW"
FT   gene            653069..653818
FT                   /locus_tag="Ppha_0639"
FT   CDS_pept        653069..653818
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0639"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gfo:GFO_0545 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0639"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42938"
FT                   /db_xref="InterPro:IPR006342"
FT                   /db_xref="UniProtKB/TrEMBL:B4SDU7"
FT                   /protein_id="ACF42938.1"
FT                   /translation="MQKQIVLSVNPDRLAHFFRLIKPVTTNHPLIRIGGEFDGGYLIPD
FT                   DLDKIKVCFSPGVSTIVDFELDLVKRGITCFLADYSVEAPPVQNKLFHFEKKYLGPSET
FT                   STDMTLENWVKKSAPNQTDYILQMDIEGGEYGVIFDTSSEILRKFRIMVIEFHSMYALI
FT                   DKFGWELINLAFTKILKDFKIVHIHPNNCCRSIVYNKFEIPPVVEFTFLRKDRITEMEP
FT                   SLFFPHPSDRKNVPENNDLLLPSCWYK"
FT   gene            654295..654807
FT                   /locus_tag="Ppha_0640"
FT   CDS_pept        654295..654807
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0640"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sit:TM1040_1486 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0640"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42939"
FT                   /db_xref="UniProtKB/TrEMBL:B4SDU8"
FT                   /protein_id="ACF42939.1"
FT                   /translation="MVQTPYVMNLNLDDRLAMDAVEVMESALDSGSDLVGGDWKICYSQ
FT                   EETDAVASSFPASELPFIPAWPPAGDLTRLGSGTGSRGTLGPACMWRTHLHKTLARYPY
FT                   QFGDGTLIRVIGDAVWWRLLVQNKKKMQRVASIIGNYNSHQHDQAEFRNSAQSEEQRLK
FT                   LIGVRLL"
FT   gene            655353..658637
FT                   /locus_tag="Ppha_0641"
FT   CDS_pept        655353..658637
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0641"
FT                   /product="TPR repeat-containing protein"
FT                   /note="PFAM: TPR repeat-containing protein;
FT                   Tetratricopeptide TPR_4; Tetratricopeptide TPR_2 repeat
FT                   protein; Methyltransferase type 11; Methyltransferase type
FT                   12; SMART: Tetratricopeptide domain protein; KEGG:
FT                   cph:Cpha266_1841 TPR repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0641"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42940"
FT                   /db_xref="GOA:B4SDU9"
FT                   /db_xref="InterPro:IPR001440"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR029489"
FT                   /db_xref="InterPro:IPR037919"
FT                   /db_xref="UniProtKB/TrEMBL:B4SDU9"
FT                   /protein_id="ACF42940.1"
FT                   /translation="MNDIRMSCKPEHLVVKREVSKEDTAFVLRSAFLLHQQGRLEEAEA
FT                   LYREIVQSDPEHFEALRLLAIIAVQKKRFEDSLVLFDHALKINPRHAATLNNQGVVYEE
FT                   LHRFDEALCSYEHALAVKPDYAEASLNRGVMLQELGRFDEAVLSYDHALTNDADNARIW
FT                   FHRGNVLQDLKRYGEAVFSFEKALAINPDYAIAYANLGNVLQDLKRYEEAVLSYDRAIA
FT                   VNPDSVRAYVNRGIALQELKRYEEAVFSFEKACAINPDYAIAYANLGNVLQYLKRYGEA
FT                   VLSYDKAIALKPDYAEAHSDRGVALQGLQLYEEALLSYDRALLVRPDYAEACYNRGVVL
FT                   QKLKRHVEALASYEQALALKPDYDFLSGMCLNIKMQMCDWRDFECQLSRLFQKIERSEK
FT                   VAVPFSFLSISDSLLLQKKVAMISVGESCFSPQVPSAISKRSRHEKIRIGYYSADFHDH
FT                   ATAYLMAELFERHDRSQFELFAFSFGPDRQDKMRKRVAAAFDHFFDVRTRSDAEIVLFS
FT                   RDLEIDIAIDLKGFTQGFRRGIFALRAAPIQVSYLGYPGTMGVGYIDYLIADSMLIPEG
FT                   SRKYYTEKIVYLPDSYQVNDTKRVIAEKLFTRKECGLPEQGFVFACFNNNNKITPATFD
FT                   GWMRILGQVEGSVLWLLEDNVAAADNLRNEAMQRGVDAARLVFAKRMPLAEHLARQRLG
FT                   DLFLDTFPCNAHTTASDALWAGLPLLTLLGESFAGRVAASLLNAMQLPELITSKQEEYE
FT                   ALAIELASNPAKLGNIRRKLEQNRLATPLFDTKRFTRHIEQAYCMMYERYQQELPPDHL
FT                   FSLPSAQGSTGTISQLQQEYACCPLCGCKNSLYGRADCSRHTLWHEPLPRILEWMRCPG
FT                   CHHVYTRHFWTQAGIDELFRNAQQNQLAGFGASQDAKRANWVPVVDRVLNLLGGYRSIM
FT                   DNGSHPTWVDVGCGDGALVMTAGDFGFTALGLDARSEAVRRIIELGFKAEEGDFMQCTF
FT                   ERKLDVLSMMDVLEHMPYPGLALGKAAELVRPGGVLVISLPDLSCSSWRMMDAAKCNPY
FT                   WMEIEHYHNFSRERLIALLGERGFDVADFGIPNRYKAQMELYAVRK"
FT   gene            658936..659619
FT                   /locus_tag="Ppha_0642"
FT   CDS_pept        658936..659619
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0642"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cph:Cpha266_1326 pentapeptide repeat protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0642"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42941"
FT                   /db_xref="GOA:B4SDV0"
FT                   /db_xref="InterPro:IPR011460"
FT                   /db_xref="UniProtKB/TrEMBL:B4SDV0"
FT                   /protein_id="ACF42941.1"
FT                   /translation="MMITPFTVMSSKYNGVMVQGAVVGGMTNWSGGDLLRTGEKRRGFR
FT                   HETEKKDGRVQCGSAHSGEDGVYAIMKLFAFIILLTLLLTGAWLVAASASSQAVVMVGR
FT                   DSFGDGGVATIAKPGQQPGNRVTVQHGLIAAEEDLPGFFSWAEARVSCDSLTLHGYDDW
FT                   YLPDKDELNRLFFSKGAVGGFLDTLYWNSTSSDAQEAWSQDFFGGTQNSVKKSATLRVR
FT                   PVRKF"
FT   gene            659918..660415
FT                   /locus_tag="Ppha_0643"
FT   CDS_pept        659918..660415
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0643"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cph:Cpha266_1326 pentapeptide repeat protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0643"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42942"
FT                   /db_xref="InterPro:IPR011460"
FT                   /db_xref="UniProtKB/TrEMBL:B4SDV1"
FT                   /protein_id="ACF42942.1"
FT                   /translation="MEHFFGKFGIRLFTALLLWGLGVLAVSEVSFAAPKVGDEYGGGKV
FT                   VYILQPGDPGYVAGEEHGMVAAKEDLPQESLSWAEAKAAAERLELSGYKGWSLPTQQEL
FT                   SLLYKNQAIVGGFRDYSYYWSGSEVDNQKAWALDFYNGEKVLSVKSGALTGIRRIRAIR
FT                   KF"
FT   sig_peptide     659918..660016
FT                   /locus_tag="Ppha_0643"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.997) with cleavage site probability 0.992 at
FT                   residue 33"
FT   gene            660682..661224
FT                   /locus_tag="Ppha_0644"
FT   CDS_pept        660682..661224
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0644"
FT                   /product="isochorismatase hydrolase"
FT                   /note="PFAM: isochorismatase hydrolase; KEGG:
FT                   cph:Cpha266_0525 isochorismatase hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0644"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42943"
FT                   /db_xref="GOA:B4SDV2"
FT                   /db_xref="InterPro:IPR000868"
FT                   /db_xref="InterPro:IPR036380"
FT                   /db_xref="UniProtKB/TrEMBL:B4SDV2"
FT                   /protein_id="ACF42943.1"
FT                   /translation="MLSSRETLLLVIDVQGRLAQSVVQPAALETNISKLVRACLILDVP
FT                   VLVTEQYPKGLGSTVDTLKELLPGMVPVEKLSFSCCGTPEFMKQLRSFNRNDILVVGME
FT                   AHVCVYQTAVDLVEFGYNVHLVTDAVSSRTEANRLLGIRCIEKAGASLTSTEMAVFELL
FT                   RVAEGERFKAISKIIKE"
FT   gene            complement(661279..662346)
FT                   /locus_tag="Ppha_0645"
FT   CDS_pept        complement(661279..662346)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0645"
FT                   /product="tetraacyldisaccharide 4'-kinase"
FT                   /EC_number="2.7.1.130"
FT                   /note="KEGG: cch:Cag_0169 tetraacyldisaccharide-1-P
FT                   4'-kinase; TIGRFAM: tetraacyldisaccharide 4'-kinase; PFAM:
FT                   Tetraacyldisaccharide-1-P 4'-kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0645"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42944"
FT                   /db_xref="GOA:B4SDV3"
FT                   /db_xref="InterPro:IPR003758"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4SDV3"
FT                   /protein_id="ACF42944.1"
FT                   /translation="MHNPLSILLRPAALGYRVIVQLRNTLFDRQLLPAWKSPVPIVSIG
FT                   NLSVGGTGKTPLVDWVVKYYLSIGCKPAIISRGYRRESKGVQLVSDGQKVLLSSSESGD
FT                   ETAMLAWNNPDAIVIVAKKRKEAVKYLVKHFAARMPSVIILDDAFQHRQIQRELNIAII
FT                   NVSEPFLKARMLPEGRMREPLKNLSRADLIVLNKIDDPEKADAIVRKIKERGTPLIKAR
FT                   VAIAELVCFSGAFISSEEAPPLTSISALAFAGISSPQSFLDSLGKEGVTIAAHRFFYDH
FT                   EPYSAKKLTEIFREAESKGLSLITTEKDYFRMLGHPELIRIITARPCYYLKIKTDIFEG
FT                   KEILQSMLRKAVAMK"
FT   gene            complement(662339..662950)
FT                   /locus_tag="Ppha_0646"
FT   CDS_pept        complement(662339..662950)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0646"
FT                   /product="protein of unknown function DUF374"
FT                   /note="PFAM: protein of unknown function DUF374; KEGG:
FT                   cch:Cag_0170 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0646"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42945"
FT                   /db_xref="InterPro:IPR007172"
FT                   /db_xref="UniProtKB/TrEMBL:B4SDV4"
FT                   /protein_id="ACF42945.1"
FT                   /translation="MPLSPLISRHLIPFALKLLYASLRISVIPKIIQLPDKEVIITFWH
FT                   GKMITGWLLAQRLFPEKKITAVVSMSEDGKTLADTLERLGFSLIRGSSSKGGAAVKQAM
FT                   QKALQNGNIVALTPDGPRGPANQFKYGTLRLASENHYPLVFAEIRHKKSWTLKSWDQFE
FT                   IPKPFSETSVQLHLIHLPAFENEAEIESYTKQLAIQLHHA"
FT   gene            663127..664407
FT                   /locus_tag="Ppha_0647"
FT   CDS_pept        663127..664407
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0647"
FT                   /product="phosphoribosylamine/glycine ligase"
FT                   /EC_number="6.3.4.13"
FT                   /note="KEGG: plt:Plut_1653 phosphoribosylglycinamide
FT                   synthetase; TIGRFAM: phosphoribosylamine/glycine ligase;
FT                   PFAM: phosphoribosylglycinamide synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0647"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42946"
FT                   /db_xref="GOA:B4SDV5"
FT                   /db_xref="InterPro:IPR000115"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR020560"
FT                   /db_xref="InterPro:IPR020561"
FT                   /db_xref="InterPro:IPR020562"
FT                   /db_xref="InterPro:IPR037123"
FT                   /db_xref="UniProtKB/TrEMBL:B4SDV5"
FT                   /protein_id="ACF42946.1"
FT                   /translation="MNVLIIGSGAREHAMCQCAVESEGVQRVFVAPGNGGTAMMGGPVC
FT                   NVPLKVTALDDLLRFAEENAIDLTVVGSEAPLELGIVDLFRRAGKKIVGPAQEAASLES
FT                   SKVFAKEFMRRHGIPTAGYHVFHDALSANAYIGLPETLFPQVIKASGLCAGKGVFIALD
FT                   REQAMMANNALFEERIFGDAANEVVIEDFLQGEEASVFALTDGTRYRLFLPAQDHKRIG
FT                   DGDTGKNTGGMGAYAPAPLVTSEVMQKVEERIIQPTLKGMRDDGYPYTGFLYVGLMIDR
FT                   GEPFVVEYNARMGDPETQVVLPLLKSDFIAALQASVDGTLGEVPFEMYQKSAATVVIAS
FT                   AGYPDHYETGKAVALADELSAMKDCQVFHAGTAYEGGRLVTAGGRVFSVTALGDTLRES
FT                   IDRAYSAVEKISFEGAYYRTDIGAKAL"
FT   gene            664429..664860
FT                   /locus_tag="Ppha_0648"
FT   CDS_pept        664429..664860
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0648"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cch:Cag_0172 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0648"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42947"
FT                   /db_xref="InterPro:IPR028090"
FT                   /db_xref="UniProtKB/TrEMBL:B4SDV6"
FT                   /protein_id="ACF42947.1"
FT                   /translation="MKLPRRQFEIIQEQAFRELPYECCGLLVGIQNSDHRGNVENIVYE
FT                   VAPCRNCLYFGKEQGFEIAHQEYLDVEREARMLGYEIIGSYHSHINSPALPSLHDVDFA
FT                   RPGHTLLIISLMNAQPKEVTAWLRRGSGGVHQEQIRVLE"
FT   gene            664952..666430
FT                   /locus_tag="Ppha_0649"
FT   CDS_pept        664952..666430
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0649"
FT                   /product="Carbamoyl-phosphate synthase L chain ATP-binding"
FT                   /note="PFAM: Carbamoyl-phosphate synthase L chain
FT                   ATP-binding; Carbamoyl-phosphate synthetase large chain
FT                   oligomerisation; Carbamoyl-phosphate synthetase large chain
FT                   domain protein; KEGG: cch:Cag_0173 carbamoyl-phosphate
FT                   synthase, medium subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0649"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42948"
FT                   /db_xref="GOA:B4SDV7"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005480"
FT                   /db_xref="InterPro:IPR005483"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR036897"
FT                   /db_xref="UniProtKB/TrEMBL:B4SDV7"
FT                   /protein_id="ACF42948.1"
FT                   /translation="MPKREDIKSILVIGAGPIVIGQACEFDYSGTQACRALKEDGYRVV
FT                   LVNSNPATIMTDIEFADATYIEPITPEYVQKIIEREKPDALLPTMGGQTALNIAVSLAE
FT                   SGILERNGVELIGAKLRAIRKAENREFFSDAMKKIGLEMAKGFFVRNEKEAKEALEEIG
FT                   LPIVIRPSFTLGGTGGGFAETKADYYDAIRRGLTESPISEVLVEECLIGWKEYELEVIR
FT                   DLADNVIIVCSIENVDPMGVHTGDSITVAPAQTLTDRQYQELRDASVRIIREIGVETGG
FT                   SNIQFAINPLNGRIVVIEMNPRVSRSSALASKATGFPIAKVAAKLAVGYTLDEILNDIT
FT                   RTTPASFEPAIDYCVVKIPRWDFEKFKNVDARLGVQMKSVGEVMAFGRNFREALQKSLR
FT                   GLEIGRAGLGSDGKDVMNVLAMTPQQKKFAREDILEKIRIPKADRMFYLRYAFQAGATV
FT                   DEVHQSTGIDPWFLDNILQIVELEEKLRELAAAV"
FT   gene            666440..667210
FT                   /locus_tag="Ppha_0650"
FT   CDS_pept        666440..667210
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0650"
FT                   /product="Indole-3-glycerol-phosphate synthase"
FT                   /EC_number="4.1.1.48"
FT                   /note="PFAM: Indole-3-glycerol phosphate synthase; KEGG:
FT                   cph:Cpha266_0531 indole-3-glycerol phosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0650"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42949"
FT                   /db_xref="GOA:B4SDV8"
FT                   /db_xref="InterPro:IPR001468"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR013798"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4SDV8"
FT                   /protein_id="ACF42949.1"
FT                   /translation="MSYLSRILEEKEREVGELASEHPARRYAELQGSLAPTRDFTGALR
FT                   RTGRGLRLIAEIKKASPSRGLIVPDFDPVNIARRYGELGAAAYSVLTDRTFFQGSIDYL
FT                   QMVSRSFQLPVLRKDFIIDESQIFQSRLTGADAILLIVAALDSCQLGDYLQLAASVGLH
FT                   VLVEVHDRKELDRAIEKGAPIIGVNNRDLKDFSLKLETSLSLRPFIPSDVLAVSESGLK
FT                   SSADIALIEQASFDAVLIGEGLYTSPELGRITWS"
FT   gene            complement(667197..667862)
FT                   /locus_tag="Ppha_0651"
FT   CDS_pept        complement(667197..667862)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0651"
FT                   /product="Ribulose-phosphate 3-epimerase"
FT                   /EC_number="5.1.3.1"
FT                   /note="PFAM: ribulose-phosphate 3-epimerase; Orotidine
FT                   5'-phosphate decarboxylase; KEGG: cch:Cag_0175
FT                   ribulose-phosphate 3-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0651"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42950"
FT                   /db_xref="GOA:B4SDV9"
FT                   /db_xref="InterPro:IPR000056"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR026019"
FT                   /db_xref="UniProtKB/TrEMBL:B4SDV9"
FT                   /protein_id="ACF42950.1"
FT                   /translation="MPAPSTLLAPSILSADFTRLEHSIDIATKAGADWMHCDIMDGNFV
FT                   PNITFGPLIVQAIASCTPMIIDTHLMIVDPDRFIEEFIKAGSHQITVHQEACPHLHRTI
FT                   QLIKSLGAKAGVSINPGTSLSTLESILPDLDLVLLMSVNPGFGGQKFIPSSIGKIRQLH
FT                   EMRLKVNPGMVIAIDGGITEENGQEVVSAGADALIAGTAFFKAANPAQTAAKFRAMTR"
FT   gene            complement(667908..670112)
FT                   /locus_tag="Ppha_0652"
FT   CDS_pept        complement(667908..670112)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0652"
FT                   /product="surface antigen (D15)"
FT                   /note="PFAM: surface antigen (D15); surface antigen
FT                   variable number repeat protein; KEGG: cph:Cpha266_0533
FT                   surface antigen (D15)"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0652"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42951"
FT                   /db_xref="GOA:B4SDW0"
FT                   /db_xref="InterPro:IPR000184"
FT                   /db_xref="InterPro:IPR010827"
FT                   /db_xref="InterPro:IPR039910"
FT                   /db_xref="UniProtKB/TrEMBL:B4SDW0"
FT                   /protein_id="ACF42951.1"
FT                   /translation="MTKAVLTLISLLLLCAFPAQGRSISTGKKQVAVSPYVNNIHFSGN
FT                   KSISEEELRLIIVTAENRSFLGLGLFGGSRRAFNKEEFEKDLFLIKKLYTYKGFFFTDL
FT                   DTTIVRKNGGKKLDINIRIRENNPSKVDFITYEGLEKIPAELKTDYLHNKRLNVNDVFS
FT                   VERLIEERDRTIAFFKEYGFSFFHEDSIRIKVDTVGTRAGVLFRLSLPKQLHYGAITAI
FT                   VHNPVNSDTTPKTKTYTKENISATILGNQHISPHLITSAIEFRPGDITRKSLEQSTLQN
FT                   FGATNLFSSISISPDSVQADKLYTTIHLETAPKHQIEPKILVDNRYGALFFGTSLAYEN
FT                   KNLLGGAEQFRASTEYGTQAGYNNKLLQNLDTDQYARVIPYEFGLKSSLVLPVLKKPGN
FT                   FYATTVEYAATKLPVLLSNKNGLLRATYSARLNPSSRLNFDFFEFEWVKKDSLKGFKQL
FT                   FETDLAYNIGIDPSNEAAVNAGIDSLLETHVNQTFRLRYNFTNRQSAPAERTIRNLDLL
FT                   LEESGSLAWLMDTYLDTKNYSGFTDKDPQIFGTTYSQYVKLESALSLAKNFSPQSQLAG
FT                   RGRIGWMTPYGKAETTPEERRFYAGGTNSMRGWLFNTLGPGRSVSKVAANFGADIKLEL
FT                   NMEYRRKFFTLFNQPSGITLFTDIGNIWDRNGVYGLTLKSLARDFAWDAGIGLRIGSPI
FT                   GPFRFDFAYKLHDPTQEKPWRFSALNIGDYTFNFGIGEAF"
FT   sig_peptide     complement(670047..670112)
FT                   /locus_tag="Ppha_0652"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.992 at
FT                   residue 22"
FT   gene            complement(670132..670359)
FT                   /locus_tag="Ppha_0653"
FT   CDS_pept        complement(670132..670359)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0653"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: plt:Plut_1647 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0653"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42952"
FT                   /db_xref="InterPro:IPR021527"
FT                   /db_xref="UniProtKB/TrEMBL:B4SDW1"
FT                   /protein_id="ACF42952.1"
FT                   /translation="MYWNLDLARHIADAPWPVTKDELINYANRSGAPQQVIDNLLDLPE
FT                   SDDMYESLDEIWPDYPTDEDFGYGDEEPLT"
FT   gene            complement(670384..671208)
FT                   /locus_tag="Ppha_0654"
FT   CDS_pept        complement(670384..671208)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0654"
FT                   /product="Peptidase M23"
FT                   /note="PFAM: Peptidase M23; KEGG: cph:Cpha266_0535
FT                   peptidase M23B"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0654"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42953"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="UniProtKB/TrEMBL:B4SDW2"
FT                   /protein_id="ACF42953.1"
FT                   /translation="MNDIPVQTNNPRYHMTLKHRFMAVSEYGRNAKESLFACLSSGIVA
FT                   LSLALFSFVIGAPATLLAEEAQSIETKTPAPRANTTEGILASTEQMIEQLILQIDRQRN
FT                   NATESRVQSEEPTSTSYFSSIPNIRPVSGAITSAFGKRVHPIYKVTLFHSGIDFSAAEG
FT                   TRVQSTGDGVIAYSGYDRGYGQKITINHGFGYQTIYAHLSKSLVRQGQRVKRGEIIALS
FT                   GNTGLSTGPHLHYEVQKDNVKVNPTAYFFDESNPDKFITTQKPAPEQSDNNS"
FT   sig_peptide     complement(671017..671208)
FT                   /locus_tag="Ppha_0654"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.643) with cleavage site probability 0.587 at
FT                   residue 64"
FT   gene            complement(671248..674082)
FT                   /locus_tag="Ppha_0655"
FT   CDS_pept        complement(671248..674082)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0655"
FT                   /product="DNA polymerase I"
FT                   /EC_number="2.7.7.7"
FT                   /note="KEGG: plt:Plut_1645 DNA polymerase A; TIGRFAM: DNA
FT                   polymerase I; PFAM: DNA-directed DNA polymerase; 5'-3'
FT                   exonuclease; 3'-5' exonuclease; SMART: Helix-hairpin-helix
FT                   domain protein class 2"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0655"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42954"
FT                   /db_xref="GOA:B4SDW3"
FT                   /db_xref="InterPro:IPR001098"
FT                   /db_xref="InterPro:IPR002298"
FT                   /db_xref="InterPro:IPR002421"
FT                   /db_xref="InterPro:IPR002562"
FT                   /db_xref="InterPro:IPR008918"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR018320"
FT                   /db_xref="InterPro:IPR020045"
FT                   /db_xref="InterPro:IPR020046"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="InterPro:IPR036279"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:B4SDW3"
FT                   /protein_id="ACF42954.1"
FT                   /translation="MNNRQLDFFPPANPEERIKNPATITKKPALFLLDGMAIVYRSFYA
FT                   LQRTGMTSQEGMPTGAIYGFASTLLKIFETYRPQYLAAVFDSKEKTFRHDLYPLYKANR
FT                   QAPPEDLIMQLDAIFKLLEAFDIPLIKTPGYEADDLIGTASRKFSPMCQVYIVTPDKDL
FT                   AQLVHEGVNILKPGKNQNELELLGKKEIIEQFGVPPELFIPFLTLTGDTSDNIPGAKGI
FT                   GPKTAISLLDQYGSLQNIYNHLDTISPKNRQSLEAFQPTLDLITQLVTIRTDLQIDVTL
FT                   KELACGLPDPAKLFPLLQKLGLKTISSRILALFGELQQAPSATAPLHEEPSSPFHEEEP
FT                   ALRSPRENADYARIDTVDKLMELMESLHDARHIAVDTETTSLDTFEAELAGISIAVETG
FT                   KARFISFAQSALDRDKTVEILKPLLENPSLPKIGQNLKYDMLVLKKYGIELSPVAFDTM
FT                   LASYVLNPEEKHNLDDLAAHHLGYRTTTFDELVGTGKTKQHIFEVDPEKLSDYACQDAD
FT                   LALQLEGVFRKKLDGETELLWLCENIEFPLVTVLAEMEYAGICIDTHHLEKASERVKKE
FT                   LELLTETIYAAAGSAFNIDSPKQLAHILFDLLALPPKKRTKTGYSTNVEVLEELATLFP
FT                   IARDLLEYRSLQKLKSTYIDALPKMVNPLTGRLHTTFNQFITATGRLSSSNPNLQNIPI
FT                   RSPLGKEIRRAFIPSTPENWLLSADYSQIELRIAAEISGDPQLLEAFRNREDIHTATAK
FT                   VIFDTDEITSDMRRKAKEVNFGVLYGIMPFGLSRRLNIPQKEAKAIIDTYISKYPGLFK
FT                   ALQEIIVTGREKGYVTTILGRRRYLADLNSRNTNLKKAAERAAMNTPIQGTAADIIKCA
FT                   MNLCSSRMRHLNMKSVMLLQVHDELLFETTDAEKEPLSKLVEQAMIDAAIRCGLKNVPV
FT                   LVDTGIGKNWLEAH"
FT   gene            complement(674079..674909)
FT                   /locus_tag="Ppha_0656"
FT   CDS_pept        complement(674079..674909)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0656"
FT                   /product="Prephenate dehydratase"
FT                   /EC_number="4.2.1.51"
FT                   /note="PFAM: prephenate dehydratase; amino acid-binding ACT
FT                   domain protein; KEGG: cph:Cpha266_0537 prephenate
FT                   dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0656"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42955"
FT                   /db_xref="GOA:B4SDW4"
FT                   /db_xref="InterPro:IPR001086"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR018528"
FT                   /db_xref="UniProtKB/TrEMBL:B4SDW4"
FT                   /protein_id="ACF42955.1"
FT                   /translation="MTAYQGEPGAYSEIAALRIGEPKPFESFDEVFAAVENQKVHYAVI
FT                   PIENSLGGSIHHNYDLLLQHPVTIVAETFVKVKHCLLGIPGSSTERALKVLSHPQALAQ
FT                   CRNFFATHQHLKAEVAYDTAGSAKMIAAEKDPGKLAIASKRAGELYGLEILQENLADEE
FT                   WNITRFFCIAHAKNPENPLPETTAKSAQHKTSIVFTLPNEQGSLFKALATFAMRDIDLT
FT                   KIESRPFRKKAFEYLFYVDFIGDQNDRNIQNALCHLKEFATMVNVLGSYGVIAE"
FT   gene            675038..675790
FT                   /locus_tag="Ppha_0657"
FT   CDS_pept        675038..675790
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0657"
FT                   /product="protein of unknown function DUF28"
FT                   /note="PFAM: protein of unknown function DUF28; KEGG:
FT                   cch:Cag_0165 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0657"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42956"
FT                   /db_xref="GOA:B4SDW5"
FT                   /db_xref="InterPro:IPR002876"
FT                   /db_xref="InterPro:IPR017856"
FT                   /db_xref="InterPro:IPR026564"
FT                   /db_xref="InterPro:IPR029072"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4SDW5"
FT                   /protein_id="ACF42956.1"
FT                   /translation="MSGHSKWATIKRKKAVTDQKRGSLFTKLVKEITIAAKMGGGDPAG
FT                   NPRLRLAIDTARDNSMPMDNIQRAIKKGTGELEGVTWDEITYEGYGPAGIALIIETATD
FT                   NRNRTVADIRHIMSRNNGSLGESGSVAWMFQRKGTLDVPRSAAGEDQLMELLLEAGLED
FT                   LGSDDENYFTVITDVKDLERVKKALDDAAIMYENAKIDLIPENYIELEAEDARKVIKLI
FT                   DAFENNDDVQAVYTNMEISESAMSSLNE"
FT   gene            675795..676370
FT                   /locus_tag="Ppha_0658"
FT   CDS_pept        675795..676370
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0658"
FT                   /product="crossover junction endodeoxyribonuclease RuvC"
FT                   /EC_number="3.1.22.4"
FT                   /note="KEGG: cph:Cpha266_0539 crossover junction
FT                   endodeoxyribonuclease RuvC; TIGRFAM: crossover junction
FT                   endodeoxyribonuclease RuvC; PFAM: Crossover junction
FT                   endodeoxyribonuclease RuvC"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0658"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42957"
FT                   /db_xref="GOA:B4SDW6"
FT                   /db_xref="InterPro:IPR002176"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR020563"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4SDW6"
FT                   /protein_id="ACF42957.1"
FT                   /translation="MVVLGVDPGSRLTGYGVIRQEGTFFTVLSCGVIRLHPRSSHAERI
FT                   GQIYRELEAVITDYAPECVALETVFLSRNVQSALKLGQVRGAVIALAMNRNLLLHEYAP
FT                   REVKSAVTGKGAASKEQVAFMVARMLALNPVPEPFDVTDALGIALCDLLRGGSREPFKS
FT                   AGQSRKGGMSWSQFVGASPDMVIRLFQK"
FT   gene            676381..676935
FT                   /locus_tag="Ppha_0659"
FT   CDS_pept        676381..676935
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0659"
FT                   /product="CDP-alcohol phosphatidyltransferase"
FT                   /note="PFAM: CDP-alcohol phosphatidyltransferase; KEGG:
FT                   plt:Plut_1641 CDP-diacylglycerol--glycerol-3-phosphate
FT                   3-phosphatidyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0659"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42958"
FT                   /db_xref="GOA:B4SDW7"
FT                   /db_xref="InterPro:IPR000462"
FT                   /db_xref="InterPro:IPR004570"
FT                   /db_xref="UniProtKB/TrEMBL:B4SDW7"
FT                   /protein_id="ACF42958.1"
FT                   /translation="MEGRIVNIPNFLSILRILLIPWFIYYFHTGHLDIAITIMIVAVLT
FT                   DWFDGQAARWTNDVSEMGKILDPLADKLCLASVAVYFLWVGQLPLWFVLFAVLRDILIF
FT                   IGAGYVKFRHSVVTTSLWPGKWAVGFVSMLFIAMVWPHPFFREYLVKEFFLYLSTLMLF
FT                   YSFVLYCLRFYKIHKGLEYRA"
FT   gene            complement(677334..678737)
FT                   /locus_tag="Ppha_0660"
FT   CDS_pept        complement(677334..678737)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0660"
FT                   /product="beta-hydroxyacyl-(acyl-carrier-protein)
FT                   dehydratase FabZ"
FT                   /note="TIGRFAM: beta-hydroxyacyl-(acyl-carrier-protein)
FT                   dehydratase FabZ; PFAM: UDP-3-0-acyl N-acetylglucosamine
FT                   deacetylase; thioesterase superfamily protein;
FT                   Beta-hydroxyacyl-(acyl-carrier-protein) dehydratase
FT                   FabA/FabZ; KEGG: cch:Cag_0162 bifunctional
FT                   UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine
FT                   deacetylase/(3R)-hydroxymyristoyl-[acyl-carrier-protein]
FT                   dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0660"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42959"
FT                   /db_xref="GOA:B4SDW8"
FT                   /db_xref="InterPro:IPR004463"
FT                   /db_xref="InterPro:IPR010084"
FT                   /db_xref="InterPro:IPR011334"
FT                   /db_xref="InterPro:IPR013114"
FT                   /db_xref="InterPro:IPR015870"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:B4SDW8"
FT                   /protein_id="ACF42959.1"
FT                   /translation="MLILQRTLQKEVSLWGSGLHTGKECMITFKPAPVNYGYRFVRTDI
FT                   DDSPEIPALIENVVDVLRGTTIGLNGVKVHTTEHVLGALYGLQIDNCRIEISGPEPPVM
FT                   DGSSHPFAAALIEAGFKEQDEPKNYLVIDETIEYHDANNSVDIVALPLDSFRITVMVDY
FT                   KNPALGSQHSGLFDLDKEFVKEFSSSRTFCFLSEVEALANQGIIKGGDVDNAIVIIDKT
FT                   MCEQELSDLGKKLGIESKNLVLGDNGILNNRELRFKNEPARHKLLDLLGDIALLGMPLK
FT                   AQVLAARPGHASNVEFVKQLKKYVDRNKLARQFQHEKKAGVIFDINAIQQILPHRYPFL
FT                   LIDKIIEFKLDEKIVSIKNVTINEPFFQGHFPGNPIMPGVLILEAMAQTGGIMMLNGND
FT                   NIKESVVLFMGIDKARFRKPVLPGDTLVIEAILTNKRRNICQFDAKAYVRGELVCEASL
FT                   MATVAPKSK"
FT   gene            complement(678887..679684)
FT                   /locus_tag="Ppha_0661"
FT   CDS_pept        complement(678887..679684)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0661"
FT                   /product="Inositol-phosphate phosphatase"
FT                   /EC_number="3.1.3.25"
FT                   /note="PFAM: inositol monophosphatase; KEGG:
FT                   cph:Cpha266_0543 inositol-phosphate phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0661"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42960"
FT                   /db_xref="GOA:B4SDW9"
FT                   /db_xref="InterPro:IPR000760"
FT                   /db_xref="InterPro:IPR020550"
FT                   /db_xref="InterPro:IPR020583"
FT                   /db_xref="InterPro:IPR022337"
FT                   /db_xref="InterPro:IPR033942"
FT                   /db_xref="UniProtKB/TrEMBL:B4SDW9"
FT                   /protein_id="ACF42960.1"
FT                   /translation="MRAQSKELQTAIRAAHAAGAITLEKFGELSHPEIQVKEFKDFVTD
FT                   VDKACEAAISSIITENFPEDSMLCEEGTIITGTSGRTWIVDPLDGTLNFIHSFPVFSIS
FT                   IALKGSDDELLTAVVYQPVLKELFTAERGQGAYLNGKKITISSRTDKESFLIGTGMPFK
FT                   EYHYLESYIGMLKEVIHDSAGIRRAGSAALDLAYTACGRFDGFWEYKLFPWDFAAGVLL
FT                   VREAGGTITDFSGDPDVFLKQSIIAGNNITHPLLLEKALKHFT"
FT   gene            679836..680312
FT                   /locus_tag="Ppha_0662"
FT   CDS_pept        679836..680312
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0662"
FT                   /product="TspO and MBR like protein"
FT                   /note="PFAM: TspO/MBR family protein; KEGG:
FT                   cph:Cpha266_0544 TspO and MBR like proteins"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0662"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42961"
FT                   /db_xref="GOA:B4SDX0"
FT                   /db_xref="InterPro:IPR004307"
FT                   /db_xref="InterPro:IPR038330"
FT                   /db_xref="UniProtKB/TrEMBL:B4SDX0"
FT                   /protein_id="ACF42961.1"
FT                   /translation="MNVNIPKLALCIGLCFVFAFAGSTFTPVPGSDWYYHVLNKPSWNP
FT                   PDWLFPPAWSLLFLLMGIALYLVVQQYSKETKIRGALIVFGAQLLLNLGWSAAFFGLHS
FT                   PVLAMVVIVLLWLAIVLTIVKFRAVSPMAGNLLIPYLMWVTFASFLNFTIVQLN"
FT   sig_peptide     679836..679901
FT                   /locus_tag="Ppha_0662"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.997) with cleavage site probability 0.877 at
FT                   residue 22"
FT   gene            complement(680401..680874)
FT                   /locus_tag="Ppha_0663"
FT   CDS_pept        complement(680401..680874)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0663"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cph:Cpha266_0064 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0663"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42962"
FT                   /db_xref="GOA:B4SDX1"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="InterPro:IPR025517"
FT                   /db_xref="UniProtKB/TrEMBL:B4SDX1"
FT                   /protein_id="ACF42962.1"
FT                   /translation="MKSWATPLATGTFVILAVTGILMFFKIEAGYTKPVHEWLSWAMVA
FT                   GVLLHIAANWKAFTGYFTRKPALAIIGAGLLITILSIVMPARNEQNPRMKMTRALEKSK
FT                   LETVAVVAGQKSESIILKLEQKGIAVESSAMSIREIAAKNGKKEMDVLAVIFN"
FT   gene            complement(681089..683092)
FT                   /locus_tag="Ppha_0664"
FT   CDS_pept        complement(681089..683092)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0664"
FT                   /product="acetate/CoA ligase"
FT                   /note="TIGRFAM: acetate/CoA ligase; PFAM: AMP-dependent
FT                   synthetase and ligase; KEGG: cph:Cpha266_0550
FT                   acetyl-coenzyme A synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0664"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42963"
FT                   /db_xref="GOA:B4SDX2"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR011904"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR032387"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:B4SDX2"
FT                   /protein_id="ACF42963.1"
FT                   /translation="MATEETTSNAQHTETSSSGEESISSVLSEKRKFPPSAEFSNNAHI
FT                   SSMEEYEKLYAAAEADPDAYWGGIAEQFHWFKKWDSVLEWNTPYAKWFNGGKTNICYNA
FT                   LDVHVNSWRKNKAAIIWEGEEGNQRVLTYGELHRQVSKFANVLKIAGIKPGDRVAIYMG
FT                   MVPELVIAVLACARVGAVHNVIFAGFSAHAITERVNDSRAKMVICADGTRRRGGSINLK
FT                   NIVDEAIVNTPSIRSVIVLKVTDEEIHMHNGMDHWWHDLMGLAADESEPAELDAEHPLF
FT                   VLYTSGSTGKPKGILHTTAGYMVHAASSFKYVFDIKDEDIYFCTADVGWITGHTYMIYG
FT                   PMLNGATILMYEGAPNYPQWDRFWDIINRHKVTIFYTAPTAIRAFIRAGNEWVTKHNLS
FT                   SLRLLGTVGEPINPEAWMWYQKVVGQEKCPIVDTWWQTETGGIMVSPLPGATPTKPGTA
FT                   TRPLPGIMVDVVRKDGTPCEANEGGYLVIKKPWPSMLRTIYGDNERYEKTYWSEFHDMY
FT                   FTGDGARKDEDGYIWIMGRVDDVVNVSGHRLGTSEVESALVSHEAVAEAAVVSRPDELK
FT                   GNALVAFVTLKDEYVGDMTLREALRNHVAKEIGPIAKPDEIRWAKGLPKTRSGKIMRRL
FT                   LRELATSNEIKGDVTTLEDFGVLENLRDQEND"
FT   gene            complement(683275..685698)
FT                   /locus_tag="Ppha_0665"
FT   CDS_pept        complement(683275..685698)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ppha_0665"
FT                   /product="leucyl-tRNA synthetase"
FT                   /note="TIGRFAM: leucyl-tRNA synthetase; KEGG: cch:Cag_1688
FT                   leucyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Ppha_0665"
FT                   /db_xref="EnsemblGenomes-Tr:ACF42964"
FT                   /db_