(data stored in ACNUC7421 zone)

EMBL: CP001111

ID   CP001111; SV 1; circular; genomic DNA; STD; PRO; 4573969 BP.
XX
AC   CP001111; AAVZ01000000-AAVZ01000147;
XX
PR   Project:PRJNA17107;
XX
DT   22-JUL-2008 (Rel. 96, Created)
DT   12-DEC-2013 (Rel. 119, Last updated, Version 6)
XX
DE   Stenotrophomonas maltophilia R551-3, complete genome.
XX
KW   .
XX
OS   Stenotrophomonas maltophilia R551-3
OC   Bacteria; Proteobacteria; Gammaproteobacteria; Xanthomonadales;
OC   Xanthomonadaceae; Stenotrophomonas; Stenotrophomonas maltophilia group.
XX
RN   [1]
RP   1-4573969
RG   US DOE Joint Genome Institute
RA   Lucas S., Copeland A., Lapidus A., Glavina del Rio T., Dalin E., Tice H.,
RA   Pitluck S., Chain P., Malfatti S., Shin M., Vergez L., Lang D., Schmutz J.,
RA   Larimer F., Land M., Hauser L., Kyrpides N., Mikhailova N., Taghavi S.,
RA   Monchy S., Newman L., Vangronsveld J., van der Lelie D., Richardson P.;
RT   "Complete sequence of Stenotrophomonas maltophilia R551-3";
RL   Unpublished.
XX
RN   [2]
RP   1-4573969
RG   US DOE Joint Genome Institute
RA   Lucas S., Copeland A., Lapidus A., Glavina del Rio T., Dalin E., Tice H.,
RA   Pitluck S., Chain P., Malfatti S., Shin M., Vergez L., Lang D., Schmutz J.,
RA   Larimer F., Land M., Hauser L., Kyrpides N., Mikhailova N., Taghavi S.,
RA   Monchy S., Newman L., Vangronsveld J., van der Lelie D., Richardson P.;
RT   ;
RL   Submitted (25-JUN-2008) to the INSDC.
RL   US DOE Joint Genome Institute, 2800 Mitchell Drive B100, Walnut Creek, CA
RL   94598-1698, USA
XX
DR   MD5; c9283732a994e7817325f583bbbf0ff9.
DR   BioSample; SAMN00623065.
DR   EnsemblGenomes-Gn; EBG00001240996.
DR   EnsemblGenomes-Gn; EBG00001240997.
DR   EnsemblGenomes-Gn; EBG00001240998.
DR   EnsemblGenomes-Gn; EBG00001240999.
DR   EnsemblGenomes-Gn; EBG00001241000.
DR   EnsemblGenomes-Gn; EBG00001241001.
DR   EnsemblGenomes-Gn; EBG00001241002.
DR   EnsemblGenomes-Gn; EBG00001241003.
DR   EnsemblGenomes-Gn; EBG00001241004.
DR   EnsemblGenomes-Gn; EBG00001241005.
DR   EnsemblGenomes-Gn; EBG00001241006.
DR   EnsemblGenomes-Gn; EBG00001241007.
DR   EnsemblGenomes-Gn; EBG00001241008.
DR   EnsemblGenomes-Gn; EBG00001241009.
DR   EnsemblGenomes-Gn; EBG00001241010.
DR   EnsemblGenomes-Gn; EBG00001241011.
DR   EnsemblGenomes-Gn; EBG00001241012.
DR   EnsemblGenomes-Gn; EBG00001241013.
DR   EnsemblGenomes-Gn; EBG00001241014.
DR   EnsemblGenomes-Gn; EBG00001241015.
DR   EnsemblGenomes-Gn; EBG00001241016.
DR   EnsemblGenomes-Gn; EBG00001241017.
DR   EnsemblGenomes-Gn; EBG00001241018.
DR   EnsemblGenomes-Gn; EBG00001241019.
DR   EnsemblGenomes-Gn; EBG00001241020.
DR   EnsemblGenomes-Gn; EBG00001241021.
DR   EnsemblGenomes-Gn; EBG00001241022.
DR   EnsemblGenomes-Gn; EBG00001241023.
DR   EnsemblGenomes-Gn; EBG00001241024.
DR   EnsemblGenomes-Gn; EBG00001241025.
DR   EnsemblGenomes-Gn; EBG00001241026.
DR   EnsemblGenomes-Gn; EBG00001241027.
DR   EnsemblGenomes-Gn; EBG00001241028.
DR   EnsemblGenomes-Gn; EBG00001241029.
DR   EnsemblGenomes-Gn; EBG00001241030.
DR   EnsemblGenomes-Gn; EBG00001241031.
DR   EnsemblGenomes-Gn; EBG00001241032.
DR   EnsemblGenomes-Gn; EBG00001241033.
DR   EnsemblGenomes-Gn; EBG00001241034.
DR   EnsemblGenomes-Gn; EBG00001241035.
DR   EnsemblGenomes-Gn; EBG00001241036.
DR   EnsemblGenomes-Gn; EBG00001241037.
DR   EnsemblGenomes-Gn; EBG00001241038.
DR   EnsemblGenomes-Gn; EBG00001241039.
DR   EnsemblGenomes-Gn; EBG00001241040.
DR   EnsemblGenomes-Gn; EBG00001241041.
DR   EnsemblGenomes-Gn; EBG00001241042.
DR   EnsemblGenomes-Gn; EBG00001241043.
DR   EnsemblGenomes-Gn; EBG00001241044.
DR   EnsemblGenomes-Gn; EBG00001241045.
DR   EnsemblGenomes-Gn; EBG00001241046.
DR   EnsemblGenomes-Gn; EBG00001241047.
DR   EnsemblGenomes-Gn; EBG00001241048.
DR   EnsemblGenomes-Gn; EBG00001241049.
DR   EnsemblGenomes-Gn; EBG00001241050.
DR   EnsemblGenomes-Gn; EBG00001241051.
DR   EnsemblGenomes-Gn; EBG00001241052.
DR   EnsemblGenomes-Gn; EBG00001241053.
DR   EnsemblGenomes-Gn; EBG00001241054.
DR   EnsemblGenomes-Gn; EBG00001241055.
DR   EnsemblGenomes-Gn; EBG00001241056.
DR   EnsemblGenomes-Gn; EBG00001241057.
DR   EnsemblGenomes-Gn; EBG00001241058.
DR   EnsemblGenomes-Gn; EBG00001241059.
DR   EnsemblGenomes-Gn; EBG00001241060.
DR   EnsemblGenomes-Gn; EBG00001241061.
DR   EnsemblGenomes-Gn; EBG00001241062.
DR   EnsemblGenomes-Gn; EBG00001241063.
DR   EnsemblGenomes-Gn; EBG00001241064.
DR   EnsemblGenomes-Gn; EBG00001241065.
DR   EnsemblGenomes-Gn; EBG00001241066.
DR   EnsemblGenomes-Gn; EBG00001241067.
DR   EnsemblGenomes-Gn; EBG00001241068.
DR   EnsemblGenomes-Gn; EBG00001241069.
DR   EnsemblGenomes-Gn; EBG00001241070.
DR   EnsemblGenomes-Gn; EBG00001241071.
DR   EnsemblGenomes-Gn; EBG00001241072.
DR   EnsemblGenomes-Gn; EBG00001241073.
DR   EnsemblGenomes-Gn; EBG00001241074.
DR   EnsemblGenomes-Gn; EBG00001241075.
DR   EnsemblGenomes-Gn; EBG00001241076.
DR   EnsemblGenomes-Gn; EBG00001241077.
DR   EnsemblGenomes-Gn; EBG00001241078.
DR   EnsemblGenomes-Gn; EBG00001241079.
DR   EnsemblGenomes-Gn; EBG00001241080.
DR   EnsemblGenomes-Gn; EBG00001241081.
DR   EnsemblGenomes-Gn; EBG00001241082.
DR   EnsemblGenomes-Gn; EBG00001241083.
DR   EnsemblGenomes-Gn; EBG00001241084.
DR   EnsemblGenomes-Gn; EBG00001241085.
DR   EnsemblGenomes-Gn; EBG00001241086.
DR   EnsemblGenomes-Gn; EBG00001241087.
DR   EnsemblGenomes-Gn; EBG00001241088.
DR   EnsemblGenomes-Gn; EBG00001241089.
DR   EnsemblGenomes-Gn; EBG00001241090.
DR   EnsemblGenomes-Gn; EBG00001241091.
DR   EnsemblGenomes-Gn; EBG00001241092.
DR   EnsemblGenomes-Gn; EBG00001241093.
DR   EnsemblGenomes-Gn; EBG00001241094.
DR   EnsemblGenomes-Gn; EBG00001241095.
DR   EnsemblGenomes-Gn; EBG00001241096.
DR   EnsemblGenomes-Gn; EBG00001241097.
DR   EnsemblGenomes-Gn; EBG00001241098.
DR   EnsemblGenomes-Gn; EBG00001241099.
DR   EnsemblGenomes-Gn; EBG00001241100.
DR   EnsemblGenomes-Gn; EBG00001241101.
DR   EnsemblGenomes-Gn; EBG00001241102.
DR   EnsemblGenomes-Gn; EBG00001241103.
DR   EnsemblGenomes-Gn; EBG00001241104.
DR   EnsemblGenomes-Gn; EBG00001241105.
DR   EnsemblGenomes-Gn; EBG00001241106.
DR   EnsemblGenomes-Gn; EBG00001241107.
DR   EnsemblGenomes-Gn; EBG00001241108.
DR   EnsemblGenomes-Gn; Smal_R0001.
DR   EnsemblGenomes-Gn; Smal_R0002.
DR   EnsemblGenomes-Gn; Smal_R0003.
DR   EnsemblGenomes-Gn; Smal_R0004.
DR   EnsemblGenomes-Gn; Smal_R0005.
DR   EnsemblGenomes-Gn; Smal_R0006.
DR   EnsemblGenomes-Gn; Smal_R0007.
DR   EnsemblGenomes-Gn; Smal_R0008.
DR   EnsemblGenomes-Gn; Smal_R0009.
DR   EnsemblGenomes-Gn; Smal_R0010.
DR   EnsemblGenomes-Gn; Smal_R0011.
DR   EnsemblGenomes-Gn; Smal_R0012.
DR   EnsemblGenomes-Gn; Smal_R0013.
DR   EnsemblGenomes-Gn; Smal_R0014.
DR   EnsemblGenomes-Gn; Smal_R0015.
DR   EnsemblGenomes-Gn; Smal_R0016.
DR   EnsemblGenomes-Gn; Smal_R0017.
DR   EnsemblGenomes-Gn; Smal_R0018.
DR   EnsemblGenomes-Gn; Smal_R0019.
DR   EnsemblGenomes-Gn; Smal_R0020.
DR   EnsemblGenomes-Gn; Smal_R0021.
DR   EnsemblGenomes-Gn; Smal_R0022.
DR   EnsemblGenomes-Gn; Smal_R0023.
DR   EnsemblGenomes-Gn; Smal_R0024.
DR   EnsemblGenomes-Gn; Smal_R0025.
DR   EnsemblGenomes-Gn; Smal_R0026.
DR   EnsemblGenomes-Gn; Smal_R0027.
DR   EnsemblGenomes-Gn; Smal_R0028.
DR   EnsemblGenomes-Gn; Smal_R0029.
DR   EnsemblGenomes-Gn; Smal_R0030.
DR   EnsemblGenomes-Gn; Smal_R0031.
DR   EnsemblGenomes-Gn; Smal_R0032.
DR   EnsemblGenomes-Gn; Smal_R0033.
DR   EnsemblGenomes-Gn; Smal_R0034.
DR   EnsemblGenomes-Gn; Smal_R0035.
DR   EnsemblGenomes-Gn; Smal_R0036.
DR   EnsemblGenomes-Gn; Smal_R0037.
DR   EnsemblGenomes-Gn; Smal_R0038.
DR   EnsemblGenomes-Gn; Smal_R0039.
DR   EnsemblGenomes-Gn; Smal_R0040.
DR   EnsemblGenomes-Gn; Smal_R0041.
DR   EnsemblGenomes-Gn; Smal_R0042.
DR   EnsemblGenomes-Gn; Smal_R0043.
DR   EnsemblGenomes-Gn; Smal_R0044.
DR   EnsemblGenomes-Gn; Smal_R0045.
DR   EnsemblGenomes-Gn; Smal_R0046.
DR   EnsemblGenomes-Gn; Smal_R0047.
DR   EnsemblGenomes-Gn; Smal_R0048.
DR   EnsemblGenomes-Gn; Smal_R0049.
DR   EnsemblGenomes-Gn; Smal_R0050.
DR   EnsemblGenomes-Gn; Smal_R0051.
DR   EnsemblGenomes-Gn; Smal_R0052.
DR   EnsemblGenomes-Gn; Smal_R0053.
DR   EnsemblGenomes-Gn; Smal_R0054.
DR   EnsemblGenomes-Gn; Smal_R0055.
DR   EnsemblGenomes-Gn; Smal_R0056.
DR   EnsemblGenomes-Gn; Smal_R0057.
DR   EnsemblGenomes-Gn; Smal_R0058.
DR   EnsemblGenomes-Gn; Smal_R0059.
DR   EnsemblGenomes-Gn; Smal_R0060.
DR   EnsemblGenomes-Gn; Smal_R0061.
DR   EnsemblGenomes-Gn; Smal_R0062.
DR   EnsemblGenomes-Gn; Smal_R0063.
DR   EnsemblGenomes-Gn; Smal_R0064.
DR   EnsemblGenomes-Gn; Smal_R0065.
DR   EnsemblGenomes-Gn; Smal_R0066.
DR   EnsemblGenomes-Gn; Smal_R0067.
DR   EnsemblGenomes-Gn; Smal_R0068.
DR   EnsemblGenomes-Gn; Smal_R0069.
DR   EnsemblGenomes-Gn; Smal_R0070.
DR   EnsemblGenomes-Gn; Smal_R0071.
DR   EnsemblGenomes-Gn; Smal_R0072.
DR   EnsemblGenomes-Gn; Smal_R0073.
DR   EnsemblGenomes-Gn; Smal_R0074.
DR   EnsemblGenomes-Gn; Smal_R0075.
DR   EnsemblGenomes-Gn; Smal_R0076.
DR   EnsemblGenomes-Gn; Smal_R0077.
DR   EnsemblGenomes-Gn; Smal_R0078.
DR   EnsemblGenomes-Gn; Smal_R0079.
DR   EnsemblGenomes-Gn; Smal_R0080.
DR   EnsemblGenomes-Gn; Smal_R0081.
DR   EnsemblGenomes-Gn; Smal_R0082.
DR   EnsemblGenomes-Gn; Smal_R0083.
DR   EnsemblGenomes-Gn; Smal_R0084.
DR   EnsemblGenomes-Gn; Smal_R0085.
DR   EnsemblGenomes-Gn; Smal_R0086.
DR   EnsemblGenomes-Gn; Smal_R0087.
DR   EnsemblGenomes-Gn; Smal_R0088.
DR   EnsemblGenomes-Gn; Smal_R0089.
DR   EnsemblGenomes-Gn; Smal_R0090.
DR   EnsemblGenomes-Tr; EBT00001586307.
DR   EnsemblGenomes-Tr; EBT00001586308.
DR   EnsemblGenomes-Tr; EBT00001586309.
DR   EnsemblGenomes-Tr; EBT00001586310.
DR   EnsemblGenomes-Tr; EBT00001586311.
DR   EnsemblGenomes-Tr; EBT00001586312.
DR   EnsemblGenomes-Tr; EBT00001586313.
DR   EnsemblGenomes-Tr; EBT00001586314.
DR   EnsemblGenomes-Tr; EBT00001586315.
DR   EnsemblGenomes-Tr; EBT00001586316.
DR   EnsemblGenomes-Tr; EBT00001586317.
DR   EnsemblGenomes-Tr; EBT00001586318.
DR   EnsemblGenomes-Tr; EBT00001586319.
DR   EnsemblGenomes-Tr; EBT00001586320.
DR   EnsemblGenomes-Tr; EBT00001586321.
DR   EnsemblGenomes-Tr; EBT00001586322.
DR   EnsemblGenomes-Tr; EBT00001586323.
DR   EnsemblGenomes-Tr; EBT00001586324.
DR   EnsemblGenomes-Tr; EBT00001586325.
DR   EnsemblGenomes-Tr; EBT00001586326.
DR   EnsemblGenomes-Tr; EBT00001586327.
DR   EnsemblGenomes-Tr; EBT00001586328.
DR   EnsemblGenomes-Tr; EBT00001586329.
DR   EnsemblGenomes-Tr; EBT00001586330.
DR   EnsemblGenomes-Tr; EBT00001586331.
DR   EnsemblGenomes-Tr; EBT00001586332.
DR   EnsemblGenomes-Tr; EBT00001586333.
DR   EnsemblGenomes-Tr; EBT00001586334.
DR   EnsemblGenomes-Tr; EBT00001586335.
DR   EnsemblGenomes-Tr; EBT00001586336.
DR   EnsemblGenomes-Tr; EBT00001586337.
DR   EnsemblGenomes-Tr; EBT00001586338.
DR   EnsemblGenomes-Tr; EBT00001586339.
DR   EnsemblGenomes-Tr; EBT00001586340.
DR   EnsemblGenomes-Tr; EBT00001586341.
DR   EnsemblGenomes-Tr; EBT00001586342.
DR   EnsemblGenomes-Tr; EBT00001586343.
DR   EnsemblGenomes-Tr; EBT00001586344.
DR   EnsemblGenomes-Tr; EBT00001586345.
DR   EnsemblGenomes-Tr; EBT00001586346.
DR   EnsemblGenomes-Tr; EBT00001586347.
DR   EnsemblGenomes-Tr; EBT00001586348.
DR   EnsemblGenomes-Tr; EBT00001586349.
DR   EnsemblGenomes-Tr; EBT00001586350.
DR   EnsemblGenomes-Tr; EBT00001586351.
DR   EnsemblGenomes-Tr; EBT00001586352.
DR   EnsemblGenomes-Tr; EBT00001586353.
DR   EnsemblGenomes-Tr; EBT00001586354.
DR   EnsemblGenomes-Tr; EBT00001586355.
DR   EnsemblGenomes-Tr; EBT00001586356.
DR   EnsemblGenomes-Tr; EBT00001586357.
DR   EnsemblGenomes-Tr; EBT00001586358.
DR   EnsemblGenomes-Tr; EBT00001586359.
DR   EnsemblGenomes-Tr; EBT00001586360.
DR   EnsemblGenomes-Tr; EBT00001586361.
DR   EnsemblGenomes-Tr; EBT00001586362.
DR   EnsemblGenomes-Tr; EBT00001586363.
DR   EnsemblGenomes-Tr; EBT00001586364.
DR   EnsemblGenomes-Tr; EBT00001586365.
DR   EnsemblGenomes-Tr; EBT00001586366.
DR   EnsemblGenomes-Tr; EBT00001586367.
DR   EnsemblGenomes-Tr; EBT00001586368.
DR   EnsemblGenomes-Tr; EBT00001586369.
DR   EnsemblGenomes-Tr; EBT00001586370.
DR   EnsemblGenomes-Tr; EBT00001586371.
DR   EnsemblGenomes-Tr; EBT00001586372.
DR   EnsemblGenomes-Tr; EBT00001586373.
DR   EnsemblGenomes-Tr; EBT00001586374.
DR   EnsemblGenomes-Tr; EBT00001586375.
DR   EnsemblGenomes-Tr; EBT00001586376.
DR   EnsemblGenomes-Tr; EBT00001586377.
DR   EnsemblGenomes-Tr; EBT00001586378.
DR   EnsemblGenomes-Tr; EBT00001586379.
DR   EnsemblGenomes-Tr; EBT00001586380.
DR   EnsemblGenomes-Tr; EBT00001586381.
DR   EnsemblGenomes-Tr; EBT00001586382.
DR   EnsemblGenomes-Tr; EBT00001586383.
DR   EnsemblGenomes-Tr; EBT00001586384.
DR   EnsemblGenomes-Tr; EBT00001586385.
DR   EnsemblGenomes-Tr; EBT00001586386.
DR   EnsemblGenomes-Tr; EBT00001586387.
DR   EnsemblGenomes-Tr; EBT00001586388.
DR   EnsemblGenomes-Tr; EBT00001586389.
DR   EnsemblGenomes-Tr; EBT00001586390.
DR   EnsemblGenomes-Tr; EBT00001586391.
DR   EnsemblGenomes-Tr; EBT00001586392.
DR   EnsemblGenomes-Tr; EBT00001586393.
DR   EnsemblGenomes-Tr; EBT00001586394.
DR   EnsemblGenomes-Tr; EBT00001586395.
DR   EnsemblGenomes-Tr; EBT00001586396.
DR   EnsemblGenomes-Tr; EBT00001586397.
DR   EnsemblGenomes-Tr; EBT00001586398.
DR   EnsemblGenomes-Tr; EBT00001586399.
DR   EnsemblGenomes-Tr; EBT00001586400.
DR   EnsemblGenomes-Tr; EBT00001586401.
DR   EnsemblGenomes-Tr; EBT00001586402.
DR   EnsemblGenomes-Tr; EBT00001586403.
DR   EnsemblGenomes-Tr; EBT00001586404.
DR   EnsemblGenomes-Tr; EBT00001586405.
DR   EnsemblGenomes-Tr; EBT00001586406.
DR   EnsemblGenomes-Tr; EBT00001586407.
DR   EnsemblGenomes-Tr; EBT00001586408.
DR   EnsemblGenomes-Tr; EBT00001586409.
DR   EnsemblGenomes-Tr; EBT00001586410.
DR   EnsemblGenomes-Tr; EBT00001586411.
DR   EnsemblGenomes-Tr; EBT00001586412.
DR   EnsemblGenomes-Tr; EBT00001586413.
DR   EnsemblGenomes-Tr; EBT00001586414.
DR   EnsemblGenomes-Tr; EBT00001586415.
DR   EnsemblGenomes-Tr; EBT00001586416.
DR   EnsemblGenomes-Tr; EBT00001586417.
DR   EnsemblGenomes-Tr; EBT00001586418.
DR   EnsemblGenomes-Tr; EBT00001586419.
DR   EnsemblGenomes-Tr; Smal_R0001-1.
DR   EnsemblGenomes-Tr; Smal_R0002-1.
DR   EnsemblGenomes-Tr; Smal_R0003-1.
DR   EnsemblGenomes-Tr; Smal_R0004-1.
DR   EnsemblGenomes-Tr; Smal_R0005-1.
DR   EnsemblGenomes-Tr; Smal_R0006-1.
DR   EnsemblGenomes-Tr; Smal_R0007-1.
DR   EnsemblGenomes-Tr; Smal_R0008-1.
DR   EnsemblGenomes-Tr; Smal_R0009-1.
DR   EnsemblGenomes-Tr; Smal_R0010-1.
DR   EnsemblGenomes-Tr; Smal_R0011-1.
DR   EnsemblGenomes-Tr; Smal_R0012-1.
DR   EnsemblGenomes-Tr; Smal_R0013-1.
DR   EnsemblGenomes-Tr; Smal_R0014-1.
DR   EnsemblGenomes-Tr; Smal_R0015-1.
DR   EnsemblGenomes-Tr; Smal_R0016-1.
DR   EnsemblGenomes-Tr; Smal_R0017-1.
DR   EnsemblGenomes-Tr; Smal_R0018-1.
DR   EnsemblGenomes-Tr; Smal_R0019-1.
DR   EnsemblGenomes-Tr; Smal_R0020-1.
DR   EnsemblGenomes-Tr; Smal_R0021-1.
DR   EnsemblGenomes-Tr; Smal_R0022-1.
DR   EnsemblGenomes-Tr; Smal_R0023-1.
DR   EnsemblGenomes-Tr; Smal_R0024-1.
DR   EnsemblGenomes-Tr; Smal_R0025-1.
DR   EnsemblGenomes-Tr; Smal_R0026-1.
DR   EnsemblGenomes-Tr; Smal_R0027-1.
DR   EnsemblGenomes-Tr; Smal_R0028-1.
DR   EnsemblGenomes-Tr; Smal_R0029-1.
DR   EnsemblGenomes-Tr; Smal_R0030-1.
DR   EnsemblGenomes-Tr; Smal_R0031-1.
DR   EnsemblGenomes-Tr; Smal_R0032-1.
DR   EnsemblGenomes-Tr; Smal_R0033-1.
DR   EnsemblGenomes-Tr; Smal_R0034-1.
DR   EnsemblGenomes-Tr; Smal_R0035-1.
DR   EnsemblGenomes-Tr; Smal_R0036-1.
DR   EnsemblGenomes-Tr; Smal_R0037-1.
DR   EnsemblGenomes-Tr; Smal_R0038-1.
DR   EnsemblGenomes-Tr; Smal_R0039-1.
DR   EnsemblGenomes-Tr; Smal_R0040-1.
DR   EnsemblGenomes-Tr; Smal_R0041-1.
DR   EnsemblGenomes-Tr; Smal_R0042-1.
DR   EnsemblGenomes-Tr; Smal_R0043-1.
DR   EnsemblGenomes-Tr; Smal_R0044-1.
DR   EnsemblGenomes-Tr; Smal_R0045-1.
DR   EnsemblGenomes-Tr; Smal_R0046-1.
DR   EnsemblGenomes-Tr; Smal_R0047-1.
DR   EnsemblGenomes-Tr; Smal_R0048-1.
DR   EnsemblGenomes-Tr; Smal_R0049-1.
DR   EnsemblGenomes-Tr; Smal_R0050-1.
DR   EnsemblGenomes-Tr; Smal_R0051-1.
DR   EnsemblGenomes-Tr; Smal_R0052-1.
DR   EnsemblGenomes-Tr; Smal_R0053-1.
DR   EnsemblGenomes-Tr; Smal_R0054-1.
DR   EnsemblGenomes-Tr; Smal_R0055-1.
DR   EnsemblGenomes-Tr; Smal_R0056-1.
DR   EnsemblGenomes-Tr; Smal_R0057-1.
DR   EnsemblGenomes-Tr; Smal_R0058-1.
DR   EnsemblGenomes-Tr; Smal_R0059-1.
DR   EnsemblGenomes-Tr; Smal_R0060-1.
DR   EnsemblGenomes-Tr; Smal_R0061-1.
DR   EnsemblGenomes-Tr; Smal_R0062-1.
DR   EnsemblGenomes-Tr; Smal_R0063-1.
DR   EnsemblGenomes-Tr; Smal_R0064-1.
DR   EnsemblGenomes-Tr; Smal_R0065-1.
DR   EnsemblGenomes-Tr; Smal_R0066-1.
DR   EnsemblGenomes-Tr; Smal_R0067-1.
DR   EnsemblGenomes-Tr; Smal_R0068-1.
DR   EnsemblGenomes-Tr; Smal_R0069-1.
DR   EnsemblGenomes-Tr; Smal_R0070-1.
DR   EnsemblGenomes-Tr; Smal_R0071-1.
DR   EnsemblGenomes-Tr; Smal_R0072-1.
DR   EnsemblGenomes-Tr; Smal_R0073-1.
DR   EnsemblGenomes-Tr; Smal_R0074-1.
DR   EnsemblGenomes-Tr; Smal_R0075-1.
DR   EnsemblGenomes-Tr; Smal_R0076-1.
DR   EnsemblGenomes-Tr; Smal_R0077-1.
DR   EnsemblGenomes-Tr; Smal_R0078-1.
DR   EnsemblGenomes-Tr; Smal_R0079-1.
DR   EnsemblGenomes-Tr; Smal_R0080-1.
DR   EnsemblGenomes-Tr; Smal_R0081-1.
DR   EnsemblGenomes-Tr; Smal_R0082-1.
DR   EnsemblGenomes-Tr; Smal_R0083-1.
DR   EnsemblGenomes-Tr; Smal_R0084-1.
DR   EnsemblGenomes-Tr; Smal_R0085-1.
DR   EnsemblGenomes-Tr; Smal_R0086-1.
DR   EnsemblGenomes-Tr; Smal_R0087-1.
DR   EnsemblGenomes-Tr; Smal_R0088-1.
DR   EnsemblGenomes-Tr; Smal_R0089-1.
DR   EnsemblGenomes-Tr; Smal_R0090-1.
DR   EuropePMC; PMC2772435; 19749062.
DR   EuropePMC; PMC3715506; 23874407.
DR   EuropePMC; PMC4054175; 24769700.
DR   EuropePMC; PMC4437187; 26042098.
DR   EuropePMC; PMC4559654; 26388863.
DR   EuropePMC; PMC4837224; 26861677.
DR   EuropePMC; PMC5512189; 28748209.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00002; 5_8S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00080; yybP-ykoY.
DR   RFAM; RF00162; SAM.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00504; Glycine.
DR   RFAM; RF01057; SAH_riboswitch.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01695; C4.
DR   RFAM; RF01734; crcB.
DR   RFAM; RF01766; cspA.
DR   RFAM; RF01852; tRNA-Sec.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   RFAM; RF01989; SECIS_3.
DR   RFAM; RF02223; sX4.
DR   RFAM; RF02224; sX5.
DR   RFAM; RF02225; sX6.
DR   RFAM; RF02230; sX11.
DR   RFAM; RF02232; sX13.
DR   RFAM; RF02234; sX15.
DR   RFAM; RF02235; asX1.
DR   RFAM; RF02240; Xoo1.
DR   RFAM; RF02242; Xoo5.
DR   RFAM; RF02243; Xoo8.
DR   SILVA-LSU; CP001111.
DR   SILVA-SSU; CP001111.
XX
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID: 4002722
CC   Source DNA and bacteria available from Daniel van der Lelie
CC   (vdlelied@bnl.gov) and Safiyh Taghavi (taghavis@bnl.gov)
CC   Contacts: Daniel van der Lelie (vdlelied@bnl.gov)
CC        Safiyh Taghavi (taghavis@bnl.gov)
CC        David Bruce (microbes@cuba.jgi-psf.org)
CC   Quality assurance done by JGI-Stanford
CC   Annotation done by JGI-ORNL and JGI-PGF
CC   Finishing done by JGI-LLNL
CC   Finished microbial genomes have been curated to close all gaps with
CC   greater than 98% coverage of at least two independent clones. Each
CC   base pair has a minimum q (quality) value of 30 and the total error
CC   rate is less than one per 50000.
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. it is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..4573969
FT                   /organism="Stenotrophomonas maltophilia R551-3"
FT                   /strain="R551-3"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:391008"
FT   gene            215..1546
FT                   /locus_tag="Smal_0001"
FT   CDS_pept        215..1546
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0001"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /note="KEGG: xac:XAC0001 chromosomal replication initiation
FT                   protein; TIGRFAM: chromosomal replication initiator protein
FT                   DnaA; PFAM: Chromosomal replication initiator DnaA domain;
FT                   Chromosomal replication initiator DnaA; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49706"
FT                   /db_xref="GOA:B4SU11"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4SU11"
FT                   /protein_id="ACF49706.1"
FT                   /translation="MDAWSRSLERLEAEFPPEDVHTWLKPLQADLRVDSLVLYAPNAFI
FT                   VDQVRELYLARIRELLAHFAGFSDVFLEIGSRPRPVEAQNAPFSTPSAHVSSEPQVPFA
FT                   GNLDNHYTFANFVEGRSNQLGLAAAFQAAQKPGDRAHNPLLLYGGTGLGKTHLMFAAGN
FT                   AMRQANPGAKVLYLRSEQFFSAMIRALQEKTMDQFKRQFQQVDALLIDDIQFFAGKDRT
FT                   QEEFFHTFNALFDGKQQIILTCDRYPREVEGLEARLKSRLAWGLSVAIEPPDFETRAAI
FT                   VLAKARERGAEIPDDVAFLIAKKMRSNVRDLEGALNTLTARANFTGRAITTEFAQETLR
FT                   DLLRAQQQAISIPNIQKTVADYYGLQIKDLLSKRRTRSLARPRQVAMALTKELTEHSLP
FT                   EIGDAFAGRDHTTVLHACRQIRTLMEADGKLREDWDKLIRKLSE"
FT   gene            1823..2923
FT                   /locus_tag="Smal_0002"
FT   CDS_pept        1823..2923
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0002"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="KEGG: xac:XAC0002 DNA polymerase III subunit beta;
FT                   TIGRFAM: DNA polymerase III, beta subunit; PFAM: DNA
FT                   polymerase III beta chain"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49707"
FT                   /db_xref="GOA:B4SU12"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:B4SU12"
FT                   /protein_id="ACF49707.1"
FT                   /translation="MRFTLQREAFLKPLAQVVNVVERRQTLPVLANFLVQVQNGQLSLT
FT                   GTDLEVEMVSRIAVEDAQDGETTIPARKLFEIIRALPDGSRITVSQTGDKITVQAGRSR
FT                   FTLATLPSNDFPSVDEVEATERVAIGEATLKELIERTAFAMAQQDVRYYLNGLLFDLRG
FT                   DALRTVATDGHRLALCETDLAKPSGSKRQIIVPRKGVTELQRLLESGDREIELEVGRSH
FT                   VRVKRDDVTFTSKLIDGRFPDYEAVIPIGADREVKVNRESLRASLQRAAILSNEKYRGI
FT                   RVEVSPGNLKISAHNPEQEEAQEEIEADTTVSDLAIGFNVNYLLDALSALRDEEVIIQL
FT                   RDSNSSALVRESSSEKSRHVVMPLRL"
FT   gene            3921..5015
FT                   /locus_tag="Smal_0003"
FT   CDS_pept        3921..5015
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0003"
FT                   /product="DNA replication and repair protein RecF"
FT                   /note="TIGRFAM: DNA replication and repair protein RecF;
FT                   PFAM: SMC domain protein; KEGG: xcb:XC_0003 recombination
FT                   protein F"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49708"
FT                   /db_xref="GOA:B4SR07"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4SR07"
FT                   /protein_id="ACF49708.1"
FT                   /translation="MQIRRLALHQLRRFNAVELSPQPGLNLLTGDNGAGKTSILEALHL
FT                   MAYGRSFRGRVRDGLVRQGQEALEIFVEWDEQRASHPPHRRKAGLRHSGQDWKGRLDGE
FT                   DVAQLGNLCAALAVVTFEPGSHALVSGGGEPRRRFLDWGLFHVEPDFLSLWRRYSRALK
FT                   QRNALLKQGGPSRMLDTWDHELAEAGEPLTSRRQHYLERLQQRTVALAAELAPQLGIQA
FT                   MELSPGWRRHELPLADALLLARERDRQAGYTSVGPHRADWSVDFHNIPGRDALSRGQAK
FT                   LTALACLLAQAEDYAEQRGEWPVIALDDLASELDRTHQARVLERLLGGPAQIFVTATET
FT                   PAALQELTHIARFHVEHAQIVAVP"
FT   gene            5128..7587
FT                   /locus_tag="Smal_0004"
FT   CDS_pept        5128..7587
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0004"
FT                   /product="DNA gyrase, B subunit"
FT                   /EC_number="5.99.1.3"
FT                   /note="KEGG: xcb:XC_0004 DNA gyrase subunit B; TIGRFAM: DNA
FT                   gyrase, B subunit; PFAM: DNA gyrase subunit B domain
FT                   protein; ATP-binding region ATPase domain protein; TOPRIM
FT                   domain protein; DNA topoisomerase type IIA subunit B region
FT                   2 domain protein; SMART: DNA topoisomerase II"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49709"
FT                   /db_xref="GOA:B4SR08"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR034160"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR041423"
FT                   /db_xref="UniProtKB/TrEMBL:B4SR08"
FT                   /protein_id="ACF49709.1"
FT                   /translation="MSDEQNTPANNGNYDANSITALEGLEAVRKRPGMYIGDVHDGTGL
FT                   HHMVFEVVDNSIDEALAGHADHVAVTIHADGSVSVSDNGRGIPTGKHEQMSAKLGREVS
FT                   AAEVVMTVLHAGGKFDDNSYKVSGGLHGVGVSVVNALSQKLLVDVFQGGFHYQQEFSNG
FT                   AAVTPLAKLESTTKRGTTVRFWPSTVAFHDNVEYHYDILARRLRELSFLNSGVKIVLAD
FT                   ERGDGRRDDFHYEGGIRSFVEHLAQLKTPLHPNVISVTGEHNNIVVDVALQWTDSYQET
FT                   MYCFTNNIPQKDGGTHLAGFRGALTRVLNNYIEQNGIAKQAKINLTGDDMREGMIAVLS
FT                   VKVPDPSFSSQTKEKLVSSDVRPAVENAFGARLEEFLQENPNEAKAIAGKIVDAARARE
FT                   AARKARDLTRRKGALDIAGLPGKLADCQEKDPALSELFIVEGDSAGGSAKQGRNRKNQA
FT                   VLPLRGKILNVERARFDRMLASDQVGTLITALGTGIGRDEYNPDKLRYHKIIIMTDADV
FT                   DGAHIRTLLLTFFYRQMPELIERGYVYIGLPPLYKIKQGKQELYLKDDPALDSYLASSA
FT                   VENAALVPATGEPGIEGLALEKLLLTYAAAQDSIERNAHRYDRNVLEALVDFVPMDMDS
FT                   LRNAGEGEGLDALAKRLNQGSLGSPRFTLELQEANEQRPAAVLVTRRHMGEELIQVLPL
FT                   SAFESGELRAIHQASSLLHGLVREGAIISRGAKSIEVDTFAKAQNWLLEEAKRGRQIQR
FT                   FKGLGEMNPEQLWDTTVNPETRRLLQVRIEDAVAADQIFSTLMGDVVEPRRDFIEDNAL
FT                   KVANLDI"
FT   gene            7655..8500
FT                   /locus_tag="Smal_0005"
FT   CDS_pept        7655..8500
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0005"
FT                   /product="Abortive infection protein"
FT                   /note="PFAM: Abortive infection protein; KEGG: xcb:XC_0005
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49710"
FT                   /db_xref="GOA:B4SR09"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="UniProtKB/TrEMBL:B4SR09"
FT                   /protein_id="ACF49710.1"
FT                   /translation="MSASAPVSAPPPVPPASTAPRAGSPLAGFFIDLGIAAVTLFGLSM
FT                   VTGLLWGFYRAIVVGYANAQANGGALSPAETTAAVGQPGALAQILMALIATGGAALLLY
FT                   FWRRPANAAERLASRQALRQPSTWGWTVLVALLIVLGSNGIAFLAKQFGIAPVPTNVEL
FT                   MQNAIARFPLFLVLFAVVLAPAYEELLFRRVLFGRLWQAGRPWLGVILSSLAFALVHEV
FT                   PGVSRNSLLGMAQLWLVYGGMGAAFCWLYQRTGTLWAAITAHALNNAVALAAMVFLGST
FT                   "
FT   gene            8572..9378
FT                   /locus_tag="Smal_0006"
FT   CDS_pept        8572..9378
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0006"
FT                   /product="peptidase M48 Ste24p"
FT                   /note="PFAM: peptidase M48 Ste24p; KEGG: xac:XAC0006
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49711"
FT                   /db_xref="GOA:B4SR10"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="UniProtKB/TrEMBL:B4SR10"
FT                   /protein_id="ACF49711.1"
FT                   /translation="MKHLLLALVITTLVSACATTTSPTGRRQMVGGVSQAQLDQLGAQA
FT                   FAETKQKEKISTDGRQNGYVQCVVNALVAQLPPQYRGVRWETAVFVDKEPNAFALPGGK
FT                   VGVNTGIFTVAKNQDQLAAVIGHEIGHVIARHHEERITRQMGAQTGLAVLGALAGAAYG
FT                   EGAASTVNQLGGMGAQTAFLLPGSRTQESEADVIGQRLMAQAGFNPAQAVDLWQNMMAA
FT                   SGGRSPQWLSTHPDPANRIQELRRDAPGLTPVYQQAQAAGLRPKCG"
FT   sig_peptide     8572..8628
FT                   /locus_tag="Smal_0006"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.491 at
FT                   residue 19"
FT   gene            9511..10698
FT                   /locus_tag="Smal_0007"
FT   CDS_pept        9511..10698
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0007"
FT                   /product="TPR repeat-containing protein"
FT                   /note="PFAM: TPR repeat-containing protein; SMART:
FT                   Tetratricopeptide domain protein; KEGG: xac:XAC0007
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49712"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:B4SR11"
FT                   /protein_id="ACF49712.1"
FT                   /translation="MIFRNHKAVLSVLVATALTGAVVTDAFAQSSRSSERGNRGGKQAK
FT                   AEALYPNATRQEPTVKASAKMGSKLQKMIDSYNKEKFPETRTQADAILADSAANEYDKS
FT                   LAAQLASQAAYQTEDTPAAVAYLKQVLQFNGLDNNGHFQSMLMLGQLELQEDKTAEGLA
FT                   TLDKYFAESKSTKPEELIAKGQALYQLERYQEAIPVLKQAIAGSAEPKDNWNQLLMAAL
FT                   SEAGQSGEAVKEAEALAAKNPSDKKAQLNLASMYMQADQMDKAATVMDKLRSSGQLTEE
FT                   REYKQLYSIYANTEHKEKDVIAVINEGLQKGILKPDYQVYLALAQSYYYSDQVPQAIDA
FT                   WQKAAPLSKDGETYLNLARVLHAEGRVPEAKQAAQQALAKGVKNQADAKKIINLK"
FT   sig_peptide     9511..9597
FT                   /locus_tag="Smal_0007"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.744 at
FT                   residue 29"
FT   gene            10842..11510
FT                   /locus_tag="Smal_0008"
FT   CDS_pept        10842..11510
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0008"
FT                   /product="TonB family protein"
FT                   /note="TIGRFAM: TonB family protein; PFAM: Gram-negative
FT                   tonB protein; KEGG: xac:XAC0008 TonB protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49713"
FT                   /db_xref="GOA:B4SR12"
FT                   /db_xref="InterPro:IPR006260"
FT                   /db_xref="InterPro:IPR037682"
FT                   /db_xref="UniProtKB/TrEMBL:B4SR12"
FT                   /protein_id="ACF49713.1"
FT                   /translation="MTEQLVVHRYEQPDDKGLSWPRIVGIAFVIALHLAAFMMLLIPAV
FT                   APKAVAEKERNVMVTIVDAPPPPPPPPPPPPPTDTPPPPVKNLSPPKPSPVPPPPQAPV
FT                   VDVPEPRPSDIVTPPSPPSPPAPPTSIEASVDISSKAMNPPRYPPAAFRAGIQGEVILI
FT                   IDVDASGNVTNVTVEKSSRNRDLDRAAMEAARKWRFNAAEAGGKKAAGRVRVPVNFALN
FT                   "
FT   gene            11606..12367
FT                   /locus_tag="Smal_0009"
FT   CDS_pept        11606..12367
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0009"
FT                   /product="MotA/TolQ/ExbB proton channel"
FT                   /note="PFAM: MotA/TolQ/ExbB proton channel; KEGG:
FT                   xac:XAC0009 biopolymer transport ExbB protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49714"
FT                   /db_xref="GOA:B4SR13"
FT                   /db_xref="InterPro:IPR002898"
FT                   /db_xref="UniProtKB/TrEMBL:B4SR13"
FT                   /protein_id="ACF49714.1"
FT                   /translation="MLQEIFIAAAAGGNPSNALSQMGFEHLIHEMTTKPGDFAVSWVVL
FT                   LTLVVMSAMSWYWTVINIFRATRLKSAADRVVSLFWDTPNAQDAIRAMEEQPASEPFSK
FT                   IALDAAQAAAHHQRAEGGATGGVGENLSRSEFVDRALRQAVTRESNKLQSGMTLLATVG
FT                   ATAPFVGLLGTVWGIYGALIKIGATGSASIDAVAGPVGEALIMTAIGLFVAIPAVFAFN
FT                   FFSKINSATISKFDTFAHDLHDFFATGSRVR"
FT   gene            12428..12853
FT                   /locus_tag="Smal_0010"
FT   CDS_pept        12428..12853
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0010"
FT                   /product="Biopolymer transport protein ExbD/TolR"
FT                   /note="PFAM: Biopolymer transport protein ExbD/TolR; KEGG:
FT                   xcb:XC_0010 biopolymer transport ExbD1 protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49715"
FT                   /db_xref="GOA:B4SR14"
FT                   /db_xref="InterPro:IPR003400"
FT                   /db_xref="UniProtKB/TrEMBL:B4SR14"
FT                   /protein_id="ACF49715.1"
FT                   /translation="MAFSSGNSGGPMADINVTPLVDVMLVLLIIFIITAPLMSHKVKVD
FT                   LPEANLVQKPDDTNDRKGPITLAVKEDGSIYWNDEEINKQTLESRLATAAQQTPQPPLN
FT                   LRGDRTTKMRVINEMTKIAQEQGMLDVGFVATKEKGQ"
FT   gene            12857..13270
FT                   /locus_tag="Smal_0011"
FT   CDS_pept        12857..13270
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0011"
FT                   /product="Biopolymer transport protein ExbD/TolR"
FT                   /note="PFAM: Biopolymer transport protein ExbD/TolR; KEGG:
FT                   xom:XOO_0011 biopolymer transport ExbD2 protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49716"
FT                   /db_xref="GOA:B4SR15"
FT                   /db_xref="InterPro:IPR003400"
FT                   /db_xref="UniProtKB/TrEMBL:B4SR15"
FT                   /protein_id="ACF49716.1"
FT                   /translation="MAFSSGGGKGPMADINVTPLVDVMLVLLIIFIVTAPIMTYPIAVD
FT                   LPQRVLNPPPQLVEPPPPIELKIDASNQVSWNNSPINASELQQRMEQEVQRDPTNQPEL
FT                   RIDASPDSEYDVMAKVLAAAKNAQMKKIGFVQQ"
FT   gene            13421..14881
FT                   /locus_tag="Smal_0012"
FT   CDS_pept        13421..14881
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0012"
FT                   /product="phospholipase D/Transphosphatidylase"
FT                   /note="PFAM: phospholipase D/Transphosphatidylase; KEGG:
FT                   xcv:XCV0015 cardiolipin synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49717"
FT                   /db_xref="GOA:B4SR16"
FT                   /db_xref="InterPro:IPR001736"
FT                   /db_xref="InterPro:IPR022924"
FT                   /db_xref="InterPro:IPR025202"
FT                   /db_xref="InterPro:IPR027379"
FT                   /db_xref="UniProtKB/TrEMBL:B4SR16"
FT                   /protein_id="ACF49717.1"
FT                   /translation="MLALFDSLRHWLDGIAHLGTILAVAYLLYLFALAGWIMLQKREPV
FT                   ATLSWILSLALLPYLGLFIYYLLGPQKVKRQRLRRGRARSGMEHYSDVCPPDADCTELA
FT                   KIAQATTGLAPSSATEVTWLVDGAATYAALLEAVAQARDHVHLEYYIFNPDHAGTALRD
FT                   ALVERARAGVQVRLLLDAVGSSALPRRFLQPLLDAGGEAIWFHPRQLLKPFKRPWLNLR
FT                   THRKLVIVDGRLAFTGGINITDDEDESRRTDAYRDLHMRIRGHVVRSLQLVFAEDWLYA
FT                   SGQDPSRMDIARLWPADMPLRGDGPINAQVLVSGPDSGWETIHRLHVAAIQEAHERVWL
FT                   VTPYFVPGEAARMALTSAALGGLDVRLLVPKMSDSWFVTQAARSYFDELLHAGVKIYEY
FT                   GPRMLHTKAFIADDDVCIVGSANFDHRSFRLNFELSMMISDRGRVAALAELLEGEFERA
FT                   TRVNDQAGRSLWLHRLPEAFARLASPLL"
FT   gene            14922..15191
FT                   /locus_tag="Smal_0013"
FT   CDS_pept        14922..15191
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0013"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xcv:XCV0014 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49718"
FT                   /db_xref="GOA:B4SR17"
FT                   /db_xref="UniProtKB/TrEMBL:B4SR17"
FT                   /protein_id="ACF49718.1"
FT                   /translation="MYWLYLLLALGCFAFALKTPNAGLMTLCLLAALAFLLAWVRGRYV
FT                   ARFGDLQRDPATLVDAEELRRLREQAQARRSAAPDEHDPSPLSK"
FT   sig_peptide     14922..14972
FT                   /locus_tag="Smal_0013"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.806) with cleavage site probability 0.289 at
FT                   residue 17"
FT   gene            15201..15944
FT                   /locus_tag="Smal_0014"
FT   CDS_pept        15201..15944
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0014"
FT                   /product="Pyridoxal phosphate biosynthetic protein PdxJ"
FT                   /note="PFAM: Pyridoxal phosphate biosynthetic protein PdxJ;
FT                   KEGG: xcb:XC_0012 pyridoxal phosphate biosynthetic protein
FT                   PdxJ"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49719"
FT                   /db_xref="GOA:B4SR18"
FT                   /db_xref="InterPro:IPR004569"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR036130"
FT                   /db_xref="UniProtKB/TrEMBL:B4SR18"
FT                   /protein_id="ACF49719.1"
FT                   /translation="MTQLSVNVNKIAVLRNSRGGAEPDVVRAAQACLDAGAHGITVHPR
FT                   PDRRHITAEDVLALSTLTRARGVEFNIEGNPFAPPREGYPGLLPLCAQTRPAQATLVPD
FT                   SDGQITSDHGFDFERDAERLRPLIAELKAMGCRVSLFVDAGNPLLEQAAEVGADRIELY
FT                   TGPYAEAHAAGDAGAMLTLFATAARRAQAVGLGVNAGHDLSQDNLRDFLANVPDVLEVS
FT                   IGHALIGEALYDGLDATVRGYLALL"
FT   gene            16088..17179
FT                   /locus_tag="Smal_0015"
FT   CDS_pept        16088..17179
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0015"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: Radical SAM domain protein; SMART: Elongator
FT                   protein 3/MiaB/NifB; KEGG: xcc:XCC0015 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49720"
FT                   /db_xref="GOA:B4SR19"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR040086"
FT                   /db_xref="UniProtKB/TrEMBL:B4SR19"
FT                   /protein_id="ACF49720.1"
FT                   /translation="MGIAIKGRGSTSHLAGRFESTVSEAVDDGWAVDESEEFLAPRLRT
FT                   EVRAETARSIITRNNSPDVGFSQSVNPYRGCEHGCSYCFARPSHAYLNLSPGLDFETKL
FT                   FAKTNAPQLLRKELSKPGYVPQPIALGINTDAYQPIERKFKLTRQLIEVMLETKHPFSL
FT                   ITKNALVERDIDLLAPLAAENLVSVHFSVTSLDPHLSAKLEPRASAPHARLRAMKRLHE
FT                   VGIPVGVMVAPVIPWINDSELEAVLEAAHDAGASTAGYVLLRLPLEVAPLFREWLDTHH
FT                   PDRAAHVMSTIQQLRGGKDYDSQFGTRMRGQGVYADLLNNRFKLARKRLGFNAQNSHWP
FT                   KLDCSRFQKPLPPRKDSPQGSLF"
FT   gene            17350..20574
FT                   /locus_tag="Smal_0016"
FT   CDS_pept        17350..20574
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0016"
FT                   /product="YD repeat protein"
FT                   /note="TIGRFAM: YD repeat protein; PFAM: YD
FT                   repeat-containing protein; KEGG: xac:XAC1305
FT                   wall-associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49721"
FT                   /db_xref="InterPro:IPR006530"
FT                   /db_xref="InterPro:IPR010916"
FT                   /db_xref="InterPro:IPR031325"
FT                   /db_xref="UniProtKB/TrEMBL:B4SR20"
FT                   /protein_id="ACF49721.1"
FT                   /translation="MMHFATRNTLKSRLLLLPLLSLPMTLATAANTLETVQVTAKRPAG
FT                   GGGVGGFGFGGGSGVHLSESQMDNGGGGGAIPTETAKEQPTDDKEKDCNGRKGNPVVLY
FT                   SGNKVEPELDFASQGEMGLFLQRNYNHYWSATGLFGNHWLSNFDYSLAFTDANQLAWVQ
FT                   RPDGRRIKYLKDPASGRWYEDKAQPIAYLSANGDGTFTLRNENNGTETYNVEGYITRLS
FT                   NEQGVSWTFSYADRYLQKVTHSSGRSVSFGWANGQVSQVTDPAGNVYRYTYTPNVFGNG
FT                   RGRLASSTLPGTPATTISYHYEDARFPGALTGKSFDGVRYSTFAYDAERRAISTEHNGG
FT                   IERFRFSYAVRSTEPVLPPPAPTRPGGVRADEERGWCEQRTGGSRICYQPRSLPVDSLP
FT                   MESALGMTAAAAPGLTRPVDIDVTVINPLGRSTTYTFKDGKMVSTKGDPSPNCPASYKE
FT                   QSYDANGYPDLVHDFQDNLTNFDYSAQGYLLKRVEAVGSSAERTTLQEWDTTRNRLLKT
FT                   TVVGDLEVAYSYDDRGNVASATERNLTARGVPSQTRVTRSTYTYHANGLKASIKVDGPL
FT                   AQDDVTSVFNGQGDLTSVTNALGHTISYSNYNGLGLPGRIVNANGGVRELTYDGRGRVV
FT                   SDRTSSGTGWATTAIGYTAAGDIASLTQPDGVTVRYGYDAGRRLTQEVRSMGDGKWAWI
FT                   RHSYNNASNRTRTEVSQTDYPMDTVVKGMIDEITHDGQWNWFVRGWACSTGSAGSIQVD
FT                   GYADGNVYLGSTQANLASEPGVAAACQASGSAYRYQLPISLAQRQQLGGRKFSIYGQSP
FT                   QGRGQDRPLPNSGVLAIPTAKIVGDIGGVTQDGNWNFFLEGWACSIGVDSSIDVHVYAG
FT                   NSAWAGGTFVASGRANLATDGNVASACQARGNAYWFKIPLDGNLRSAHGGKALYVHGIS
FT                   PWGGDHLTINRSGTFTVPAVVRSAEFVSFNAYPTNITNGRQSTLTIQVRNTGNVVWDGN
FT                   TYLAWGQDQLDQSRALAGPVSPGGIASFSIDVAPYHDGIGIRSFAYIAQMATNGMAWGP
FT                   RPYTMIAVENADWYCPPNSTTCEAPM"
FT   sig_peptide     17350..17439
FT                   /locus_tag="Smal_0016"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.941 at
FT                   residue 30"
FT   gene            20769..22985
FT                   /locus_tag="Smal_0017"
FT   CDS_pept        20769..22985
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0017"
FT                   /product="YD repeat protein"
FT                   /note="TIGRFAM: YD repeat protein; PFAM: YD
FT                   repeat-containing protein; KEGG: sdn:Sden_2443 YD repeat"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49722"
FT                   /db_xref="InterPro:IPR006530"
FT                   /db_xref="InterPro:IPR022385"
FT                   /db_xref="InterPro:IPR031325"
FT                   /db_xref="UniProtKB/TrEMBL:B4SR21"
FT                   /protein_id="ACF49722.1"
FT                   /translation="MPALTLALIGLNAVVSVNTYEYDELGRVIVERGNGVQNVRYAYDA
FT                   EGRVTQVTDSQNRVTRMSYDPRGRLIKSIDAVGGTTQIAYDLADRPVRVSDPRNLVTTY
FT                   EFDGFGQMWKQVSPDTGTTQHQYDAAGLRTSTTRADGSVVSFGYDGLGRMTSASAEGRT
FT                   MGYSYDWCGNGKGQMCGTSGPGTATHFAYTPNGQLQIRRDFTDLSGQKTDYSTTYGYDG
FT                   INRLSQIIYPNGDKATYTYGSQGKPSALTATVDGTQRSIISQANWKVTGAHEWLAYGNG
FT                   LARGYNHDQEGRLTAMSVWGPNGSKVSYWDYQYSADGEITAIVDAVDPNMTQLIGYDAL
FT                   SRMTKLTRFGVINNLSYDAGGNHDRYQAGNQLTQYSIDPGSNRVLNYTNQDGSRQYQYD
FT                   ALGNRISETAGSRISTYEYDAFNRMSRSNIGGTATDYVLNAQGQRVAKVNKNINSRYFY
FT                   AGQNQLMTELNNGVWTNYFWFEGELVGLARSGQHNYVHTDHLGRPEFVTSPSQQTVWKA
FT                   YNYAYGRSVQKDEIGGLNIGFPGQYYDVESGLWYNGFRDYDASIGRYVQSDPIGLAGGL
FT                   NTYAYAEGNPVTGFDPLGLCKTDYVGAILGAADMAAGVGAITAGSADSIIAAVAGSEDG
FT                   GLVGLTVAAMGLATFHDGANNLATAFDGKERTPALEKVGGSLLGWQGAQIGRYVSNFNT
FT                   ITSLSKGIRSVLKGTAKLSDAHEIAKGIKENGGGPASPCDCGGK"
FT   gene            22991..23173
FT                   /locus_tag="Smal_0018"
FT   CDS_pept        22991..23173
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0018"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49723"
FT                   /db_xref="GOA:B4SR22"
FT                   /db_xref="UniProtKB/TrEMBL:B4SR22"
FT                   /protein_id="ACF49723.1"
FT                   /translation="MKIIYWLGIAFLWMLPLNVLLLTAGKLMSGGTLGEEELVGFGVAV
FT                   FGAAAGTILYRRRPR"
FT   sig_peptide     22991..23080
FT                   /locus_tag="Smal_0018"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.637) with cleavage site probability 0.280 at
FT                   residue 30"
FT   gene            complement(23234..23941)
FT                   /locus_tag="Smal_0019"
FT   CDS_pept        complement(23234..23941)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0019"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xac:XAC0018 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49724"
FT                   /db_xref="GOA:B4SR23"
FT                   /db_xref="InterPro:IPR005123"
FT                   /db_xref="UniProtKB/TrEMBL:B4SR23"
FT                   /protein_id="ACF49724.1"
FT                   /translation="MHEQGPVDFIEVIHNAVPSEVCAAIVERLRATRGLQPGAVGSGVF
FT                   PELKHSKDLRISGLGGWQDVDQQLQIAVFNGLLTYLRRYPQALIAPLMLQIQDSNGQPR
FT                   RLSAEDFPDMPQQQLADLARTCLRPGAINLQWYAAGEGGYPYWHCELYPKDAQAETLHR
FT                   HVLWTLYLNDDFEEGETEFLFQGRKIAPRTGSLLIAPTAFTHTHRGNRPQGGDKFIATS
FT                   WILFQSAQKLFGG"
FT   gene            complement(24049..25065)
FT                   /locus_tag="Smal_0020"
FT   CDS_pept        complement(24049..25065)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0020"
FT                   /product="Inositol phosphatase/fructose-16-bisphosphatase"
FT                   /note="PFAM: Inositol
FT                   phosphatase/fructose-16-bisphosphatase; KEGG: xac:XAC0124
FT                   fructose-1,6-bisphosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49725"
FT                   /db_xref="GOA:B4SR24"
FT                   /db_xref="InterPro:IPR000146"
FT                   /db_xref="InterPro:IPR028343"
FT                   /db_xref="InterPro:IPR033391"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4SR24"
FT                   /protein_id="ACF49725.1"
FT                   /translation="MSRTSLTRFLIQEQHAGRINADLRQLIAVVARACTSISIAVSKGA
FT                   LGGVLGDAGTGNVQGEAQKKLDVISNEILLEANAWGGHLAACASEEMDHSQPVPDIYPR
FT                   GDFLLLFDPLDGSSNIDVNVSVGTIFSVLRCPTNVELPGDDAFLQPGSKQIAAGYCIYG
FT                   PSTQLVLTVGHGTHAFTLDREKGEFVLTTENMQIPAATQEFAINMSNQRHWEAPMQAYV
FT                   GDLLAGKEGARGKNFNMRWIASMVADVHRILTRGGIFIYPWDKKDPSKAGKLRLMYEAN
FT                   PMGLLVEQAGGAAWTGRERILDIQPDQLHQRVPVFLGSREEVAEAVRYHHAHDDARG"
FT   gene            complement(25398..26600)
FT                   /locus_tag="Smal_0021"
FT   CDS_pept        complement(25398..26600)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0021"
FT                   /product="Aspartate transaminase"
FT                   /EC_number="2.6.1.1"
FT                   /note="PFAM: aminotransferase class I and II; KEGG:
FT                   xac:XAC0125 aromatic amino acid aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49726"
FT                   /db_xref="GOA:B4SR25"
FT                   /db_xref="InterPro:IPR000796"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:B4SR25"
FT                   /protein_id="ACF49726.1"
FT                   /translation="MSFFANVELVPGDPILGLTEAYNADSRPTKVNLGVGIYYDESGRI
FT                   PLLRAVKQIEQQLANEAKPRGYLPIDGLPAYTQATRELVFGKDSPLLAAGRVTTAQTVG
FT                   GSGALRVGADVLKKLLPHATVALSNPSWENHRAVFSAAGFEVVDYTYFDPTTHGVNFDG
FT                   LLADLGKLEAGTVVLLHACCHNPTGADLTVTQWKQVAQLLKDKQLFPFIDMAYQGFDKG
FT                   IEQDGAAVRIIAEAGIDSFIVANSYSKSFSLYGERVGALSMVAPTAADAKAVQSQVKRV
FT                   IRTIYSSPSTHGAALVAGVLTNPELRAMWEQELTEMRERIHALRQGLVEKLAAAGAPQF
FT                   GFINEQAGMFSYSGLSREQVERLRDEFGIYAVGTGRICVAALNQNNLEYVAKAVATVAK
FT                   G"
FT   gene            26772..28865
FT                   /locus_tag="Smal_0022"
FT   CDS_pept        26772..28865
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0022"
FT                   /product="TonB-dependent receptor"
FT                   /note="PFAM: TonB-dependent receptor; TonB-dependent
FT                   receptor plug; KEGG: xcb:XC_0101 iron transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49727"
FT                   /db_xref="GOA:B4SR26"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039426"
FT                   /db_xref="UniProtKB/TrEMBL:B4SR26"
FT                   /protein_id="ACF49727.1"
FT                   /translation="MNPAARRHCLPLSALLLSPLAAMAEPAPIALPAVQVQAARVPGID
FT                   PFALPASQDTVWIDAGRAGNSVQLSEALAGVPGLLARDRQNFAQDTQLSIRGFGARSTF
FT                   GVRGVRVLIDGVPATMPDGQGQLSHASLLGAERIEVLRGPFSALYGNSSGGVLQVWSAQ
FT                   GQASDPWRLRLNAGADNTLSIGAQLKGASHGLDYNIAANHFRTDGWREHSRARRESLTA
FT                   RIGGDLGGGRLELLLNALDAPDAQDPLGLTRAQVAADPRQATAVAHQYNTRKSVRQQQA
FT                   GLRWTRETDAQRWQLMGYAGQRAVRQYLPIPPAAQTNSPLHAGGVIDLEGGYGGLDARW
FT                   GWHGDLAGRPLDLVAGLSADRQRQHRTGYENFIGSALGVRGRLRRDQIDTVQNVDQFAQ
FT                   AWWQWSPRWSLLAGLRHSAVRFESDDRYITGRNPDDSGRRRYQATTPVAGVSFEASPQW
FT                   RLHAAVGRGFETPTFNELGYRADGQAGLALDLAAARSRNLEVGSKWHAQDGTQLDISLF
FT                   RADTDDELAVASNIGGRSTYRNIGRTRRQGVELQYRQPLAEQLELQLAWTWLQAQVRSP
FT                   YLTSNNVVAAGSRLPGVPRQQAFARLQWTPADWQWALEASASSDTVVNDVATERAPGYA
FT                   LLHVEGGRRWTLPGGELRAFARLENVLDQAYIGSVIVNDGNGRFYEPGPGRRASLGLQW
FT                   SWR"
FT   sig_peptide     26772..26846
FT                   /locus_tag="Smal_0022"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 25"
FT   gene            complement(29094..29438)
FT                   /locus_tag="Smal_0023"
FT   CDS_pept        complement(29094..29438)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0023"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: xcb:XC_3775 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49728"
FT                   /db_xref="UniProtKB/TrEMBL:B4SR27"
FT                   /protein_id="ACF49728.1"
FT                   /translation="MSRETSRDPLRENHPPIPGEQRGKRDADNADYRGTGAPFFDAEHG
FT                   GEHLPVKHESEQAALDRKDGGDRHRGGQESPLKRRERKQHASDNQDEALEETFPASDPT
FT                   SPFVPAKAPD"
FT   gene            29586..29984
FT                   /locus_tag="Smal_0024"
FT   CDS_pept        29586..29984
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0024"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xcv:XCV0108 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49729"
FT                   /db_xref="UniProtKB/TrEMBL:B4SR28"
FT                   /protein_id="ACF49729.1"
FT                   /translation="MPRLERPAPSVFNALLDPLGQRTAQRRTRRHEDPQAVAQDYLQYM
FT                   LSDYEERRGQSHRNWRDLCPVYAFALTTHAADWPRGDAADTCEELAEHWEQMRGHSRLS
FT                   WSQARPVVEDAWRALDHIPAAAVRPLLQ"
FT   gene            30139..31044
FT                   /locus_tag="Smal_0025"
FT   CDS_pept        30139..31044
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0025"
FT                   /product="Ku protein"
FT                   /note="TIGRFAM: Ku protein; PFAM: Ku domain protein; KEGG:
FT                   xcb:XC_0108 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49730"
FT                   /db_xref="GOA:B4SR29"
FT                   /db_xref="InterPro:IPR006164"
FT                   /db_xref="InterPro:IPR009187"
FT                   /db_xref="InterPro:IPR016194"
FT                   /db_xref="UniProtKB/TrEMBL:B4SR29"
FT                   /protein_id="ACF49730.1"
FT                   /translation="MARPIWTGTLSFGLLNVPVSLMSGERKVDLQFRMLDSRDRKPIRF
FT                   ERVNADTGEEVPWKDIVKAYEYDKGSYVVLEEGDIRSAAPESHEAVEVESFVDAAQIDP
FT                   RYYEKPYLLVPGKKAEKGYVLLRETLRSTGKVGIARVVVRTREYLCAVMPHEDALVLMI
FT                   LRYPQELVDPEDYKLPTGKLSDYRITSKETAMAEQLIESMAGDWDPSQYHDEFRERLQL
FT                   VLNKRIKSKGGTTRVEDEPSPREDATTNVVDFMALLQKSLDANKRTPAKKTATRKAPAK
FT                   KAAKKAAKKAVKKTTRRKAG"
FT   gene            31048..33525
FT                   /locus_tag="Smal_0026"
FT   CDS_pept        31048..33525
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0026"
FT                   /product="DNA ligase D"
FT                   /note="TIGRFAM: DNA ligase D; DNA ligase D,
FT                   3'-phosphoesterase domain protein; DNA polymerase LigD,
FT                   polymerase domain protein; DNA polymerase LigD, ligase
FT                   domain protein; PFAM: DNA primase small subunit; ATP
FT                   dependent DNA ligase domain protein; ATP dependent DNA
FT                   ligase; KEGG: xcb:XC_1808 ATP-dependent DNA ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49731"
FT                   /db_xref="GOA:B4SR30"
FT                   /db_xref="InterPro:IPR012309"
FT                   /db_xref="InterPro:IPR012310"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014143"
FT                   /db_xref="InterPro:IPR014144"
FT                   /db_xref="InterPro:IPR014145"
FT                   /db_xref="InterPro:IPR014146"
FT                   /db_xref="InterPro:IPR033651"
FT                   /db_xref="UniProtKB/TrEMBL:B4SR30"
FT                   /protein_id="ACF49731.1"
FT                   /translation="MSLHQYRRKRRLGGGAGQTPEPDDTPARGDPKRRPTFVIQLHHAS
FT                   SRHYDFRLEMDGVLKSWAVPKGPSLRVGEKRLAVEVEDHPLSYAGFEGDIPEGHYGAGH
FT                   VDVFDHGTWACEGDPLQALAAGKIDFVLHGQRLAGGWKLVRTAMKGRQVQWLLIKRDDG
FT                   EARDAEADDLLTAPMPKRAPAAKKRSVERAAAAARTTTRKADARWHARALKLDGARDTP
FT                   YPRAFKPQLTDHRDSAPDGARWLHEIKWDGYRLLADLHDGEVKLRSRNGLDWTDDFPEL
FT                   VQAVLALPVRDARLDGELVVLDPDGRSDFAALQRVIDGSSKQPLRYIVFDLPGVAGVDI
FT                   SRVPLLERKALLKDLIGPAPGTLAFSEHVIDHGPQVFDASGGAGFEGIVSKQVDAPYVN
FT                   TRARSWVKVKHEDTDEFVIVGHTAPKGSRVGFGSLLLATPDKAGLRYVGRVGTGFDDDS
FT                   LRALLKALQPLAVNAPVLQLPAHVPFRAASVRWVKPVTVAEVAFRGWGKEGLLRQASFK
FT                   RLRSDKQKEDLGMSTADTEAGGEVQITHPERVVFPKEKLSKGDVADYYQRVARWILPEL
FT                   AGRPLSLLRCPDGVGRACFFQKHHGPGLGDAVHAVPLQQKSGREDYVYIDDARGLLQLV
FT                   QMNTLELHPWGATVIDPEHPDRLVFDLDPGEGVSWAQVKAGARDVRDRLQQVGLKSFVR
FT                   LSGGKGVHVVVPMQPKAGWDEAKAFCEAFAQAMALEQPDRYVATMSKAKRNGVIFIDWL
FT                   RNTRGATSVCSWSLRARDGAGVAVPLRWEELARVSAADAFPMAKALARAKRLKGDPWQG
FT                   IERLKQTLPSLKR"
FT   gene            complement(33597..33989)
FT                   /locus_tag="Smal_0027"
FT   CDS_pept        complement(33597..33989)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0027"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49732"
FT                   /db_xref="GOA:B4SR31"
FT                   /db_xref="UniProtKB/TrEMBL:B4SR31"
FT                   /protein_id="ACF49732.1"
FT                   /translation="MPGLLKTLFLSIVALIGGVLSLALVSSVASWLPPLVGLSPGDSSV
FT                   QLGWDLAFSVLGGVAGISFATYYAPCWPRSHGFSIWSLIALGCGYAVWTAGADFPLWFV
FT                   ISLLASLPLQLLAGWWFGRRASRDPR"
FT   sig_peptide     complement(33900..33989)
FT                   /locus_tag="Smal_0027"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.804 at
FT                   residue 30"
FT   gene            complement(34147..35175)
FT                   /locus_tag="Smal_0028"
FT   CDS_pept        complement(34147..35175)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0028"
FT                   /product="Alcohol dehydrogenase GroES domain protein"
FT                   /note="PFAM: Alcohol dehydrogenase zinc-binding domain
FT                   protein; Alcohol dehydrogenase GroES domain protein; KEGG:
FT                   dac:Daci_2868 alcohol dehydrogenase GroES domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49733"
FT                   /db_xref="GOA:B4SR32"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B4SR32"
FT                   /protein_id="ACF49733.1"
FT                   /translation="MNSTMKAAVVREFGKPLVIEEVSVPRPGAGEVLVKIEACGVCHTD
FT                   LHAAEGDWPVKPNPPFIPGHEGVGHIVAVGGGVGHVKEGDRVGIPWLYSACGHCEHCLG
FT                   GWETLCETQRNTGYSVNGGFAEYALADANYVGLLPKEVGFVEIAPVLCAGVTVYKGLKV
FT                   TDTKPGDWVVISGIGGLGHMAVQYARAMGLNVAAVDVDDSKLALARQLGAQITVNARTT
FT                   DPAAFLKKEIGGAHGALVTAVSPKAFEQALGMVRRGGTVSLNGLPPGNFPLDIFGMVLN
FT                   GITVRGSIVGTRLDLQESLQFAAEGKVAATVSTDRLENINDVFARMHAGTIEGRVVLDF
FT                   AA"
FT   gene            complement(35272..35910)
FT                   /locus_tag="Smal_0029"
FT   CDS_pept        complement(35272..35910)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0029"
FT                   /product="2-dehydro-3-deoxyphosphogluconate
FT                   aldolase/4-hydroxy-2-oxoglutarate aldolase"
FT                   /EC_number="4.1.2.14"
FT                   /note="KEGG: ajs:Ajs_2048 2-keto-3-deoxy-phosphogluconate
FT                   aldolase; TIGRFAM: 2-dehydro-3-deoxyphosphogluconate
FT                   aldolase/4-hydroxy-2-oxoglutarate aldolase; PFAM: KDPG and
FT                   KHG aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49734"
FT                   /db_xref="GOA:B4SR33"
FT                   /db_xref="InterPro:IPR000887"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR031337"
FT                   /db_xref="InterPro:IPR031338"
FT                   /db_xref="UniProtKB/TrEMBL:B4SR33"
FT                   /protein_id="ACF49734.1"
FT                   /translation="MSSADPRLRALLKLAPVIPVYTPEDVNEAVEVAQALFRGGLPVIE
FT                   VTLRTPQALDAIKAMVEAVPDAVIGAGTVLNAAQMQAAKQAGARFAVSPGATPALYAAA
FT                   RDADLPYLPGAATASDLILGLEHGQDTFKFFPAVQAGGAALLAAWHGPFADVRFCPTGG
FT                   ISTQTAPQFLHLPNVLCVGGSWLTTPALLQTRDWDAIERLAREASVLAG"
FT   gene            complement(36026..36682)
FT                   /locus_tag="Smal_0030"
FT   CDS_pept        complement(36026..36682)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0030"
FT                   /product="cysteine dioxygenase type I"
FT                   /note="PFAM: cysteine dioxygenase type I; KEGG:
FT                   bwe:BcerKBAB4_2507 cysteine dioxygenase type I"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49735"
FT                   /db_xref="GOA:B4SR34"
FT                   /db_xref="InterPro:IPR010300"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:B4SR34"
FT                   /protein_id="ACF49735.1"
FT                   /translation="MNAGATRANANIPLTMLRYSQDMDLQTSPFPPFRGRDRLIAAVDA
FT                   AMTSGDAGRITADLQLALQDAIADSRIELPECVHRPVGDHYARRPLYHSREHGYSVIAM
FT                   SWGPGQGTPLHDHDAMWCVEGVWLGELEITRYELLERNGERCRFRRHAALRGGCGSAGS
FT                   LIPPHEYHTLRNASDAALAISVHVYEAPMERAAVFDPLGGDWYQRRIQALQADPA"
FT   gene            36856..37911
FT                   /locus_tag="Smal_0031"
FT   CDS_pept        36856..37911
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0031"
FT                   /product="transcriptional regulator, LacI family"
FT                   /note="PFAM: regulatory protein LacI; periplasmic binding
FT                   protein/LacI transcriptional regulator; KEGG: xcv:XCV0151
FT                   transcriptional regulator, LacI family"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49736"
FT                   /db_xref="GOA:B4SR35"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:B4SR35"
FT                   /protein_id="ACF49736.1"
FT                   /translation="MSVRIISDAALPASKGKAATINDIARLSGVSKKTVSRIINNSPLV
FT                   RKDTRDKVEALMREVGYVPDPLARGLAFRRSFLIGLVYDDPGAQCIVDLQQGALEALRG
FT                   TGYELVVHPCDSQSADCAQGVRRFVQQQKLHGVILGPRASESVALTGMLDEIECRYIRI
FT                   NAHASDDEAQAVVTHDRDGAAAAAGYLLSLGHRDIAVITGPGDRRTARERTHGFLDRLA
FT                   QVGLTLPGERVLEAGDTFESGVHAAERLLMGEGRPSAIFAGNDEMAAGVYQVALRAGIA
FT                   VPQQLSIVSYDDSPLASRLWPPLTSVRRHVSDIGRMAAAMLVQTDVPEAPTAASVHPQL
FT                   MVRGSCRAVEG"
FT   gene            complement(38010..38903)
FT                   /locus_tag="Smal_0032"
FT   CDS_pept        complement(38010..38903)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0032"
FT                   /product="phenylalanine-4-hydroxylase"
FT                   /EC_number="1.14.16.1"
FT                   /note="KEGG: xac:XAC0174 phenylalanine 4-monooxygenase;
FT                   TIGRFAM: phenylalanine-4-hydroxylase; PFAM: aromatic amino
FT                   acid hydroxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49737"
FT                   /db_xref="GOA:B4SR36"
FT                   /db_xref="InterPro:IPR001273"
FT                   /db_xref="InterPro:IPR005960"
FT                   /db_xref="InterPro:IPR018301"
FT                   /db_xref="InterPro:IPR019774"
FT                   /db_xref="InterPro:IPR036329"
FT                   /db_xref="InterPro:IPR036951"
FT                   /db_xref="UniProtKB/TrEMBL:B4SR36"
FT                   /protein_id="ACF49737.1"
FT                   /translation="MDLAQPRRVEHQQTDKGYVPVYTTALVEQPWDTYTADDHATWSTL
FT                   YQRQRELLVGRACQEFLDAQDEMGMSAHMIPRFDQLNEVLGAATGWTLVGVEGLLPELD
FT                   FFDHLANRRFPVTWWIRRPDQIDYIAEPDLFHDLFGHVPLLMNPVFANYMEAYGRGGVK
FT                   AHAIGPDALQNLTRLYWYTVEFGLIDTPDGLRIYGAGIVSSKGESLYSLESAAPNRIGF
FT                   DLQRIMRTKYRIDTFQKTYFVIDSFEQLMQATSPDFTPIYAALSDQAHLPAGEVQADDR
FT                   VFQKGTGEGWADGGDV"
FT   gene            39029..39514
FT                   /locus_tag="Smal_0033"
FT   CDS_pept        39029..39514
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0033"
FT                   /product="transcriptional regulator, AsnC family"
FT                   /note="PFAM: regulatory protein AsnC/Lrp family; KEGG:
FT                   xac:XAC0175 transcriptional regulator AsnC family"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49738"
FT                   /db_xref="GOA:B4SR37"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR019885"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B4SR37"
FT                   /protein_id="ACF49738.1"
FT                   /translation="MAGEVQFDRTDIRLLAEIQRDGRATNAELATRVNLSPSACLRRLQ
FT                   RLESEGVIVGYGARLEPRQLRLGLQAFVRVQLEKHDQAAIGHFVDSVQAWDEVVACHAL
FT                   TGDMDYLLHVYVRDLEHFSHFLLDRLLNAGGVADANSSFVLRTVKGFQALPLSQLES"
FT   gene            39662..40405
FT                   /locus_tag="Smal_0034"
FT   CDS_pept        39662..40405
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0034"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49739"
FT                   /db_xref="UniProtKB/TrEMBL:B4SR38"
FT                   /protein_id="ACF49739.1"
FT                   /translation="MKVCLAPVIALLAAALMPAAAGASPQTANAQPLALSCGATEFVGM
FT                   TSNSSTLAKRQCNGGYVYGIGVSVNEAVENLNGFMAVLQAGVSCSANASSIVSGAYGKG
FT                   VFAQFVCNGWPIAGVGNSPTTAARNSLAIATEMAATGTHCAAPLNGSYYPEAWGFRFRY
FT                   DCGNTQTLKSWSIAGLGASVDDANVIAMRLMRYTTAAGQSCDFERAEINGVILKATLVC
FT                   NGSYIQGYGSSVTAAANDALAQIGA"
FT   sig_peptide     39662..39754
FT                   /locus_tag="Smal_0034"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.507 at
FT                   residue 31"
FT   gene            complement(40452..41444)
FT                   /locus_tag="Smal_0035"
FT   CDS_pept        complement(40452..41444)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0035"
FT                   /product="Patatin"
FT                   /note="PFAM: Patatin; KEGG: xcb:XC_0168 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49740"
FT                   /db_xref="GOA:B4SR39"
FT                   /db_xref="InterPro:IPR002641"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="UniProtKB/TrEMBL:B4SR39"
FT                   /protein_id="ACF49740.1"
FT                   /translation="MSLFRPRMLLSVALVGLLAGCGGDPVRPTPPPAPTVVPQAKPVKI
FT                   GIALGGGAAKGFAHIGVIKMLEANGFEPAVVSGTSAGSVVGALYASGMDAFQMQSKAVA
FT                   LDEASIRDVRLFSGGLVQGQKLQDYVNEQVANRSAERLKKPFAAVATQLETGERAIFVR
FT                   GNVGQAVRASSSIPGVFEPVKIGGRNYIDGGVVSPVPVDAARQLGADFVIAVDISSKAS
FT                   GKAPTDMLGIVNQSISIMGQRLGEQELARADIVIRPKVLDIGAADFSQRGTAILEGEKA
FT                   AMAAMPQIRAKIQQLQRARAAAAAPAPVAAPKCEEASRLGKLMGRKDKC"
FT   sig_peptide     complement(41373..41444)
FT                   /locus_tag="Smal_0035"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.853) with cleavage site probability 0.419 at
FT                   residue 24"
FT   gene            complement(41729..42745)
FT                   /locus_tag="Smal_0036"
FT   CDS_pept        complement(41729..42745)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0036"
FT                   /product="protein of unknown function DUF124"
FT                   /note="PFAM: protein of unknown function DUF124; KEGG:
FT                   xac:XAC0178 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49741"
FT                   /db_xref="InterPro:IPR002838"
FT                   /db_xref="InterPro:IPR016031"
FT                   /db_xref="InterPro:IPR025640"
FT                   /db_xref="InterPro:IPR036983"
FT                   /db_xref="UniProtKB/TrEMBL:B4SR40"
FT                   /protein_id="ACF49741.1"
FT                   /translation="MTQWYFHAFAQAERIGPLDDEAARRYAQANPRALAWCQGMSGWTS
FT                   IAEVPELQSAAPGMPNTPPPVPATASGRADDIEFRIVGHEMQFVEIELDPGESAIAEAG
FT                   ALMFKDATVQMDTVFGAATGDQGGGLMGKVMAAGKRVLTGESLFATVYTQSGHGKGKVA
FT                   FAAPYPGTVLAMKLDQHGGRLICQKDSFLAGARGVQIGVQFQRKIMTGLFGGEGFIMQK
FT                   LEGDGWVFIHAGGCVVERELAAGERLDVDTGCVVAYHPTVDMDVRRVAGIKSMLFGGEG
FT                   VFLATLTGPGKVWLQSLPFSRLAGRMWMAAPQGGGQNRGEGSVLGGLGRMLDGDNRF"
FT   gene            42905..45178
FT                   /locus_tag="Smal_0037"
FT   CDS_pept        42905..45178
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0037"
FT                   /product="TonB-dependent receptor"
FT                   /note="PFAM: TonB-dependent receptor; TonB-dependent
FT                   receptor plug; KEGG: xac:XAC1143 TonB-dependent receptor"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49742"
FT                   /db_xref="GOA:B4SR41"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR039423"
FT                   /db_xref="UniProtKB/TrEMBL:B4SR41"
FT                   /protein_id="ACF49742.1"
FT                   /translation="MSPTRTSRGRLPVARPLVAALSALLPLVAAAQETPAAKDPVALDA
FT                   LQVTAQRRVENAKDVPVAISAIQGEKLDVLGSAGDDIRFLAARVPSLNIESSYGRAFPR
FT                   FYIRGLGNTDFDLNASQPVSLVYDDVVQESPLLKGFPLFDLANVEVLRGPQGTLFGRNT
FT                   PAGVVKFDSARPSQDADGYVRVGYGSYNSWNVQGAYGGPLTDRWSARVSAIYQRRDDWV
FT                   DNTRAGAPNSGFEGYDEAAGRVQFLYEGDDFEALFNLHKRKLNGTARLFRANIIEKGGN
FT                   SLVENFDRDKVANDGVNFSDLKTWGGSARLQWNLGSVTLHSITGYETAESLNRGDIDGG
FT                   YGDASLGAGNYGPGFIPFSSESADGLPHHRQWTQEFRVESNEWGRFDWQAGVFYFDEDV
FT                   TINNFNYNSLKPGNPQTGHVVQNQRNKAWAVFASGDFDVTDRFKLRAGVRYTQDKKDFN
FT                   ASVLQAVLPFGTPVSGPYLANTDVNDVSWDVSGVYKLTDNVNAYARVAKGFRAPSIQGR
FT                   LAFAPGLSQADSEKVISYEAGIKADLFERRARLGLSVFRYNVDGQQLIAVGGTNNTATL
FT                   LNADKTIGQGVELDLEAYLADNVLLTFGSSYNDTEIKDKDLAVAICGGGCTINDPTTVI
FT                   NGGTYALVNGNPLPQAPKWIHNATLRVGFPLSDGSELYAYTDWAYRSAVNFFIYESPEF
FT                   RGRSSLEGGLRLGYNWDYGQYDVAVFGRNLTNQTRVVGAIDFNNLTGFLNEPRTWGVEF
FT                   TAKF"
FT   sig_peptide     42905..43000
FT                   /locus_tag="Smal_0037"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.994 at
FT                   residue 32"
FT   gene            complement(45291..46130)
FT                   /locus_tag="Smal_0038"
FT   CDS_pept        complement(45291..46130)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0038"
FT                   /product="Acid phosphatase"
FT                   /EC_number="3.1.3.2"
FT                   /note="PFAM: phosphoesterase PA-phosphatase related; KEGG:
FT                   xom:XOO_4367 phosphatase precursor"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49743"
FT                   /db_xref="GOA:B4SR42"
FT                   /db_xref="InterPro:IPR000326"
FT                   /db_xref="InterPro:IPR001011"
FT                   /db_xref="InterPro:IPR018296"
FT                   /db_xref="InterPro:IPR036938"
FT                   /db_xref="UniProtKB/TrEMBL:B4SR42"
FT                   /protein_id="ACF49743.1"
FT                   /translation="MSLISHPARPLLGLAVVAALAGCAATAAKPTAVEANITTKAVGYL
FT                   DKSAVPGSLDLVPAPPVAGSAALALDEQVSREARALRGSPRFAQAGVDAELGFPEGANH
FT                   FSCAADIDVDAVKTPALYRLLERSRIDASAATKAAKNHYQRPRPFMVNGEPTCAPKDEE
FT                   GLRKNGSYPSGHTSIGWAWALILSEIAPDRADAIQARGRNYGESRLVCNVHWQSDILEG
FT                   RFMGAAAVARLHDNAAFNKDLLAARKEIAAARKAGLHSSRDCTTENAVLKVRPQSAL"
FT   sig_peptide     complement(46047..46130)
FT                   /locus_tag="Smal_0038"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.569 at
FT                   residue 28"
FT   gene            46392..47270
FT                   /locus_tag="Smal_0039"
FT   CDS_pept        46392..47270
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0039"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: spc:Sputcn32_1417 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49744"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B4SR43"
FT                   /protein_id="ACF49744.1"
FT                   /translation="MRSTATGSTVLALLLGLAAAPAQAADVVGVAFVHGTGAQTNATQD
FT                   YWQPAIIDTVRQGLPNSSNYVVINCDFTQYMWKPEAAGCLANQLTGFIDSRGITQLVVI
FT                   THSNGGNVMRWILSNPTYDSRYPKIIRTVRKVNALAPSSAGTPLADAVLNGNTFETSLG
FT                   WLLGYKNDAVRQQQVASMATYNAQNLYGTAGRPALPKPFRAVVGSDVESAVWDSNSYCG
FT                   GYAANVGLEFTQNWLSSCSDGFLECSSQKAAGTTWFTDKQRTKDAEPLSHNQSRRECFG
FT                   LGTLLRNDLTQ"
FT   sig_peptide     46392..46466
FT                   /locus_tag="Smal_0039"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 25"
FT   gene            47282..48484
FT                   /locus_tag="Smal_0040"
FT   CDS_pept        47282..48484
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0040"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: slo:Shew_3564 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49745"
FT                   /db_xref="InterPro:IPR031979"
FT                   /db_xref="UniProtKB/TrEMBL:B4SR44"
FT                   /protein_id="ACF49745.1"
FT                   /translation="MTIHSTLLASAVLAVLSLSTAHAAQPLQAARAGDQVPVALVAAPL
FT                   PADESEHAPLAFAWALDPAQPLQAATPYASVSRSYWQQVDGTQLQRGLDLPLTAPDAVI
FT                   QLSPADGARALPANTLQVRDPAGRSSVARSVDARALQDAGMPVSDGSSMLRTGATSAVG
FT                   AYTLQSAQAQGRYVVQVLEPNSPLRLEVQANQAQVLAGGNVQLQARLLEDGATTAQLAS
FT                   RRGGLGGEALLVAPDGRSWPQRLLRTTDGALRAQVRIPADVGTVQGLWELQVFAQADGV
FT                   LRDGKVAFAVARATARFSGQAAPDPASRQVALPLQVAAAGRYEARGTLYATARDGQLKP
FT                   VAQAHAAAWFDGPGAGQLVLPFDQAALPAGFGAPYELRDLQLQDQSRMAPIESRALALR
FT                   F"
FT   sig_peptide     47282..47353
FT                   /locus_tag="Smal_0040"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.997 at
FT                   residue 24"
FT   gene            complement(48628..49479)
FT                   /locus_tag="Smal_0041"
FT   CDS_pept        complement(48628..49479)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0041"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: xac:XAC0179 ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49746"
FT                   /db_xref="GOA:B4SR45"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B4SR45"
FT                   /protein_id="ACF49746.1"
FT                   /translation="MSSLDPRACAVTVAPSAGELPPLIELDRATVVRGQVKVLHGLSLR
FT                   IAQGQHTALLGPNGCGKSTFIKLITRELYPLAQGDGTVAVKVLGQNRWQVDRLRSQLGI
FT                   VTGDLSSNLSDMPGLTVEQAVLSGFFASYVVPAFREVTADMRARVGETLAMTGALSLRE
FT                   RAYAELSAGETRRVLIARALVNRPQALLLDEPSTGLDLVAREQLVATMRVLAQQGITLV
FT                   LVTHHIEEIIPEIERVVLLRDGRVLADGTRAELLRNEPLSAVFGGAITVVEQEGRLTAY
FT                   AG"
FT   gene            49601..50803
FT                   /locus_tag="Smal_0042"
FT   CDS_pept        49601..50803
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0042"
FT                   /product="fatty acid desaturase"
FT                   /note="PFAM: fatty acid desaturase; KEGG: xac:XAC0180 fatty
FT                   acid desaturase"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49747"
FT                   /db_xref="GOA:B4SR46"
FT                   /db_xref="InterPro:IPR005804"
FT                   /db_xref="InterPro:IPR015876"
FT                   /db_xref="UniProtKB/TrEMBL:B4SR46"
FT                   /protein_id="ACF49747.1"
FT                   /translation="MPDALMSLLTGGVLGLGWWAMLAVLLVFTQITIFSVTLYLHRSQA
FT                   HRGVDFHPALAHVFRFWLWLTTSMITREWVAIHRKHHAKVETEDDPHSPVTRGIGKVFW
FT                   HGVELYREARGQRADIEQYGRGTPDDAIERRLYTPHATLGPVLLFAINTVLFGLPGVAL
FT                   WAIQMAWIPFWAAGVVNGLGHWWGYRNYESADTSTNLTPWGFWIGGEELHNNHHAFPSS
FT                   ARFAMRRWEFDIGWSAIRLLQALRLAKVLRVVPAMDVRPNIAVPDAETLKALLSHRFQA
FT                   MTDYQRNVFMPALREEAVQAGAKLRRLLPRRLRRGLVNDGRWLKPDSRAQLSEWVAQRP
FT                   RIRTLVEYRGRLAALLEARGHDAAERLHQLQAWCREAEESGIAALQAYAARLKGYSLVG
FT                   A"
FT   gene            50800..51132
FT                   /locus_tag="Smal_0043"
FT   CDS_pept        50800..51132
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0043"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xom:XOO_4252 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49748"
FT                   /db_xref="GOA:B4SR47"
FT                   /db_xref="InterPro:IPR002048"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="UniProtKB/TrEMBL:B4SR47"
FT                   /protein_id="ACF49748.1"
FT                   /translation="MRAGYGVLLAVLLPGVALAQVTDTTSYLQRMDSDGDGRVSESEYV
FT                   QWMLYAFDRMDRNGDGVLGADELPGGKGRVITREQQRQVIVQRFHKQDANGDGFLDARE
FT                   LSAPPR"
FT   sig_peptide     50800..50859
FT                   /locus_tag="Smal_0043"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.997 at
FT                   residue 20"
FT   gene            51363..52145
FT                   /locus_tag="Smal_0044"
FT   CDS_pept        51363..52145
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0044"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xac:XAC3635 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49749"
FT                   /db_xref="UniProtKB/TrEMBL:B4SR48"
FT                   /protein_id="ACF49749.1"
FT                   /translation="MKANPVLLTATLLGGLAFGAPVLADEPPAASEPQQDADAAAVAPA
FT                   PAWEHRVPTSTKLETNADGQPIGDRALRLVQRSTTGKVVAAQAAVSLFAGVIGGRGFSK
FT                   DQLKGTRVDTVPNPAFSSMEQQARAALATYFSAHPGAIPEQSRPVQVTVGDFTLIYKEL
FT                   GNAETEYELRQNVDLGFPYRRKLPTMRLTGGEGAHCRIAEPVSASLEAWQADDYALVRQ
FT                   TAERYAEACVASFVQTLPTLFPDTAPVAIQAPVEGQEV"
FT   sig_peptide     51363..51437
FT                   /locus_tag="Smal_0044"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 25"
FT   gene            52216..53028
FT                   /locus_tag="Smal_0045"
FT   CDS_pept        52216..53028
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0045"
FT                   /product="formamidopyrimidine-DNA glycosylase"
FT                   /EC_number="3.2.2.23"
FT                   /note="KEGG: xcb:XC_4239 formamidopyrimidine-DNA
FT                   glycosylase; TIGRFAM: formamidopyrimidine-DNA glycosylase;
FT                   PFAM: Formamidopyrimidine-DNA glycosylase catalytic domain
FT                   protein; DNA glycosylase/AP lyase, H2TH DNA-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49750"
FT                   /db_xref="GOA:B4SRN0"
FT                   /db_xref="InterPro:IPR000214"
FT                   /db_xref="InterPro:IPR010663"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR012319"
FT                   /db_xref="InterPro:IPR015886"
FT                   /db_xref="InterPro:IPR015887"
FT                   /db_xref="InterPro:IPR020629"
FT                   /db_xref="InterPro:IPR035937"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4SRN0"
FT                   /protein_id="ACF49750.1"
FT                   /translation="MPELPEVETTRRGLAPHLQGRRVHGVILRRADLRWPIPPEVAGQL
FT                   PGQRIDAVRRRAKYLLLDTAAGSAVLHLGMSGSLRVLPGDTPLRAHDHVDISLDNGRLL
FT                   RFNDPRRFGSLLWQPAGEVHPLLQGLGPEPLDDAFDGNYLFARSRGRSAPVKTFLMDQA
FT                   VVVGVGNIYAAESLFKAGISPLREAGKISRERYQRLADAVKEILGYAITRGGTTLRDFI
FT                   SPDGAPGYFEQELLVYGRDGLPCPNCGRALKHATIGQRASVWCSHCQR"
FT   gene            53134..54738
FT                   /locus_tag="Smal_0046"
FT   CDS_pept        53134..54738
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0046"
FT                   /product="periplasmic glucan biosynthesis protein MdoG"
FT                   /note="PFAM: periplasmic glucan biosynthesis protein MdoG;
FT                   KEGG: xcv:XCV4387 glucan biosynthesis protein D"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49751"
FT                   /db_xref="GOA:B4SRN1"
FT                   /db_xref="InterPro:IPR007444"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014438"
FT                   /db_xref="InterPro:IPR014718"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR023724"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4SRN1"
FT                   /protein_id="ACF49751.1"
FT                   /translation="MQRRDFIRNASLALAAFGLPSLPACAASKSGQMGLRRLGQPQPFD
FT                   FATLKGQARALAQAPYKSHKRVLPGRLEGLDWDQYQSIGYRQDHALWADQPGKFQAKFF
FT                   HLGLYFHSPVRMFDVVDGKAQELAYDGAAFNYGKSGIKDGELPADLGFAGFRLNTRKDT
FT                   DRDFAAFLGASYFRAVGKEGQYGQSARGLAIDTGMGKPEEFPDFIAYYLEQPSADSETI
FT                   VVYGLLDSPSVAGAYRFAITNGDVLLMDIDSALYPRKAIERLGIAPCTSMYQVGENDRR
FT                   MAWDWRPEIHDTDGLSLWTGAGEWIWRPLLNPRNLRFNMFVDRNPRGFGLLQRDRNFDH
FT                   YQDDGVFYEKRPCLWVEPKGEWGEGSVQLVEIPTVDETFDNIVAFWNPKEKPQPGQELL
FT                   VGYRLYWGAEPPARPPLAHCVASRTGLGGVVGKKREYFSWRFAVDFEGGELARLIDKGE
FT                   VEAVVEASRGRVEIVSARPLREINGYRAMFDLVPPEGSTEQIDIRLFLRSGGKTLTETW
FT                   LYQYTPPPAGAPERTLY"
FT   sig_peptide     53134..53214
FT                   /locus_tag="Smal_0046"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.998 at
FT                   residue 27"
FT   gene            complement(55261..55881)
FT                   /locus_tag="Smal_0047"
FT   CDS_pept        complement(55261..55881)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0047"
FT                   /product="Thymidine kinase"
FT                   /EC_number="2.7.1.21"
FT                   /note="PFAM: thymidine kinase; KEGG: xac:XAC4282 thymidine
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49752"
FT                   /db_xref="GOA:B4SRN2"
FT                   /db_xref="InterPro:IPR001267"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B4SRN2"
FT                   /protein_id="ACF49752.1"
FT                   /translation="MAKLYFYYSAMNAGKTTTLLQSAHNYRERGMRVAILTPRLDDRAG
FT                   AGVVASRIGLRADGMAFDRDTDLQRWVEHDLATNGPMGCVLVDEAQFLTRAQVWQLSEI
FT                   VDQLRIPVLCYGLRTDFRGELFEGSQYLLAWADEMQEIKTICHSGKKATMTVRVDEHGR
FT                   AVQDGPQVEIGGNDRYVSVSRAEFKKITRGEGRIDPAQAPLPL"
FT   gene            complement(55891..56619)
FT                   /locus_tag="Smal_0048"
FT   CDS_pept        complement(55891..56619)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0048"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sfu:Sfum_0326 Sel1 domain protein
FT                   repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49753"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:B4SRN3"
FT                   /protein_id="ACF49753.1"
FT                   /translation="MKAKHAPLCLLLGLSMAAAVTARECPVEAPRQIPPTVLTGGFFDA
FT                   HPDLFWRSMAQRAERDKRPARALDYYKRSARYADKFSQAMVARLYQEGIGTRADPVMAY
FT                   IWMDLAAERMYHDFLVLREHYWARLDALQQAQAIERGQQVYADYGDRVAKPRMERALRD
FT                   GRQQITGSRLGYVSSGLIVVQRRGNEQGIATPGSIVYDNDYWRAADYWCLQDNYWRPAL
FT                   TPSVEIGRPDTVRDDKAVGD"
FT   sig_peptide     complement(56551..56619)
FT                   /locus_tag="Smal_0048"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.827 at
FT                   residue 23"
FT   gene            complement(56655..57383)
FT                   /locus_tag="Smal_0049"
FT   CDS_pept        complement(56655..57383)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0049"
FT                   /product="Sel1 domain protein repeat-containing protein"
FT                   /note="PFAM: Sel1 domain protein repeat-containing protein;
FT                   KEGG: xac:XAC2943 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49754"
FT                   /db_xref="InterPro:IPR006597"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:B4SRN4"
FT                   /protein_id="ACF49754.1"
FT                   /translation="MSPIVSSALLGSVLLLVVPLSARGAGCAPGSGTSILPAVMTQGFL
FT                   QAHPDLHWRELGLQSWRQGRSDHALVRFKRAAAHADKVSQSLVARMYQEGVGTDADPVM
FT                   AYIWMDLAAERGYRELLLERERYWNRLDAGQRQRVLAEGPALYAKYGDVVAKPRMETAM
FT                   RLERSRMTGSRTGWVSSMLHVELSSGPEAGWPISGDDYYREAYWEPTAYWCMQDQIWQQ
FT                   EHRSGNVEVGPLSPVEGAGR"
FT   sig_peptide     complement(57309..57383)
FT                   /locus_tag="Smal_0049"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.719 at
FT                   residue 25"
FT   gene            57483..59459
FT                   /locus_tag="Smal_0050"
FT   CDS_pept        57483..59459
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0050"
FT                   /product="ATP-dependent DNA helicase Rep"
FT                   /note="TIGRFAM: ATP-dependent DNA helicase Rep; PFAM:
FT                   UvrD/REP helicase; KEGG: xcb:XC_4231 ATP-dependent DNA
FT                   helicase"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49755"
FT                   /db_xref="GOA:B4SRN5"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR005752"
FT                   /db_xref="InterPro:IPR013986"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="UniProtKB/TrEMBL:B4SRN5"
FT                   /protein_id="ACF49755.1"
FT                   /translation="MHGLNPPQAAAVLHIEGPLLVLAGAGSGKTRVIVEKIAHLIGCGR
FT                   YPARRIAAITFTNKSAKEMRERVAKRLREQDADEVTICTFHALGLKFLQIEHAAVGLKR
FT                   GFSIFDADDAAAQIKDLMYGAKPDDIEDMKNLVSRAKNAGLSPEQAMAAARSNREKEAA
FT                   SVYERYQLRLTAFNAVDFDDLIRLPVQVLEENPDIAVAWRERIGYLLVDECQDTNDAQY
FT                   RLLKQLAGDKGNFTCVGDDDQSIYAWRGANPENLQQMGRDYPALEIIKLEQNYRCSNRV
FT                   LRAANALIANNPHEHLKKLWSDQADGERIRVWECRNSEHEAEKVAAEIAFVAQSRKVPW
FT                   SDFCILFRGNFQSRPLEKAMQLLRIPYHLTGGTMFLERQEVKDTLAWLRLLVNPDDDTA
FT                   FMRAVQSPKRDVGAGTLAKLAELAQEKDMPMAQAAEAIGALQQLPPRAANSLARFTDIL
FT                   RDLRAQTRQISSGDMIRKVAKESGLLSELRQQAKEEASYQRRANNIEELAQWFEGGPRG
FT                   ATAADLAGQLALLSRSDKDEGGNQVRMMTMHASKGLEFPYVFIVGCEDGVLPHQVSLDE
FT                   GNLQEERRLLYVGITRAKIQLWMSYSKLTRKFGEHVRLKPSRFFEEIPAEEIQRDGADP
FT                   VADAARKKERASAGLAAIEALFD"
FT   gene            59721..60248
FT                   /locus_tag="Smal_0051"
FT   CDS_pept        59721..60248
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0051"
FT                   /product="acetyltransferase"
FT                   /note="KEGG: xac:XAC4280 acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49756"
FT                   /db_xref="GOA:B4SRN6"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:B4SRN6"
FT                   /protein_id="ACF49756.1"
FT                   /translation="MHPIESERLRLRAIEPDRDAAPMLALLNDPGFVRFIGDRNVRSEE
FT                   QAREYIALRVLHSYALNGFGMYAIERLSDGAWLGNAGLVRRDGLPAPDIGYAVLSDFAG
FT                   QGYAGEAARAVFNHARTVLGVQDLYGITDLDNVVSGKILLGLGMQERGVIQLPGIDTPS
FT                   RLYATLGAADVG"
FT   gene            complement(60347..60997)
FT                   /locus_tag="Smal_0052"
FT   CDS_pept        complement(60347..60997)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0052"
FT                   /product="protein of unknown function DUF480"
FT                   /note="PFAM: protein of unknown function DUF480; KEGG:
FT                   xcv:XCV4380 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49757"
FT                   /db_xref="InterPro:IPR007432"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4SRN7"
FT                   /protein_id="ACF49757.1"
FT                   /translation="MTDSTQTPDIPLLDAVQARLLGCLVEKEATTPDTYPLTVNAAQSA
FT                   ANQKTAREPVMNIDAGGVQHALRQLETLGLARQHFSSRADRYEHRLQAALDLTRQQTVL
FT                   LAQLLLRGPQTLGELVTRSERLHRFADADEARHAIERLQQRALLVVLPRASGQREDRYM
FT                   HLLCGEVDGAALAAKYASSGGGSEAADPGLAERVAQLEAAVAELQAQLAELRG"
FT   gene            61099..62022
FT                   /locus_tag="Smal_0053"
FT   CDS_pept        61099..62022
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0053"
FT                   /product="5'-nucleotidase, lipoprotein e(P4) family"
FT                   /note="TIGRFAM: 5'-nucleotidase, lipoprotein e(P4) family;
FT                   PFAM: acid phosphatase (Class B); KEGG: xcb:XC_4227 acid
FT                   phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49758"
FT                   /db_xref="GOA:B4SRN8"
FT                   /db_xref="InterPro:IPR005519"
FT                   /db_xref="InterPro:IPR006423"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:B4SRN8"
FT                   /protein_id="ACF49758.1"
FT                   /translation="MRRPVSLSLTLLATAALGLSACKCVDAPAADAAAPEAPAAAAKAE
FT                   GTPDVTANDNLNAVLWMQRAQEYKAITEQTYRAAADHLDVALKEAHWDALVPEERGNEA
FT                   KGLKPAVVLDVDETVLDNSPYQARLVRDGKEYDELSWDQWVAEKKAKAIPGVVDFAKAA
FT                   NAKGVTLLYISNRAVHLKDATLANLREQGLPVADDSVFLGLGTVVEGCEQAGSEKNCRR
FT                   RLAGQKYRVLMQFGDQLGDFVEVTANTNDGRDALLQQYHDWFGERWWMLPNPTYGGFEP
FT                   AQFNNDYSQSRQARHDAKRAALDYAP"
FT   sig_peptide     61099..61170
FT                   /locus_tag="Smal_0053"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.424 at
FT                   residue 24"
FT   gene            62019..62744
FT                   /locus_tag="Smal_0054"
FT   CDS_pept        62019..62744
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0054"
FT                   /product="orotidine 5'-phosphate decarboxylase"
FT                   /EC_number="4.1.1.23"
FT                   /note="KEGG: xcv:XCV4378 orotidine 5'-phosphate
FT                   decarboxylase; TIGRFAM: orotidine 5'-phosphate
FT                   decarboxylase; PFAM: Orotidine 5'-phosphate decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49759"
FT                   /db_xref="GOA:B4SRN9"
FT                   /db_xref="InterPro:IPR001754"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR014732"
FT                   /db_xref="InterPro:IPR018089"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4SRN9"
FT                   /protein_id="ACF49759.1"
FT                   /translation="MSRAPLPLRDDERLIFALDVPDRVQALDWVERLGDSVAFYKIGME
FT                   LLASGEYFQVLDELARRDKRVFVDLKFFDIPATAAAVIKRLSQWPVSYATIHGWHPAMM
FT                   EACAAANSSDMRLLAVTVLTSMGRPDLAQMGIDREPVDVVVERALAAQAAGIDGVIASG
FT                   QEAGPIRAATGAGFSIVCPGIRPGGPVGDDQKRTVGVAQAFADGADAIVIGRPIRLAAD
FT                   PQAAARAIQQEIASALAAR"
FT   gene            63143..64096
FT                   /locus_tag="Smal_0055"
FT   CDS_pept        63143..64096
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0055"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xcb:XC_4221 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49760"
FT                   /db_xref="UniProtKB/TrEMBL:B4SRP0"
FT                   /protein_id="ACF49760.1"
FT                   /translation="MSVAVRGRSARGWGLAAMLLLAVAACRESADDPAKPAAEPVAAVQ
FT                   AMALRLAEDDLVGYAKLSVPPSQYQRLQQAWTDGYSQWPLTELPLGDQLLPMLAALRKP
FT                   NASAELQRSFDRQLAGQASAVRQAAQSMGNFGVQYLRHQKGYTPGQQAHYVALVQTLAE
FT                   WAQGAPISDRARARNTIAALVGAAGKVGFDDEAGLQAAGMEGSLQQLAPFIHTLKAVLG
FT                   SYGLGVDEALRSVRGELLSVEGDNALVRLRYDLAGREMTLQLPLSRREGHWYLTRTLAD
FT                   TDALLRQADAARAAVAPAPVEAPTEGGEAATPPPKP"
FT   sig_peptide     63143..63235
FT                   /locus_tag="Smal_0055"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.964) with cleavage site probability 0.728 at
FT                   residue 31"
FT   gene            64096..66732
FT                   /locus_tag="Smal_0056"
FT   CDS_pept        64096..66732
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0056"
FT                   /product="Glycerol-3-phosphate O-acyltransferase"
FT                   /EC_number="2.3.1.15"
FT                   /note="PFAM: phospholipid/glycerol acyltransferase; KEGG:
FT                   xcc:XCC4128 glycerol-3-phosphate acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49761"
FT                   /db_xref="GOA:B4SRP1"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="InterPro:IPR022284"
FT                   /db_xref="InterPro:IPR028354"
FT                   /db_xref="InterPro:IPR041728"
FT                   /db_xref="UniProtKB/TrEMBL:B4SRP1"
FT                   /protein_id="ACF49761.1"
FT                   /translation="MAPMSKQNPLPFPGEESQSTPADTAPASPSTGTGPNPVPPPAHAR
FT                   PAGRRPLWARLLGRLVEPWLSLKIEPEDPGQYNDGRPVMYVLEDYGLSNALILDKACRQ
FT                   AGLPSPLVPLAGDPTGRKRAYLALSRRSSSNSLIPEQRGAKTHSDSLAKVLQAHRVRDD
FT                   LDVHLVPVSIFVGRAPDKQSGWFAVLFSENWALVGRFRRLLAVLLNGRSTIVRFAPPIS
FT                   LRSTVDEGLEPERTVRKLQRVLRTHFRRIRESVIGPDLSTRRLLVDQVLAAEPVREAIA
FT                   AQAKRDNSKPADAWKKAHAYAWEIAADYSSPVVRSASFMLSHVWNRIYAGVLVHHLDKF
FT                   KAAAPGHEVVYVPSHRSHMDYLLLSYLLYDRGIVPPHIVAGINLNLPVVGTLLRKGGAF
FT                   FIRRSIRGNALYSAVLSEYVAQLVAGGYSLEYFVEGGRSRTGRLLQPKGGMISMTLRAF
FT                   LRQPRKPVLFQPIYIGYEKLMEGGSYLDELSGRPKEKESIWSLLWGIPKVLKQNYGQVV
FT                   VNFGEPIALNDVLAEKAPEWGGEAVSEDEKPSWLSTTVDTLAERIQVRINGAADVNPIN
FT                   LLALALLSTPKHAMGEADLIAQIELCKTLLVEMPYSGRVTVTPHSPERIIAHAEEINVL
FT                   TRIKHPLGDVLSVSGDTAVLLSYFRNNVVHLFTASSWVACCFQNNRRMSRTGLVQLGRT
FT                   VYPFLQAELFLPWTEDEFAQRIDQTIDVFVREGLLQNVNEDDGGILARNTGQTDEVFRL
FT                   RAIGHSLQQAFERYYIAISVLVKNGPGVLGAAELESLCQQAAQRLSLLYAPAAPEFFDK
FT                   SLFRGFIQKLRELRLVWPDENSKLLFDERLDAWAKDAKFILGRELRHTIERVSPEAARP
FT                   DEPAPQD"
FT   gene            complement(66823..67026)
FT                   /locus_tag="Smal_0057"
FT   CDS_pept        complement(66823..67026)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0057"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xcb:XC_4218 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49762"
FT                   /db_xref="InterPro:IPR007420"
FT                   /db_xref="InterPro:IPR038444"
FT                   /db_xref="UniProtKB/TrEMBL:B4SRP2"
FT                   /protein_id="ACF49762.1"
FT                   /translation="MDTYSPAEIVEHLAALRAEHRLLDEQITRMAANGEDELESKRLKR
FT                   RKLQLKDCIAKLESLQIPDEPA"
FT   gene            67117..68013
FT                   /locus_tag="Smal_0058"
FT   CDS_pept        67117..68013
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0058"
FT                   /product="PP-loop domain protein"
FT                   /note="PFAM: PP-loop domain protein; KEGG: xcv:XCV4328
FT                   putative PP-loop family ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49763"
FT                   /db_xref="GOA:B4SRP3"
FT                   /db_xref="InterPro:IPR011063"
FT                   /db_xref="InterPro:IPR012089"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR035107"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4SRP3"
FT                   /protein_id="ACF49763.1"
FT                   /translation="MTAVISLPDPPQRASRGPRVAGPGQDRLGKRLRRQVGQAIADFGM
FT                   IEAGDKVMVCLSGGKDSYTLLDLLLQLQKRAPVPFELVAVNLDQKQPGFPEHVLPEYLA
FT                   ALGVPYQIIEQDTYSVVSRVIPEGRTMCSLCSRLRRGALYNHAKAHGFTRIALGHHCDD
FT                   MVATLFMNLFHHAKLAAMPPKLLSDDGQHVVIRPLAYVREHDIAEYAQARRFPIIPCTL
FT                   CGSQESLQRRQVGLMLKQWDQDHPGRIEQIARAMADVRPAQLADATLFDFRALGHSGHA
FT                   AHADAWLADAVPETPAD"
FT   gene            68050..68955
FT                   /locus_tag="Smal_0059"
FT   CDS_pept        68050..68955
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0059"
FT                   /product="putative exonuclease RdgC"
FT                   /note="PFAM: putative exonuclease RdgC; KEGG: xcv:XCV4327
FT                   recombination associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49764"
FT                   /db_xref="GOA:B4SRP4"
FT                   /db_xref="InterPro:IPR007476"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4SRP4"
FT                   /protein_id="ACF49764.1"
FT                   /translation="MFFRNLTFFRFPTTTDFSEVDTLLPHALLKPVGALEMNSRGFISP
FT                   FGREEKELLSHRIAEHLWLTVGGEDKILPAAVVNDLLERKLEEIEEKEGRRPGGRERKR
FT                   MKDDLLHELLPRAFVKSSRNDAFIDLQHGYVAVDTSSRKTGEYFMSDIRGLLGSFPAMP
FT                   LNAEVAPRSILTGWIAGEPLPTGLSLGEECEMKDPVEGGAVVKCQHQELRCDEIDKHLD
FT                   AGKQVTKLALIFEDNLSFVIGDDLIVRKLKFLDGALDQLEHADEDGRRAEFDARFALQS
FT                   AEIRRLFLLLEEAFKLSKAD"
FT   gene            69015..69794
FT                   /locus_tag="Smal_0060"
FT   CDS_pept        69015..69794
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0060"
FT                   /product="protein of unknown function DUF45"
FT                   /note="PFAM: protein of unknown function DUF45; KEGG:
FT                   xcb:XC_4188 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49765"
FT                   /db_xref="InterPro:IPR002725"
FT                   /db_xref="UniProtKB/TrEMBL:B4SRP5"
FT                   /protein_id="ACF49765.1"
FT                   /translation="MSRLLRRLISPTPPATVQRDTVRLRLEDAEIEVLRVRDPRARRIK
FT                   LSVDERGARLTLPPRASLVMGERFLEQHRDWLALQLRQYQSQELPAPLQPGEAGVLPLR
FT                   GELLPLRWQEGRYARLELDDHGACVQWPTRAGDATLRRLLREFYEAQTRADVGRWLPKY
FT                   LPGLPRAPSRLRLKVMSSQWGSLAPDGSMALDLALVLGRPEAFEYVLVHELCHLIQANH
FT                   SPAFWHEVEQRFPAWREQRDYFQLEGRRLKAMLRQLL"
FT   gene            complement(70087..70953)
FT                   /locus_tag="Smal_0061"
FT   CDS_pept        complement(70087..70953)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0061"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: dac:Daci_5146 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49766"
FT                   /db_xref="GOA:B4SRP6"
FT                   /db_xref="InterPro:IPR004363"
FT                   /db_xref="InterPro:IPR018148"
FT                   /db_xref="InterPro:IPR036914"
FT                   /db_xref="UniProtKB/TrEMBL:B4SRP6"
FT                   /protein_id="ACF49766.1"
FT                   /translation="MRIGLAANRLHHHDVRAALFRWLRASEAGLRELGVSLHAVGRTHD
FT                   AIERHGFLAGYGGLHRYPYGREGGLMKLVAEVVGMGPDRTLDGAIYLIDPVDPSSVFPE
FT                   ATALKRQCVIHGKPFISTVATARDWVEVERIHAGLAADAGADDLHAFEDQTLALIAHDA
FT                   MKPAMLAFADEHFEVLARFGERVATGTTGQRLNELAWSRGWPSDTPWVTRYQSGPMGGD
FT                   AQIADRVLEGRCQRAIFFEDPHVARQHEADIQLLERAVTTVTDQAVCITAPRVAARWAT
FT                   AAALRAG"
FT   gene            71106..73529
FT                   /locus_tag="Smal_0062"
FT   CDS_pept        71106..73529
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0062"
FT                   /product="multi-sensor hybrid histidine kinase"
FT                   /EC_number="2.7.13.3"
FT                   /note="PFAM: response regulator receiver; ATP-binding
FT                   region ATPase domain protein; histidine kinase A domain
FT                   protein; PAS fold-3 domain protein; KEGG: reu:Reut_B4471
FT                   PAS/PAC sensor hybrid histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49767"
FT                   /db_xref="GOA:B4SRP7"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B4SRP7"
FT                   /protein_id="ACF49767.1"
FT                   /translation="MRTSTVNAAGLPAAVAVMACLMLPATASAAGCETPLRIAWPSDRA
FT                   PLSSAIEGQAEGVSAAYLNLLGEQRPLQAQPLPATAVVEGLLPPATQALLGWPRSQLPS
FT                   GWVASAPYLQLPQVIVRRADARPVLGLEDLRERAVASPDRLPLAALLAEQAPGAQLLPP
FT                   APLDDALSLLGTGLVDAVIANLGEVEAGLRRYQGDRLVIAAPAGFDDALVLATVPACAG
FT                   VIPGFEQAVSQLTDTQRDVIRTGWLPDQPRNPPSSSPLRWLVPASLILLALALVYAFGY
FT                   WRVHRESARRRVAAQRLQEVTANLPAVVYQARRTATGDYSFPQIAGDVQALFGVSVETA
FT                   RIDHPRLLAAVHPDDRTLVMDCVEAAALARGPIDVTFRTRSPQGWRWVHSQGRTLACDD
FT                   SNVEWSGYWMDVSEVHTRTQALADARREAEQAALAKTHFLATMSHEIRTPMSTLLGMLE
FT                   RLAASDLDHRQQQVLATIGDAAQMLRQILDDVLHSQRLQPAPLQRQPTDLAALLRAVQQ
FT                   LLLPVAASRGLYLQIHLDPALQAGSLADSLRLRQILFNLVGNALKFTLHGGVELRVQVL
FT                   QQHAQGQRLRLQVSDSGVGISAERQQAVFGAYTQAEASTTRRFGGSGLGLAICRELAVS
FT                   MGGDLQLHSATGEGTTVWLELDLSACELPAGAPSPAIAEEQPLPPARVLVAEDHPTNLQ
FT                   LLEQRLHDLGLQVHACADGAQALQAWQSQPFELVITDCHMPGMNGFALARAIRADTCQH
FT                   RARVPIIALTASVLERTREACRDAGIDHFLAKPVEPRELRALLAVLLAPDSVRQ"
FT   sig_peptide     71106..71195
FT                   /locus_tag="Smal_0062"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.597 at
FT                   residue 30"
FT   gene            complement(73515..74960)
FT                   /locus_tag="Smal_0063"
FT   CDS_pept        complement(73515..74960)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0063"
FT                   /product="glutamate synthase, small subunit"
FT                   /note="TIGRFAM: glutamate synthase, small subunit; PFAM:
FT                   FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; KEGG: xcv:XCV0036 glutamate synthase
FT                   subunit beta"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49768"
FT                   /db_xref="GOA:B4SRP8"
FT                   /db_xref="InterPro:IPR006006"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR028261"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B4SRP8"
FT                   /protein_id="ACF49768.1"
FT                   /translation="MSRKHAFQFLDLPRTMPQRIPVELRTSGDWGELYGKFGKEDAQYQ
FT                   AGRCLDCGNPYCSWKCPVHNAIPQWLQLVQENRIHEAATLCHSTNPLPEVCGRVCPQDR
FT                   LCEGSCTLEEFGAVTIGAVEKYIVDTALATGWRPDMAAVQATGHTVAVIGAGPAGLACA
FT                   DRLAHAGITAVVYDRYEQVGGLLQFGIPSFKLDKDVIRRRREVLEGMGVQFRLGVEVGR
FT                   DVSLQQLLDTHDAVFLGTGAYRYTDGGLDGQDLKGVLPALPFLVQNSRIVGGDDPHGRP
FT                   IAGWEDTIALPDLNGKRVVVLGGGDTGMDCVRSAVRLGAAKVTCAYRRDEANMPGSARE
FT                   VANAREEGVRFLFNRQPLSIEAGADDEVIGVTVVETRLGEPDANGRQNAVPIEGSESLL
FT                   EADVVIIAFGFSPTVPAWLAEHGVEGQTNGRIVAGGKDRLPFQTAHPRLFAGGDAVRGA
FT                   DLVVTAVAEGRDAAASIVRLLAH"
FT   gene            complement(75046..79500)
FT                   /locus_tag="Smal_0064"
FT   CDS_pept        complement(75046..79500)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0064"
FT                   /product="Glutamate synthase (ferredoxin)"
FT                   /EC_number="1.4.7.1"
FT                   /note="PFAM: glutamine amidotransferase class-II; glutamate
FT                   synthase alpha subunit domain protein; ferredoxin-dependent
FT                   glutamate synthase; glutamate synthase; KEGG: xcv:XCV0037
FT                   glutamate synthase subunit alpha"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49769"
FT                   /db_xref="GOA:B4SRP9"
FT                   /db_xref="InterPro:IPR002489"
FT                   /db_xref="InterPro:IPR002932"
FT                   /db_xref="InterPro:IPR006982"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR036485"
FT                   /db_xref="UniProtKB/TrEMBL:B4SRP9"
FT                   /protein_id="ACF49769.1"
FT                   /translation="MAPRNRQGLYDPRSERDACGFGMVAQLDDQPSRLLVDTAIAALSR
FT                   MTHRGGVAADGLTGDGCGLLLRRPDAFLKLLASEAGIAVSARFAAGLVFLPHDADAAQA
FT                   CRTQLQAQLEAVGCKVAGWREVPTDDSVCGQLARDTLPRIEQVFVDAGVGQDDAGFALA
FT                   LFLARRRSEQQLRAHADFYVTTLTPDAISYKGMVLPDKLSRFFPDLQRRELASSAIVFH
FT                   QRFSTNTLPRWPLAHPFRMLAHNGEINTIEGNRRWAQARSKVWKTPRFDIGEFDPVISM
FT                   HGSDSQSLDNMLELMVAGGMELIQALRILVPPATQSLEFKDPDLAAFYEFHGLNSEPWD
FT                   GPAGIVACDSRYAVCTLDRNGLRPARWMLTADRHFLVASEAGVWEVPTERVVRKGKLGP
FT                   GEMIAIDLKRGDLLDSDAVDRINRGRAPYKQWLQQGVTYLQTELIDPSLVEEPFDEGTL
FT                   RSYHKLYQLSSEEVEQVLRPLAETEQEATGSMGDDTPMAVLSQRSRPLYDYFRQAFAQV
FT                   TNPPIDPLREDCAMSLSTQLGRETNIFHAGPETVNHVILNSPVLSQRKLRQLLKMDQYV
FT                   QANRLLDLSYGEDEGLRAGIERICAEAEQAARDGMVMLLLSDRYPVAGRPMVHALLATS
FT                   AVHHHLSRLGLRCDVNLIVETGTARDPHHMACLLGFGATAVYPYLAYQTLFDLGRRGIL
FT                   KLSKGGEQSQIGRRYRKGVYKGLSKIISKMGICTVASYRGAQLFEIIGLEPEVVDLCFP
FT                   DTASRIGGAGFARLDADARELCVQAWDAQQGVDVGGLLKYVHGGEYHMYNPDVVTTLQR
FT                   AARSGDPRAWQQYCDAVHARPPSALRDLLELVPAAAPTPLDDVAPASELFPRFDTAAIS
FT                   LGALSPEAHEALAIAMNRLGGRSNSGEGGEDPARYGTAKRSKIKQVASGRFGVTAEYLV
FT                   NAEVLQIKVAQGAKPGEGGQLPGHKVNELIARLRYARPGIGLISPPPHHDIYSIEDLAQ
FT                   LIYDLKQVNPTALVSVKLVSHAGVGTIAAGVVKAGADLITISGHDGGTGASPVSSIRYA
FT                   GVPWELGIAEAHQALLANDLRGRTLLQTDGGLKTGLDVVKAALLGADSFGFGTAPMIVL
FT                   GCKYLRICHLNNCATGVATQDERLRENHFTGQPERVENFFRLLAEEVRGWLSYLGVRSL
FT                   EEIVGRTDLLRQIDAAPRDGVRVDLSRLLADSRYEGSHCAAQRLYESPDSLATQMDGLL
FT                   APAIEHKRGGEHRFLIHNTDRSIGTRLAGAVARAHGNQGMAESPLELRFRGSAGQSFGA
FT                   FNVGGLHLEVEGEANDYVGKGMAGGRLVVRPPRGARFEARSTAIIGNTCLYGATGGELF
FT                   AAGRAGERFAVRNSGALAVVEGAGDHCCEYMTDGVVLVLGKVGLNFGAGFTGGLAYVLD
FT                   VDRDFVDRYNHELIDIHRVSAEGFENYRQHLHRLIGRHRELTGSIWAQQILDEFRDYIG
FT                   KFWLVKPKAASIESLTETLRRAA"
FT   gene            complement(79676..80065)
FT                   /locus_tag="Smal_0065"
FT   CDS_pept        complement(79676..80065)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0065"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xac:XAC0034 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49770"
FT                   /db_xref="InterPro:IPR021719"
FT                   /db_xref="UniProtKB/TrEMBL:B4SRQ0"
FT                   /protein_id="ACF49770.1"
FT                   /translation="MSFPIRARSLSALLLPAVLALTACQAPALDEQDSATAHAQQAAEA
FT                   AKAPADDAGKATEAPPVGTCDASQVQSLVGQAYTDALGKQAQEDAGASQVRVLKPNDVA
FT                   TMEFLGDRLNIEVDDKGAVSGARCG"
FT   sig_peptide     complement(79988..80065)
FT                   /locus_tag="Smal_0065"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.539 at
FT                   residue 26"
FT   gene            80177..81235
FT                   /locus_tag="Smal_0066"
FT   CDS_pept        80177..81235
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0066"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xcb:XC_0034 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49771"
FT                   /db_xref="GOA:B4SRQ1"
FT                   /db_xref="InterPro:IPR001631"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013500"
FT                   /db_xref="InterPro:IPR014711"
FT                   /db_xref="InterPro:IPR035447"
FT                   /db_xref="UniProtKB/TrEMBL:B4SRQ1"
FT                   /protein_id="ACF49771.1"
FT                   /translation="MSATSTPERQAARAAGLRYVDDTQPGISRRRAGKGFSYRDADGRA
FT                   LRDATTLQRIRALAIPPAYTAVWICAHANGHLQATGRDARGRKQYRYHADWAKERDAGK
FT                   FDRIIAFGEALPTLRRRLSRDLKRPGFPREKVLAVVVALLADTLVRVGNETYAQQNRSF
FT                   GLTTLRNRHLELLRGGRVRMRFRGKSGQLQEVTVGDRKLGLLVRRLQQLPGQALFQYHD
FT                   DEGALQPVDSGAVNDYLREVMGEDFTAKDFRTWGGTVAAVQAFAATELPEPASQRALAQ
FT                   AQRAVVCEVASLLGNTPAVCRKAYIDPCVFAGWERGELAKLAGLRGPRQWEQATLRVLR
FT                   RARRLNRSRQPQ"
FT   gene            complement(81223..81531)
FT                   /locus_tag="Smal_0067"
FT   CDS_pept        complement(81223..81531)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0067"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xom:XOO_0154 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49772"
FT                   /db_xref="UniProtKB/TrEMBL:B4SRQ2"
FT                   /protein_id="ACF49772.1"
FT                   /translation="MKLAIATAAVCFALAACSSTPMAQVQPIDGVISGQCHSDMVRGAL
FT                   GLAASDATVARARVDSDSLHVRVLRHDGPRVPPASEGGDRLTIEKGRTNNITAIYCG"
FT   sig_peptide     complement(81460..81531)
FT                   /locus_tag="Smal_0067"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.976 at
FT                   residue 24"
FT   gene            81748..82854
FT                   /locus_tag="Smal_0068"
FT   CDS_pept        81748..82854
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0068"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR
FT                   domain protein; KEGG: pna:Pnap_2744 short-chain
FT                   dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49773"
FT                   /db_xref="GOA:B4SRQ3"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B4SRQ3"
FT                   /protein_id="ACF49773.1"
FT                   /translation="MATTKKTLTRRKASPKVRKGSTATKTAADPDRPRVVKTATRKAAA
FT                   SDPRASRVAARQRRLQDQEKAKDVRAEKKATKKTATQAGARRQPEAMPAQQLAKPGHEH
FT                   ELELAPRFLAPDYTGSGKLRGMRAIVTGGDSGIGRAVAVLFAREGADVAVLHLDEAEDA
FT                   DITRQHVEREGGRCVVIAGDVRDPRFCNKAVKQVAKAFGGIDILVNNAAFQLHCARLED
FT                   LEDAHLQETLQTNIGGYIQMARAVLPHLGEGASIINTGSETGIFGSKALIDYSATKGAI
FT                   HAFTKSLASQLLPRGIRVNCVAPGPVWTPLNPADKPAEDVAEFGKDSDMGRPAQPEELS
FT                   PAYVFLASPVCASYISGVILPVMGGPRG"
FT   gene            82974..84389
FT                   /locus_tag="Smal_0069"
FT   CDS_pept        82974..84389
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0069"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xcv:XCV1185 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49774"
FT                   /db_xref="UniProtKB/TrEMBL:B4SRQ4"
FT                   /protein_id="ACF49774.1"
FT                   /translation="MPEMDINAAANEVVALMRQNDVRGAAARLEALHDGQSVVVQESLD
FT                   RYISARAATELEALRRNGGVAAADAATVNPMLDRLGEATRPPRMPEAAETAGLSQAQQY
FT                   DVYGSIVAQRGNTAANEAMATQDRVVLGLRDENRTTEARGRGVYDDRIVVLWKDAQGQG
FT                   HVREFNQATTEPTAQYDGHAKTTPRSPGFGNVAPRTKTEGEDVNGDRVKDLGRLGEGTT
FT                   EMRATTHPRHGHADEFALRPSQDAVTAGAGRVERDSNGDGWFDARDTQGVQDLNDTFKI
FT                   HRGSRANTDSAGCQTIGGGEYDDFVATVRGTPGQNRWQYVLTSVAPGQARELGQDAPLA
FT                   ANDDPRQPQHRDHALQQQISTRLQALGGRYAEHADAYSLVMLREAKAAGITQVDQIVAS
FT                   NPSAGRAAGETLFLVQGSPGDPAAVRAGVNASEVRDTPVESSLRQLQQQSREQAAPAPV
FT                   PAQQPEAPAMGGR"
FT   gene            84390..85193
FT                   /locus_tag="Smal_0070"
FT   CDS_pept        84390..85193
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0070"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xac:XAC1162 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49775"
FT                   /db_xref="UniProtKB/TrEMBL:B4SRQ5"
FT                   /protein_id="ACF49775.1"
FT                   /translation="MMARPHLTPALSLMLLLACSACAPAGEHIAAAAPTSKPSTMPAQP
FT                   LSPDRGLPGLPEASGSAHPGGRYGALPEPARRVLTQLKCDVDGASDVQVFSLPGQGDQQ
FT                   DFMVTDRSGPGFQYWIRSFAGSAGTTGYLVQLENCPATTAGMRAYIAQGAAPLQDVTAS
FT                   LLAQAELPDAATMTAYQDKGAGDLFAFIGALDKVPVLRWVAEADPEQPLAVDARSFDHG
FT                   NAIHGGFLRWNQDHFEVARTVPAALWPCDDSPLLPCKGDPFVSGR"
FT   sig_peptide     84390..84473
FT                   /locus_tag="Smal_0070"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.501 at
FT                   residue 28"
FT   gene            complement(85128..86249)
FT                   /locus_tag="Smal_0071"
FT   CDS_pept        complement(85128..86249)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0071"
FT                   /product="beta-lactamase"
FT                   /note="PFAM: beta-lactamase; KEGG: fjo:Fjoh_3817
FT                   beta-lactamase"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49776"
FT                   /db_xref="InterPro:IPR001466"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:B4SRQ6"
FT                   /protein_id="ACF49776.1"
FT                   /translation="MLITALPFAAVSASQDQANDQTRRLIRQIMLEQRIPGLQIAVVKD
FT                   GQIVLSEAYGLANVENGVLASRDTRFPLNSAIKAFTGVAAAQLAQQGQLDLDAPASRYL
FT                   DDLPAAWRDVRVRQLLAHTSGLPDILDASGLLGGGTEAQAWAAVTALPMEAASGQRFAY
FT                   NQTNYVLLARIIAQQSGMPYAHFLATGQFSSARMARTTFGDSYDLIPQMATMYSLAPRA
FT                   TDAADAPPRLSHWFYDIPPSLWAGGGILTTADDTARWLVALTDGRLLQDAPRKRMWTAE
FT                   RLTDGRAGPWAGGWPVLRASPDLQVAGIGGARSAFVVYPDRDVAVVVLTNLVGANPQQS
FT                   IPRIADFYARAASTPAHERVALARQQRAVIAGP"
FT   sig_peptide     complement(86193..86249)
FT                   /locus_tag="Smal_0071"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.801) with cleavage site probability 0.790 at
FT                   residue 19"
FT   gene            complement(86394..87341)
FT                   /locus_tag="Smal_0072"
FT   CDS_pept        complement(86394..87341)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0072"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: helix-turn-helix- domain containing protein
FT                   AraC type; KEGG: csa:Csal_2540 transcriptional regulator,
FT                   AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49777"
FT                   /db_xref="GOA:B4SRQ7"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="UniProtKB/TrEMBL:B4SRQ7"
FT                   /protein_id="ACF49777.1"
FT                   /translation="MQVYSCAELMSAAHALGGRVDFESGLPDALPVLAGWQQVQSMDSG
FT                   LVLYLSRSQDMVGGRSQNCLPAGLTASFLLQGQAEVVITNQRLQMDSRRAGSPAMLVHL
FT                   REEEAFQRHWQAGREETKVSLHLGQDWLSRQLDGIASAGLTRLRLSHARNQAWQPPAPL
FT                   LRRAAALFGAETAEPPLLASLQRESFALEVAASVVRSVIAEREAPAPSAHLRRCVDQLQ
FT                   QWLQSGEADGLTINQMARRLGTNAVDLQSTFQQLHGSSIAAWLRALRLQRAHDALLQRR
FT                   VSVDVAASLAGYAHTSSFSAAFKRQFGRSPSQIR"
FT   gene            87475..87861
FT                   /locus_tag="Smal_0073"
FT   CDS_pept        87475..87861
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0073"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fph:Fphi_0921 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49778"
FT                   /db_xref="UniProtKB/TrEMBL:B4SRQ8"
FT                   /protein_id="ACF49778.1"
FT                   /translation="MGLVINEAVVLRAVFHGAVDAHQIRYWLDRVQALIDAHRPFYFVA
FT                   STAPGATFCDDYRALQAVWYKQYKAAFRRYCRGLVRIASDAADQQRLDTPALHAAWAVP
FT                   YFVTADAGAGMRWIGEHLEQADAH"
FT   gene            87851..89071
FT                   /locus_tag="Smal_0074"
FT   CDS_pept        87851..89071
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0074"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   fph:Fphi_0920 putative transmembrane transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49779"
FT                   /db_xref="GOA:B4SRQ9"
FT                   /db_xref="InterPro:IPR004752"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B4SRQ9"
FT                   /protein_id="ACF49779.1"
FT                   /translation="MRTERAAASPFGLGVIVALYMAHALPLYFYNVAVPAILRSQGVDL
FT                   RWIGMLSLLYLPWALKFLWAPLVDRWHLPALGRRRSWLWLTQLLLLAGILVLAFTGLDH
FT                   GLVVFVLVGMWISSIAATQDIAIDGYTVEALAPAEHRLGSMAQSVGVALGSMIGGAGVL
FT                   WLYETRGWSVALLSLAAMSALTLLAVQRINETPARPDAPRPSILRALRRRELRWALLLI
FT                   VLYRLVEAPAMAMINPLLVDQQFSLTEIGLLISVGGAGTGMLAAVGAAWLLKQRRAEQL
FT                   LMHAGWWRTVLYVLLALMLYSGAMASSRWGLGVLVIALLALRYVAMTSLYALFMRVSSR
FT                   AQAGTDFTLLVCFELLVNFIGGALSGFLAKGLGYPIYYIALAAVSALGLLLCRPLMRRF
FT                   AAPTNSP"
FT   sig_peptide     87851..87919
FT                   /locus_tag="Smal_0074"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.847) with cleavage site probability 0.571 at
FT                   residue 23"
FT   gene            89089..91344
FT                   /locus_tag="Smal_0075"
FT   CDS_pept        89089..91344
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0075"
FT                   /product="TonB-dependent receptor"
FT                   /note="PFAM: TonB-dependent receptor; TonB-dependent
FT                   receptor plug; KEGG: aci:ACIAD2116 putative ferric
FT                   siderophore receptor protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49780"
FT                   /db_xref="GOA:B4SRR0"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039426"
FT                   /db_xref="UniProtKB/TrEMBL:B4SRR0"
FT                   /protein_id="ACF49780.1"
FT                   /translation="MRHTAATLPLAMLALAISGQLAAQNTSATAGTRQLDAVSVTAVRG
FT                   ARSVAEIAGTVYAIEREQIAPQITAGRSTADILGQLVPSLAPASGTTSNYGMTMRGRSV
FT                   QVMIDGVPLTGARDGSRQLNSISPTMIERIEVISGATALYGAGASGGIINIITLQPGEQ
FT                   PVQLASQFGLRSPSHLSSDTLAWNAAQTMTVRGDQFSGAFGFAYGRQGASLDAHGRRIG
FT                   PEIAQTDRQDTETRELNARFDWTLTDSQRLSVGVRWFDDQQDSDHGPDYGPRLAALFNP
FT                   AFTPSHQALPGLQLEAQPRTRHQGVNAQYRNRDVLGGQELSVEAYYRNEQGRWFPSVST
FT                   LVHPALRGGFAYVAMQSNTEIDVWGLRSALHKDFQVGGRSLQLSYGVDHEREQDSQRGQ
FT                   MYDINRFIASNGLDYRPTAQYAMGPDVRVDTTGLFLQADHSLGERFSVQAGVRHQILRN
FT                   RVEDSLPYTEAITADAVAGYTPRLLQGGRVRHAQTLFNAGVVYRLDASQQLFANFSQGF
FT                   SLPDTQRMLRDVPASFVIDSRNVGPIKVDSYELGWRRSDASLQSAVTAFYNRSDKTVQF
FT                   NRDYSVSVADTDERVWGVEANLRYTPTAQLELGASLASTRGQYRDAAGRWRELNAFRVS
FT                   PLKAGVHGQWRFANDSLLRLQGQVVGGTDRAWRDAPLAAISPSIRATPAAKIHGYAVFD
FT                   LIGEVPLAGGRFSAGIYNLADRDYRTVYGQQAEATYGKMSSLPAAGRTFSIGYRVEY"
FT   sig_peptide     89089..89160
FT                   /locus_tag="Smal_0075"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.814 at
FT                   residue 24"
FT   gene            91452..91838
FT                   /locus_tag="Smal_0076"
FT   CDS_pept        91452..91838
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0076"
FT                   /product="transcriptional repressor, CopY family"
FT                   /note="PFAM: Penicillinase repressor; KEGG: xac:XAC0069
FT                   methicillin resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49781"
FT                   /db_xref="GOA:B4SRR1"
FT                   /db_xref="InterPro:IPR005650"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B4SRR1"
FT                   /protein_id="ACF49781.1"
FT                   /translation="MRGKTIGDQELALLQYIDEHAPASVGEVASGYGEARGLARSTVLT
FT                   MMERLRAKGYLRRQQQDGVYRYQATRGPESVLQGAVAQFVDNTLQGSVSPFVAYLSQRQ
FT                   QVSDNELAELEALVAELQSRRQEG"
FT   gene            91842..93836
FT                   /locus_tag="Smal_0077"
FT   CDS_pept        91842..93836
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0077"
FT                   /product="peptidase M56 BlaR1"
FT                   /note="PFAM: peptidase M56 BlaR1; KEGG: xcv:XCV0046 BlaR1
FT                   peptidase M56 family membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49782"
FT                   /db_xref="GOA:B4SRR2"
FT                   /db_xref="InterPro:IPR008756"
FT                   /db_xref="UniProtKB/TrEMBL:B4SRR2"
FT                   /protein_id="ACF49782.1"
FT                   /translation="MDTTMLILLLERLGWTSLQTVLLVALVYGVCRALPSLSAATRCRL
FT                   WWLVSLQAVLGLFWSQPLQLAWLPAPQAVAMTATDVAADMVYPLAPDASAQLLATMPVP
FT                   AADVPAVAWWAVALAVLWASGVLLMALRTFGEWRRCRALLAAAYPCEDEALVQALQLAS
FT                   DAHGVRPAPRLWMSAQVDAPQLVGPFRPVLLLPAGDNALQGDALDLALTHELQHLQRRD
FT                   LQWGLLPALAQHLFFFHPLLRLSVREYAQAREEAVDAAVVGQHGASRQAYGRLLLQLGV
FT                   APQPHLGVASAAPNTTSLKRRLLSLQSRRSCPRILAMALTAVVVVVGVAPMRLVAAPVP
FT                   PAPPAPPAAPKAVVPPPPKAPNAPPAPPSAARVPAVPVAPAPPAEPADVEALSGPDDAD
FT                   VAVDVDVDVDTDMHSEHSTSHTTSITTYGRLDLGKSPSQAYVLVDGDSTFANGGIDDVT
FT                   VARRQLGKGPALWFRQGDKRYVVRDPMLIQTLQRAYSGAADLGRQQSELGRQQSALGRE
FT                   QGELGRQMGEMGRLQGEESRRIALAAAEVARSAMAAHDINREAAAEAAKAARGATSDMA
FT                   VAREAAREAAAEARRAMQEARSEAAQSGRTRDMQRLASQQSELASRQAALGSQQAALGE
FT                   RQARVHAQASQQAQQVIARALASGKAERL"
FT   gene            complement(93930..94244)
FT                   /locus_tag="Smal_0078"
FT   CDS_pept        complement(93930..94244)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0078"
FT                   /product="lipoprotein, putative"
FT                   /note="KEGG: pap:PSPA7_3327 lipoprotein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49783"
FT                   /db_xref="InterPro:IPR021719"
FT                   /db_xref="UniProtKB/TrEMBL:B4SRR3"
FT                   /protein_id="ACF49783.1"
FT                   /translation="MRLNPLVLLAILPLAACSHAGSSTSHDPAPAPVADAAHECKPEAL
FT                   EAFTGKTADEATIKKLVTASGARGARVVKPGMAVTMDFRQDRVTVQVDAQNRIERASCG
FT                   "
FT   sig_peptide     complement(94182..94244)
FT                   /locus_tag="Smal_0078"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.611 at
FT                   residue 21"
FT   gene            complement(94311..95333)
FT                   /locus_tag="Smal_0079"
FT   CDS_pept        complement(94311..95333)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0079"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xcb:XC_0053 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49784"
FT                   /db_xref="GOA:B4SRR4"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038720"
FT                   /db_xref="UniProtKB/TrEMBL:B4SRR4"
FT                   /protein_id="ACF49784.1"
FT                   /translation="MSLSLDKLRLLRKQAGDPKAVTPAAPEPPPAAPAPVAANDARQPP
FT                   AERSVFAWVEQEIRHKATGAAASTPTPAPLRRPEVGSLHRLLGLRTRGGPAPARASAQD
FT                   RQLPGEEIAPGLFLIESLQPQPIPAQSMSLDFARREGEHVAPRDLLFFDTETTGLAGGT
FT                   GTRAFMIGAADWHVCPQRGEGLRIRQLLMSTMAAEDAMLATFASWLQPSTVFCSYNGRS
FT                   YDAPLLKARYRLARQRCPITALDHVDLLYPTRRRYRGTWENCKLSTIERQLLRVVREDD
FT                   LPGSEAPGAWLRFLRGGDAVNLRRVADHNHQDVVTLALLLQRLVREEQRERETLALVGQ
FT                   "
FT   gene            complement(95330..97819)
FT                   /locus_tag="Smal_0080"
FT   CDS_pept        complement(95330..97819)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0080"
FT                   /product="DEAD/DEAH box helicase domain protein"
FT                   /note="PFAM: helicase domain protein; DEAD/DEAH box
FT                   helicase domain protein; Helicase superfamily 1 and 2
FT                   ATP-binding; SMART: DEAD-like helicases; KEGG: xom:XOO_0145
FT                   ATP-dependent RNA helicase"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49785"
FT                   /db_xref="GOA:B4SRR5"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR018973"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B4SRR5"
FT                   /protein_id="ACF49785.1"
FT                   /translation="MAYELAKRTADAEQKLATRDGLPARDGALLSARLQRRYQDRITGS
FT                   FAIPGREGRYAPLPDSVPPALAAALKARGIEQLYSHQAEAWEASQRGEHVAIVTPTASG
FT                   KSLCYTLPVVSAAMQDKAKALYLFPTKALAQDQVAELLELNRAGDLGVKAFTFDGDTPG
FT                   DARQAIRLHGDIVVSNPDMLHQAILPHHTKWAQFFENLRYIVIDEVHTYRGVFGSHVTN
FT                   VLRRLKRICAFYGVQPQFILCSATIGNPQAHAEALIEAPVTAITESGAPSGPKQVLLWN
FT                   PPVINPDLGLRASARSQSNRIARIAIKSGLKTLVFAQTRLMVEVLTKYLKDIFDHDPRK
FT                   PPRIRAYRGGYLPTERRETERAMRAGTIDGIVSTSALELGVDIGSLDVVILNGYPGSVA
FT                   ATWQRFGRAGRRQQPALGVMVASSQPLDQYVVRHPDFFAEASPEHARIAPDQPLILFDH
FT                   IRCAAFELPFRVGDGFGPIDPEVFLEALAETEVIHREGERWEWIADSYPANAVSLRAVA
FT                   DGNFVVVDRSDGRQQIIAEVDYSAAALTLYEGAIHMVQSTPYQVETLDWDGRKAYVTRT
FT                   HVDYYTDSIDFTKLKVLDRFDGGVAGRGDSHHGEVHVVRRVAGYKKIRYYTHENIGYGP
FT                   VNLPDQELHTTAVWWQLPQALLLRAFASKQDALDGFLGAAYALHIVATVAVMADARDLQ
FT                   KSVGNGDGSWFAIADQSGRGQLRGSEGDPGVVELLQEFVPTVYLYDNFPGGVGLSEPLW
FT                   QRQAELVQRARELVQRCDCKAGCPACVGPVLAAQEEDETSPRALALRVLDLFDAEACQH
FT                   VPDVVMTTRDPMELLAP"
FT   gene            98032..98550
FT                   /locus_tag="Smal_0081"
FT   CDS_pept        98032..98550
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0081"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mcc:718526 regulatory factor X, 1 (influences
FT                   HLA class II expression)"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49786"
FT                   /db_xref="UniProtKB/TrEMBL:B4SRR6"
FT                   /protein_id="ACF49786.1"
FT                   /translation="MAVARRGTQGAVLASMLLAGIAQAQQATPVAVPDPAPEPPADAPA
FT                   ATTAPISTTLPQDNVTTLGEVRALKPEDEPLDLYRFKNPVKFGDNRFSRDWSEPPSPEQ
FT                   VSMGGGYIMMGVVKGVMAAAKGINKLTGGPAQIQAAVARPPPELSAEQQQRALRFSQEQ
FT                   DAGDAPPVK"
FT   sig_peptide     98032..98106
FT                   /locus_tag="Smal_0081"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.982 at
FT                   residue 25"
FT   gene            98590..99264
FT                   /locus_tag="Smal_0082"
FT   CDS_pept        98590..99264
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0082"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xcb:XC_0139 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49787"
FT                   /db_xref="UniProtKB/TrEMBL:B4SRR7"
FT                   /protein_id="ACF49787.1"
FT                   /translation="MFLRSICLLAALLPASAFADGIAGDGACRNGAFPSEQSRFALARV
FT                   VDAPRLYLLGDMDGCPAKGEPACRQRSYVVNGDTVVTGRDLGRYRCAFFPNKVGGSAGW
FT                   VDRSKLQALPVVVPSLQDWAGHWKDGDNGLRITVQGGQLHVEGDAYWPSANPTPEQRPY
FT                   GPNMGQVEARAAPRGADVEFVEDTCKVRVHSLGEVLIVADNRECGGMNVRFNGVYRRAG
FT                   TR"
FT   sig_peptide     98590..98649
FT                   /locus_tag="Smal_0082"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 20"
FT   gene            complement(99364..101172)
FT                   /locus_tag="Smal_0083"
FT   CDS_pept        complement(99364..101172)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0083"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xcb:XC_0088 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49788"
FT                   /db_xref="GOA:B4SRR8"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:B4SRR8"
FT                   /protein_id="ACF49788.1"
FT                   /translation="MNASAVNLWIALALALIVVIASVRQLRGDTAHPGRRWIMIALQII
FT                   VAALLYFCLVPPTRQQPAGGLVVLGTDADKASALPASEGPLLLLPEAADIPGAQRVPDL
FT                   ATALRQHPASTLTLVGAGLAARDHDALLPPDVRWQAAPEPRGWIALQPPANVAPGARFD
FT                   VQAQARGAARAKAELLDPADSVVDRTDVAEDGRVKLSGIARAEGRSVFQLRLLDADGHV
FT                   VDSVPVPQQTLPAAPLRLMVRASAPGPELKYLRRWAADAGIRVQVQADTGAGVSVGDGA
FT                   VALDAASLARSDLLLLDERSLAALSAGQLAAVRQALREGLGVLVRGAGAPSASARQRLR
FT                   DLGLPVQGDGSSRTLELPGDGDSAVLAARRGPLAAGTLPTGYGEEADRSSHNAPLPALE
FT                   ALALQAPGSTALLQDGTGKAVGGWRAAGKGRIGLLPLTDSWRWVLAGRDDRHGELWSGV
FT                   VATLARAQGSADALWSPQPIGWAGERQSLCGVQAPLQVFNKRGDDVSLIVDGATSALRC
FT                   AGWWPREPGWQRLQHGDSVVWRYVFDPKDAPALHRQAMIDATTQALASSTSANALVMQH
FT                   VPGSRWPWWLAFVLCASLLWWLERRR"
FT   sig_peptide     complement(101086..101172)
FT                   /locus_tag="Smal_0083"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.785) with cleavage site probability 0.598 at
FT                   residue 29"
FT   gene            complement(101169..103355)
FT                   /locus_tag="Smal_0084"
FT   CDS_pept        complement(101169..103355)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0084"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xcb:XC_0089 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49789"
FT                   /db_xref="GOA:B4SRR9"
FT                   /db_xref="UniProtKB/TrEMBL:B4SRR9"
FT                   /protein_id="ACF49789.1"
FT                   /translation="MKTLQHAWQRARRRRAAITLLLGLPWALAATALALRLSGFDIACV
FT                   VATVSLLACAAFATARARQLDRQWLQRQLDGSGASEDSADLLFADAAALNPLQQRQRAH
FT                   VLATLERAMPELRPRWPHLAVMLCWIGGLAVALLAFGWPRSNPDPAAVHSATTGSTASA
FT                   GPLQLQSSRLRIDAPAYTGQATLTQSTLDAKVAADSQLSWSLRFDRAPAKAWLQFHDGR
FT                   RLPLSEHDGQWQAQDVARTPVLYRVVSEPALAETRLYRLDVVADRAPSVRVLEPSASLV
FT                   LGTPGQRQWALRFEASDDYGVAAQATLSITTTQGSGENITFVKRSVTLAGSGEATARRF
FT                   AHTLDLAALGAQPGNDVIAQLEVRDNHAPTPQTGRSSSVILRLPSAEVALGAELEGRIK
FT                   KTLPAYFRSQRQIIIDAEALIRQRRSLAAEDFVKRSDAIGVDQRILRLRYGQFLGEESE
FT                   GAPKPPPTSDLPTSDTPAADDHDHDHDHDDDHDHDHGAEAGAHDEHGHDHGGKASNADT
FT                   PPVFGSATDVLSEYGHTHDHAEAATLLDPQTRATLKAALDQMWSAEGELRQGRPEQALP
FT                   FAYKALGFIKQVQQAERIYLARVGPELPPIDEGRRLGGDRAGLASRELPLAARTPPDPA
FT                   IVEAWQRLGDDTGAPDLDALATWQQRNAAYLPDALDLAAAIEQLRIEPGCHDCRQRLRA
FT                   QLWRALQRPLPQVMRRSAADAMGQRYLDALEAQP"
FT   sig_peptide     complement(103251..103355)
FT                   /locus_tag="Smal_0084"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.457 at
FT                   residue 35"
FT   gene            complement(103352..104473)
FT                   /locus_tag="Smal_0085"
FT   CDS_pept        complement(103352..104473)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0085"
FT                   /product="conserved hypothetical membrane protein"
FT                   /note="TIGRFAM: conserved hypothetical membrane protein;
FT                   PFAM: protein of unknown function DUF1550; KEGG:
FT                   xac:XAC0116 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49790"
FT                   /db_xref="GOA:B4SRS0"
FT                   /db_xref="InterPro:IPR011933"
FT                   /db_xref="InterPro:IPR024163"
FT                   /db_xref="UniProtKB/TrEMBL:B4SRS0"
FT                   /protein_id="ACF49790.1"
FT                   /translation="MTLLFPLGLAALAAWLLPLLIHLARRHPYTPLDFAALRWLRAQIR
FT                   PRQRIRFDDWPLLLVRLLLLAALALLLARPALTGPAPAPTAWTVVAPGLDATALRGTAE
FT                   AGNWHWLAPGFPAIDQVPPASTASLPSLLRELDAQLPVGTALTVHVPDPLPGLDGARLQ
FT                   LSREVQWHTQPMPVTAQPRAATSPRLRVHSDASAAAQHWLNALQRAWGVQAPLAPLVAD
FT                   ALPERGEIGVWSRNDALPANWQAWLQDGGSVLIAAKPATEAQVLLRSAEGVPLLWQQRV
FT                   GLGRLLSLPGDWDAASNTALRDPQLPRSLLLALQPPPSPRVGDAQDQAPRQIALPAAAS
FT                   PVREPTAWLLLAIVLLFALERWMASSARRRAIA"
FT   gene            complement(104470..105366)
FT                   /locus_tag="Smal_0086"
FT   CDS_pept        complement(104470..105366)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0086"
FT                   /product="protein of unknown function DUF58"
FT                   /note="PFAM: protein of unknown function DUF58; KEGG:
FT                   xcb:XC_0091 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49791"
FT                   /db_xref="InterPro:IPR002881"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:B4SRS1"
FT                   /protein_id="ACF49791.1"
FT                   /translation="MNAGTSLTLPPELRARLRLLRLRPRLASGASGIGQHASRSRGAGL
FT                   EFAQYRAYEPGDELRQIDWKLYARSDRFFVRESERESPITVWLLLDATASAGQADRAAP
FT                   ERTRLDHMRGVAACLVELALQQGDRFGLLAINGDGLQLVPAASGARQRDRVHLQLHALQ
FT                   ARGGWPSADRLRPLWERVRPGDMLLAIGDGFDEAGIVLLEQLASARREVALLQILTADE
FT                   RDFPFDAGHRFRDPETGEELLGDGAAIRADYLQRFADARSALQSRLQASGIASATGWLD
FT                   QPLDQPLQALFGRGGGA"
FT   gene            complement(105374..106357)
FT                   /locus_tag="Smal_0087"
FT   CDS_pept        complement(105374..106357)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0087"
FT                   /product="ATPase associated with various cellular
FT                   activities AAA_3"
FT                   /note="PFAM: ATPase associated with various cellular
FT                   activities AAA_3; ATPase associated with various cellular
FT                   activities AAA_5; KEGG: xcv:XCV0089 MoxR-like ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49792"
FT                   /db_xref="GOA:B4SRS2"
FT                   /db_xref="InterPro:IPR011703"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041628"
FT                   /db_xref="UniProtKB/TrEMBL:B4SRS2"
FT                   /protein_id="ACF49792.1"
FT                   /translation="MTTADLDSLLPRLHDLRAALARAVVGQNTVVEQLLIGLLAGGHCL
FT                   LEGAPGLGKTLLVRSLGQALELQFRRVQFTPDLMPSDILGTELLEEDHGTGHRHFRFQQ
FT                   GPIFTNLLLADELNRTPPKTQAALLEAMQERTVSYAGTTYALPAPFFVLATQNPIEQAG
FT                   TYPLPEAQLDRFLLHVLVDYPSEDEERQILEQTTGGATDAVPKVMDAEAVIALQAAVRQ
FT                   VHVSPDVLAWITRLVRASRPAEGAPAAINQWVKWGAGPRAGQSLVLAAKARALLQGRFA
FT                   ATREDVQALAAPVMRHRLLLSFAAEAEQKRADDVVAALLQAVPFPG"
FT   gene            complement(106374..107081)
FT                   /locus_tag="Smal_0088"
FT   CDS_pept        complement(106374..107081)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0088"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xcb:XC_0093 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49793"
FT                   /db_xref="InterPro:IPR025297"
FT                   /db_xref="UniProtKB/TrEMBL:B4SRS3"
FT                   /protein_id="ACF49793.1"
FT                   /translation="MDRRACLRWLAAAASAAALPAFAQAGPRSSRYDFWFTRLQYDSGD
FT                   WDVDARMPSNLITSLIDYTSLRVDPQEHVVALADPRMLEAPFCYLAGHTLVEFNAAERQ
FT                   NFVRYVRNGGFVFVDDCNHDIDGLFATSFEAQMGRLFGPKALQKLPNSHALYRSFFRFP
FT                   DGPPATSFELNGWGDDLVHDYLKGIEVDGRLGLLYSNKDYGCEWDYDWRNKRFLAEDNT
FT                   RFGVNIVMYALNN"
FT   sig_peptide     complement(107010..107081)
FT                   /locus_tag="Smal_0088"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.862 at
FT                   residue 24"
FT   gene            complement(107081..108415)
FT                   /locus_tag="Smal_0089"
FT   CDS_pept        complement(107081..108415)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0089"
FT                   /product="peptidase U62 modulator of DNA gyrase"
FT                   /note="PFAM: peptidase U62 modulator of DNA gyrase; KEGG:
FT                   xac:XAC0120 TldD protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49794"
FT                   /db_xref="GOA:B4SRS4"
FT                   /db_xref="InterPro:IPR002510"
FT                   /db_xref="InterPro:IPR035068"
FT                   /db_xref="InterPro:IPR036059"
FT                   /db_xref="UniProtKB/TrEMBL:B4SRS4"
FT                   /protein_id="ACF49794.1"
FT                   /translation="MSIFTEAQAKAILDKVIALSKADECTAVLAGAINGNIRFALNNVS
FT                   TSGIVDNTELAVTVAFGKRVGTASINEFDDAALERVVRRAEDLARLAPENPEFMPAIGK
FT                   QSYRASPTFSESTAAIDPAFRAKVAADSIAPCRGHGLIAAGFLEDGQGFQATANSNGNF
FT                   AYQRTTNFDYTCTVRTEDGRGSGWVGRNLKDAADFKADQDIRIAMRKATESAEAKALEP
FT                   GKYTVILEPAAAAGLISFMMNFFSARSADEGRSFLSKKGGGNKLGEQVYDPRVTMFADP
FT                   WHPDAPVLPWDNEGMPRERIAIIENGKIANLDYSRFWAQKQGKTAKASPGNLLMSGGDK
FT                   STAELVRGTQKGILVTRTWYIRMVDPQTVLLTGLTRDGTFYIENGQIKHPVKNFRFNES
FT                   PVIMLNNIEELGKPVRVAGDESNYVMMIPPMKLRDFTFTSLSDAV"
FT   gene            complement(108437..110071)
FT                   /locus_tag="Smal_0090"
FT   CDS_pept        complement(108437..110071)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0090"
FT                   /product="peptidase U62 modulator of DNA gyrase"
FT                   /note="PFAM: peptidase U62 modulator of DNA gyrase; KEGG:
FT                   xcv:XCV0092 putative modulator of DNA gyrase"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49795"
FT                   /db_xref="GOA:B4SRS5"
FT                   /db_xref="InterPro:IPR002510"
FT                   /db_xref="InterPro:IPR035068"
FT                   /db_xref="InterPro:IPR036059"
FT                   /db_xref="UniProtKB/TrEMBL:B4SRS5"
FT                   /protein_id="ACF49795.1"
FT                   /translation="MHRRDFLALTGLTAGGLIVPSFFGKAIAAEQLQSSLDPALKKRLA
FT                   DAALQAARSAGATYCDVRIGRYLRQFVITREDKVQNVVNTESTGVGIRVIVNGAWGFAA
FT                   TNALGTADVARAAQQAAAIAKANAGVQTAPVQLAKAPGVGEVSWRTPIHKNAMEVPIKD
FT                   KVGLLLDVNAAAMGAGASFVNSMLFLVNEQKYFASTDGSYIDQDVHRIWAPMTVTAIDK
FT                   TSGKFRTRSGLSSPMGLGYEYLDGAAAGKVVSPNGVVNYSSSYDMKEDAIAAAKQAQEK
FT                   LKAPSVKPGKYDLVLDPSHTWLTIHESIGHPLELDRVLGYEANYAGTSFATLDKREQHF
FT                   QYGSELVNIFADKTQQGSLGAVAYDDEGVKCKRWDLISNGKLVDYQTIRDQAHILGKTE
FT                   SDGCCYADSWSSVQFQRMANVSMAPGKKPLSVPDLIKDVENGIYIIGDGSFSIDQQRYN
FT                   AQFGGQLFYEIKNGQITRMLEDVAYQIRTPEFWNACTAVADERDYRLGGSFFDGKGQPG
FT                   QVSAVSHGSSTARFNGINVINTARSLG"
FT   sig_peptide     complement(109985..110071)
FT                   /locus_tag="Smal_0090"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.997 at
FT                   residue 29"
FT   gene            complement(110099..111730)
FT                   /locus_tag="Smal_0091"
FT   CDS_pept        complement(110099..111730)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0091"
FT                   /product="peptidase U62 modulator of DNA gyrase"
FT                   /note="PFAM: peptidase U62 modulator of DNA gyrase; KEGG:
FT                   xcv:XCV0093 putative modulator of DNA gyrase"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49796"
FT                   /db_xref="GOA:B4SRS6"
FT                   /db_xref="InterPro:IPR002510"
FT                   /db_xref="InterPro:IPR035068"
FT                   /db_xref="InterPro:IPR036059"
FT                   /db_xref="UniProtKB/TrEMBL:B4SRS6"
FT                   /protein_id="ACF49796.1"
FT                   /translation="MQRREFLAFSALGLAGLTLPHSRLIAAEQLLAPVDPAKRRRLAEV
FT                   ALAAARSAKASYCDVRIGRYLNQSVITREHQVGNVTNRESSGVGVRVIVNGAWGFAATH
FT                   QQTEAAVRTAVEQATAIARANASIQSRPVQLAPTPAVGEVRWQTPIRRNALEVPIQDKV
FT                   ELLLALNAAALNAGADYINSTLFLVNEQKYFASSDGSFIDQDIHRIWLPFTATAIDKAS
FT                   GKFRTRAGLSSPMGMGYEFLDGDARGKVQLPGGITAYRDSYDPVEDAIAAARQAREKLK
FT                   APSVKPGKYDLVLDPSNLFLTIHENVGHPLELDRVLGYEANYAGTSFATLDKRDAGFRW
FT                   GSDIVTFFADKTQPGSLGAVGYDDEGVKTQRWDLVRDGILVDYQATRDEAHILGRDASH
FT                   GCSYADSWSSVQFQRMANVSLAPGRTPLSVEDMIKDVENGIYIHGRGSYSIDQQRYNAQ
FT                   FGGQLYYQIRNGKITGMVEDAAYQIRTPEFWNACTAICDERDFRLGGSFFDGKGQPGQV
FT                   SAVSHGSSTTRFNGINIINTARSLGA"
FT   sig_peptide     complement(111650..111730)
FT                   /locus_tag="Smal_0091"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.989) with cleavage site probability 0.890 at
FT                   residue 27"
FT   gene            112416..113030
FT                   /locus_tag="Smal_0092"
FT   CDS_pept        112416..113030
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0092"
FT                   /product="protein of unknown function DUF938"
FT                   /note="PFAM: protein of unknown function DUF938; KEGG:
FT                   xoo:XOO0034 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49797"
FT                   /db_xref="InterPro:IPR010342"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B4SRS7"
FT                   /protein_id="ACF49797.1"
FT                   /translation="MSSKPYSEACERNREPIAAALDPWMGDRHRVLEIGSGTGQHAAFF
FT                   AERWPWLRWQPSDHPDHLPGIEARRAEAALLNLLPPVALQVELPPAPGLSLPEGSTFDA
FT                   AFSANTLHIMSWEHVQALFAALPSVMRHGALLAVYGPFNYGGRYTSDSNAQFDAWQRTR
FT                   DPRSGIRDSEAVQALAADNGFTRLGDVAMPANNRLLLWRLG"
FT   gene            complement(113031..114353)
FT                   /locus_tag="Smal_0093"
FT   CDS_pept        complement(113031..114353)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0093"
FT                   /product="HipA N-terminal domain protein"
FT                   /note="TIGRFAM: HipA N-terminal domain protein; PFAM: HipA
FT                   domain protein; KEGG: bmu:Bmul_4225 HipA N-terminal domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49798"
FT                   /db_xref="InterPro:IPR012893"
FT                   /db_xref="InterPro:IPR017508"
FT                   /db_xref="UniProtKB/TrEMBL:B4SRS8"
FT                   /protein_id="ACF49798.1"
FT                   /translation="MGTLRVWMNGVEVALWDDVRSGSSRLSYVDSWISSAQSRPLSLSL
FT                   PLLPEGESHRGNVVNNYFDNLLPDNGVIRNRIRDRFSTRSSDTFDLLEAIGRDCVGAAQ
FT                   LLPLSHTPGDIQQITCEALDESGVAAILRQVTTGNLPGAPTSDDAFRISIAGAQEKTGL
FT                   LLHAGQWCIPTGSTPSTHIFKLPLGIVGNMRADMHQSVENEWLCMQLLSAFGIPVANTQ
FT                   MGRFKDERALIVERFDRRLSADRRWWLRLPQEDMCQVFGLPAARKYESDGGPGIVTIMD
FT                   LLRQSEHFKDRETFFKTQILFWMLAATDGHAKNFSVYLEADGRFRLTPVYDVLSVHPIL
FT                   GRGPNQLDPRNAQLAMSVQGKNHHRKLHLVRRRHWNETARACGVADGAEPWIEALIAAV
FT                   EPAIEQVTRQLPSDFPVNVSEPIFNGLRAAAARLSSMSPDA"
FT   gene            complement(114357..114614)
FT                   /locus_tag="Smal_0094"
FT   CDS_pept        complement(114357..114614)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0094"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="PFAM: helix-turn-helix domain protein; KEGG:
FT                   rso:RSp1252 putative transcription regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49799"
FT                   /db_xref="GOA:B4SRS9"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:B4SRS9"
FT                   /protein_id="ACF49799.1"
FT                   /translation="MDRPLHTVRTPQQLAPLMRAFRRQAGLSQAQLAAQLGISRQAVGA
FT                   LERDPASASFERLMRVWAVLGLEVRLQQRSPPETTSTLEW"
FT   gene            complement(114772..118458)
FT                   /locus_tag="Smal_0095"
FT   CDS_pept        complement(114772..118458)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0095"
FT                   /product="pyruvate ferredoxin/flavodoxin oxidoreductase"
FT                   /note="PFAM: pyruvate ferredoxin/flavodoxin oxidoreductase;
FT                   KEGG: xcv:XCV0172 indolepyruvate ferredoxin oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49800"
FT                   /db_xref="GOA:B4SRT0"
FT                   /db_xref="InterPro:IPR002869"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR019752"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:B4SRT0"
FT                   /protein_id="ACF49800.1"
FT                   /translation="MTSTAQLTSPSSADLLDRDYTLDHKYTRNEGRIYLSGVQALVRLP
FT                   LMQRLRDAAEGIDSAGFVSGYRGSPLGGFDLELWRARKHLDAAKVKFTPGLNEDLGATM
FT                   VWGTQQTNLFPGANVQGVFGMWYGKGPGVDRCGDVFKHANAAGTSRYGGVLALAADDHA
FT                   CRSSTLPHGSEDEFVSAMMPVLNPAGVQDILDMGLLGWAMSRYTGRWVGFKTIAETVES
FT                   SASVQVDPMARRIVLPEDFEMPSGGLNIRWPDPPLDQEMRLHRYAVKAAQAFARANGID
FT                   KVVMDAPRARLGIVTTGKSYLDVLQALEYLGLDEAACADIGIRVYKVGMTWPLEPQGIA
FT                   RFAQGLEDIIVVEEKRAFIERQMKEQFFNWPASWGQRPSIVGKYDESGEWILPSTGELT
FT                   PATIAGVIGRRIQKFFNNESIEQRLQWMQEKEAELALPRASFPRVPHYCSGCPHNTSTQ
FT                   VPEGSRALAGIGCHYMVTWMDRSTDTFTHMGGEGVTWAGQAPFTDTPHVFQNLGDGTYF
FT                   HSGSLAIRQAVAAGVNITYKILYNDAVAMTGGQPVDGPLSVPDIAKQMRAEGIHTIVVL
FT                   SDNIGKWTGQREHFPSDVEFHDRSELDAVQKRLREVKGVSILIYEQTCATEKRRRRKRG
FT                   KLEDPQKRVLINSLVCEGCGDCGKKSFCVSVLPKETEFGRKREIDQSNCNKDYSCVNGF
FT                   CPSFVTVHGGQPRKGSKRDASTLLDNLPAPTIRSTLEQPWNILITGVGGTGVVTIGALL
FT                   GMAGHLEGKGATVLDQTGLAQKGGAVTTHIRIARRPEDIHAVRIAAGEADLVVGCDMVV
FT                   VNDYWALSKVRAGRSQVVLNTYEAMPGTFTTRPDMQFPAADIVAGVRVALGGEEPLLLD
FT                   ATQLATALLGDAIAANLFILGYAWQQGLVPLSFESLMRAIELNGAAVAMNQQAFAWGRL
FT                   AVVDPQAVQQAAGLVRNRHTDTETTPGPLHPLPPGEWEGNEWGATAAPRNTGDERELRG
FT                   LPSHGGDVAFLPLDDARLSRSLDEMIERRAAFLVEYQDDAYANRYRSLVERVRAAEADR
FT                   IGGSTALTETVARYLFKLMAYKDEYEVARLYTSGDFQRRLQQQFEGDYQLRFHLAPPLF
FT                   AKKDEQGRLLKKEYGPWMFKAFGLLAKLKFLRGGRLDVFGRTEERRMERKLIGDYEATV
FT                   QLLLDGLEDGRLALAVEIASVPEHIRGFGHVKEAHFEQAKAREAALLAQWRNPKALHIV
FT                   QVA"
FT   gene            118628..119263
FT                   /locus_tag="Smal_0096"
FT   CDS_pept        118628..119263
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0096"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xcb:XC_0180 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49801"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:B4SRT1"
FT                   /protein_id="ACF49801.1"
FT                   /translation="MSVSGKILASVLLASGAATAWAAPALPAPQEFYFDSDLAATPMVA
FT                   IQGEGDELVTQLVKLRERGRRAVEATVQLASVAGAQGRSELAEQLYGEALKEASAQSSS
FT                   GRSVRWNYGWDLLRQGRVEAALEQWLSSAGNARTKPSWVPPTYALALWRLGQKQEAVQW
FT                   YAAAVRTEPSQWNTTANYGQLLPQWREDERATLAEVQQAWAAAPPVWP"
FT   sig_peptide     118628..118696
FT                   /locus_tag="Smal_0096"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.995 at
FT                   residue 23"
FT   gene            complement(119856..121340)
FT                   /locus_tag="Smal_0097"
FT   CDS_pept        complement(119856..121340)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0097"
FT                   /product="AAA ATPase central domain protein"
FT                   /note="PFAM: AAA ATPase central domain protein; SMART: AAA
FT                   ATPase; KEGG: pap:PSPA7_0798 probable ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49802"
FT                   /db_xref="GOA:B4SRT2"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B4SRT2"
FT                   /protein_id="ACF49802.1"
FT                   /translation="MSELQDLSALIRANTPLIVIETQDEGRIVELFRQTLMHVWRALHR
FT                   WSITEGLRRIDLDSEDPAVGPPDASAALQMIRQADQRGVYLLLDFHPYLGYASHQRALR
FT                   DLIQRRHSEPHVLVLIGAKVELPAELEALAVRFNPRLPDANALLKMLREEADAYAREHG
FT                   GRRVEVDSEAVKKILKNLQGLSLVDARRIARQLIYADGALRDDDLPQLARLKFELLNRS
FT                   GHLFFEHDSARFGDVAGANRLKRWINQRRVAFIAGSAPAGLDPPRGMLLLGVQGCGKSM
FT                   LAKATAAGFGVPLLRLDVGALYNKYHGETEANLRQALASAEQLAPCVLWMDEIEKGLAS
FT                   GGEDGGVSRRVLGYLLTWMAERKAPVFIVATANQVHELPAELLRKGRFDEIFFVDLPSP
FT                   EVRVELLRLHLGRRQLNADDFALPALAAAANGFSGAEIEQAIVAGLYAAHAEGRPLDTE
FT                   LLMNEIRATRPLSVLMAEQVEALRAWASGRTVSADD"
FT   gene            121464..122093
FT                   /locus_tag="Smal_0098"
FT   CDS_pept        121464..122093
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0098"
FT                   /product="partition protein"
FT                   /note="KEGG: xcb:XC_0183 partition protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49803"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B4SRT3"
FT                   /protein_id="ACF49803.1"
FT                   /translation="MKTILVAGSKGGVGKTTVATHLAAYAALQGKATVIADADPQGSST
FT                   RWAQRRAGLESAVLPIDVYRKKQWAQKLPDGTETVIIDAPAGALADDIPHFLDAADAVV
FT                   VPVLPSALDIEAIVGFLNSLAQNPRVHSRKLPVGLVLNRTKPWTQTSQQALQMLSEWPY
FT                   PVVAQLRDSQSYVVMTGLGRSLFDYRSAQVREHQADWEPLLSWLKL"
FT   gene            122131..122607
FT                   /locus_tag="Smal_0099"
FT   CDS_pept        122131..122607
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0099"
FT                   /product="putative phosphohistidine phosphatase, SixA"
FT                   /note="PFAM: Phosphoglycerate mutase; KEGG: xac:XAC0193
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49804"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:B4SRT4"
FT                   /protein_id="ACF49804.1"
FT                   /translation="MRELILLRHAHAEPAVSGQADLDRPLSPVGLAEAEAAGKWLKENK
FT                   LLPDCVLCSPSRRTRETLEAVMAAIGYVEKRLEDRIYEATPGTLAALVDERRDLDRVLI
FT                   VGHNPGLEQLVALMTDGTSSDYRGMPPGGVAVLGFPREASIEPGVASLNAFWWP"
FT   gene            122612..123229
FT                   /locus_tag="Smal_0100"
FT   CDS_pept        122612..123229
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0100"
FT                   /product="YceI family protein"
FT                   /note="PFAM: YceI family protein; KEGG: xac:XAC0194
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49805"
FT                   /db_xref="InterPro:IPR007372"
FT                   /db_xref="InterPro:IPR036761"
FT                   /db_xref="UniProtKB/TrEMBL:B4SRT5"
FT                   /protein_id="ACF49805.1"
FT                   /translation="MSLARRSRFLLPVLLVSGPAWAAAPPPTTLPPVVAEAHRVLRLDT
FT                   QRSQIGFEVRTRFGQRIEGVFPHFEGRIEILSDGRHQVHLKMFTRSVEIPGKPRYTGWM
FT                   RGEEFFDAGRHPVVEFDSLPYWPETVEDGGDINGRLTLRGISHPESLKVEKADCARPGY
FT                   DCDVVSRGTVQRGRYGMESWQLALSDRVTFVLRARLSEAPKP"
FT   sig_peptide     122612..122680
FT                   /locus_tag="Smal_0100"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 23"
FT   gene            123226..125277
FT                   /locus_tag="Smal_0101"
FT   CDS_pept        123226..125277
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0101"
FT                   /product="phospholipase D/Transphosphatidylase"
FT                   /note="PFAM: phospholipase D/Transphosphatidylase; KEGG:
FT                   xcv:XCV0178 phospholipase precursor"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49806"
FT                   /db_xref="GOA:B4SRT6"
FT                   /db_xref="InterPro:IPR001736"
FT                   /db_xref="InterPro:IPR025202"
FT                   /db_xref="UniProtKB/TrEMBL:B4SRT6"
FT                   /protein_id="ACF49806.1"
FT                   /translation="MNHLLRVLALATVLLGSGCASLSHAERDRAEAIAVQARSTQVDCQ
FT                   RADRCALDSPLRALAGRAFTESTPERPQHYATLLDEGEGALVARLNLLRSATRSIDLQT
FT                   YIFDKDDSARLVIDELLAASRRGVKVRVLIDQLSAISDLEILGALSGAHQNFQLRVYNP
FT                   TFGKARLNYFDYAGSVLCCFRRFNQRMHNKLLVIDDAIGVVGGRNYQDDYYDWDREYNF
FT                   RDRDVLIAGPEARTMAANFDAFWRAQRSVPAERLNDVGRTLLRQGVPTLPPATFRRPER
FT                   VQRVSAEANDMDFVTRSFVDTALPVASVRYVADLPRKHRREKADAPLAGQHVTEPQLDA
FT                   LIAGAQKEVILQTPYLVLSKPAQKLFRELRKRPQPPRVVVSSNSLAATDNPIVYALSYK
FT                   YKRRNMRELGFNIFEYKPFPLDAPVDYRNLLPDPIAAPDGVDDSGRNPLIGGSAAGSNA
FT                   GGGRDGGSSGTGKQGPVNHRHSDGAYDNARARRRAAGSEVETRLLRTETRPSFLGSKAV
FT                   NKPLPVTRKGARMGLHAKSLVVDRRIGVVGTHNFDPRSENYNTEGAVIIDDPAFAEELA
FT                   QSILRDIHPQNSWTVAPRAKPPVLSGLNYSVGKASEALPILDFWPWRYATDYEFKPGPD
FT                   CPRPLPRQDPDFHRCYSAVGDFPEVNVGPKWLLVRMLTAFGAGLVPIL"
FT   sig_peptide     123226..123303
FT                   /locus_tag="Smal_0101"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.965 at
FT                   residue 26"
FT   gene            125287..125721
FT                   /locus_tag="Smal_0102"
FT   CDS_pept        125287..125721
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0102"
FT                   /product="thioesterase superfamily protein"
FT                   /note="PFAM: thioesterase superfamily protein; KEGG:
FT                   xcv:XCV0179 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49807"
FT                   /db_xref="InterPro:IPR003736"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:B4SRT7"
FT                   /protein_id="ACF49807.1"
FT                   /translation="MTQVFREAVSIEQLNALSRNTAIESLGIVFSAVGDDWLQATMPVD
FT                   ERTRQPYGILHGGASVVLAETLGSSAGNLCVDTAKQICVGLEINANHVRAVRSGTVTGT
FT                   ARALHVGRSTQLWEIRIEDEQGRLVCISRLTLAVVAAGHG"
FT   gene            125842..126633
FT                   /locus_tag="Smal_0103"
FT   CDS_pept        125842..126633
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0103"
FT                   /product="phospholipid/glycerol acyltransferase"
FT                   /note="PFAM: phospholipid/glycerol acyltransferase; KEGG:
FT                   xcb:XC_0188 acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49808"
FT                   /db_xref="GOA:B4SRT8"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="UniProtKB/TrEMBL:B4SRT8"
FT                   /protein_id="ACF49808.1"
FT                   /translation="MTSPTPAPRGGVARVCRYLYRVPLLLVHITVFLPLILIGMLPPWG
FT                   ELRVGEDTFGAKVVNWWQGGLMWIFGFRLSQVGRPLPGAVLFVANHVSWVDISILHSQR
FT                   MMGFVAKREIASWPLVGWLAARGQTIFHQRGNTESLGGVMQVMADRLRAGKAVGVFPEG
FT                   RTRGGHEVGPFHARIFQAAVETGVPVQPVALVYGAKGDAQTIVAFGPGESFAANFLRLL
FT                   GEPARHTEVHFLEPIGTQDLEGRRRIAETSRARIVAAMSTQ"
FT   gene            126641..127675
FT                   /locus_tag="Smal_0104"
FT   CDS_pept        126641..127675
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0104"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xcb:XC_0189 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49809"
FT                   /db_xref="InterPro:IPR012020"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B4SRT9"
FT                   /protein_id="ACF49809.1"
FT                   /translation="MALIPPPVLDAGTPTLHASDYQPPRWLRNPHLQSMLSSSRMRLQR
FT                   GLLLLAATGAVSEELILDGGDGVRLQGWHSHVEGREPKGIALLLHGWEGSAESSYMRMA
FT                   AARMIEQGFDVVRLNFRDHGNTHHLNPGIFHSNLIDEVVHAAGDIAQRWPQLPLVAAGY
FT                   SLGGNFVLRLALRAPAAGVPLLRVASVCPVLDPALTMDSIENGPAMYDWYFRRKWAGSL
FT                   RRKRDLFPELSDCDDRVLKLDIRALTAWLVERHTSFGSLQAYFDGYSIAGDRLSTLQVP
FT                   ADILMAQDDPVIPYVTFSDWQLPRQAHLETACWGGHCGFLENWRGDGFSERWVAQRLQR
FT                   VLQG"
FT   gene            127732..129801
FT                   /locus_tag="Smal_0105"
FT   CDS_pept        127732..129801
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0105"
FT                   /product="TPR repeat-containing protein"
FT                   /note="PFAM: TPR repeat-containing protein;
FT                   Tetratricopeptide TPR_4; Tetratricopeptide TPR_2 repeat
FT                   protein; SMART: Tetratricopeptide domain protein; KEGG:
FT                   xac:XAC0199 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49810"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR013105"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:B4SRU0"
FT                   /protein_id="ACF49810.1"
FT                   /translation="MQDQIIQALRQNQADQAVQLAQAWTRDEPGLAEAHRWLALALQQQ
FT                   GNAEHAMDALQEALRLAPDDAQLHLQQAGLLLALRQFEGADEALARTTGLDPNSFSAYL
FT                   MQAHLAIGRNDFDEAARVSTLASRVEPDHPELLTIDGMVALRRGDADRALSLLSAASKA
FT                   LPDDPRVLYALGFAYLGKDMLAFAEQSFRRVLELNPSLSSLHGLVVQLALRQGNVPAAA
FT                   EAMQVALQQPQMDVPAMRRLAGELSLRSGQPLQALEYLLPLLETQPDDRQMLQLLLMSW
FT                   QRLGREDEARARLDAVLENNDQLHDVWLARLAIEQVGSESAVTAVERWMAAMPEHLPAL
FT                   EARLRLHDMAGEHAQAEAIAERIVSQEPGRVSGETRLVEGLLQRDPAAAVARVQALIDL
FT                   APEGHRADLRTWMGEIQDRAAQPQEALRTWMALQADQAPQRLPLPPQAKAPPSWPDKGD
FT                   IDGDATSAPIFLWGAPGSGVERVATGLAAASPVLRSDRYTNTPPDDAFQNYHTLQDLAS
FT                   GVLTPERLVERWREQLPARGLQNDTVIDWLLWWDNALLWALRPQLPQGRLLLVLRDPRD
FT                   MLLDWVAYGAAAPLAMTSLAEAGEWLARALTQVATLHEEDLYPHVLLRIDHIGNDPQAM
FT                   AELLGRLFERPMPPAAQLGAPRLPPGHWRNYRDVMSAAFALLTPIAVRLGYPEE"
FT   gene            129812..130423
FT                   /locus_tag="Smal_0106"
FT   CDS_pept        129812..130423
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0106"
FT                   /product="PEBP family protein"
FT                   /note="PFAM: PEBP family protein; KEGG: xcb:XC_0191
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49811"
FT                   /db_xref="InterPro:IPR005247"
FT                   /db_xref="InterPro:IPR008914"
FT                   /db_xref="InterPro:IPR036610"
FT                   /db_xref="UniProtKB/TrEMBL:B4SRU1"
FT                   /protein_id="ACF49811.1"
FT                   /translation="MQLSSHSLTNGAPIDREFAAGDAAGFAPDRNPHLAWNGAPEGTRS
FT                   FLLVCVDPDVPTVPETVGRTDMTVPRDQPRCDFVHWVMADIPASVQEIAAGSCSDGFVV
FT                   KGRTAPAGPAGSRQGLNDFTGWFAGNPDMAGDYLGYDGPYPPFNDERVHRYFFRVFALD
FT                   VASLDLPARFTAADAYRAMHGHVLAEAALHGTYTLNPALG"
FT   gene            complement(130556..131383)
FT                   /locus_tag="Smal_0107"
FT   CDS_pept        complement(130556..131383)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0107"
FT                   /product="protein of unknown function DUF306 Meta and HslJ"
FT                   /note="PFAM: protein of unknown function DUF306 Meta and
FT                   HslJ; KEGG: pen:PSEEN3175 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49812"
FT                   /db_xref="InterPro:IPR005184"
FT                   /db_xref="InterPro:IPR025485"
FT                   /db_xref="InterPro:IPR038670"
FT                   /db_xref="UniProtKB/TrEMBL:B4SRU2"
FT                   /protein_id="ACF49812.1"
FT                   /translation="MNRKLTLLLPLALLAACSQTPAPAGTGGDDVAPAAAKAADQQTLA
FT                   HLDAQRLQSQHWLLQQATAADGKRIDALFAREDKPVTLDFADGRLSVSNACNHMGGGYT
FT                   LADGKLTVSAMASTMMACTDKALMALDEAVSSRLQGELKAEQDADGKLTLTNAKGDVLV
FT                   FNPEPTAETRYGGAGETVFLEVAAKTEKCSHPLIPDYQCLQVREVKFDDKGLKQGEPGK
FT                   FENFYGNIEGYTHEDGVRNVVRVKRYEVKNPPADAPSQAYVLDMVVESAIEKK"
FT   sig_peptide     complement(131303..131383)
FT                   /locus_tag="Smal_0107"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.517 at
FT                   residue 27"
FT   gene            complement(131457..132251)
FT                   /locus_tag="Smal_0108"
FT   CDS_pept        complement(131457..132251)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0108"
FT                   /product="Undecaprenyl-diphosphatase"
FT                   /EC_number="3.6.1.27"
FT                   /note="PFAM: Bacitracin resistance protein BacA; KEGG:
FT                   xcb:XC_0193 undecaprenyl pyrophosphate phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49813"
FT                   /db_xref="GOA:B4SRU3"
FT                   /db_xref="InterPro:IPR003824"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4SRU3"
FT                   /protein_id="ACF49813.1"
FT                   /translation="MSDLLSALLLGILEGLTEFLPISSTGHLLIAQHWLGARSDFFNIV
FT                   IQAGAIVAVVLVFRQRLLQLATGFGQRENREYVFKLGAAFLVTAVVGLVVRKAGWSLPE
FT                   TVSPVAWALIIGGIWMLLVEAYTARLPDRDQVTWTVAIGVGLAQVVAGVFPGTSRSASA
FT                   IFLAMLLGLSRRAAAAEFVFLVGIPTMFAASAYTFLEMAKAGQLGSENWTEVGVAFLAA
FT                   AVTGFVVVKWLMGYIKSHKFTAFALYRIALGAALLLWLPSGS"
FT   gene            132476..133885
FT                   /locus_tag="Smal_0109"
FT   CDS_pept        132476..133885
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0109"
FT                   /product="glutamine synthetase, type I"
FT                   /note="TIGRFAM: glutamine synthetase, type I; PFAM:
FT                   glutamine synthetase catalytic region; glutamine synthetase
FT                   beta-Grasp; KEGG: xcb:XC_0194 glutamine synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49814"
FT                   /db_xref="GOA:B4SRU4"
FT                   /db_xref="InterPro:IPR004809"
FT                   /db_xref="InterPro:IPR008146"
FT                   /db_xref="InterPro:IPR008147"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR027302"
FT                   /db_xref="InterPro:IPR027303"
FT                   /db_xref="InterPro:IPR036651"
FT                   /db_xref="UniProtKB/TrEMBL:B4SRU4"
FT                   /protein_id="ACF49814.1"
FT                   /translation="MSVENVEKLIKDNQIEFVDLRFVDMRGVEQHVTFPVSIVEPSLFE
FT                   EGKMFDGSSIAGWKGIAESDMVLLPDTASAYVDPFYADPTIVISCDILDPATMQPYGRC
FT                   PRGIAKRAEAYLKSSGIAETAFFGPEPEFFIFDSVRFANEMGHTFFQVDSEEAAWNSGA
FT                   KYDGANSGYRPGVKGGYFPVPPTDTLHDLRAEMCKTLEQVGIEVEVQHHEVATAGQCEI
FT                   GTKFSTLVQKADELLRMKYVIKNVAHRNGKTVTFMPKPIVGDNGSGMHVHQSLSKGGTN
FT                   LFSGDGYGGLSQLALWYIGGIFKHAKAINAFANSGTNSYKRLVPGYEAPVMLAYSARNR
FT                   SASCRIPWVSNPKARRIEMRFPDPIQSGYLTFTALMMAGLDGIKNQIDPGAPSDKDLYD
FT                   LPPEEEKLIPQVCSSLDQALEALDKDREFLKAGGVMSDDFIDGYIALKMQEVTKFRAAT
FT                   HPLEYQLYYAS"
FT   gene            134155..134493
FT                   /locus_tag="Smal_0110"
FT   CDS_pept        134155..134493
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0110"
FT                   /product="nitrogen regulatory protein P-II"
FT                   /note="PFAM: nitrogen regulatory protein P-II; KEGG:
FT                   xac:XAC0205 nitrogen regulatory protein P-II"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49815"
FT                   /db_xref="GOA:B4SRU5"
FT                   /db_xref="InterPro:IPR002187"
FT                   /db_xref="InterPro:IPR002332"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="InterPro:IPR017918"
FT                   /db_xref="UniProtKB/TrEMBL:B4SRU5"
FT                   /protein_id="ACF49815.1"
FT                   /translation="MKLISAIIRPFKLDEVREALSDAGVSGITVTEVKGFGRQKGHTEL
FT                   YRGAEYVVDFLPKIKIETVVTDERADAVIEAIQSSAGTGKIGDGKIFVTAVEQVIRIRT
FT                   GEIGADAL"
FT   gene            134515..135945
FT                   /locus_tag="Smal_0111"
FT   CDS_pept        134515..135945
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0111"
FT                   /product="ammonium transporter"
FT                   /note="TIGRFAM: ammonium transporter; PFAM: Rh family
FT                   protein/ammonium transporter; KEGG: xcb:XC_0196 ammonium
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49816"
FT                   /db_xref="GOA:B4SRU6"
FT                   /db_xref="InterPro:IPR001905"
FT                   /db_xref="InterPro:IPR002229"
FT                   /db_xref="InterPro:IPR018047"
FT                   /db_xref="InterPro:IPR024041"
FT                   /db_xref="InterPro:IPR029020"
FT                   /db_xref="UniProtKB/TrEMBL:B4SRU6"
FT                   /protein_id="ACF49816.1"
FT                   /translation="MKMRLLTGWQARFHLVCLLMLLSALAAGAWPGTAHAQAQVSPLPS
FT                   ESVAVEPLQEPVAAAAAPAVAEAAAAYDHGDVAWMLTSTLLVLLMVVPGLALFYGGLVR
FT                   SKNVLSVLSQILVVFSLVLLLWVAYGYSAVFSAGNPFFGSFTEFAFLKGFTPESVGNTP
FT                   IKGLPDYLFVAFQSTFAGITTALIVGAFAERIKFRAVLLFSALWFTLSYIPMAHIVWGG
FT                   GYLGEMGAIDFAGGTVVHINAGVAGLVAAWFVGKRLGYGQTALKPHNVPFTYIGAMLLW
FT                   VGWFGFNAGSAAAADTVASLAFLNTVLATAAAVLGWTLVEAISKGKPSALGAASGAVAG
FT                   LVGITPACGTVGPLGAIIIGFVAGVVCVWGVTGLKRLLKVDDTADVFGVHGVGGIVGAI
FT                   LTGVFSAQSLGGTKADLDIAHQVWVQVVSVGLTVVWSAVVTTLILLVVRSVVGLRVTEE
FT                   AERTGLDVTSHGESAYEA"
FT   sig_peptide     134515..134625
FT                   /locus_tag="Smal_0111"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.985 at
FT                   residue 37"
FT   gene            136241..137965
FT                   /locus_tag="Smal_0112"
FT   CDS_pept        136241..137965
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0112"
FT                   /product="Polypeptide-transport-associated domain protein
FT                   ShlB-type"
FT                   /note="PFAM: Hemolysin activator HlyB domain protein;
FT                   Polypeptide-transport-associated domain protein ShlB-type;
FT                   KEGG: xfa:XF2550 outer membrane hemolysin activator
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49817"
FT                   /db_xref="GOA:B4SRU7"
FT                   /db_xref="InterPro:IPR005565"
FT                   /db_xref="InterPro:IPR013686"
FT                   /db_xref="InterPro:IPR027282"
FT                   /db_xref="InterPro:IPR035251"
FT                   /db_xref="UniProtKB/TrEMBL:B4SRU7"
FT                   /protein_id="ACF49817.1"
FT                   /translation="MEQGRNVRSRALQWRLSVAVALAMAGFQAPAWAQVVSPEQELLRQ
FT                   QERERALREQQESTPDVRLQPATEDLGHLPADESPCFTINSIVLQGDLAERFRWALAAA
FT                   DPRSDPATGRCLGTAGVDIVMKRVQNAIIERGYVTTRILAAPQDLKTGILTLTVVPGRV
FT                   NAIRFADGEGRTPALWNAVRVARGEVLNLRDIEQALENLQRVPTATVDIQIAPPADGAA
FT                   AKPGESDLVISWQQARLVRVNLTLDDAGSQSTGKMQAGTTVSVDNAAGLSDLFYINVGK
FT                   SVLNGSERGTDSWAVHYSVPLGGWLLGANASNFDYEQTVAGAFENYVYSGSSRNAELRL
FT                   TRMLFRNARAKTSMYARGWYRESDNFINDTEIEVQRRRMAGWELGLGHRHFIGKATLDV
FT                   NLAYRKGTGAFNALRAPEEAFGEGTAHGRIYTADAQLLLPLQWGKQSLRYVGSWRAQWN
FT                   RSPLVPQDRFSIGGRYTVRGFDGEMSLTGERGWLLRNEVGVPLGSGVEAYVAVDHGRVA
FT                   GPSTARLLGDRLTGTALGLRGGTRHVNWDAFVGSPLSRPRGFQTAYTTFGMNLGISF"
FT   sig_peptide     136241..136342
FT                   /locus_tag="Smal_0112"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 34"
FT   gene            138072..152972
FT                   /locus_tag="Smal_0113"
FT   CDS_pept        138072..152972
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0113"
FT                   /product="filamentous haemagglutinin family outer membrane
FT                   protein"
FT                   /note="TIGRFAM: filamentous haemagglutinin family outer
FT                   membrane protein; adhesin HecA family; PFAM: Haemagluttinin
FT                   repeat-containing protein; filamentous haemagglutinin
FT                   domain protein; KEGG: pst:PSPTO_3229 filamentous
FT                   hemagglutinin, intein-containing, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49818"
FT                   /db_xref="InterPro:IPR008619"
FT                   /db_xref="InterPro:IPR008638"
FT                   /db_xref="InterPro:IPR010069"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="InterPro:IPR024973"
FT                   /db_xref="InterPro:IPR025157"
FT                   /db_xref="UniProtKB/TrEMBL:B4SRU8"
FT                   /protein_id="ACF49818.1"
FT                   /translation="MNKVYRLVFNRTLGVMQVASELVNAARGGADSREGHAVGTLRPIS
FT                   FALWLVLGWVGLVQPLSAQQAPADPGRIAADPGAPANQRPTVITSANGTPQVNITTPSA
FT                   GGVSRNSYQQFDVGQQGVILNNSRGDVQTQLGGWVQGNPWLATGTARVILNEVNSSNPS
FT                   HLNGYVEVAGTRAQVVIANPAGIQVNGAGFLNASRVTLTTGTPIVSNGVLEGYRVEGGS
FT                   IGVGGTGLDTSRADYTDIITRSLQVNAGIWANQLQASLGSNVVSADHSSVQQQKPTSAA
FT                   PTFALDVGALGGMYANRIWLVGNEHGVGVSNAGKIGAQAGELVVTADGRLQNTGAMHAQ
FT                   QDLRIDASAGIANAGTLSAERELRVQTPADVDNSGGTLNARRIEVNADALRNRGGSIEQ
FT                   LGTQALQLQAADLSNLQGRIGTVSSVSPGTGTGGTGTPPGTGTPGTGTPGTGTPGTGTP
FT                   GTGTPGTGGGTLPVTPLPPLAAGVLNIVGTLGNDGGRIEASGDLQLSARNSLDNSDGTL
FT                   GVSTLLVQGQALRNMRGTLQVQGAASAQVQQLDNSGGRMTFARGFELQAQSAINRGGSL
FT                   AHGGSAGTIWTIGQLDNSEGSISSNATRLGLDIGTLVNTRGSINHAGSEGLLLRAEVLD
FT                   GVQGSIATAGAADLLLGRADHRGAQLIARQLGLSAQDFDNRGGRVLSTGLQASTLNVRN
FT                   HLDNSDGGLLASNADLQIDAASFGNAGGTVQQAGTGNLRVTTANLQGQGGTVLSNGTLQ
FT                   LHGDTLNLRNGTTAAQRIDVRAGDLTTAGGTLTSTGGDALQLQVSRTLDNSGGTVGANG
FT                   ALDINSGILINDGGKLIAAGTGTSRIHASQRLQNQRGLLSGNGDLDIKTDGLLNESGSI
FT                   DHAGTGTLQIDATTVQGAAGSIASNGLLQLSGQQLDLQKGTTRAREVQITATGLDTSGG
FT                   SLLSLGNNAMQLQVQGRLRNDGGSISANGAQQIQAGALSNRGGALNSAGTAASQIRVDG
FT                   TLDNSGGSIASNAAHLQLKSGALVNAGGTLSHAGSDGLIIDSGRLDGAKGQIATAGALQ
FT                   LTAAEVDHQGASLAAAQLDITATGFDNRGGRIIATGTGGNTLRVQGTLDNGNGGTLASN
FT                   GNLDIHARTFGNAGGTVQQAGSGSLVITTQDLTGAGGTLLSNGSLELQGDTLDLRNGTT
FT                   TAQRISIDGDTVTTAGGQLSALGTQALQLQARSLLDNTGGTLGSNGAVDVHAGRFVNDH
FT                   GKLIAAGDAASAIRAAQLENHSGSISANGNLRIEAQTLSGQSGSIGAARALSLQGGSLD
FT                   LRGGSVAAEQLDIVADSLDNSAGALRATGSGTLALQVSGRLANDAGTIASNGAQRIEAG
FT                   ELSNRGGTLSSAGSATTELHVAGLFDNSNGVLASNGAALKIDAGHMANVKGTLSHAGTQ
FT                   GLLLRTGQLDGQGGSIASAGGITLQAGSVDHRGATLQAERIALDAQSFDNRAGKVIATG
FT                   AESSTINVVGTLDNGEGGLLASNGDLSIQAAVFGNAGGTVQHAGEGVLSIDAGTLNGTG
FT                   GTLVSNGSLLLKGTTTDLRAGITSAKRIEIDTGSLITAGGTLTATGNDMLRLSARERID
FT                   NSGGTVSSNGALDLRSATLVNAGGTLQSAGTAASQLIIGQDINNRGGRILANGGLGISS
FT                   GSIDNQGGTLHSAARLVVKADGLLDNSNKGVIASGAGMQVAATSLDNRSGSIEQAGDDL
FT                   LQIDATTLQGHAGRIVSNGELQLKGETLDLSAGTTAAQQVSIEAGQLDNTAGTLNATGS
FT                   QAMSLQVRGALGNDGGTIAANGAQQINAGSLSNAGGTLSSAGTSDSRITVTGRFNNGGG
FT                   TLASNAGNLRLDAGQLVNAAGSIVHAGKGMLTVKATQLDGAGGSIATAGALQLDAVSVD
FT                   HRGATLNADHFTVNADRFDNQNGKLLATGTQASTVQATTSLDNGGNGLIASNGDLTLTS
FT                   ALFGNAGGTVQQAGTGTLAINAHTLNGQGGKLLSNGALQLTGETTDLRDGTLSAARIAV
FT                   DTGTLLNAGGSIIASGTDALKVSARDRLDNSGGTLAGNGALDLRSAQLLNNLGTIQAAG
FT                   SGSSTLAITHALENRGGRILTTGDAGISAGTLDNRGGTVHSDGNSALTVRVDGLLDNSD
FT                   KGTLSAGGALLAEAQAINNSSGTVAAGQNLQLTSADLLRNEGGLVQAGKHLQVSASGVN
FT                   NNSGRIIANDLQLDTRGQALDNRSGIIASLSGNAALRSGALDNTGGLLQSAAALSIDTS
FT                   GQRLTNAASNGNGIVSSGTLQIRSGDLDNRGGSVFAKAGVDVQAVNIDNSGGGSLVSAA
FT                   DLLLRAQQLANSGGSVTAGGNADIGLQGALLNSGGLVAATGRLDLQAGYIDNRNTLSQA
FT                   NGPALGLQGKNLQVTTGNLDNQNGQVIADNLLLQVNQRLDNSGGQVSAALTSDVRADTL
FT                   VNSGGTLVAGRQQTLRTREIIGDGRLMSQGDMTLELGQSHTNRGEMVANGTLSLSIHGN
FT                   LDNSGKLAGANVNINAGNITNASTGEISSIGLTRLAAGGALVNYGLLDGNVTHITAASV
FT                   DNIGSGRIYGDRVAIQAGSLNNLAANIGGVDRAGTIAARQRLDLGVGTLTNSGKSLIFS
FT                   DGDAAIGGALNGLGAVGSAQKVDNIGSTIEVSGNLDLSALAVNNIRENVVVEKVTTVHA
FT                   PVRLEQPGWFKNATNNNRDFRATSNYQPYEIYYLDPSDILEDTPYVTPDGQQIRKAVIR
FT                   LTSNTSAYAFARGGAYGARASRERLNVQDGTVTVYYVGRADNRSNPDQLGAGAEDPFRD
FT                   LSTRGPGSPPIEYVTDTLRYNNAYGTCTTTCVQIITYPDYDNPESMLINMQRHTQDTSG
FT                   NEKTRVATRTTVEDVVVSAGNNAVINAGGNMRISTDRLENRFANIAAGRDLAIVGLNRD
FT                   QSEVINAAEQLTRTSTFDNVSITYGGSSSRWKAAPITEKTGALGSSITAGGKLTIDVGN
FT                   LRNDNTGGSNPNAGGGKGTAQLDTGGRGAGAVGPGAGSVQGPGQSTGQGAGSVDAQGPG
FT                   TAGAAQGANGGHQQAVAQADGVRADAAGAQGPGQAGNAGSGAGTAQDISAAQAGQANAN
FT                   GPAAVRAGEHAGSGGNTAVEGKQATTTTGTDPRVVVTTSPNASAPTASLFNVDANRGNH
FT                   IVETDPRFASYRDWLSSDYLLQRAGFDPAQTQKRLGDGFYEQKLVREQIGELTGRRFLT
FT                   GHGSDEEQYRALLEAGATVASEWGLRPGVALTAEQMARLTSDIVWLVEKDVTLADGSVV
FT                   RALVPQVYLRVMPGDLGNDGALLAGAEVDIKLRGDLVNSGTIAGRQLVSIDAGNIRNLS
FT                   GGQISGAQVGLSARQDIDIIGSTVKATDALALKAGGNITVASTTTEWKDQGDRLSQQKT
FT                   TLDRVAGLYVTNPGGDGVLSVVAGGDIGLKAAEIRNAGTHGITQLAAGGNLDLGAQTLG
FT                   QSSALNHDSRNYTSNSQTTHAVSSIEGAGDVLLVAGKDINLAATRIKTGGGMALQAGGD
FT                   INSQVLVDSSSSDFNAGGKRSSLQISQSDEIVRGSQLSAGDNVVLKATRDINLTATQVA
FT                   SSDGTLSVVAGRDVNLLSASETHDFSLDSYDKKKKTLSSTTTTRHAESSDSYAIGTALQ
FT                   GKAVNVNAGHDLTAVGTVIDATGNVTLGAGNNVLIASAEDHHSSESSQSKKKSGFTGGF
FT                   ANGTASIGYGSSKNSSSTAEQSTTQVGSAIASREGNVLINAGNQLTIAASDVAAGRDLT
FT                   LVGRDINLIARQDTVDTQASQSSKSSGFSVGVTYDPAKAYRTARDNATEGMADSGTMMG
FT                   RITRTAEGVAAGVSAAVLPAITAGSQRSNSNQSHSSSDARVSNLNAGGNLTLIANGGSI
FT                   TSQGAQMSAEGDAALLATKDIVFDVAHNTERSSSDSRGKGWGISTNSAGLPFGTNNSRS
FT                   DGAGQSDTITGTQLSVGGGVRMATTEGDIRLTAANIAAEKDVNIRAAGDLTIRSGQDTV
FT                   GNANRSDSKAIGTVQISDTEKFSGWHREQHRDDSAQVSQVASTVGSLGGSVNLTAGGKY
FT                   TQTASNVVAAQDVNITAAQIELLTADESGHYSQSDKDLKIGAFARVKSPLIDLLNNVDA
FT                   ARKSDGRLQAMQGLAASANAYQSASAIADMAKGAGGGSLLSAEAGVGFKTSSRSADGSS
FT                   QVSRGSTIQGGGNVNLTSTQGDIHVVQGSLSAGSTLALDSARDILLEAGQANLQSKSKG
FT                   SNAGAEVGVGVSVGAQTGVYVYAEASVGSSKSNAESSTWQNTTLAGSTISLKAEGDTTL
FT                   RGATATADRIDVKTGGTLTIESLQDIAESMSKDNQVGGRVQVSFGTAWNVNGYASAGKA
FT                   NGSYQGVGQQSGLFAGDGGYHVDAGHVNLIGGAIASTQTGNSELTAQTLTFTDLKNEMD
FT                   YRASSVGISGGFGSTGKVATDADGNPIAAPNAAGQLKDIGNTITTGGYGKANTTTFSPG
FT                   IPMTESGHDSSTTYATLTGGNITIGGKKVDAADLGINTDASTAHKALDTLPDLQQMLQQ
FT                   QRAMAQATGTVVSVGMQIRSDINASIDAATDRREAVKAILNDPEQRAALTPEREAQLIA
FT                   VGVAASGEIDRLQRAGVLVGAITGGLAASSGSAGSIVAGTLAPAISYQIGQYFKENADR
FT                   NMADGGSRSEEGSATHLLAHALLGAAVASAGGDNALIGALAAGSAEAAAPSIARFMFGK
FT                   DSKDLTASEKEAVSTVAGIGGAMLGTFQDGMLGAAAGNNAAKNAVENNWGEVGHYSTTA
FT                   TILYLSGFTESDAKGIAAATWAPDTDRRNAITPFNVAWAKFKGTPQQHNHALGGEMDPE
FT                   AVRAIQAELGEKVAVILADIKRNENNPEAKRAILDNVETQRVLHLFGDSFAHVQRDGTQ
FT                   FKPVLGHAKASTQDEGINDPDNPYTHRDAYLAYSLALYKAATGASKGKALGDANYIADL
FT                   ASRVSAVNGEAAQKGVLDAAASFFMPTRTSGLVDAPMSDCGWYCTYVPAGWMARPELEK
FT                   IYRKPVEVPQTPVIDWTKFSQGRW"
FT   gene            152978..153316
FT                   /locus_tag="Smal_0114"
FT   CDS_pept        152978..153316
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0114"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49819"
FT                   /db_xref="GOA:B4SRU9"
FT                   /db_xref="UniProtKB/TrEMBL:B4SRU9"
FT                   /protein_id="ACF49819.1"
FT                   /translation="MMRTWGSRLLRVVAKAGDWLHLLLWAASITYLMLSFLSWTVFHDY
FT                   TFMGLTANSFYVRYRDFIFWYSYAAVPVLTAVVIALIWIRRRVAPAEMLIAFVGWGLLL
FT                   FHLSLVRS"
FT   gene            153441..154199
FT                   /locus_tag="Smal_0115"
FT   CDS_pept        153441..154199
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0115"
FT                   /product="N-acetylmuramyl-L-alanine amidase, negative
FT                   regulator of AmpC, AmpD"
FT                   /note="PFAM: N-acetylmuramoyl-L-alanine amidase family 2;
FT                   KEGG: xcb:XC_3877 N-acetylmuramoyl-L-alanine amidase"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49820"
FT                   /db_xref="GOA:B4SRV0"
FT                   /db_xref="InterPro:IPR002502"
FT                   /db_xref="InterPro:IPR036505"
FT                   /db_xref="UniProtKB/TrEMBL:B4SRV0"
FT                   /protein_id="ACF49820.1"
FT                   /translation="MAHNHRMGPFRIPLLLLAAVLFAGCASTDVHNPLATWVPSPNQNA
FT                   RTPVIIVIHHTEQKSVQQSLHTLRTANSGGRVSAHYLIGADGHRYQLVADERRAWHAGA
FT                   GRWGTITDLNSASIGIELDNDGRSPFSPVQIESLIVLLRDLAERLNIPPRQVIGHADLA
FT                   PTRKQDPSRFFPWQQLAEAGFGVWPRAADGAAPEGFDAWNALARFGYPLDNREATIAAF
FT                   HRRFRGRDDLPKTLDAEDARILHSLLLQTP"
FT   sig_peptide     153441..153527
FT                   /locus_tag="Smal_0115"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.981) with cleavage site probability 0.643 at
FT                   residue 29"
FT   gene            complement(154330..155031)
FT                   /locus_tag="Smal_0116"
FT   CDS_pept        complement(154330..155031)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0116"
FT                   /product="two component transcriptional regulator, LytTR
FT                   family"
FT                   /note="PFAM: response regulator receiver; LytTr DNA-binding
FT                   region; KEGG: fjo:Fjoh_4495 two component transcriptional
FT                   regulator, LytTR family"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49821"
FT                   /db_xref="GOA:B4SRV1"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR007492"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:B4SRV1"
FT                   /protein_id="ACF49821.1"
FT                   /translation="MRILIVEDEPLVRQRLLRLCSEQAGTRARFDAVADLESAGDRLQC
FT                   SVYDGLLLDLNLGGDDGFELLRRAVAGRYQCVVVSAHRDRALQAFEHGVLDFVPKPFSR
FT                   ERLGQALERLLDTSGSRPGRARYLGVWRAQGTATVELADVLWIRADGDYSQVRMRDGRS
FT                   ELHDKSLAGLGSVLPGDFVRCHRSYLVNLQHVRMLHAGSGSRYWLVLSDGSELAVGRAH
FT                   VAALRDALGSG"
FT   gene            complement(155019..156728)
FT                   /locus_tag="Smal_0117"
FT   CDS_pept        complement(155019..156728)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0117"
FT                   /product="C-terminal ATPase domain signal transduction-like
FT                   protein"
FT                   /note="KEGG: fjo:Fjoh_4494 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49822"
FT                   /db_xref="GOA:B4SRV2"
FT                   /db_xref="InterPro:IPR010559"
FT                   /db_xref="UniProtKB/TrEMBL:B4SRV2"
FT                   /protein_id="ACF49822.1"
FT                   /translation="MQIPRTLAVLAVLLAAVAVWLLVSTPPPGLVQVPGAQMALANIGT
FT                   AGAVPARPPQDLHWRPLDQRELAAWRGPYWLRWQVPAPTTADVHGRTMRLSLRAASQLY
FT                   WNGNPWVSNGVVGRSAAEERPGRIDLVRVLPPASGNRSDELIVLASSQRQHFHLHGADA
FT                   MVLIAPATVLYGQIILPWLIAAFATGALAAACLYFLTVLRGQTQAPGARLLLALGAVGL
FT                   ALPVVEAWRSLLGYPYPWHGPRLVALLCLHVAAAALLPAYLARRFAVAMPRAVYLGYLA
FT                   VIIAAAVALPGFDTRSAAVLLSSLLASAGALLRAHCESEDRWPILALLLAGLLALLVAG
FT                   GAFLDGPYFLLLAVLMVFLLLRHAAQLQALDRHNAWLSEERARLSLQLLQRGIQPHWLM
FT                   NTLTCLQELIEQAPARASRLVESLADQFDRLRDSSDRRSVSLQDELALCRSHLDIVGMA
FT                   LDQRMRLEVDGEDAMLSLPPGILHAQVENALTHAGALACAKHPFHLRVQRTNARWILEL
FT                   RSARGSAPHRGRGTGTRYIEASLAAACPGGWTFVQGAEGDHWRSRIELTCAS"
FT   sig_peptide     complement(156633..156728)
FT                   /locus_tag="Smal_0117"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.994) with cleavage site probability 0.461 at
FT                   residue 32"
FT   gene            156856..158367
FT                   /locus_tag="Smal_0118"
FT   CDS_pept        156856..158367
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0118"
FT                   /product="alpha/beta hydrolase fold"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG:
FT                   mmr:Mmar10_1192 alpha/beta hydrolase fold"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49823"
FT                   /db_xref="GOA:B4SRV3"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B4SRV3"
FT                   /protein_id="ACF49823.1"
FT                   /translation="MTRSARTLPCSSHRCRTTIATALAAIGLALAVAAPAQASPAALAF
FT                   EPYTLQTKAHGSIPAEIAVLAVPRRHSEPDGPRMQLKVVRLRATGGNGRSAPVVYLAGG
FT                   PGGSGIDTARGPRWPVFDQVRREADVLLLDQRGAGLSEPPPECPHQTRFDDAQPLQRDT
FT                   ALVALQATAAKCVAFWRQAGVDLGAYTTAESAADLDDLRRALGVPKISLWGMSYGTHLA
FT                   LAAVRLHGEGLERVVLMGTEGPDDTLKLPLSSDAVLQALAQLARKDGFDDLAGSATRVL
FT                   QALREQPRQGRSGMHESRQVTIGLYDAQIVIANMLGQRITQQWLPLVLREAERGNYDPL
FT                   ADLVLIGRAQFAQFPAMGLAMDIASGQSPQRRVLAEAQARESLFGDGLNFPFPAIGNGL
FT                   GLADLGDSFRGPLRSEVPVLFISGTLDGRTPPANADALRPGFRNGRSLLVRNASHHHEL
FT                   WTGNPAIARSIVEFLAGRTVSDAVLDVPPPVFATSNSGLLGSGGR"
FT   sig_peptide     156856..156972
FT                   /locus_tag="Smal_0118"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.940 at
FT                   residue 39"
FT   gene            158433..159593
FT                   /locus_tag="Smal_0119"
FT   CDS_pept        158433..159593
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0119"
FT                   /product="MltA domain protein"
FT                   /note="PFAM: MltA domain protein; 3D domain protein; KEGG:
FT                   pst:PSPTO_1025 transglycosylase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49824"
FT                   /db_xref="GOA:B4SRV4"
FT                   /db_xref="InterPro:IPR005300"
FT                   /db_xref="InterPro:IPR010611"
FT                   /db_xref="InterPro:IPR026044"
FT                   /db_xref="InterPro:IPR034654"
FT                   /db_xref="InterPro:IPR036908"
FT                   /db_xref="UniProtKB/TrEMBL:B4SRV4"
FT                   /protein_id="ACF49824.1"
FT                   /translation="MKDIIAPLSRTSLSLLALAVLAACSTTGTRPEAPPAPIKPAATYA
FT                   KVEWSALPPVSDTDLQAGFVAWRSSCARLKNDAVWAKPCTTAAAVNDKDPAAIRQFLQR
FT                   DLDVYALRAGGHQADGLITGYYEPIYPGSLTRTDKATVPVYGTPDDLIVVQLDSVYPEL
FT                   KGKRLRGRVEGKVLKPYDDAGTIAAKGAKAPVLAWLTDPMDLQLLQIQGSGRVRLADGK
FT                   QVRLAYAEQNGHPYRAIGRWLVDQGQLKKEDVTMDAIRAWARANPSRVPELLRSNPSYV
FT                   FFVRNPDSPEGPRGSLNVPLTAGYSVAVDRTVVPLGSLLWLSTTRPDGSPVVRPVAAQD
FT                   TGGAIAGEVRADLYWGSGDAAGKLAGDMKQKGNIWMLWPKGSPLPK"
FT   sig_peptide     158433..158510
FT                   /locus_tag="Smal_0119"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.990) with cleavage site probability 0.295 at
FT                   residue 26"
FT   gene            159702..160004
FT                   /locus_tag="Smal_0120"
FT   CDS_pept        159702..160004
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0120"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hch:HCH_03534 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49825"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="UniProtKB/TrEMBL:B4SRV5"
FT                   /protein_id="ACF49825.1"
FT                   /translation="MKYAKPNAKTNSKKYYKHWAESSLGKGNVLMEARGEKIVRQVEIY
FT                   GAKVVWADETGQSDDRFVLADQPVSFMDFDEDDEISAREFESAWKKAREATGYPV"
FT   gene            160084..162129
FT                   /locus_tag="Smal_0121"
FT   CDS_pept        160084..162129
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0121"
FT                   /product="TonB-dependent receptor"
FT                   /note="PFAM: TonB-dependent receptor; TonB-dependent
FT                   receptor plug; KEGG: xac:XAC0690 TonB-dependent receptor"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49826"
FT                   /db_xref="GOA:B4SRV6"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039423"
FT                   /db_xref="UniProtKB/TrEMBL:B4SRV6"
FT                   /protein_id="ACF49826.1"
FT                   /translation="MKTSTLVAALAAAPFAPEALAQSADAALTLGKVDVHQHGEGQLSA
FT                   HQVLTSVDVLGADQIEDRNVSHSWELLGQMPGIQLTETRQGAESGKVSFRAFNGEGYLN
FT                   AIKTLIDGIPSNVNSGNQRYIDMLFPLEISYIEVVRGTNDPRYGLHNIGGNVNFGTRQG
FT                   GNYTDARLAYGSYNTRDAQLAVGREANGVAQNYFVGTQASDGYRDHDTSRKYSLGGKWF
FT                   LGTLDDGLRVGLTARAYHHEADEPGFMTVEEMRTHRRGSDLRNGNDGDDRDMRQIAAHL
FT                   DMKLSERLTFGTRLYYNRYEDDRRVTFSDLPTGNLPRQRRVWDERQNGLLSTVTWQASP
FT                   ALTVEGGLNYEQQDNSYIRERYAYAEPTDFSRAPARVQNNDRHSFDNWGAYVQAIYQPV
FT                   EAWKIVPAYRVDRFSGRTHLMNGLSARLQDYGSIGQPKLSVIHSLGENTHVYANWGRTF
FT                   QVLTGSTAPAYLAPGQARMRPSTNTGMELGLKFQPFAGSQARLAVWQQDAENEVSNMPA
FT                   TGTTVTLGKTRRRGVDAQLSLQLGDDWTVWASHAYQEAKITRDDRDASMSLRGREVAAT
FT                   PRHISNLGVDYHASDALRLGLQARAQGDYYLEERNVAGKFGGFAVLDLSAAYQITPRWS
FT                   VDLQLKNVTGRQYAYAWYDSFFWDSARPMFSPAPGRSVFVGLNMKL"
FT   sig_peptide     160084..160149
FT                   /locus_tag="Smal_0121"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.954 at
FT                   residue 22"
FT   gene            162245..163306
FT                   /locus_tag="Smal_0122"
FT   CDS_pept        162245..163306
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0122"
FT                   /product="signal transduction histidine kinase, nitrogen
FT                   specific, NtrB"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase A domain protein; KEGG: xcb:XC_0197
FT                   two-component system sensor protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49827"
FT                   /db_xref="GOA:B4SRV7"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B4SRV7"
FT                   /protein_id="ACF49827.1"
FT                   /translation="MSDPAPPPSLDALGTPLAWAGADGRIIGCNPAFARWLGVSIRRLL
FT                   GQPLAALEVQGEALAHFLARDERDSLRLNRLALAVPGEAPRFAEGWMSRRDDGGWLLEA
FT                   HPVDEFPGLDPTQALPSALSAALKGLAHELRNPLAGLKGAAQLLARRAAQRDASERELI
FT                   ELIGSEIERLNGLLDQLLSPAPAAPHAELNIHAALERVLRLAENEAGWAVRLQRDYDPS
FT                   IPEFHGDADRLTQAVWNLVRNAIQAGAGNITLRTRVEHGVRIAEQLHTLALRLEIADDG
FT                   RGVPEELAEHLFLPLVSGRAEGTGLGLALAQQVAREHRGTLTYRSRPGHTVFTLLLPIG
FT                   NGAAPAEEAPRDV"
FT   gene            163299..164747
FT                   /locus_tag="Smal_0123"
FT   CDS_pept        163299..164747
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0123"
FT                   /product="nitrogen metabolism transcriptional regulator,
FT                   NtrC, Fis Family"
FT                   /note="KEGG: xcb:XC_0198 two-component system regulatory
FT                   protein; TIGRFAM: nitrogen regulation protein NR(I); PFAM:
FT                   response regulator receiver; sigma-54 factor interaction
FT                   domain-containing protein; helix-turn-helix Fis-type;
FT                   SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49828"
FT                   /db_xref="GOA:B4SRV8"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR010114"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B4SRV8"
FT                   /protein_id="ACF49828.1"
FT                   /translation="MSDASTPAQRIWVVDDDRAVRFVLCTALREAGYQVVDFDSAAPAL
FT                   QALSEGPPPALLFTDVRMPGDDGLVLLDKLKAVLPQLPVVVMSAYTDVASTAGAFRGGA
FT                   HEFLSKPFDLDDAVALAQRVLPAVAPAMAAAAPTTATSSDQPPQLVGDTPPMRALFRAI
FT                   GRLAQAPLAVLITGETGTGKELVAHALHRESPRAQAPFVALNTAAIPAELLESELFGHE
FT                   AGAFTGAQRRHIGRFEQANGGTLFLDEIGDMPLPLQTRLLRVLAQGEFFRVGGRELIRV
FT                   DVRVVAATHQDLEGLVAQGKFRADLLHRLDVVRLQLPPLRERREDIAQLANTFLAAAAR
FT                   KLDTPPKRLTAAALQALREHDWPGNVRELENVCWRMAALAAADTIGVADVDTALNRTRG
FT                   RRSSTTSADPGQWEALLAEWARRQLAEGVEGLHAQVRERVDHALLEAALQITHGRRAEA
FT                   AARLGLGRNTLTRKLGAGRRRGGH"
FT   gene            164841..165410
FT                   /locus_tag="Smal_0124"
FT   CDS_pept        164841..165410
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0124"
FT                   /product="superoxide dismutase copper/zinc binding"
FT                   /note="PFAM: superoxide dismutase copper/zinc binding;
FT                   KEGG: xoo:XOO4482 superoxide dismutase like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49829"
FT                   /db_xref="GOA:B4SRV9"
FT                   /db_xref="InterPro:IPR001424"
FT                   /db_xref="InterPro:IPR018152"
FT                   /db_xref="InterPro:IPR024134"
FT                   /db_xref="InterPro:IPR036423"
FT                   /db_xref="UniProtKB/TrEMBL:B4SRV9"
FT                   /protein_id="ACF49829.1"
FT                   /translation="MRLSFAILPLSAAVLLSACGSAPKKPQPTPPPPTVVGTAKQAEAN
FT                   LSPASASIVSGRIALVVEPGGIHITGLIGGLQPMQQAGFHIHERGDCSAVDASSAGNHF
FT                   NPGGTAHGRAGTGKHHLGDMDNLRADAQGRANVDIHLKGVTLGGGAATDIAGRALVVHA
FT                   NADDYRSQPAGNAGVRIACGVIRVVR"
FT   sig_peptide     164841..164903
FT                   /locus_tag="Smal_0124"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.984) with cleavage site probability 0.559 at
FT                   residue 21"
FT   gene            165442..166062
FT                   /locus_tag="Smal_0125"
FT   CDS_pept        165442..166062
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0125"
FT                   /product="superoxide dismutase copper/zinc binding"
FT                   /note="PFAM: superoxide dismutase copper/zinc binding;
FT                   KEGG: xcv:XCV0194 superoxide dismutase"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49830"
FT                   /db_xref="GOA:B4SRW0"
FT                   /db_xref="InterPro:IPR001424"
FT                   /db_xref="InterPro:IPR018152"
FT                   /db_xref="InterPro:IPR024134"
FT                   /db_xref="InterPro:IPR036423"
FT                   /db_xref="UniProtKB/TrEMBL:B4SRW0"
FT                   /protein_id="ACF49830.1"
FT                   /translation="MRLIHTSLFAAIAALGLAACNQQPAAPQTETPPAAPAEGATTEPA
FT                   AAPAAAPAADASATAELAPTQGNETKGSVTFKVVDGKVHVTGQISGLKPGSEHGFHIHE
FT                   KGDCSAPDGMSAGGHFNPGKQDHGSMAVDPHHGGDMPNIKADDKGVATIDGPVSSNVNI
FT                   GKGDDFDIIGRGLIVHADADDYKTQPTGNAGARLACAVIQKAP"
FT   sig_peptide     165442..165507
FT                   /locus_tag="Smal_0125"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.996) with cleavage site probability 0.537 at
FT                   residue 22"
FT   gene            complement(166147..167214)
FT                   /locus_tag="Smal_0126"
FT   CDS_pept        complement(166147..167214)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0126"
FT                   /product="TonB family protein"
FT                   /note="TIGRFAM: TonB family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49831"
FT                   /db_xref="GOA:B4SRW1"
FT                   /db_xref="InterPro:IPR006260"
FT                   /db_xref="InterPro:IPR037682"
FT                   /db_xref="UniProtKB/TrEMBL:B4SRW1"
FT                   /protein_id="ACF49831.1"
FT                   /translation="MLHTLQCAGLTLLATAVCGLPIMAQAAAPVAATPTCSIAPAFAAA
FT                   VAEPEVYDSHISFSNTVKVQVNVDAQGRAHDARVLNGSRNRVLDDAARQAALSWKYQCQ
FT                   GQGGIAQPVVPVPEPACRLDRLSWADNEPRFSSALRSSGLRGSAEVWLRPVADDPARTE
FT                   VKIGRSSGDARIDDTLLTAARNWRLICPPDTPVKHPWISFTQSFNFEPRNQPAATEASE
FT                   PEPDDVVIANDALLEFGTVAGFVEALPKMKGVDLAPDQSSQPGVTLYNTSLGAIMREIE
FT                   MTEGRLKPVTMTHWLVMVPPHRTAPAVVRTFKREVIDAKTGKAHMQTDISILCESGPAE
FT                   CAELRQRRDTLLRSP"
FT   sig_peptide     complement(167134..167214)
FT                   /locus_tag="Smal_0126"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.761 at
FT                   residue 27"
FT   gene            complement(167311..168198)
FT                   /locus_tag="Smal_0127"
FT   CDS_pept        complement(167311..168198)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0127"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xac:XAC0212 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49832"
FT                   /db_xref="UniProtKB/TrEMBL:B4SRW2"
FT                   /protein_id="ACF49832.1"
FT                   /translation="MSKPDPAMNALGVLALELAGGEIPRQAVLSAEQAGELAERVGRDL
FT                   AKQVPQVAELDLVFAAAHFDPAEVLRPGWPIHRRLEELQMRAPGRNQGPRLLAFGTDAT
FT                   GDVPLPFQADASLVGGGLRVVPFLLTGSDVATTNAVAEALEDTLLANGMAHADTALMAQ
FT                   NTFGARIEHARYFTVNDLAAMMSMQYDNQGLAALWPLIETAIMAPGEDEWLNAAPEPLL
FT                   RYTHGEARMALFDPAGWCAHYDHGNNDCDRLKGIYEQFLMRQRQMAAVLEAHGVPVLFV
FT                   HCEAGQDARELLAR"
FT   gene            168292..169587
FT                   /locus_tag="Smal_0128"
FT   CDS_pept        168292..169587
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0128"
FT                   /product="acetyl-CoA acetyltransferase"
FT                   /EC_number="2.3.1.16"
FT                   /note="KEGG: xcv:XCV0198 acetyl-CoA acetyltransferase;
FT                   TIGRFAM: acetyl-CoA acetyltransferase; PFAM: Thiolase"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49833"
FT                   /db_xref="GOA:B4SRW3"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:B4SRW3"
FT                   /protein_id="ACF49833.1"
FT                   /translation="MPGISMPNARPVAILGGVRIPFCRQNTAYSDVGNLGMSVRTLGAL
FT                   VERFGLHGQQLGEVAMGAVIKHSSDWNLGREATLSSGLSPLTPGITLQRACGTSLDSII
FT                   TVANKIALGQIESGIGGGSDTTSDVPIVYGKKLRARLLAANRAKSTGDKIRALTAGFKF
FT                   SELKPEFPGVAEPRTGKSMGDHCEDMAKEWNISRDSQDEWAVSSHKKLAAAYERGFFSD
FT                   LIAPFRGVERDNILRADTSLEKLATLKPAFDKVSGRGTLTAANSTPLTDGAAAVLLASE
FT                   EWARAHGHEPQAYLRDAHVSAVDFVHGEGLLMAPTVAVPEMLKRNGLTLQDFDIYEIHE
FT                   AFAAQVLCTLRAWESEDYCRNRLGLDAPMGRIDPDKINLLGSSLATGHPFAATGARVIA
FT                   TAAKQLAERGGGRALVSICTAGGMGVVAIVER"
FT   gene            complement(169716..171011)
FT                   /locus_tag="Smal_0129"
FT   CDS_pept        complement(169716..171011)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0129"
FT                   /product="HemY domain protein"
FT                   /note="PFAM: HemY domain protein; KEGG: xac:XAC0214
FT                   porphyrin biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49834"
FT                   /db_xref="GOA:B4SRW4"
FT                   /db_xref="InterPro:IPR005254"
FT                   /db_xref="InterPro:IPR010817"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:B4SRW4"
FT                   /protein_id="ACF49834.1"
FT                   /translation="MKPLQSLVVLLLAVAIGVVAAQWLGADDLNRFGEVTLRYGGYDYH
FT                   SNLPKVALLSVVAVLVLWLLWSLIAAPFRAWGRYRRKQGRVRLIDGLQAYEHGQWQRAE
FT                   KLLDGAAKDPEVSAVALANAVRSAQARADGAAGEALLQRLGESDATLQALLRAEQLLAR
FT                   DLPVDAINALDVAAIQPLPPRGLWLRTEALAQAGRAHEAYGQLGALRQSKVLPADANSE
FT                   LEARLAAQALLEAADVNALAAQWEATPKALRPTPDVVGAYASRAVALSWDEPALLALEH
FT                   ALDQRWDDELVALYGRLPAERLATRQANLARWRNVHDSSAALRLAQGRVALGQQQWDAA
FT                   DAFLHEAIAAGAGAPAWEALGELFAQRGDHALAAQCLANALRLQRGEDSVELVRGTEAP
FT                   LRATVEEQPVTVQPPVYDANEERDEFGNPRLP"
FT   sig_peptide     complement(170946..171011)
FT                   /locus_tag="Smal_0129"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.869 at
FT                   residue 22"
FT   gene            complement(171018..171992)
FT                   /locus_tag="Smal_0130"
FT   CDS_pept        complement(171018..171992)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0130"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xac:XAC0215 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49835"
FT                   /db_xref="GOA:B4SRW5"
FT                   /db_xref="InterPro:IPR007470"
FT                   /db_xref="UniProtKB/TrEMBL:B4SRW5"
FT                   /protein_id="ACF49835.1"
FT                   /translation="MNETPPVSPPRRPVRWLLPLAGVVVLGVGGYAGWRFWHEQQDAQD
FT                   AQAQTTAVQLQGLEATLDALRRDQRATSQRLQDAAATNRVLRDEMLGLSQRSALLEENL
FT                   AKLADSANQGRQAVQRDEAELLLTQAAQRLNYSDDVEGARRLYAQAATALADLPDSDGL
FT                   NLRQALVQEREALDALGAGPRVQSLQRLDALAKALQGLPSQVTGSATANARPWWQATLA
FT                   PFVDITPSRQNGPLTAAERHNADDALQLELTLARAAIERGDRSGRDTALQRVEHWAQRR
FT                   WPDSPALRAQRAELKALRELPLQASNTVLGSTLQQLRTQTDRR"
FT   gene            complement(172096..172905)
FT                   /locus_tag="Smal_0131"
FT   CDS_pept        complement(172096..172905)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0131"
FT                   /product="Uroporphyrinogen III synthase HEM4"
FT                   /note="PFAM: Uroporphyrinogen III synthase HEM4; KEGG:
FT                   xom:XOO_3862 uroporphyrinogen-III synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49836"
FT                   /db_xref="GOA:B4SRW6"
FT                   /db_xref="InterPro:IPR003754"
FT                   /db_xref="InterPro:IPR036108"
FT                   /db_xref="InterPro:IPR039793"
FT                   /db_xref="UniProtKB/TrEMBL:B4SRW6"
FT                   /protein_id="ACF49836.1"
FT                   /translation="MQAMADHTIPTGAAGSDADWTFISLRPQGQHAALRRAVAGLDGHL
FT                   LALSPWRLQRLHGTPVVRQLQRALNCDRVVFTSPAAVAAAASLLPLADAQRSPWLTVGE
FT                   GTARALRAQGVHEVHAPQRMDSEGLLALPVLADVRGRRIGLVTAPGGRGLIAAQLQAAG
FT                   ASIERADVYQRRPLRLSPRTLARLAHSAYPWVLAVSSGEALQHFWRQLPHALQQRLQAH
FT                   ASVVVASDRLREQAQALGLQRISRSAGPAGAQLVSAAHATLTVPAAT"
FT   gene            172941..173408
FT                   /locus_tag="Smal_0132"
FT   CDS_pept        172941..173408
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0132"
FT                   /product="thioesterase domain protein"
FT                   /note="TIGRFAM: thioesterase domain protein; PFAM:
FT                   Thioesterase putative; KEGG: xac:XAC0218 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49837"
FT                   /db_xref="InterPro:IPR012660"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:B4SRW7"
FT                   /protein_id="ACF49837.1"
FT                   /translation="MSVDALTSSLAALQDVLDCMPAVRAMQIQLDGYADGVLRITAPLA
FT                   ANVNDKGNAFGGSLASVLTLSGWALVSLRLRLAGHDAEVYVADSNLRYLAPVYEDLHAH
FT                   AEAAEATGWDAFLNTFRQRRKARISIVATQPGADGKPAAEFSGRFVAFAKG"
FT   gene            173441..173866
FT                   /locus_tag="Smal_0133"
FT   CDS_pept        173441..173866
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0133"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xcb:XC_0211 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49838"
FT                   /db_xref="UniProtKB/TrEMBL:B4SRW8"
FT                   /protein_id="ACF49838.1"
FT                   /translation="MRRLIQFLMFSLLLVSAVASADDLTRKQRKLLEETQIAYGATIRW
FT                   GSMDDAIGYLDPKLRKEKPPTEFELNRYAQLRVSSYRERSSAALEGGLVERRVEIGVIN
FT                   QNTQAERTVVVVERWRWDAEAKRWWQTAGLPDLWKGQ"
FT   sig_peptide     173441..173506
FT                   /locus_tag="Smal_0133"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 22"
FT   gene            173924..174361
FT                   /locus_tag="Smal_0134"
FT   CDS_pept        173924..174361
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0134"
FT                   /product="Rhodanese domain protein"
FT                   /note="PFAM: Rhodanese domain protein; KEGG: xcb:XC_0212
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49839"
FT                   /db_xref="GOA:B4SRW9"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:B4SRW9"
FT                   /protein_id="ACF49839.1"
FT                   /translation="MNYEELLAFAGRNPMLSAALVGLTVAIIVTEIRRLFRGFKGIKPA
FT                   ELTQLINAGGTVVVDLSASGDFEKGHIAGSRNAQASAFGPDNKLVANAKQSPVVLVCRS
FT                   GNASETAAKALKKAGFEKVYVLDGGIPAWQQAELPLVKGRN"
FT   gene            174462..174980
FT                   /locus_tag="Smal_0135"
FT   CDS_pept        174462..174980
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0135"
FT                   /product="protein-export protein SecB"
FT                   /note="TIGRFAM: protein-export protein SecB; PFAM: protein
FT                   export chaperone SecB; KEGG: xac:XAC0221 preprotein
FT                   translocase subunit SecB"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49840"
FT                   /db_xref="GOA:B4SSF8"
FT                   /db_xref="InterPro:IPR003708"
FT                   /db_xref="InterPro:IPR035958"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4SSF8"
FT                   /protein_id="ACF49840.1"
FT                   /translation="MSEETTNGAVAPADAATGPAFTVEKIYVKDVSFESPNAPTIFNDQ
FT                   VQPELQLNLNQQVQRLGENAFEVVLAVTLTCQAGERTAYVAEVKQAGVFGLVGLDPQSI
FT                   DVLLGTQCPNILFPYVRQLISDLIQAGGFPPFFLQPINFEGLYAETLRQRQEQGDAPSL
FT                   ADSEPAGNA"
FT   gene            175001..176026
FT                   /locus_tag="Smal_0136"
FT   CDS_pept        175001..176026
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0136"
FT                   /product="Glycerol-3-phosphate dehydrogenase (NAD(P)(+))"
FT                   /EC_number="1.1.1.94"
FT                   /note="PFAM: NADP oxidoreductase coenzyme F420-dependent;
FT                   NAD-dependent glycerol-3-phosphate dehydrogenase domain
FT                   protein; 3-hydroxyacyl-CoA dehydrogenase NAD-binding;
FT                   Ketopantoate reductase ApbA/PanE domain protein; KEGG:
FT                   xcb:XC_0214 NAD(P)H-dependent glycerol-3-phosphate
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49841"
FT                   /db_xref="GOA:B4SSF9"
FT                   /db_xref="InterPro:IPR006109"
FT                   /db_xref="InterPro:IPR006168"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR011128"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4SSF9"
FT                   /protein_id="ACF49841.1"
FT                   /translation="MSTTADKIAVLGAGSWGTALASLLARHGHPTVLWGRDAAMVEAID
FT                   QRHENPRYLPGIPLPDSLRATTDLASAVEGAAWILVVTPSHAFGETVRALAPLRPAGAG
FT                   VAWATKGFEPGSGRFLHEVAREVLGEDVPLAVVTGPSFAKEVTQGLPTAITVHGDVPEF
FT                   AQTVAEAMHGPAFRAYTGDDMVGAELGGAMKNVLAVATGVADGMQLGLNARAGLITRGL
FT                   NEMLRLAAAIGAKPETLMGLAGLGDLVLTCTGDLSRNRRLGLALGRGQTLQDAVREIGQ
FT                   VVESVQTADEVMRQARRHGIDLPISDRVRAVLHGEQTPEEGLRALLAREQKPEYPDTLF
FT                   K"
FT   sig_peptide     175001..175066
FT                   /locus_tag="Smal_0136"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.682) with cleavage site probability 0.493 at
FT                   residue 22"
FT   gene            complement(176166..176642)
FT                   /locus_tag="Smal_0137"
FT   CDS_pept        complement(176166..176642)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0137"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cel:F09E10.7 F09E10.7a"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49842"
FT                   /db_xref="InterPro:IPR027843"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:B4SSG0"
FT                   /protein_id="ACF49842.1"
FT                   /translation="MRRTRLAVIFCSALLLAIPAIAHDAESTKAAQPLPDAALPATLDR
FT                   VLRDYEQAWRSGDAKALAALFAEDGFVLQSSQLPVRGRSAIEAAYSGQGGSPLRLRALA
FT                   YSVDGNTGYIIGAYRYGNNMGDTGKFTLTLKRVGDGPWLIFSDMDNGNAPPRAR"
FT   sig_peptide     complement(176574..176642)
FT                   /locus_tag="Smal_0137"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 23"
FT   gene            176759..177427
FT                   /locus_tag="Smal_0138"
FT   CDS_pept        176759..177427
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0138"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ssc:733643 nuclear receptor corepressor 2"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49843"
FT                   /db_xref="InterPro:IPR036501"
FT                   /db_xref="UniProtKB/TrEMBL:B4SSG1"
FT                   /protein_id="ACF49843.1"
FT                   /translation="MKIRITGMVLTVALLAACGQEPAPDAAAPAAPAPATEAPAATATV
FT                   VEKEPPIEDGVDPSVWDNEGEPEDPSAGGELTCADNPLATHFFTLVGGNTVDDCGRKDP
FT                   KVLAAFNALMKNTAAAESADKEIPSLRERLLSGPSGPGELVVLQGEPWWFYTACQAHDC
FT                   PGTALAMLYSPDQSKMVGRLTARCRIWWLGEPSDEQRALIEREQPVDKEMLKEEGESCE
FT                   "
FT   sig_peptide     176759..176818
FT                   /locus_tag="Smal_0138"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.995) with cleavage site probability 0.678 at
FT                   residue 20"
FT   gene            complement(177464..178846)
FT                   /locus_tag="Smal_0139"
FT   CDS_pept        complement(177464..178846)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0139"
FT                   /product="HipA N-terminal domain protein"
FT                   /note="TIGRFAM: HipA N-terminal domain protein; PFAM: HipA
FT                   domain protein; KEGG: bpt:Bpet0232 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49844"
FT                   /db_xref="InterPro:IPR012893"
FT                   /db_xref="InterPro:IPR017508"
FT                   /db_xref="UniProtKB/TrEMBL:B4SSG2"
FT                   /protein_id="ACF49844.1"
FT                   /translation="MSAPRIDLKDVITTTVLSGLHYPLPPRELQVSIDEAPVGRLTEAA
FT                   NLWRFTYAPEWLGSAHRFPLAPALPLQDTAILDGSSQRPVQWYFDNLLPEEQQRTLMAT
FT                   DARVDGADAFALLAAYGAESAGSLTLLPPGQRLPPGGRKPLPDAELSTRIQGLPRTSLA
FT                   AGAAKRMSLAGAQHKLAIIETGGELYQPLGAEPSTHILKPDSTSSSYPHSVANEWFVMR
FT                   LAQRMGLQVPKIERRYVPEPVFIIERFDREITADAIHRRHAIDACQLLNLDRQFKYTLG
FT                   SIDTLKVIVEQCRSKLKTRVRLFDWMIFNVLTGNNDAHLKNLSFLVDSRGIELAPHYDL
FT                   LSTACYETRAYADEGARWPERSELSWPILGVARFHDLRFEHLVSAGEALGLGRPAATRQ
FT                   LRHQIDRIAGEAQALYAEVLQENQQWLTRFDIGPSLEGEVHFLRTLVHVIIADMVRQLS
FT                   PA"
FT   gene            complement(178843..179106)
FT                   /locus_tag="Smal_0140"
FT   CDS_pept        complement(178843..179106)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0140"
FT                   /product="helix-turn-helix domain protein"
FT                   /note="PFAM: helix-turn-helix domain protein; KEGG:
FT                   reu:Reut_A1911 putative transcription regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49845"
FT                   /db_xref="GOA:B4SSG3"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:B4SSG3"
FT                   /protein_id="ACF49845.1"
FT                   /translation="MKIRLEKAEALGPLVRAARKHQGLRQDATAEGIGVSENFLAKVER
FT                   GGTTVQWGKLFTVLDELGLHVEIDVPDEAMALLAKRANGKAP"
FT   gene            complement(179540..180226)
FT                   /locus_tag="Smal_0141"
FT   CDS_pept        complement(179540..180226)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0141"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cak:Caul_4105 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49846"
FT                   /db_xref="UniProtKB/TrEMBL:B4SSG4"
FT                   /protein_id="ACF49846.1"
FT                   /translation="MALAVACSGVANARDKDAPAPPVATVDELPADQSVSETVIELAGW
FT                   VVASKDNQGYPFAIMDKAAAQVLVFSGDGKLRGAAPALFGSAIGDHSAPGVAKLALSAI
FT                   PGHDRTTPAGRFIGGYGPSDDAGRVLWVDYDSAVSMHPLPPGTPKEKRAQRLASPSPDD
FT                   NRVTHGCINVTPAFYEQIVQSTFEKGGVFYILPDKDSIAKTFPEFAQSRGDAKDEDEKG
FT                   ARRASK"
FT   gene            complement(180383..180655)
FT                   /locus_tag="Smal_0142"
FT   CDS_pept        complement(180383..180655)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0142"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: nar:Saro_2539 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49847"
FT                   /db_xref="UniProtKB/TrEMBL:B4SSG5"
FT                   /protein_id="ACF49847.1"
FT                   /translation="MKLTSQHMKMARALSVALIATVSLGACASYKNEFATINSRLDQLD
FT                   VKVQGAAQSAESANQSAQQANQRLDQIEGRVQQLERAPAGRKPRG"
FT   sig_peptide     complement(180569..180655)
FT                   /locus_tag="Smal_0142"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.692 at
FT                   residue 29"
FT   gene            complement(180868..181863)
FT                   /locus_tag="Smal_0143"
FT   CDS_pept        complement(180868..181863)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0143"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: swi:Swit_2733 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49848"
FT                   /db_xref="InterPro:IPR018728"
FT                   /db_xref="UniProtKB/TrEMBL:B4SSG6"
FT                   /protein_id="ACF49848.1"
FT                   /translation="MALLSASYAHHARCLMRALILIASPIALLQAQAAEHVGPAGHIVV
FT                   QTDDVTRFFKVLDANHGRPSANDLQHGYLDAGTDALRSFTDSRIGSMERLARAIQDKPA
FT                   LFAKARSCATALPSIRTRVAAAVDQLGALLPSARFPPVTVLVGRGNSGGVTTEAGVVIG
FT                   LEALCNADWMQADASDRFVHLIAHEYVHVQQPGARVDVEQPTLLYQTLLEGGAEYVAER
FT                   ISGQPANAHLQHWAQGRECALERAFLQDSMGTDLSRWLYNGPGDDTRRGDLGYWIGYRI
FT                   AHAYVARAPDMPNAIAELLAVQPGNAAALLEASGWQPACGAGESTQTHML"
FT   sig_peptide     complement(181762..181863)
FT                   /locus_tag="Smal_0143"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.885) with cleavage site probability 0.802 at
FT                   residue 34"
FT   gene            182025..182600
FT                   /locus_tag="Smal_0144"
FT   CDS_pept        182025..182600
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0144"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xom:XOO_3968 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49849"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="InterPro:IPR026364"
FT                   /db_xref="InterPro:IPR027385"
FT                   /db_xref="UniProtKB/TrEMBL:B4SSG7"
FT                   /protein_id="ACF49849.1"
FT                   /translation="MNKNSLLALGLLAALPFAASATDGLSYNYVEGGYVNTDAKGGDAD
FT                   GWKVKGSVAVHPNFHVFGDYSAQETDKFKNDVDQWRLGVGYNYGIAPNTDLVARVAYQK
FT                   YDEKRGLDFNGYSTEVGVRTAFNPYVEGYVMAGYEDFSKKHGYNPDGEFYGRVGATAKF
FT                   NQNWGLSGEVKLAKAGDREWFVGPRFTW"
FT   sig_peptide     182025..182090
FT                   /locus_tag="Smal_0144"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.984 at
FT                   residue 22"
FT   gene            182722..183489
FT                   /locus_tag="Smal_0145"
FT   CDS_pept        182722..183489
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0145"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="SMART: helix-turn-helix- domain containing protein
FT                   AraC type; KEGG: dac:Daci_4320 transcriptional regulator,
FT                   AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49850"
FT                   /db_xref="GOA:B4SSG8"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="UniProtKB/TrEMBL:B4SSG8"
FT                   /protein_id="ACF49850.1"
FT                   /translation="MGDPSSLEGTGTAYQEHLAPAPLRGHFGQLWQSQLPAGADRHITV
FT                   LPDGCVDILWRDGALFVVGPDRVAAHPALAPGAQVLGARFRPGQALAALGLPLAEIIGQ
FT                   AVPLADLKGAWAKKAAASIGDTAPAQRLQRMAYCLQRHMGAAALDTPAQRAHVLFQALA
FT                   AGHATLDTLAAHLSLSPRSLRRFSQSQFGYGAKTLERILRLQRFLRHSRALPQHSLAML
FT                   AADAGYADQAHLSREARELASMTARQLRLEWGR"
FT   gene            183558..183926
FT                   /locus_tag="Smal_0146"
FT   CDS_pept        183558..183926
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0146"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; KEGG: atc:AGR_C_2825 conserved
FT                   hypothetical protein VCA0415"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49851"
FT                   /db_xref="GOA:B4SSG9"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:B4SSG9"
FT                   /protein_id="ACF49851.1"
FT                   /translation="MSHAAPPDAERRIDNIEFNVADIARSKRFYGEVFGWNFTDYGPAY
FT                   TEFDDGRLKGGLVSDTPVRAQGSPLVILYCADLADAQQRVIAAGGEVVQAVFAFPGGRR
FT                   FHFRDLDGYELAVWSDVD"
FT   gene            184050..185024
FT                   /locus_tag="Smal_0147"
FT   CDS_pept        184050..185024
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0147"
FT                   /product="Dyp-type peroxidase family"
FT                   /note="TIGRFAM: Dyp-type peroxidase family; PFAM: Dyp-type
FT                   peroxidase; KEGG: spe:Spro_2444 Dyp-type peroxidase family"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49852"
FT                   /db_xref="GOA:B4SSH0"
FT                   /db_xref="InterPro:IPR006314"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:B4SSH0"
FT                   /protein_id="ACF49852.1"
FT                   /translation="MNSQPAPITALNHTLENEPQQITAPLTHSAAFLVLKVKDDEASIA
FT                   KAREVLASTDDLIKNTAIREIERTFTCNVAIGHRVWQPLVGTTPPRELQPFREIKGATH
FT                   TAVSTPGDLLYHIRARTMDLIVAFERNLLMAFGDAVETVDDVAGFRYFDGRDLLDFVDG
FT                   TANPEGLSLPEATIVGDEDPAHAGGSYVVVQKYLHNLDAWRAQKTEAQEAIIGRTKHDN
FT                   IELDDAPADAQKSHKTLCTIEDADGEHEILRDNMPFANPGRGEYGTYFIGYTRRLWVIE
FT                   KMLERMFIGNPAPLHDRILDFSTATTGVTFFAPSRKVLADLGD"
FT   gene            185110..185526
FT                   /locus_tag="Smal_0148"
FT   CDS_pept        185110..185526
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0148"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mms:mma_2366 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49853"
FT                   /db_xref="UniProtKB/TrEMBL:B4SSH1"
FT                   /protein_id="ACF49853.1"
FT                   /translation="MAMAGNRTGVRRWWRPLAALFGALALGSASVSAQEAPAHWMAYAA
FT                   AVGGQLQQRLQQEQDPQAQRVLEWMQAHPDAPTPLPVSVWIAADGRISKLEFGSLGDAQ
FT                   IDADLRATLQSAPLQAAPPADMRQPLRLGLLLTQ"
FT   sig_peptide     185110..185211
FT                   /locus_tag="Smal_0148"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.987 at
FT                   residue 34"
FT   gene            complement(185635..186204)
FT                   /locus_tag="Smal_0149"
FT   CDS_pept        complement(185635..186204)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0149"
FT                   /product="nicotinamide mononucleotide transporter PnuC"
FT                   /note="TIGRFAM: nicotinamide mononucleotide transporter
FT                   PnuC; PFAM: Nicotinamide mononucleotide transporter PnuC;
FT                   KEGG: bmu:Bmul_5035 nicotinamide mononucleotide transporter
FT                   PnuC"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49854"
FT                   /db_xref="GOA:B4SSH2"
FT                   /db_xref="InterPro:IPR006419"
FT                   /db_xref="UniProtKB/TrEMBL:B4SSH2"
FT                   /protein_id="ACF49854.1"
FT                   /translation="MLEWTAALCSILGVWLMAKRRLVAWPVGLLSVTLYGLVFAEAKLY
FT                   SDTLLQVAFGGFLVYGWLNWRQHAADEGSVRIVPLARGKLLRDLAIGLCGGVALGAAMH
FT                   TFTDAALPWLDAMLTALSLVGQWWQARRHVACWWVWIAVDVVYVGAYLFKSLHVTAALY
FT                   VFFLGLAVFGLRAWSAAAREPQVATQ"
FT   gene            complement(186213..188402)
FT                   /locus_tag="Smal_0150"
FT   CDS_pept        complement(186213..188402)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0150"
FT                   /product="TonB-dependent siderophore receptor"
FT                   /note="TIGRFAM: TonB-dependent siderophore receptor; PFAM:
FT                   TonB-dependent receptor; TonB-dependent receptor plug;
FT                   KEGG: xcc:XCC0674 putative siderophore receptor"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49855"
FT                   /db_xref="GOA:B4SSH3"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010105"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR030149"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039423"
FT                   /db_xref="UniProtKB/TrEMBL:B4SSH3"
FT                   /protein_id="ACF49855.1"
FT                   /translation="MNRCLRPNLLSLALCAALPLHASEADASPDAAATGAERSPTELAA
FT                   VRVQAGKPKADTSRVNAFGGGSWKETPASVNVLERDYLDRRQVRSLSELASNDASLGDA
FT                   YAPVGYYQNIAIRGFALDAATGYRFNGLSIAGEQRLALENVQSVEILKGEAGLAAGVMA
FT                   PGGIINYIGKRPAEVRTVTLGTDSEGSRYAAVDVGHWITPRFGLRLNAAWDASNSYVEH
FT                   ADGRRNFYSLAADWLIGERGKLEVDANYQTSSQRSVSGYQLLGARELPHGVDREFLLGY
FT                   QPWQRPVDIASTNITALHTYDFNDAWQSRVSVGHSRSVIDDNVAFAYGCYYATQCADGS
FT                   VPGNYFAPNGDYDVYDYRSPDDTRRNQQARAELRGRFETGSVGHQLTLGADYFRRTVDK
FT                   RPSVNEYVGTSNIHDAQVPVFEPSPKMPGPSARRLDSRQTAFFALDRMSFGDDWQWLAG
FT                   GRFVRLDERAYDKRGTPQRHSRLSRFLPQTAVVWKATDQLNAYASYVRGISLGQEAPFW
FT                   TSNADTFLPSVQSRQLEVGVKYVPVEALTLGAAVFRISQPYQYAKPDSSDVGYTFVEEG
FT                   TQTHTGLELTANGQLTDALQIVASASVLQARARDTGTPAYEGHQLVNVPKVRASVHVAY
FT                   ALPFVQGLDVTGGWRYAGANVARADGGVRAPDYSVFDAGLRFQHRLHERAVTWNLSVDN
FT                   VFNRFYWRDTGSSGGDYYLFPGAPRQARLSVTFAL"
FT   sig_peptide     complement(188334..188402)
FT                   /locus_tag="Smal_0150"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.814 at
FT                   residue 23"
FT   misc_binding    complement(188473..188568)
FT                   /bound_moiety="thiamin/thiaminpyrophosphate"
FT                   /note="TPP riboswitch (THI element) as predicted by Rfam
FT                   (RF00059), score 60.95"
FT   gene            complement(188678..189802)
FT                   /locus_tag="Smal_0151"
FT   CDS_pept        complement(188678..189802)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0151"
FT                   /product="aminoglycoside phosphotransferase"
FT                   /note="PFAM: aminoglycoside phosphotransferase; KEGG:
FT                   xac:XAC3528 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49856"
FT                   /db_xref="GOA:B4SSH4"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:B4SSH4"
FT                   /protein_id="ACF49856.1"
FT                   /translation="MTSSSHRVQGLNNDEVAADWPPISAADLAWLRQRFPQLDADSHPH
FT                   WHSPRPLSAAAIVNGTRGPVFIKRHHHSVRSAACLEEEHHFIAHLAAAGVPVVQVLAAA
FT                   DGHTAVEHGEWTFELHAVGVGEDLYRDAASWSLLTDVAQAREAGRMLAELHRAAASYHA
FT                   PQRSTHLLVARDDLIRADDPIAAIKAGLHERSGLARYLARIPWEAQLQRDVLPWHAGLA
FT                   ERLRDEPRLWAHNDWHVSNLLWRDGQVSTVLDFGLASPTSALFDLATAIERNAVAWLEL
FT                   ERGMEAVRIDIALALIDGYRKVLPLSAARVQLLADLLPMVHFDFALSEVEYFEGITGST
FT                   ANADVAWQPFMLGHPAWFHSAPGQALLQALRAAA"
FT   gene            complement(189932..190339)
FT                   /locus_tag="Smal_0152"
FT   CDS_pept        complement(189932..190339)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0152"
FT                   /product="17 kDa surface antigen"
FT                   /note="PFAM: 17 kDa surface antigen; KEGG: bpt:Bpet0245
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49857"
FT                   /db_xref="GOA:B4SSH5"
FT                   /db_xref="InterPro:IPR008816"
FT                   /db_xref="UniProtKB/TrEMBL:B4SSH5"
FT                   /protein_id="ACF49857.1"
FT                   /translation="MLSTSALSFRGLAMALALVAGVAVVSDASAMSRKDKRTLVGAVVG
FT                   GVAGNLLSNGDPAATVGGAVAGGAIGNLTTSDRRDRRYYDNRRYDDRYDRRYDRGYYRS
FT                   GYYDRGDDRRWQRERYYDNRYYHDRGRHRGW"
FT   sig_peptide     complement(190262..190339)
FT                   /locus_tag="Smal_0152"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.361 at
FT                   residue 26"
FT   gene            complement(190588..192585)
FT                   /locus_tag="Smal_0153"
FT   CDS_pept        complement(190588..192585)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0153"
FT                   /product="Peptidoglycan-binding domain 1 protein"
FT                   /note="PFAM: Peptidoglycan-binding domain 1 protein; KEGG:
FT                   xcv:XCV3751 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49858"
FT                   /db_xref="InterPro:IPR002477"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR036365"
FT                   /db_xref="InterPro:IPR036366"
FT                   /db_xref="UniProtKB/TrEMBL:B4SSH6"
FT                   /protein_id="ACF49858.1"
FT                   /translation="MAQHDYSRKEVLDIVEQVARQKGIPVDDFMRFAHIETGGSFNERA
FT                   HNTSSGAKGLFQFVPGSARQYHLTGHEFDPTRNTEAAAQMYQDNLESMARRNERTGNPY
FT                   LSGGNTPTGLDLYLAHQQGSAGYGSVQTAIATGTFGVVRNGDGEEINMRRNVLNQIGSD
FT                   AKALTGHTLAEMRGMNDGDLARTFSSYYIHKYAAISIPEKNIEPQAVAQGQGQTQTPAA
FT                   PAQASAAVAAGAATLAATATAAATPKPGIELQAAYEAGVKYDDVKYAINIPGHALYVPG
FT                   KTGKNVEQGYIDCSGWVGTLQNRTMDEINQKAGHAVFSKADRIDLGNLGSGGIVRKAFD
FT                   QSGVLLDRDAILKPDALKEGMIIGLDTARTRHEHWNGIDHIVMVVRDPNTDKLLISQST
FT                   GSKGVHTMPVEDYLKQVKDHPNWKLYASDPLSKARDLLENRTPSHEQTQGKPAAEHKAA
FT                   ATPHAELYKQGAHSEGVRKVQEQLGHLGYVGADGKPLVEDGRFGRNTDAAVRQLQKDNG
FT                   LVVDGIVGAKTLEAIKDARERPLLNDERHPRNPLFIQASKGLELLPAGTFKDRHTLESA
FT                   AAALTKEAHAAGLQRIDSVVPSPNGERLFAVQGTIGDPAASRVAVETRAASEQSLALSS
FT                   GAVQGAPNVLHQQQDAQQEQARQAQKAMGV"
FT   gene            complement(192697..193647)
FT                   /locus_tag="Smal_0154"
FT   CDS_pept        complement(192697..193647)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0154"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pfl:PFL_2375 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49859"
FT                   /db_xref="UniProtKB/TrEMBL:B4SSH7"
FT                   /protein_id="ACF49859.1"
FT                   /translation="MHHPPKLRWTLPLPPLRAFAACLLVSLSAAACSAADPAPSSSQPG
FT                   AHAQAANAPRQDVAPMQNTSPDTAVTPPDAPTVMYFTYQQDGDGATSYEVQNGSVATFW
FT                   FGHQFTLDGTTYYTGFSWDTREHYGKPGEQQPAGPDDRANLAEATFVLAGGDAKKPWKF
FT                   RGQEWTIGALGAYDKADDIDTRRKPLEHRTADGRLLLAVPTSSFDRGISGSGYALLLFN
FT                   PKRSEDDVDSKVWRYVGSVRTGEDNSAACDDGNVMPCTDSDGDLAFIADGNGLPQLTVS
FT                   FKGTTIESPGKTRALGAGDAVHYRFDSATQQYLAR"
FT   sig_peptide     complement(193543..193647)
FT                   /locus_tag="Smal_0154"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.769 at
FT                   residue 35"
FT   gene            complement(193846..194484)
FT                   /locus_tag="Smal_0155"
FT   CDS_pept        complement(193846..194484)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0155"
FT                   /product="two component transcriptional regulator, LuxR
FT                   family"
FT                   /note="PFAM: regulatory protein LuxR; response regulator
FT                   receiver; KEGG: pfl:PFL_1107 DNA-binding response
FT                   regulator, LuxR family"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49860"
FT                   /db_xref="GOA:B4SSH8"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:B4SSH8"
FT                   /protein_id="ACF49860.1"
FT                   /translation="MSLRIIIADDHPVVRIGTRAVIESSGVGRVVGEADSAQALMTLLG
FT                   SQPCDLLVTDYSMPGSPQADGFAMIGMIRRRHPDLPVLMLSVSNNLAILRMVLDSGVLG
FT                   LVDKSSSMDELPQAIQAVYRGQPYISRSLRERVEAAGSWRMREGDGKPLSPREVEVLRL
FT                   LGTGMTVKEISLQLHKSVSTISRQKGDAMLKLGLKGDAELFDYLRDGKI"
FT   gene            194560..198159
FT                   /locus_tag="Smal_0156"
FT   CDS_pept        194560..198159
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0156"
FT                   /product="multi-sensor hybrid histidine kinase"
FT                   /note="PFAM: response regulator receiver; ATP-binding
FT                   region ATPase domain protein; histidine kinase A domain
FT                   protein; Hpt domain protein; PAS fold-3 domain protein;
FT                   SMART: extracellular solute-binding protein family 3; KEGG:
FT                   pen:PSEEN3768 two-component sensor/response regulator
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49861"
FT                   /db_xref="GOA:B4SSH9"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR008207"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036641"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B4SSH9"
FT                   /protein_id="ACF49861.1"
FT                   /translation="MRSWAVRGLVLLLAVLVLPAAPVQAVPGLLPLTPLQREYLAAHPS
FT                   IVVGQYDSGWPPFESLRDGQQVGLGPDYLSLLARQLGVKVEARRYPDWTSVLDAACRGE
FT                   IDVVMNVGLSADRTRCMVYTAAYGEAPLALVGRPDDLRASDIPDLDGLRVVIEQDFLTG
FT                   PQVRARFPRARQLVANSSLTALQMVRDDKADVYIGNAYVATELIASQRLQGVVLLRPSD
FT                   LPPEQLHFGIPNSKQPLAEALDLALAATSQAQCDALVQRWLPLPQWSASARLALSQAEK
FT                   RVLEQPLKIGFAPNAAPLSFADKEGKPSGLASEYLRRLLQAGANLQPENSHDWYEVREK
FT                   ARRGELQAVMGIPADSRYLGPDWVFSQPFISVPNVIVSRVDSPALLGLSDLQGKRVLLS
FT                   DPERIRGYVLQQAPSARIIAARSAEQALQRLAAGEADAYVGNLALVDHLLRSSFPGRLQ
FT                   VAAPAGFNDQLVLAVERRHAALATTFDRLLLQMTPRKREALRGDWLAVEYRNGIDWRHA
FT                   LRWGLPLLLVLLTALLVHGIGYWRLRREVAGRRHLEQRLAEVTDNLPAVVYQARRDADG
FT                   TLGFPFIAGDLQALFGITRQQAEQDAKLLLERIEEEDRERILQAVEQAARQFAPLILEF
FT                   RLRADAGGARWVRSQAHPYAAEAGAVTWSGYWVDVSEARAQAEALTAAKAEAEQAAEAK
FT                   SRFLATMSHEIRTPMSGVLGMLEVLAHSPLDAEQQRILGVIEDSAQMLRQILDDILDYS
FT                   RLEAGALRLEPVPQPLRPLLESVCRLLSAQASARGLALLVEIDPQLAPAHEVDGVRLRQ
FT                   IVFNLLSNAIKFTARGEVRLQLEVLGPTAEDGSQPLCLSVTDTGMGIAPEQLQHLFAPF
FT                   TQAGAYIQRDHGGTGLGLSISQRLVQMMDGELTLHSTLGEGTRAEVRLSLVEAGSGDVE
FT                   ALVAEQEQASLLPPALRQARVLVIEDHPTNQAMMAWRLQQLGVPHVMVGDGQQGLDRLL
FT                   SESFDLVITDCRMPVLDGFGFTRLLREREGRNGQPRLTVLALTASVLDDDARRCREAGM
FT                   DEVLAKPLSLATLRAALLRWLPQAQGQSFAEPVTEVVADDGMALPDLSTLQQRFGSRAV
FT                   AIQLRDSLLQASEGDLAAVQRALQAGDREAAALHLHRQAGGLGAIGATVLAGQANALVE
FT                   RLQDAAETDPAPVFASVAEFVARLQQQLQRLAH"
FT   sig_peptide     194560..194637
FT                   /locus_tag="Smal_0156"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 26"
FT   gene            complement(198153..198554)
FT                   /locus_tag="Smal_0157"
FT   CDS_pept        complement(198153..198554)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0157"
FT                   /product="cytochrome c class I"
FT                   /note="PFAM: cytochrome c class I; KEGG: nar:Saro_0817
FT                   cytochrome c, class I"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49862"
FT                   /db_xref="GOA:B4SSI0"
FT                   /db_xref="InterPro:IPR002327"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:B4SSI0"
FT                   /protein_id="ACF49862.1"
FT                   /translation="MRAACLLIAVVVALAATACQRPPPAPATPEQARQQAMQRAFELCA
FT                   GCHTVQPGGIHRFGPNLHGVIGRRAGSLPDYGYSDGMRRADITWSAQTLDAFLQSPTHV
FT                   VPGTRMYNAFPSAERRALVIAYLQQQSPQ"
FT   sig_peptide     complement(198498..198554)
FT                   /locus_tag="Smal_0157"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.920 at
FT                   residue 19"
FT   gene            complement(198620..200296)
FT                   /locus_tag="Smal_0158"
FT   CDS_pept        complement(198620..200296)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0158"
FT                   /product="Electron-transferring-flavoprotein dehydrogenase"
FT                   /EC_number="1.5.5.1"
FT                   /note="PFAM: FAD dependent oxidoreductase; electron
FT                   transfer flavoprotein-ubiquinone oxidoreductase; KEGG:
FT                   rme:Rmet_1146 electron transfer flavoprotein-ubiquinone
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49863"
FT                   /db_xref="GOA:B4SSI1"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR040156"
FT                   /db_xref="UniProtKB/TrEMBL:B4SSI1"
FT                   /protein_id="ACF49863.1"
FT                   /translation="MSAEANALPPREVMEFDVVIVGAGPAGLATAIRLRQRAIEAGREL
FT                   SVCVLEKGSEPGAHVLSGAVMDPRALTELFPDWAERGAPLKQKVTRDEFLFLSETGARS
FT                   TPNALLPECFHNEGNYIISLGEVTRWLAQQAEALEVAIFPGFAAAEVLYGDDGAVIGVA
FT                   TGDMGIEKDGTRGPAFERGMALQAKYTVFAEGARGHLGRQLISRFKLDDGKDPQAYGIG
FT                   IKELWQIDPAKHEPGLVVHAAGWPLDSDTYGGAFLYHADGGKVAIGYVVGLDYKNPWLS
FT                   PFEEFQRFKTHPSIRKHLEGGTRIGYGARAITAGGLMSLPKTVFPGGALVGCEAGFLNV
FT                   SRIKGSHAAIKTGMLCADAAFDALAADRQHDELSAYPQAFEASWLHDELKLSKNFKQWF
FT                   KKGQTVATLMTGIEQWLLPKLGVRNPPWTLRHSIPDHACLEPASRHTRIAYPKPDGVLT
FT                   FDRLSSVFLSSTNHAEDQPSHLTLKDASIPVKVNLAEYAGPEARYCPAGVYEFVGEGND
FT                   ARLQINAQNCVHCKTCDIKDPTQNIVWVTPQGGGGPNYSGM"
FT   gene            200583..201776
FT                   /locus_tag="Smal_0159"
FT   CDS_pept        200583..201776
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0159"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain protein;
FT                   Acyl-CoA dehydrogenase type 2 domain; KEGG: xcb:XC_2809
FT                   glutaryl-CoA dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49864"
FT                   /db_xref="GOA:B4SSI2"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:B4SSI2"
FT                   /protein_id="ACF49864.1"
FT                   /translation="MSGSRLRVSAMALDPYDLFDVRSLLSEEERAVQESVARFTDERVL
FT                   PIIGDAFDQARFPSELVPEIASLGLLGATLPGEYGGGDLGAVSYGLICQELERGDSGLR
FT                   SFVSVQSSLCMYPIYAYGSEEQRRQWLPAMARGELIGCFGLTEAHGGSDPASMKTRAVR
FT                   DGDDWRINGSKMWITSGPVADLAIVWAQTEDGIQGFVLEKGMPGFTTQEIKHKMSLRAS
FT                   LTGALFFDDVRVPDSHRLPNVKGLKGPLGCLTQARFGISWGPIGSAIACLDEALGYAKE
FT                   RVLFGRPLAATQSAQIKLAEMARRITMAQLLALQLGRLKEAGQLQPQQVSLAKWNNCRM
FT                   AIDIARECRDLLGGAGITTEHVAIRHALNLESVITYEGTETVHQLVIGRELTGINAF"
FT   gene            complement(201909..202784)
FT                   /locus_tag="Smal_0160"
FT   CDS_pept        complement(201909..202784)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0160"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: cvi:CV_3289 probable
FT                   transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49865"
FT                   /db_xref="GOA:B4SSI3"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B4SSI3"
FT                   /protein_id="ACF49865.1"
FT                   /translation="MSRLHLDLEVLRSFVTGVELGSFALAAQQLHLSTSAISAQLKRLQ
FT                   AQIGTPLLEKTGRGLTPTAQGEALLSYARRLLELNDEAIQAVRGAPLQGAIRVGLAEDF
FT                   GASLLPGILSRFAQAHPQLRIDARVCRTATLMEALARDTLDLALVWGDDHDWPYSQHLC
FT                   RLPLHWIGSADPAPAGGPVCLATLEAPCLMRQRACDALDHAGLEWRESFSSSSLAAIWA
FT                   AVAAGLGVTVRTAAGMPDHLRIRHDLPTLPAINLLLCWNQARPGTAVQQLAAIIENAVH
FT                   TSVPGMARSA"
FT   gene            202888..203205
FT                   /locus_tag="Smal_0161"
FT   CDS_pept        202888..203205
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0161"
FT                   /product="Carboxymuconolactone decarboxylase"
FT                   /note="PFAM: Carboxymuconolactone decarboxylase; KEGG:
FT                   bur:Bcep18194_B0521 carboxymuconolactone decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49866"
FT                   /db_xref="GOA:B4SSI4"
FT                   /db_xref="InterPro:IPR003779"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="UniProtKB/TrEMBL:B4SSI4"
FT                   /protein_id="ACF49866.1"
FT                   /translation="MQDTPTTLRSLSGVVPKLVDLTEQVLFADVWQRPGLSPRERSLVT
FT                   VAALVALYRPEQLPGHLQRAVGNGLDRDALAEVITHLAFYVGWPAAFSAATVLAALDPS
FT                   P"
FT   gene            203217..203609
FT                   /locus_tag="Smal_0162"
FT   CDS_pept        203217..203609
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0162"
FT                   /product="4-oxalocrotonate tautomerase"
FT                   /note="PFAM: 4-oxalocrotonate tautomerase; KEGG:
FT                   azc:AZC_3698 putative 4-oxalocrotonate tautomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49867"
FT                   /db_xref="InterPro:IPR014347"
FT                   /db_xref="InterPro:IPR037479"
FT                   /db_xref="UniProtKB/TrEMBL:B4SSI5"
FT                   /protein_id="ACF49867.1"
FT                   /translation="MPYARISLHKGRSRDWLAAFSRSLQQSLEEAFDVPPHDCFQVFHQ
FT                   CDPGELVFDPDYAGGPRSEGFVLIHLTAGRVRSAARKQSFYARLVQRLAASPGIRPEDV
FT                   MIVIGTTSEEDWSFSQGRAQLLEAVD"
FT   gene            complement(203656..204135)
FT                   /locus_tag="Smal_0163"
FT   CDS_pept        complement(203656..204135)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0163"
FT                   /product="tRNA/rRNA methyltransferase (SpoU)"
FT                   /note="PFAM: tRNA/rRNA methyltransferase (SpoU); KEGG:
FT                   xcb:XC_0219 tRNA/rRNA methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49868"
FT                   /db_xref="GOA:B4SSI6"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR016914"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:B4SSI6"
FT                   /protein_id="ACF49868.1"
FT                   /translation="MNAAPQFHVILFQPEIPPNTGNVIRLCANTGAQLHLVEPLGFALE
FT                   DKQLKRAGLDYHEYSRLQVHPDLDTALARIAPKRLFALSTRASVRYDSVAFDDGDAFLF
FT                   GPESRGLPQDVLDALPDGHRLRLPMRPDNRSLNLSNTVAVVMYEAWRQHGFAGGQ"
FT   gene            complement(204205..204681)
FT                   /locus_tag="Smal_0164"
FT   CDS_pept        complement(204205..204681)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0164"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xac:XAC0231 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49869"
FT                   /db_xref="UniProtKB/TrEMBL:B4SSI7"
FT                   /protein_id="ACF49869.1"
FT                   /translation="MNAKTIAIAIALIAGTAVVSSVQASESIKTLSTVQVRPAADQLAQ
FT                   QAWEQASGIPTLATVEVRPSSDQLAERNGYVATPVAAAMPITTLASVEVRPSLEQRVAL
FT                   VAEQEAQRYAATLAAAATSVANQVITNLPAMQVRPSAADLQALATETAQVLLRP"
FT   sig_peptide     complement(204607..204681)
FT                   /locus_tag="Smal_0164"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.993 at
FT                   residue 25"
FT   gene            205097..207946
FT                   /locus_tag="Smal_0165"
FT   CDS_pept        205097..207946
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0165"
FT                   /product="peptidase M16 domain protein"
FT                   /note="PFAM: peptidase M16 domain protein; KEGG:
FT                   xcv:XCV0666 putative zinc metalloprotease precursor"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49870"
FT                   /db_xref="GOA:B4SSI8"
FT                   /db_xref="InterPro:IPR007863"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="InterPro:IPR011765"
FT                   /db_xref="UniProtKB/TrEMBL:B4SSI8"
FT                   /protein_id="ACF49870.1"
FT                   /translation="MSLALRPRAALLAVALSTALGTLAPTSALAAKPAAPAKVDIPFEQ
FT                   FTLPNGLRVIVHTDRKAPIVAVNVWYHVGSKDEPAGRTGFAHLFEHLMFQSSENHDGEY
FT                   FEPFKQVGATGQNGTTNTDRTNYFENVPTTALDMALWMESDRMGHLVGAIDQAALDEQR
FT                   GVVQNEKRQGENQPYGQAWDQLNKALYPVGHPYHHGVIGSMNDLNAASLDDVKTWFRTW
FT                   YGPNNAVLVLAGDIDLATAKEKAARYFGSIPAGPSMAQPAVNVAKRSADTRETMTDKVP
FT                   QARIYRAWNVPQVGTTDIDQLQLFAEVLGGAKSSRLSQRLQHQDKLVDSIGSGLSASQL
FT                   GSNFVIVATVKQGQDPAKVEKIIDEELDRLIKQGPTAAELERAKTGARAGFIRGIERIG
FT                   GFGGKADALAECAVFTGDPGCFRTSLANIDKASAADLSRLGAQWLDKGSHTLVIAPGER
FT                   VALKEDPSQAPKPFNVPAVDPKYSTLPEQVDRKAGVPQTREFPQLKFPALQRATLKNGT
FT                   QVILAERHEIPVVQFSYQFPGGFSADQGRKPGTANFTMSLMTEGAGRLGSLAFADAADA
FT                   LGASLDASAGLDSMSVDLSALKENLAPSLALYRDLLREPRFEQGEIDRVKATWIAGIQQ
FT                   EKVNPGAVAMRVLPPLLYGKGHPYAIPFTGSGDEAAINGLTREDLVDFHQDWLRPQNGT
FT                   LIVVGDTTLAEIVPLLDKQLADWKATGEAPQVKAATDVALPKGPRVFLIDQPGAVQANL
FT                   FAGQVVPPSSAASSTRFDIANGVIGGDFTSRLNMNLREDKHWSYGARSSASNSVGQRPW
FT                   MASAPVQIDKTGPALAEMRKEIAAFADGSKPATAGEVNRIRNIQTLSLPGAYETASAVA
FT                   ASIGSIVQFKRPDDYVLRRKAEIEAMTPAQVQQAAAEIKPQALTWVVVGDLKQTEAAVR
FT                   ALNLGEVTVIDAEGNPVKK"
FT   sig_peptide     205097..205189
FT                   /locus_tag="Smal_0165"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.992 at
FT                   residue 31"
FT   gene            208151..208468
FT                   /locus_tag="Smal_0166"
FT   CDS_pept        208151..208468
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0166"
FT                   /product="putative secreted protein"
FT                   /note="KEGG: xcv:XCV0238 putative secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49871"
FT                   /db_xref="InterPro:IPR025294"
FT                   /db_xref="UniProtKB/TrEMBL:B4SSI9"
FT                   /protein_id="ACF49871.1"
FT                   /translation="MRVLLLSSLLLTVTACTWVPIEPAGKTTRVLPAGPVPAGCIAKGE
FT                   VVVTVKSKVGFYNRNPLRVQEELETLARNEAPSAGANAVQAAAAPADGSQRFAAFQCPP
FT                   R"
FT   sig_peptide     208151..208204
FT                   /locus_tag="Smal_0166"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.744) with cleavage site probability 0.479 at
FT                   residue 18"
FT   gene            208572..209588
FT                   /locus_tag="Smal_0167"
FT   CDS_pept        208572..209588
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0167"
FT                   /product="3-Oxoacyl-(acyl-carrier-protein (ACP)) synthase
FT                   III domain protein"
FT                   /note="PFAM: 3-Oxoacyl-[acyl-carrier-protein (ACP)]
FT                   synthase III domain protein; KEGG: xcb:XC_0222
FT                   3-oxoacyl-(acyl carrier protein) synthase III"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49872"
FT                   /db_xref="GOA:B4SSJ0"
FT                   /db_xref="InterPro:IPR013747"
FT                   /db_xref="InterPro:IPR013751"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="UniProtKB/TrEMBL:B4SSJ0"
FT                   /protein_id="ACF49872.1"
FT                   /translation="MLFKNVSIAGLAHVDAPHTLTTKEINERLQPTLDRLGIRTDVLGD
FT                   IAGIHARRLWDNGVLASDAATMAGRKALEDAGINATQVGLLVNTSVSRDYLEPSTASIV
FT                   SGNLGVSDECMTFDVANACLAFINGMDIAARMIERGDIDYALVVDGETANLVYEKTLER
FT                   MTAPDVTADDFRNELAALTTGSGAAAMVMARSELVPDAPRYKGGVTRSATEWNQLCLGN
FT                   LDRMVTDTRLLLIEGIKLAQKTFTAAKIALGWAVEELDQFVIHQVSQPHTAAFIKNFGI
FT                   DPKKVMTIFGEHGNIGPASVPIVLSKLKQLGKLKKGDRIALLGIGSGLNCSMAEVVW"
FT   gene            209705..210595
FT                   /locus_tag="Smal_0168"
FT   CDS_pept        209705..210595
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0168"
FT                   /product="alpha/beta hydrolase fold"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG: xcv:XCV0241
FT                   putative hydrolase of the alpha/beta fold superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49873"
FT                   /db_xref="GOA:B4SSJ1"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR000639"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B4SSJ1"
FT                   /protein_id="ACF49873.1"
FT                   /translation="MSQLPGYPAHPQRFEVRPGLSMNYLDEGPRDGEVVVMVHGNPSWS
FT                   YYWRTLVAGLSDTYRCIVPDHIGMGLSDKPDDSRYEYTLQSRVDDLDALLKHLGITGPV
FT                   TLAVHDWGGMIGFGWALSHHDQVKRLVVLNTAAFPMPAAKKMPWQIALGRHWKIGEWII
FT                   RTFNAFSSGASWLGVERKMPADVRRAYVSPYNSYANRISTIRFMQDIPLSPADKAWSLL
FT                   ERAGKALPSFADRPAFLGWGLRDFVFDHHFLKGFQAALPQAQVHAFEDAGHYVLEDRHE
FT                   VLVPEIRAFLDKNPI"
FT   gene            complement(210711..211136)
FT                   /locus_tag="Smal_0169"
FT   CDS_pept        complement(210711..211136)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0169"
FT                   /product="protein of unknown function UPF0153"
FT                   /note="PFAM: protein of unknown function UPF0153; KEGG:
FT                   xac:XAC0236 ferredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49874"
FT                   /db_xref="InterPro:IPR005358"
FT                   /db_xref="UniProtKB/TrEMBL:B4SSJ2"
FT                   /protein_id="ACF49874.1"
FT                   /translation="MQHPCMTCGACCTQYRVAFHWMESDEVTPGGVPHQLTEVLDPHRL
FT                   CMRGTHSKPVRCVALDAQIGVYSRCTIHPNRPSVCREVDASWEYGKASPQCDKARIAYG
FT                   LDPLTLADWRWRDEAGNDDDHPDDNGNSPSPQAPIAA"
FT   gene            211241..212899
FT                   /locus_tag="Smal_0170"
FT   CDS_pept        211241..212899
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0170"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /note="PFAM: AMP-dependent synthetase and ligase; KEGG:
FT                   xcb:XC_0228 peptide synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49875"
FT                   /db_xref="GOA:B4SSJ3"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:B4SSJ3"
FT                   /protein_id="ACF49875.1"
FT                   /translation="MNRPCNIAARLPELARERPDQIAIRCPGRRGAGNGMAAYDVTLDY
FT                   RQLDARSDAMAAGLAGYGIGRGVRTVVMVRPSPEFFLLMFALFKLGAVPVLVDPGIDKR
FT                   ALKQCLDEAQPEAFIGIPLAHVARLVLRWAPSATRLVTVGRRLGWGGTTLAALERAGAN
FT                   GGPMLAATDGEDMAAILFTSGSTGVPKGVVYRHRHFVGQIQLLGSAFGMEAGGVDLPTF
FT                   PPFALFDPALGLTSVIPDMDPTRPAQADPARLHDAIQRFGVTQLFGSPALMRVLARHGR
FT                   PLPTVTRVTSAGAPVPPDVVATIRSLLPADAQFWTPYGATECLPVAVVEGRELERTRAA
FT                   TEAGAGTCVGSVVEPNEVRIIAIDDAPLPDWSQARVLFTGEVGEITVAGPTATDSYFNR
FT                   PQATAAAKISETLADGSVRVVHRMGDVGYFDAQGRLWFCGRKTHRVETAHGPLYTEQVE
FT                   PVFNTVPGVARTALVGVGPAGAQVPVLCVELQRGQSDSPALQEALRAHAAARAPEAGLQ
FT                   HFLVHPAFPVDIRHNAKIGREKLAVWASTELEKRA"
FT   gene            212896..213888
FT                   /locus_tag="Smal_0171"
FT   CDS_pept        212896..213888
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0171"
FT                   /product="3-beta hydroxysteroid dehydrogenase/isomerase"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase;
FT                   short-chain dehydrogenase/reductase SDR; 3-beta
FT                   hydroxysteroid dehydrogenase/isomerase; polysaccharide
FT                   biosynthesis protein CapD; dTDP-4-dehydrorhamnose
FT                   reductase; NmrA family protein; Male sterility domain;
FT                   KEGG: xcb:XC_0229 NAD(P)H steroid dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49876"
FT                   /db_xref="GOA:B4SSJ4"
FT                   /db_xref="InterPro:IPR002225"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B4SSJ4"
FT                   /protein_id="ACF49876.1"
FT                   /translation="MKILVTGGGGFLGQALCRGLVERGHQVLAFNRSHYPELQAMGVGQ
FT                   IRGDLADAQAVLHAVAGVDAVFHNGAKAGAWGSYDSYHQANVVGTDNVIAACRAHDISR
FT                   LVYTSTPSVTHRATHPVEGLGADDVPYGEDFQAPYAATKAIAEQRVLAANDATLATVAL
FT                   RPRLIWGPGDQQLVPRLAERARQGRLRLVGDGNNKVDTTYIDNAALAHFLALDALAPGA
FT                   ACAGRAYFISNGEPLPMRELVNKLLAAVGAPTVDKAISFKTAYRIGAVCERLWPLLRLR
FT                   GEPPLTRFLAEQLCTPHWYSMEPARRDFGYVPQVSIEEGLRRLKASSAA"
FT   gene            213971..214126
FT                   /locus_tag="Smal_0172"
FT   CDS_pept        213971..214126
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0172"
FT                   /product="protein of unknown function DUF1328"
FT                   /note="PFAM: protein of unknown function DUF1328; KEGG:
FT                   xac:XAC0239 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49877"
FT                   /db_xref="GOA:B4SSJ5"
FT                   /db_xref="InterPro:IPR009760"
FT                   /db_xref="UniProtKB/TrEMBL:B4SSJ5"
FT                   /protein_id="ACF49877.1"
FT                   /translation="MLHYAVIFFVIAIIAAVLGFSGIAGAASNIAWILFVVFLVLAVIS
FT                   MFRKRG"
FT   sig_peptide     213971..214051
FT                   /locus_tag="Smal_0172"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.996 at
FT                   residue 27"
FT   gene            complement(214313..215407)
FT                   /locus_tag="Smal_0173"
FT   CDS_pept        complement(214313..215407)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0173"
FT                   /product="D-alanine/D-alanine ligase"
FT                   /EC_number="6.3.2.4"
FT                   /note="KEGG: xom:XOO_0324 D-alanyl-alanine synthetase A;
FT                   TIGRFAM: D-alanine/D-alanine ligase; PFAM: ATP-dependent
FT                   carboxylate-amine ligase domain protein ATP-grasp;
FT                   D-alanine--D-alanine ligase domain protein; RimK domain
FT                   protein ATP-grasp"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49878"
FT                   /db_xref="GOA:B4SSJ6"
FT                   /db_xref="InterPro:IPR000291"
FT                   /db_xref="InterPro:IPR005905"
FT                   /db_xref="InterPro:IPR011095"
FT                   /db_xref="InterPro:IPR011127"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:B4SSJ6"
FT                   /protein_id="ACF49878.1"
FT                   /translation="MARTRVGIIFGGKSSEHEVSLQSAKNILDALNRERFEPVLVGIDK
FT                   QGQWHLSQPDTFLINADDPSRIALHRSGTSLAVRPGAEQSQLQPSDAASALGQIDVVLP
FT                   IVHGPLGEDGALQGLLRMANLPFVGSPVLGSAVAMDKDVTKRLLRDAGLKVAPWLCIRR
FT                   HQAAAVDVDAVIAQLGLPLFVKPANQGSSVGVSKVKDAAGFAGALELALRYDHKVLVES
FT                   AVVGREIECAVLGNTLPQASLCGEVVVHDEFYAYDTKYINEDGAEVVVPADIDADTQAR
FT                   IQQIALQAYQALECAGMARVDVFLTADGEIVINEVNTLPGFTRISMYPKLWGASGVDYT
FT                   TLITRLIELALERHAADRGLHSAV"
FT   gene            215958..216593
FT                   /locus_tag="Smal_0174"
FT   CDS_pept        215958..216593
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0174"
FT                   /product="Sterol-binding domain protein"
FT                   /note="PFAM: Sterol-binding domain protein; KEGG:
FT                   xcv:XCV0247 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49879"
FT                   /db_xref="GOA:B4SSJ7"
FT                   /db_xref="InterPro:IPR003033"
FT                   /db_xref="InterPro:IPR038989"
FT                   /db_xref="UniProtKB/TrEMBL:B4SSJ7"
FT                   /protein_id="ACF49879.1"
FT                   /translation="MALSLLKSLKPVAGRALQIALNRALALDPDTRHALASLDGRHIDL
FT                   TLEAPSLAMRISVDGDQLRVGPVDAQEADLAVRSSLAGVLAQLPLLANARRGDNNGKGR
FT                   VRVAGDAELARRLQQLAKGFDPDWQQPFVSVFGEVLGVQVANTLRGALQHARQGAIDLA
FT                   HSAAEFITEESRDVVPRAELDAFHDDVDVLRDDVERLGARVQRLRGAA"
FT   gene            216590..218245
FT                   /locus_tag="Smal_0175"
FT   CDS_pept        216590..218245
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0175"
FT                   /product="2-polyprenylphenol 6-hydroxylase"
FT                   /note="TIGRFAM: 2-polyprenylphenol 6-hydroxylase; PFAM:
FT                   ABC-1 domain protein; KEGG: xcv:XCV0248 putative ubiquinone
FT                   biosynthesis protein UbiB"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49880"
FT                   /db_xref="GOA:B4SSJ8"
FT                   /db_xref="InterPro:IPR004147"
FT                   /db_xref="InterPro:IPR010232"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:B4SSJ8"
FT                   /protein_id="ACF49880.1"
FT                   /translation="MKAVLRASRIGRVILRYRLDDLLQGTPAERWLRLAKPFVPRASAD
FT                   IAAQSRGARLRLALQDLGPIFVKFGQILSTRRDLVPPDVANELTLLQDRVKPFDGETAR
FT                   RIVEEALGLPVSEAFASFDTEPLASASIAQVHAATLADGRQVVVKVLRPGIEKQIDADI
FT                   ALLNSLAALVERTHPRADKIRPREVVAEVENTLAAELDLQREGANASVLRRFWENSDDL
FT                   YVPEVIWSHTAERALTLERVWGIPSDDIAALDKAGIDRKALAAKGVRVFYTQVFRDNFF
FT                   HADAHAGNIWVDTDPARRANPRFIALDFGIMGQLSQEDQYYLAENFMAIFNRDYRRIAE
FT                   LHVQARWMPDNVRIDDLEAAVRSVCEPYFTRPLSQISLAEVLMKLFRVAQRYQLTLQPQ
FT                   LILLQKTLLNIEGVGRQLDPQIDIWAVAKPVLAKILRERYSPRRVVREIGKRLPEIMTH
FT                   APDMPRLVHAWLTQQVEGRHELAMRSRDLAALDASVQRLQKHAVGAITGVGLLAIAALM
FT                   YVLQPPGWYWGDVPAWSWLSGAVGVVALLRAWWK"
FT   gene            218251..218829
FT                   /locus_tag="Smal_0176"
FT   CDS_pept        218251..218829
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0176"
FT                   /product="O-methyltransferase family 3"
FT                   /note="PFAM: O-methyltransferase family 3; KEGG:
FT                   xac:XAC2121 O-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49881"
FT                   /db_xref="GOA:B4SSJ9"
FT                   /db_xref="InterPro:IPR002935"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B4SSJ9"
FT                   /protein_id="ACF49881.1"
FT                   /translation="MLQALKDELVRFGADNDARESERGRRMLNITPDTGEFLSVLVRFG
FT                   TARRVLEIGTSNGYSTLWLAEAAAAIDGHVTTLEYAEDKVAMARDTFARSGLADRITLV
FT                   HGDAGLWLAQAADACIDLLFLDSDRGQYAGWWPQLRRVLRPGGLLVVDNATSHAGQMEP
FT                   LRALLDADEDFSTSLVPVGNGELLAVRNA"
FT   gene            218937..219698
FT                   /locus_tag="Smal_0177"
FT   CDS_pept        218937..219698
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0177"
FT                   /product="pseudouridine synthase"
FT                   /note="PFAM: pseudouridine synthase; KEGG: xcv:XCV0250
FT                   pseudouridylate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49882"
FT                   /db_xref="GOA:B4SSK0"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR006224"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/TrEMBL:B4SSK0"
FT                   /protein_id="ACF49882.1"
FT                   /translation="MPSPDNPAVSTEPDTLAAVETDTAPLQLLHLDERLAVVNKPAGLM
FT                   VHDSKLARGEDDFLADRLREQLGRPIFLVHRLDRATSGCLLLAFDRDTASLLGKALMGG
FT                   EVLKDYLTVCRGWPAELSWRVDHDLDGGPGKPVKKPAVTDFQRLATGELSVPIGEFTSS
FT                   RYALLRCQPQTGRFRQIRRHLKHLSHHMIGDTSHGDGRHNRIFRMQGVHRMLLHAERLR
FT                   FPHPDGGTVDVRAPLDGGFQKALDLFGWQVD"
FT   gene            complement(219783..220310)
FT                   /locus_tag="Smal_0178"
FT   CDS_pept        complement(219783..220310)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0178"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xom:XOO_0319 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49883"
FT                   /db_xref="InterPro:IPR018637"
FT                   /db_xref="UniProtKB/TrEMBL:B4SSK1"
FT                   /protein_id="ACF49883.1"
FT                   /translation="MTRTAPALPSLLRRLALLLALAVASTPALAAPPTDGDINRLLSAS
FT                   RAQSMIDTMLPQIEAMQQQQFQQVAAQRQLNAQQQEQLKRIQARTSQTLRQALSWQQLR
FT                   PMYVDLYKKTFSKEDVLAMAEFYESAAGQSLLDKTPALMQNVMVAIQARMQPLFADLQK
FT                   DLEAIVNEPEKK"
FT   sig_peptide     complement(220218..220310)
FT                   /locus_tag="Smal_0178"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 31"
FT   gene            220445..220876
FT                   /locus_tag="Smal_0179"
FT   CDS_pept        220445..220876
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0179"
FT                   /product="Class I peptide chain release factor"
FT                   /note="PFAM: Class I peptide chain release factor; KEGG:
FT                   xcb:XC_0237 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49884"
FT                   /db_xref="GOA:B4SSK2"
FT                   /db_xref="InterPro:IPR000352"
FT                   /db_xref="UniProtKB/TrEMBL:B4SSK2"
FT                   /protein_id="ACF49884.1"
FT                   /translation="MGSGPVTISAQLEIPDGEIVERFVRASGAGGQNVNKVSTAVELRF
FT                   DVAGSPSLPEPLRERLLARRDRRMTGEGVLVIDAQRFRTQDRNREDARDRLAAFIQAGL
FT                   HVPKPRKATKPTLGSKLRRLDAKRGRAQVKRGRSSRDWE"
FT   gene            220881..221483
FT                   /locus_tag="Smal_0180"
FT   CDS_pept        220881..221483
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0180"
FT                   /product="phospholipid/glycerol acyltransferase"
FT                   /note="PFAM: phospholipid/glycerol acyltransferase; KEGG:
FT                   xcv:XCV0253 putative acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49885"
FT                   /db_xref="GOA:B4SSK3"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="UniProtKB/TrEMBL:B4SSK3"
FT                   /protein_id="ACF49885.1"
FT                   /translation="MNNPTPLLPAIPPNMPQVKPNRFLRWLARCTLRMGGWKVTGTLPD
FT                   IPKLVFIIAPHSSNWDGLWGMAAKIALGMKVKVLGKASLFWWPLGPLLHKLGVIPLDRS
FT                   SPQGTVGQAVDLLRNNEKMWFAITPEGTRKAVKDWKAGFLKIARMADVPVLAAYFHYPE
FT                   KIIGIGPVFHPSGDDAADMAAIREFYRPWIGKTRGTV"
FT   gene            221595..223751
FT                   /locus_tag="Smal_0181"
FT   CDS_pept        221595..223751
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0181"
FT                   /product="Peptidyl-dipeptidase Dcp"
FT                   /EC_number="3.4.15.5"
FT                   /note="PFAM: peptidase M3A and M3B thimet/oligopeptidase F;
FT                   KEGG: xoo:XOO0344 peptidyl-dipeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49886"
FT                   /db_xref="GOA:B4SSK4"
FT                   /db_xref="InterPro:IPR001567"
FT                   /db_xref="InterPro:IPR024077"
FT                   /db_xref="UniProtKB/TrEMBL:B4SSK4"
FT                   /protein_id="ACF49886.1"
FT                   /translation="MSRTVVLAAAISLALAACSGKESTPVSDAQKAPAQQPAEASTNPL
FT                   LSASTLPFQAPQFDKIKDSDYLPAFEEGMRQHLADVRKIADNPEPATFDNTLVAMERSG
FT                   ETLNRVSRIFFGLVQADGTEARQKIQEDIAPKLAAHQDEINLDPKLFARVKSLYDQRDT
FT                   LELDPVQKRLVEHYYDGLVRAGAQLSDADKASLRKLNVEETTLSTQFHTRLVAATAAAA
FT                   VVVDDKAKLAGLDDNAINNAASAAKDRKLDGKFLLPLQNTTQQPVLGSLTDRDQRAAVL
FT                   KASETRAERGDANDTRQTVQRLAQLRAQKAKLLGFDTFADYQLGDQMAKTPAAALKLLT
FT                   DTVPAATVKARAEAGEIQKVIDAQKGGFQVAASDWDFYAEQVRKAKYDLDESQIKPYFE
FT                   LDNVLQNGVFYAATQLYGITFKPRTDIPTYNPDMKVYEVFDKDGTSLALFYTDYFKRDT
FT                   KSGGAWMDVFVEQDGLTGAKPVVYNVCNFTKPADGQPALISFDDVTTMFHEFGHALHGM
FT                   FSNVKYPSIAGTATSRDFVEFPSQFNEHWALDPKVFANYAKHYKTGEAMPQELVDKILK
FT                   ARSFNQGYATTEYLSAALLDLAWHTQKADAPLQDVGAFEASALKKFKVDLPQVPPRYRT
FT                   TYFDHIWGGGYSAGYYAYFWAEVLDHDAYQWFTEHGGLTAANGQEFRDKILSRGNSVEL
FT                   STLYRDFRGKDPSVEPLLKFRGLK"
FT   sig_peptide     221595..221657
FT                   /locus_tag="Smal_0181"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.619 at
FT                   residue 21"
FT   gene            complement(223900..224346)
FT                   /locus_tag="Smal_0182"
FT   CDS_pept        complement(223900..224346)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0182"
FT                   /product="3-dehydroquinate dehydratase"
FT                   /note="KEGG: xcb:XC_4173 3-dehydroquinate dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49887"
FT                   /db_xref="GOA:B4SSK5"
FT                   /db_xref="InterPro:IPR036441"
FT                   /db_xref="UniProtKB/TrEMBL:B4SSK5"
FT                   /protein_id="ACF49887.1"
FT                   /translation="MSIFIIRGPEAAGALIRTAMPLPAPVLKSLVHRAIDAGTSVAIRA
FT                   CGSEQELLDALRVADHSRGEVTLLDPGACANSLRLQRLLPYLHNAYVEVHDDGAVAEPC
FT                   LPAGVGQRLGIAAGYGAQSYVLALDIALDHLGLAEQANRVHVGT"
FT   gene            complement(224350..224751)
FT                   /locus_tag="Smal_0183"
FT   CDS_pept        complement(224350..224751)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0183"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xom:XOO_0298 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49888"
FT                   /db_xref="UniProtKB/TrEMBL:B4SSK6"
FT                   /protein_id="ACF49888.1"
FT                   /translation="MTLLVIRHASSSAPRPQLPAQLSGHRVLCSDCASLSEVRQCLCQP
FT                   QARSADWVLLDVGAADEAQWQAEGGALQAALERLPAQYIELQAPTEPGLEARLRLQHGP
FT                   AAVVVDQRSQQAGYPLSLAIVSRRLAQEG"
FT   gene            225002..225628
FT                   /locus_tag="Smal_0184"
FT   CDS_pept        225002..225628
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0184"
FT                   /product="signal peptidase I"
FT                   /note="TIGRFAM: signal peptidase I; PFAM: peptidase S24 and
FT                   S26 domain protein; KEGG: swd:Swoo_0360 signal peptidase I"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49889"
FT                   /db_xref="GOA:B4SSK7"
FT                   /db_xref="InterPro:IPR000223"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR019756"
FT                   /db_xref="InterPro:IPR019758"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="UniProtKB/TrEMBL:B4SSK7"
FT                   /protein_id="ACF49889.1"
FT                   /translation="MDAVARPPFSERALVWLKKEALPLLVMLGLLAAARDTLANHYVVP
FT                   SGSMQPTLQPGDRVVVDMRAYGLRLPFTGKELMATGTPQRGEVAVFDSPADGTRLIKRV
FT                   AAVAGDHVQLREGHLSINGQPLQIADLQDVEAFGDRHASLDLDMGGGPDIADLVVPDGK
FT                   VLVLGDHRGNSFDGRFFGFVDADKVYGRAVAVYYRRGAGFEWQRL"
FT   gene            225686..227008
FT                   /locus_tag="Smal_0185"
FT   CDS_pept        225686..227008
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0185"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   mrd:Mrad2831_5565 major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49890"
FT                   /db_xref="GOA:B4SSK8"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B4SSK8"
FT                   /protein_id="ACF49890.1"
FT                   /translation="MDGPSLGPVPSHARPPHRPIDPMTGETVVAVEGRPSTVDSIAETR
FT                   IQQGTPAFRRTALALFLAGFSTFGLLYTVQPLLPEFSRHFGVSAAGSAMSLSLTTGTLA
FT                   VAMLLAGLLSDAVGRRPMMIVALLASATLSLCTALVDDWTTLLVLRTLLGLALSGVPAV
FT                   AMTYLVEEMDSRALGLAMGLYIGGNAIGGMSGRLLAGIIADHWGWRWGIGVVSIIAIAS
FT                   TVLLWLQLPPSRHFHPRRDGLRQLPSRWRTLFADPGLPWLFATSFVLMGVFVTLYNYLG
FT                   YHLLAPPYHLSQTVVGLIFSVYLVGTFSSAWMGQQATRYGRGRILSISFALIGAGIVLL
FT                   AMPWLSAMALGIALVTFGFFGGHSVASSWVGSRAGAMRAEASALYLFAYYLGSSVLGAV
FT                   GGLAYAAWDWLGVCVFAAVLTLIGGGIVWALQQRAQQPLTA"
FT   gene            complement(227092..228000)
FT                   /locus_tag="Smal_0186"
FT   CDS_pept        complement(227092..228000)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0186"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: psa:PST_0564 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49891"
FT                   /db_xref="GOA:B4SSK9"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B4SSK9"
FT                   /protein_id="ACF49891.1"
FT                   /translation="MSIELRHLRYFLAVADTLHFGQAAERLGMSQPPLSQQIRQLEDLI
FT                   GARLFVRSHRRVQLTAAGELLQERARAIVLQVESAVDEVQRAQRGEQGELRIGLTRATP
FT                   LSPQIPRSILQYRQRYPQVRLQLSEMNTLQQIDALLDGSLDVGIIRKRALPPELVAHSL
FT                   FVDPLALIVHADHPALRRLSKQGTLSLRDFAQEPFVAFRRSAGAGIHDHMIALCAAAGF
FT                   TPRIVQEAGEASTLISLAAAGLGAAILPSSCDHIRVEGARFVALADAGAHSEVQLAWHR
FT                   EGVTPLIRNFAGLLREAFAEG"
FT   gene            complement(228277..229245)
FT                   /locus_tag="Smal_0187"
FT   CDS_pept        complement(228277..229245)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0187"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: xac:XAC0255 transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49892"
FT                   /db_xref="GOA:B4SSL0"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B4SSL0"
FT                   /protein_id="ACF49892.1"
FT                   /translation="MTTRPPPSPRFSYKSDRLKPLRAFCQTVRLGSVSRAAEALFVSQP
FT                   AISLQLQALERELGVPLFERSGRRLVPSREGQLLYEMAQPLVENLDGLEARFRDKVRGL
FT                   DAGELNIAANSSTILYLLPKIVERFRLHHPDVRLTLHNAISADGTDLLREDAADLAIGS
FT                   MTDVPADLSYAPAYRFEQVLIAPHDHPLASGGELELADIARYPLVLPPKRQITYRLVDQ
FT                   VFQRHRIAYTVALEVGGWEVIKQYVAMGMGISIVPALCLNEADRERLAARSMKRWFPER
FT                   SYGVIVRRGKALSAQARAFIELIQPELFSPRDYDQSGHSER"
FT   gene            229356..230993
FT                   /locus_tag="Smal_0188"
FT   CDS_pept        229356..230993
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0188"
FT                   /product="malate synthase A"
FT                   /EC_number="2.3.3.9"
FT                   /note="KEGG: xcb:XC_0247 malate synthase; TIGRFAM: malate
FT                   synthase A; PFAM: malate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49893"
FT                   /db_xref="GOA:B4SSL1"
FT                   /db_xref="InterPro:IPR001465"
FT                   /db_xref="InterPro:IPR006252"
FT                   /db_xref="InterPro:IPR011076"
FT                   /db_xref="UniProtKB/TrEMBL:B4SSL1"
FT                   /protein_id="ACF49893.1"
FT                   /translation="MPAVASAVPTPAAKATPGIALATRVAGQDTLLPAPLLALLVSLHR
FT                   AVEPGRQARLQARRVRQAFFDQGGLPDFREDTTAIRSGDWRVAPLPAALQDRRVEITGP
FT                   TDPKMVINALNSGAKVFMADFEDSTSPTWRNLLAGQQSLAAAVRGDLEYTAPASNGKAG
FT                   KHYTLRPFDEQAVLIVRPRGWHLDEKHVRIDGQFIAGGLFDAAVFAFHNARTLQAKDRG
FT                   PYFYLPKLQSMEEAALWETALSHIEGMLGLPHGQIKVTVLIETLPAVFEMDEILHALRD
FT                   RIVGLNCGRWDYIFSYLKTFRRHADRVLPERGQVTMTQPFLKAYSELLIQTCHRRGAHA
FT                   MGGMAAQIPINNDAAANEQAMARVRADKLREVTAGHDGTWVAHPALIPVAMAIFDEHMP
FT                   GANQHSVLRQDVRVGRDELIARPPGTITRAGFEGNVEVCVRYLAAWLDGNGCVPIHHLM
FT                   EDAATAEISRSQLWQWLHTPGQQLDDGTAIDLALLDSTLSQLPARLGDTAALPGGTHIG
FT                   EAIALLGELSRSDELTDFLTLPAYARID"
FT   gene            231058..232359
FT                   /locus_tag="Smal_0189"
FT   CDS_pept        231058..232359
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0189"
FT                   /product="isocitrate lyase"
FT                   /note="TIGRFAM: isocitrate lyase; PFAM: isocitrate lyase
FT                   and phosphorylmutase; KEGG: xcv:XCV0265 isocitrate lyase"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49894"
FT                   /db_xref="GOA:B4SSL2"
FT                   /db_xref="InterPro:IPR006254"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018523"
FT                   /db_xref="InterPro:IPR039556"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:B4SSL2"
FT                   /protein_id="ACF49894.1"
FT                   /translation="MSKLPTAEQIQHDWDTNPRWEGIQRNYSAADVVRLRGTVHIEHSL
FT                   ARLGAEKLWASLHEREFVNALGALTGNQAMQQVKAGLKAIYLSGWQVAADANLAGQMYP
FT                   DQSLYPADSVPAVVKRINNTLLRADQLHHAEGKDDIDFLQPIVADAEAGFGGVLNAFEL
FT                   MKAMIEAGAAGVHFEDQLASVKKCGHMGGKVLVPTREAIEKLNAARLAADVLGVPTLLV
FT                   ARTDAEAADLLTSDIDGNDKPFATGERTVEGFYKTRNGLDQAISRGLAYAPYADLVWCE
FT                   TGKPDLEFARKFAEAIHAKFPGKLLAYNCSPSFNWKKNLDDATIAKFQKELGSYGYKFQ
FT                   FITLAGFHALNYGMFNLAHGYARRQMSAFVELQEAEFEAAERGFTAVKHQREVGTGYFD
FT                   AVTQAIQQGQSSTTALTGSTEEEQFHGGRSERAA"
FT   gene            232779..233819
FT                   /locus_tag="Smal_0190"
FT   CDS_pept        232779..233819
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0190"
FT                   /product="cyclic nucleotide-binding protein"
FT                   /note="TIGRFAM: diguanylate cyclase; PFAM: GGDEF domain
FT                   containing protein; cyclic nucleotide-binding; KEGG:
FT                   xcv:XCV0266 putative cyclic nucleotide-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49895"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018488"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:B4SSL3"
FT                   /protein_id="ACF49895.1"
FT                   /translation="MTGRGAAENSDVTSGIARVAMAEIVHALLSDAEVALFARFARACK
FT                   LHAGQWLFQRGHRGERMYVILEGRIELDFGEDLVIKTLGQHEFFGELGLLVGDHPRSAS
FT                   ARALVDCEVLELGPTDFHRLVESDPGLVAYFLRRTIMRVLTNEQALISQLRRRNHDLET
FT                   ALDNLYITTHQLTHTRELVRTDELTGLHNRRGLTLYLQECRAEAEGLPQALLLIDCDRF
FT                   KQINDRHGHQAGDRVLQSMGNILRSMAGEQDLACRLGGDEFCLILRRGNHEIVQHAAEF
FT                   ILSAVHGLLERSNGTPHVSLVSIGASLLPTESGWSEWYANADRALYQAKRDGGNCLRWA
FT                   DAADIP"
FT   gene            233836..236340
FT                   /locus_tag="Smal_0191"
FT   CDS_pept        233836..236340
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0191"
FT                   /product="Tetratricopeptide TPR_4"
FT                   /note="PFAM: Tetratricopeptide TPR_4; SMART:
FT                   Tetratricopeptide domain protein; KEGG: xcb:XC_0250
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49896"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR030966"
FT                   /db_xref="UniProtKB/TrEMBL:B4SSL4"
FT                   /protein_id="ACF49896.1"
FT                   /translation="MNGDNGTSTPHNQQLRALLFTDLCDSLLLVERIGDVAAAELFQEH
FT                   DRLVLALQQRWHGQLIDRSDGLFMLFERPIDALGFALDYQRGLQPLGQARDLRLQARAG
FT                   LHVGEVILWNNSSESIALGAKAVEVEGLAKPMAARLMQLAPPGQLLMSAAAESVVRRAA
FT                   TELGELGGRLQWRSFGRWRFRGVAQPMEVLGVAVAGKGMLSRPRASDKARPDVPVWRRP
FT                   LAMAAQAALIVSVGLGLWLLARPQPAIAFAERDWVVMADARNLTDNPVLDDALNQALRI
FT                   GLEQSRYVNVISDVKARDTMARMLMPENTEIDRTAAVQIAMRDGARAVLDPSIREVHGQ
FT                   LRVAVDVVNPATGETVYSVYSDGKGLPSALTSSDQVVVQLRSRLGEAMAQIGKTSAPLP
FT                   QVATANLDALHAYARGQLAYGRGQTESSLKFFQIATRIDPDFAMAYVGQMRSMFSQGQL
FT                   EDARGLLTKVRTLRHRLSTREGLYLDAWQVELESGSESAAGEAWKVLADLYPDHHGASV
FT                   NHGLAEFVLGHYEKAEQAVAHANVEQNPLRSVTLELLGRIQLARGKVDEAVATLHRAMQ
FT                   LAEGRPNRQLVAALAVSGRNAEASAVLARLPENGPGRWLEGTSLAIDEGRFEEALAASV
FT                   ASAGRCNGGPFACDLLGTVNLAVHAAAARCVAPRDFATQASALLRNAARPDNGERGQYL
FT                   YFAAASLYAAQRLGLQSSIGRQVAELDVLAADAVDPRARQLAAVVKANALHLSGDSAQA
FT                   IKMLQAMVDGSELFQVHSVLAAAYAAQGAIQEQQSQLDWMRRHRGRAYTEFAGSSVLQA
FT                   LNVGDSQRGPSRPGCALSPDAS"
FT   gene            complement(236357..236647)
FT                   /locus_tag="Smal_0192"
FT   CDS_pept        complement(236357..236647)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0192"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: xac:XAC0260 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49897"
FT                   /db_xref="InterPro:IPR030976"
FT                   /db_xref="UniProtKB/TrEMBL:B4SSL5"
FT                   /protein_id="ACF49897.1"
FT                   /translation="MTNRKSPLSLADATTLLDLLTTDADFRTAFKQDPATALQQISVEA
FT                   GAAAQGCMLSADLASNEDLAAARDNLVQQLTERAVFSHPHCFIDGSQAPTP"
FT   gene            236812..237990
FT                   /locus_tag="Smal_0193"
FT   CDS_pept        236812..237990
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0193"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xcv:XCV0269 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49898"
FT                   /db_xref="GOA:B4SSL6"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR020051"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="InterPro:IPR030965"
FT                   /db_xref="UniProtKB/TrEMBL:B4SSL6"
FT                   /protein_id="ACF49898.1"
FT                   /translation="MTSSRYRRCHALAVVPDEQPSFSLNSLLAGGTGVEFVQQLQVRAA
FT                   HLDQPVTLDADACALLLQTSAERWQVLPDDLQNRARVASLLEAGLLIAEEGAPEAARQA
FT                   DQRVRDGHWWALSAIHHRHSRWAGVDSAGDMEKHRMVTAQDLVQQLGKPPTEAPERQPG
FT                   AIALPVAAPDAVAQLLAARTTCRNYAEDKPLSLEMLAGMMQHVLMAQAQVETEPGVRFL
FT                   KKNVPSAGSLHPLEAYVIARKVDGLQPGLYHYHAVAHELARQQAQPAQLDDFCLRLLSG
FT                   QHWFASAHAMVVLVCRFGRNFWKYRNHAKAYRAVSLDVGHVSQALYTAATANGLGGFVT
FT                   AAINETEIESLLGFDPMVDGAMAVCGFGWRAQSMTTAELDPAGHVWKREARD"
FT   gene            complement(238039..238380)
FT                   /locus_tag="Smal_0194"
FT   CDS_pept        complement(238039..238380)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0194"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xcb:XC_0251 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49899"
FT                   /db_xref="InterPro:IPR030976"
FT                   /db_xref="UniProtKB/TrEMBL:B4SSL7"
FT                   /protein_id="ACF49899.1"
FT                   /translation="MLPFTRAPFSSEHTTTESPRFEPQTAIALLDRLCSDDVFRAQFSR
FT                   NPLPACRQIGLAFDSMAQVPPCLSTGKLASKEELSQARDALVNYLSSHRAAMTVVFTFE
FT                   AGHVHRIIQ"
FT   gene            complement(238413..238727)
FT                   /locus_tag="Smal_0195"
FT   CDS_pept        complement(238413..238727)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0195"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xcb:XC_0251 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49900"
FT                   /db_xref="InterPro:IPR030976"
FT                   /db_xref="UniProtKB/TrEMBL:B4SSL8"
FT                   /protein_id="ACF49900.1"
FT                   /translation="MSAKSPMTTVNAGRLLDLLCSDDAFRAEFTADAGAAMARHGLQAH
FT                   SGTSPCAIHNVLASKEEFQQVRQQIAALLAQRAAFNVPFMFESGHLQGSVHHSAVPQAA
FT                   "
FT   gene            complement(239128..241110)
FT                   /locus_tag="Smal_0196"
FT   CDS_pept        complement(239128..241110)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0196"
FT                   /product="Carbamoyl-phosphate synthase L chain ATP-binding"
FT                   /note="PFAM: biotin/lipoyl attachment domain-containing
FT                   protein; phosphoribosylglycinamide synthetase;
FT                   ATP-dependent carboxylate-amine ligase domain protein
FT                   ATP-grasp; Carbamoyl-phosphate synthase L chain
FT                   ATP-binding; Carbamoyl-phosphate synthetase large chain
FT                   domain protein; biotin carboxylase domain protein; KEGG:
FT                   xcv:XCV0271 biotin carboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49901"
FT                   /db_xref="GOA:B4SSL9"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001882"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005481"
FT                   /db_xref="InterPro:IPR005482"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR011764"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:B4SSL9"
FT                   /protein_id="ACF49901.1"
FT                   /translation="MFTKVLIANRGEIACRVIATCRRLGIATVAVYSDADRNARHVRLA
FT                   DEAIHIGPAAARESYLRGDVLLDAARRSGAQAIHPGYGFLSENADFADACAAAGITFIG
FT                   PPASAIRAMGDKSAAKALMAKAGVPLTPGYHGDQQAPDFLRAQADGIGYPVLIKASAGG
FT                   GGKGMRKVERSEDFVDALASCQREAASAFGNDHVLVEKYVERPRHIEIQVFGDSHGEAV
FT                   YLFERDCSVQRRHQKVLEEAPAPGMSAERRAAMGKAAVDAARAVGYVGAGTVEFIAGPD
FT                   GDFYFMEMNTRLQVEHPVTEYITGTDLVEWQLRVASGQPLPLRQEQLAIHGHAIEARLY
FT                   AEDADRGFLPSTGTLRRLRLPMPSANVRVDTGVEEGDSISPYYDPMIAKLIVWDVDRDA
FT                   ALRRMSQALADCQVVGVTTNAGFLRRLVNTDSFAHAKLDTALIEREQAALSAAGDSDDA
FT                   LWQLAAVAAVASTADAGIDARDPHSPWQAQDGWRLGASTPRALPLQQGERTHTLKVWVQ
FT                   ADGWRVQSDDAAPVQVIGTANAQGLTVQLGERRWSLQLLREGDQLYLFGADGQHRFTLH
FT                   DPVGESDTAVADAGSLLAPMPGKIVATLVAAGTEVKRGTPLVVLEAMKMEHTLQAPADG
FT                   TVKGYRAKAGDQVGDGAVLVDFEAA"
FT   gene            complement(241137..242747)
FT                   /locus_tag="Smal_0197"
FT   CDS_pept        complement(241137..242747)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0197"
FT                   /product="Propionyl-CoA carboxylase"
FT                   /EC_number="6.4.1.3"
FT                   /note="PFAM: carboxyl transferase; KEGG: xcb:XC_0255
FT                   acyl-CoA carboxyltransferase beta chain"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49902"
FT                   /db_xref="GOA:B4SSM0"
FT                   /db_xref="InterPro:IPR011762"
FT                   /db_xref="InterPro:IPR011763"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR034733"
FT                   /db_xref="UniProtKB/TrEMBL:B4SSM0"
FT                   /protein_id="ACF49902.1"
FT                   /translation="MTVLNSQLQPGSETFESNRAAMQAVVDDLHATLARTALGGSEAAR
FT                   AKHTARGKLLVRDRIDALLDPGSAFLEIAPLAAHGMYEDAVPAAGVVAGIGRVSGMECV
FT                   IVANDATVKGGTYYPMTVKKHLRAQEIAEQNHLPCIYLVDSGGAFLPLQDEVFPDRDHF
FT                   GRIFYNQANLSARGIPQIACVMGSCTAGGAYVPAMSDETVIVREQGTIFLGGPPLVKAA
FT                   TGEVVTAEELGGADVHTRISGVADHMADNDLQALARVRAIIAQLNWRKPEPAMAVQANE
FT                   EPLLPAHDLYGVIPADTRKPYDVREVIARLVDGSRFDEFKPRYGATLVTGFAHLNGYPI
FT                   GIIANNGILFSESALKGAHFIELCTQRNIPLVFLQNITGFMVGRKYEQGGIAKDGAKLV
FT                   MAVACAKVPKFTVVIGGSFGAGNYGMCGRAYSPNFLWMWPNARIGVMGGEQAASVLATV
FT                   KRDGIEAKGGQWPAAEEDAFKAPIRDQFEQQGHPYYASARLWDDGVIDPVDTRRVLALA
FT                   LSASLNAAPQQTRFGVFRM"
FT   gene            complement(242758..243921)
FT                   /locus_tag="Smal_0198"
FT   CDS_pept        complement(242758..243921)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0198"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain protein;
FT                   Acyl-CoA dehydrogenase type 2 domain; KEGG: xcv:XCV0273
FT                   acyl-CoA dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49903"
FT                   /db_xref="GOA:B4SSM1"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR034183"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:B4SSM1"
FT                   /protein_id="ACF49903.1"
FT                   /translation="MHVPSLNFDLGEDIDLLRQSVAHFAAAEVAPLAAEADATNQFPLA
FT                   LWPKLGEQGLLGLTVEEEYGGTGMGYLAHVVAMEEISRASGGIGLSYGAHSNLCVNQLR
FT                   KNGNEEQKQRFLPGLCSGALVGALAMSEPGAGSDVVSMKLRADKRGDRYVLNGNKMWIT
FT                   NGPDADVLVVYAKTDMAAGAKGITAFLVEKGMKGFSTAQKLDKLGMRSSPTCELVFQDC
FT                   EVPEENVLGQVGGGVRVLMSGLDYERVVLSGGPLGLMAAAMDVVMPYVHERHQFGEAIG
FT                   SFQLIQAKIADMYVGLGACRAYVYAVARACDQGRTTRQDAAGAILYAAEKATWLTGQAI
FT                   QILGGNGYINEYPTGRLWRDAKLYEIGAGTSEIRRMLIGRELFQRTL"
FT   gene            244082..244690
FT                   /locus_tag="Smal_0199"
FT   CDS_pept        244082..244690
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0199"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: xcb:XC_0257
FT                   transcriptional regulator AcrR family"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49904"
FT                   /db_xref="GOA:B4SSM2"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR041490"
FT                   /db_xref="UniProtKB/TrEMBL:B4SSM2"
FT                   /protein_id="ACF49904.1"
FT                   /translation="MAYKRSALMEERLAGVRERILLATRERVAAGGWRNAPVTAVATQA
FT                   GVSTGLIYRHFPSKAELFVEVLNAAVAHEVAIMERIASGPEVASERLRLAITAFVRRAL
FT                   AGPGLAHAFIVEPVDPEVEAERMRGRRAFGDVFLRLVEEGVAAGELPAQDAHVAAACLV
FT                   GAFTEAMVGPTAPSREAHRDEDALVDAICSFCLRAIGAR"
FT   gene            244896..245414
FT                   /locus_tag="Smal_0200"
FT   CDS_pept        244896..245414
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0200"
FT                   /product="cytochrome c class I"
FT                   /note="PFAM: cytochrome c class I; KEGG: xcv:XCV0281
FT                   putative cytochrome c"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49905"
FT                   /db_xref="GOA:B4SSM3"
FT                   /db_xref="InterPro:IPR002323"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:B4SSM3"
FT                   /protein_id="ACF49905.1"
FT                   /translation="MRNYDLEFLKRFSMVIALLATITLGLILLAAYIHTRIPPEVSPTA
FT                   VKRTEQRISPTGAVYAGSTGAAAQAAAAAAALAKAASQVAYGGTKDGKVIFDNLCTACH
FT                   TTGVGMAPTLDHSHWDKRIAQGKDTLYKHAIEGYTGPDGGIMPPKGGNPALTEEQIHAT
FT                   VDWMLGNLK"
FT   sig_peptide     244896..244988
FT                   /locus_tag="Smal_0200"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.899) with cleavage site probability 0.688 at
FT                   residue 31"
FT   gene            245598..247043
FT                   /locus_tag="Smal_0201"
FT   CDS_pept        245598..247043
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0201"
FT                   /product="Endonuclease/exonuclease/phosphatase"
FT                   /note="PFAM: Endonuclease/exonuclease/phosphatase; KEGG:
FT                   xac:XAC0274 nuclease"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49906"
FT                   /db_xref="GOA:B4SSM4"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/TrEMBL:B4SSM4"
FT                   /protein_id="ACF49906.1"
FT                   /translation="MRRRSLVLALSLLLPAGAFAQAQPQVAPVASPAAARNSATVVLTA
FT                   APADWRALDGQHVRIAAPLILAGTDGLERFGQLTVAFDGRLWQPTEVAAPGTAGYEQAM
FT                   ADNQRRRLVLDDGSDARDPASVAYLPANPVLRTGMQLRNVEGVVNVDAQGRPRLQVEGV
FT                   LKLPELKRPAVPTVPGSLHVAAFNLENFFNGDGQGGGFPTLRGARTPDEHKAQVAKLVT
FT                   TVNALGADVAALMELENDGYGPQSAIAELVDALNRDRGGQGDWRFVDAGSGPGENPIRV
FT                   GIIYRSTRLQPVGKPATLTGGPFVEHSRVPLAQAFQGKQGAPFVVVANHFKSKGCRDAS
FT                   GADADRNDNQGCWNATRVTSAQQLHAWLQTDPTGTGAKDAVLLGDFNAYAMEDPIRTLH
FT                   DLGWQDAFKVAKVEHPYSYVYNGYTGRLDHALLNPGMAKRLRGAAEWHSNADEQDASGY
FT                   QGRNVQGPWRSSDHDPLLLGFDK"
FT   sig_peptide     245598..245660
FT                   /locus_tag="Smal_0201"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.780 at
FT                   residue 21"
FT   gene            complement(247101..247958)
FT                   /locus_tag="Smal_0202"
FT   CDS_pept        complement(247101..247958)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0202"
FT                   /product="protein of unknown function DUF6 transmembrane"
FT                   /note="PFAM: protein of unknown function DUF6
FT                   transmembrane; KEGG: xcb:XC_0269 integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49907"
FT                   /db_xref="GOA:B4SSM5"
FT                   /db_xref="UniProtKB/TrEMBL:B4SSM5"
FT                   /protein_id="ACF49907.1"
FT                   /translation="MLYLSLAVICSVLVSVLLKLASRRQLDVSQMVTWNYLVAATLTAV
FT                   VLQPPLDALRAPHAPWLSLLALAVVLPSIFLVLGRAVAVAGIVRSDVAQRLSLLLSLAA
FT                   AFLFFGQTATPWKLAGLALGLLAMVAISLRPRGPAVASSPGGWGWLLGVWAGFAVVDVL
FT                   LKQVALSGTPSMAAVLASFSVAFVLMLALQLWRHASGRSRLAWRNLGAGALLGLLNGGN
FT                   ILFYVHAHQSMPDSPATVFAGMNIGVVVLGALVGVFAFGEATTKWNRAGLALAVLAIGL
FT                   IAWG"
FT   gene            248002..248673
FT                   /locus_tag="Smal_0203"
FT   CDS_pept        248002..248673
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0203"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xcb:XC_0270 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49908"
FT                   /db_xref="GOA:B4SSM6"
FT                   /db_xref="InterPro:IPR000383"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B4SSM6"
FT                   /protein_id="ACF49908.1"
FT                   /translation="MHKPSFPVAAGETACLVLDGPVGPLEVVVDLPKADVPAQPIVAII
FT                   CHPLSTEGGTLHNKVVTMTATTLREQGIATVRFNFRSVGGSAGEFDHGVGEQDDLKAVA
FT                   AWVRSQRPDDRLWLAGFSFGSFVSLKAAAELQPEALISIAPPAGRWDFDGIAPPARWLV
FT                   IQGEQDEIVDPQAVYQWLDTLDFPHELVRMPETSHFFHRKLIDLRGALTHGVKHWLGAA
FT                   A"
FT   gene            248670..249770
FT                   /locus_tag="Smal_0204"
FT   CDS_pept        248670..249770
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0204"
FT                   /product="AFG1-family ATPase"
FT                   /note="PFAM: AFG1-family ATPase; KEGG: xcv:XCV0288 putative
FT                   ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49909"
FT                   /db_xref="GOA:B4SSM7"
FT                   /db_xref="InterPro:IPR005654"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B4SSM7"
FT                   /protein_id="ACF49909.1"
FT                   /translation="MSATELTPSQRYAEGVARGDWQNDPAQHAALAELDRIHLGLLDSA
FT                   EDGWLDRLSSFWKKPEPVKGLYFWGGVGRGKTFLVDLFYDGLPIKQKYRTHFHRFMRSV
FT                   HERLREHQGQSDPLAKIAQEWRSNLRVLVLDEFFVTDIGDAMLLARLLERMFAEGVTLV
FT                   TTSNTAVENLYLNGLQRESFMPAIGLLQRFCVELYAEGTEDYRMRALTRSPVYRAPLTA
FT                   DSDEWLATRWNELSGGQPAKTGNIEIEGRKIPVRGRGKSIAWFDFAALCEGPRGPSDYI
FT                   EIAHEFNTVLLGGIPAFDRLNEDAARRFVNLIDELYDRHVNLVCTASTSPVELYSGTRL
FT                   QGAFERTASRLIEMQSAEYLGTPHRA"
FT   gene            complement(249846..250682)
FT                   /locus_tag="Smal_0205"
FT   CDS_pept        complement(249846..250682)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0205"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xac:XAC0284 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49910"
FT                   /db_xref="InterPro:IPR021307"
FT                   /db_xref="UniProtKB/TrEMBL:B4SSM8"
FT                   /protein_id="ACF49910.1"
FT                   /translation="MRLSLPALALLPALFIAPALAAEGPELRSDQCGIHTDYDVLVDSG
FT                   GIWLRHGPQAPHEVVFHDGELSLDGRMVTVSTADAARLRQMETGARRLMPAATALAHEV
FT                   SGVTFDALDAAFEAITGKSRNRQMRAMRGEMQDWIDASLGRGYWEQEAFGDGFDAHIDQ
FT                   MAETMAGSMTRSVLWQVFTGRVGAMERRADRLDAEVDRRMEARSQQLEAKAMALCPLVQ
FT                   SLAEAHDALEVRYQGQPLRLLERGESVRVEHGNGSGLHVSAGPDERPRDNAVAPSR"
FT   sig_peptide     complement(250617..250682)
FT                   /locus_tag="Smal_0205"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.997 at
FT                   residue 22"
FT   gene            251258..253669
FT                   /locus_tag="Smal_0206"
FT   CDS_pept        251258..253669
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0206"
FT                   /product="ribonucleoside-diphosphate reductase, alpha
FT                   subunit"
FT                   /EC_number="1.17.4.1"
FT                   /note="KEGG: mxa:MXAN_5057 ribonucleoside-diphosphate
FT                   reductase, alpha subunit; TIGRFAM:
FT                   ribonucleoside-diphosphate reductase, alpha subunit; PFAM:
FT                   ribonucleotide reductase large subunit; ATP-cone domain
FT                   protein; Ribonucleotide reductase large subunit domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49911"
FT                   /db_xref="GOA:B4SSM9"
FT                   /db_xref="InterPro:IPR000788"
FT                   /db_xref="InterPro:IPR005144"
FT                   /db_xref="InterPro:IPR008926"
FT                   /db_xref="InterPro:IPR013346"
FT                   /db_xref="InterPro:IPR013509"
FT                   /db_xref="InterPro:IPR039718"
FT                   /db_xref="UniProtKB/TrEMBL:B4SSM9"
FT                   /protein_id="ACF49911.1"
FT                   /translation="MTTESSATIEKESEFLLTSPPTANAMSVTKRNGTTELVDLNKIVR
FT                   AVQRSSEGLHAVDPMRVATRTISGLYNGATTRELDELSIRTAALLIGEEPEYGRLAARL
FT                   LANYIAKEVSGQEIYAFSQSVGRGHEVGLINDRLLNFVQTNARKLNDAIDMSLDLNFDY
FT                   FGLRTLYDRYLLRHPHTRKVIETPQQFFLRIASALSEDVPEALALYKRMGNLDYLPSSP
FT                   TLFNSGTTHEQLSSCFLLDSPQDSLESIYSKYGDIAQLSKFSGGIGVSYTRVRSRGSLI
FT                   KSTNGHSNGIVPWLKTMDSSVAAVNQGGKRKGAACVYLETWHADVEDFLELRDNTGDES
FT                   RRAHNLNLANWIPDLFMKRVEADQEWSLFDPRVVPEFTDLFGEAFEAAYLQAEAQGKAN
FT                   RTISARKLYSRMMRTLAETGNGWMTFKDKCNRASNQTLRAGNVIHLSNLCTEILEVTSA
FT                   EETAVCNLGSINLGNHFDGNGEFDFDKLADTVRLAVRQLDRVIDLNFYPIESARRGNLR
FT                   WRPVGLGCMGLQDVFFRKRLPFDGAEARALSKKIAETIYFHALETSVELAQERGKHPSF
FT                   ADTRAASGELQFDAWNVVPEDAERWDSLRERIKEHGLRNSLMIAIAPTATIASIAGCYE
FT                   CVEPQVSNLFKRETLSGDFLQVNRYLVNELKKLGHWTPEMRDAIKLAEGSIQGITQIPE
FT                   TLRHVYRTAWELPMRSLIDMAADRGAFIDQSASLNLFMESPNIGAMSSMYMYAWKQGIK
FT                   TTYYLRSRPATKIAKTTVSHAAGAAPEKVFSPEEAIACSLENPEACEACQ"
FT   gene            253799..254818
FT                   /locus_tag="Smal_0207"
FT   CDS_pept        253799..254818
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0207"
FT                   /product="Ribonucleoside-diphosphate reductase"
FT                   /EC_number="1.17.4.1"
FT                   /note="PFAM: ribonucleotide reductase; KEGG: bba:Bd1983
FT                   ribonucleotide-diphosphate reductase small chain"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49912"
FT                   /db_xref="GOA:B4SSN0"
FT                   /db_xref="InterPro:IPR000358"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012348"
FT                   /db_xref="InterPro:IPR033909"
FT                   /db_xref="UniProtKB/TrEMBL:B4SSN0"
FT                   /protein_id="ACF49912.1"
FT                   /translation="MADKPKQMLLDPGFELTLRPMRYPQFYDMYRNAIKNTWTVEEINF
FT                   QIDISDLHSKMSPGERHLIHRLVAFFATGDSIVSNNLVLNLYQHLNAPEARMYLSRQLY
FT                   EEALHVQFYLTLLDNYLPDPDERVKAFAAVENIDSIKKKADFCFKWIDSIQNLKRIETR
FT                   EERRQFLLNQICFAACIEGLFFFAAFAYVYYFRSRGLLNGLASGTNWVFRDESAHMDFA
FT                   FECVDVIREEEPDLFDDKMKQDVYDMLAEAIECEVQFAEDVLSGGVAGISTRDMRQYLQ
FT                   HCADNHFHRLGMERKYNVRNPLSFMELQDVQELTNFFERRASAYQVGVQGEVAFDMNF"
FT   gene            complement(254976..255611)
FT                   /locus_tag="Smal_0208"
FT   CDS_pept        complement(254976..255611)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0208"
FT                   /product="Lysine exporter protein (LYSE/YGGA)"
FT                   /note="PFAM: Lysine exporter protein (LYSE/YGGA); KEGG:
FT                   ppg:PputGB1_2255 lysine exporter protein (LysE/YggA)"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49913"
FT                   /db_xref="GOA:B4SSN1"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:B4SSN1"
FT                   /protein_id="ACF49913.1"
FT                   /translation="MPATSDLLAFALVSLAMVLTPGPNMIYVISRSICQGPVAGLISLG
FT                   GVALGFVFYMLCAALGITALLMTVPFAYDALRIGGALYLLYLAWQALKPGGRSPFAVRE
FT                   LPQDSPRKLFTMGFLTNLLNPKVAVMYLSLLPQFLHPDSEGSVLLQSVVLGSTQIAVSV
FT                   TVNGIIALTAGSIAGFLAARPTWQVVQRWLMGTVLAGLAVRMAVEGRR"
FT   gene            255764..256165
FT                   /locus_tag="Smal_0209"
FT   CDS_pept        255764..256165
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0209"
FT                   /product="thioesterase superfamily protein"
FT                   /note="PFAM: thioesterase superfamily protein; KEGG:
FT                   xcb:XC_4072 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49914"
FT                   /db_xref="GOA:B4SSN2"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="InterPro:IPR033120"
FT                   /db_xref="InterPro:IPR040170"
FT                   /db_xref="UniProtKB/TrEMBL:B4SSN2"
FT                   /protein_id="ACF49914.1"
FT                   /translation="MTPIHETVPPTEVRMAEIVFPNHTNHLGTLFGGQALAWMDKAAFL
FT                   AAARYSRRTVVTARSDQVDFKLPIRIGQMVETIGRIVEVGRSSMKVEVELVAEDLHSGE
FT                   RKLCTRGHFVMIALDEEGHPIAVPPLPTA"
FT   gene            256221..257027
FT                   /locus_tag="Smal_0210"
FT   CDS_pept        256221..257027
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0210"
FT                   /product="Silent information regulator protein Sir2"
FT                   /note="PFAM: Silent information regulator protein Sir2;
FT                   KEGG: xcv:XCV0329 NAD-dependent deacetylase"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49915"
FT                   /db_xref="GOA:B4SSN3"
FT                   /db_xref="InterPro:IPR003000"
FT                   /db_xref="InterPro:IPR026587"
FT                   /db_xref="InterPro:IPR026590"
FT                   /db_xref="InterPro:IPR026591"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="UniProtKB/TrEMBL:B4SSN3"
FT                   /protein_id="ACF49915.1"
FT                   /translation="MTPPLTDFIDRAQRLFVLTGAGCSTASGIPDYRDADGQWKRTPPV
FT                   TYQAFMGEAATRQRYWARSLLGWPRFGLAQPNGTHQALAALESRGTLQVLLTQNVDGLH
FT                   QRAGSHNVIDLHGRLDLVRCMGCERRSDREDFQQRLLDANPGWDALEAGIAPDGDADLE
FT                   TDFSAFVVPECPHCGSVLKPDVVFFGENVPRERVAAVHDHLQQADAVLVVGSSLMVYSG
FT                   FRFVQAAAKAGLPVAALNRGRTRADDLLLFKDERDCAEALAGFVLG"
FT   gene            257182..258282
FT                   /locus_tag="Smal_0211"
FT   CDS_pept        257182..258282
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0211"
FT                   /product="NADH:flavin oxidoreductase/NADH oxidase"
FT                   /note="PFAM: NADH:flavin oxidoreductase/NADH oxidase; KEGG:
FT                   xac:XAC0321 FMN oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49916"
FT                   /db_xref="GOA:B4SSN4"
FT                   /db_xref="InterPro:IPR001155"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:B4SSN4"
FT                   /protein_id="ACF49916.1"
FT                   /translation="MTQLFSPISFGPLTLSNRIVIAPMCQYSAEDGRASDWHAMHLGNL
FT                   AQSGAGLLILEATAVEPRGRISWADLGLWDDGTEAALAQVLTSVRRWSPMPLGIQLGHA
FT                   GRKASVRRPWDGGGQLPADDARGWATVAPSPLPFHAADPAPQELDEAGIAEVIAAFAAS
FT                   AVRAERLGFELIELHAAHGYLLHQFLSPLSNRRTDGYGGSLPNRLRLLVEVFDAVRAAV
FT                   SDKVAVGVRISASDWVDGGWDLVQSEALAQVMDARGCNFLHVSSGGLDERQKITVGPGY
FT                   QVPFAAAIKAKVRMPVIAVGMITEPEQAESILRHRHADAVALARGILYDPRWPWHAAAA
FT                   LRDSVDAAPQYLRCEPRDARGVFKTR"
FT   gene            complement(258286..259197)
FT                   /locus_tag="Smal_0212"
FT   CDS_pept        complement(258286..259197)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0212"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: xcb:XC_3052 transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49917"
FT                   /db_xref="GOA:B4SSN5"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B4SSN5"
FT                   /protein_id="ACF49917.1"
FT                   /translation="MNLLQLIRSFTRTAETGSIAAAARILGISATAVGQNINRLEAHLG
FT                   VRLLNRSTRQLALSEAGALYLAQVRHIEADLARAQAMVTSGDIEPAGPLRIASSSAFGR
FT                   HVLAPLLPSLQQRYPQLQLELRLTDRAVQHGPEAVDASIRIGAQLEDGVVARQLARVPF
FT                   VFCASPAYLKAHGTPQQPSELSGHRGLLHRFPTDGRPLRWGLLKDGQRVDAALPPSMVC
FT                   DDIDALATLAVAGAGITRLAAFVAEPYLRDGRLQAVFGADSEWRPAPMEVYFCVSDRRD
FT                   FTAKIRALFEHLQAGMAPAWRV"
FT   sig_peptide     complement(259093..259197)
FT                   /locus_tag="Smal_0212"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.857) with cleavage site probability 0.703 at
FT                   residue 35"
FT   gene            259312..260163
FT                   /locus_tag="Smal_0213"
FT   CDS_pept        259312..260163
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0213"
FT                   /product="formyltetrahydrofolate deformylase"
FT                   /note="TIGRFAM: formyltetrahydrofolate deformylase; PFAM:
FT                   formyl transferase domain protein; amino acid-binding ACT
FT                   domain protein; KEGG: xac:XAC0324 formyltetrahydrofolate
FT                   deformylase"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49918"
FT                   /db_xref="GOA:B4SSN6"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR004810"
FT                   /db_xref="InterPro:IPR036477"
FT                   /db_xref="InterPro:IPR041729"
FT                   /db_xref="UniProtKB/TrEMBL:B4SSN6"
FT                   /protein_id="ACF49918.1"
FT                   /translation="MRPDSILTLSCPDRTGIVYRVSGLLFDHGCNILDAQQFGDEESGR
FT                   FFLRVHFDRDAGLPLETVHAAMATLAAGFGMDWQLHDGRRRARLLVLVSKQGHCLNDLL
FT                   FRAHSGQLKVDIAAVASNHADFAALAASYQVPFHHLPVTADTRAVQEQQIIDLVERERI
FT                   DLVVLARYMQILSPTLCRALAGRAINIHHSFLPSFKGAQPYHQAHARGVKIIGATAHYV
FT                   TEDLDEGPIIEQDVARVDHAMVPRELVRLGSDTESLVLARAVRRHVEHRILLNGHRTVV
FT                   FR"
FT   gene            complement(260276..260902)
FT                   /locus_tag="Smal_0214"
FT   CDS_pept        complement(260276..260902)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0214"
FT                   /product="Nicotinamidase"
FT                   /EC_number="3.5.1.19"
FT                   /note="PFAM: isochorismatase hydrolase; KEGG:
FT                   xfn:XfasM23_1394 nicotinamidase"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49919"
FT                   /db_xref="GOA:B4SSN7"
FT                   /db_xref="InterPro:IPR000868"
FT                   /db_xref="InterPro:IPR036380"
FT                   /db_xref="UniProtKB/TrEMBL:B4SSN7"
FT                   /protein_id="ACF49919.1"
FT                   /translation="MTALPADVALLVIDLQPDFMPGGTLACDQGDALVAPIAELLAQRR
FT                   YRTVVATQDWHPADHASFASQHPGRRPFETILLHAQPQTLWPDHCVQGSAGAALHPGVD
FT                   WTVADLILRKGTRQQVDSYSAFRENHGPDGTRPATGLAGCLHERGIREVHVCGLARDYC
FT                   VLWSAQDAVKSGFRVRFLWELTKPVTDANDAMVREALGKAGIAIA"
FT   gene            complement(260958..261644)
FT                   /locus_tag="Smal_0215"
FT   CDS_pept        complement(260958..261644)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0215"
FT                   /product="protein of unknown function DUF208"
FT                   /note="PFAM: protein of unknown function DUF208; KEGG:
FT                   spe:Spro_2683 protein of unknown function DUF208"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49920"
FT                   /db_xref="GOA:B4SSN8"
FT                   /db_xref="InterPro:IPR003828"
FT                   /db_xref="UniProtKB/TrEMBL:B4SSN8"
FT                   /protein_id="ACF49920.1"
FT                   /translation="MRYLTMTELQRPTLSLPENGQRLLLHSCCAPCSGEVMEAITASGI
FT                   DYAIFFYNPNIHPVKEYELRKQENIRFAEQHNIPFIDCDYDTDNWFSRARGMENEPERG
FT                   IRCTMCFDMRFERTALYAHEHGYDTISSSLGISRWKNMAQINDCGIRAASRYEGLQYWD
FT                   YNWRKGGGASRMVEISKREQFYQQEYCGCVYSLRDANRHRRENGRERIKIGLLYYGQDA
FT                   ETPQGD"
FT   misc_binding    complement(261804..262019)
FT                   /bound_moiety="adenosylcobalamin"
FT                   /note="Cobalamin riboswitch as predicted by Rfam (RF00174),
FT                   score 86.92"
FT   gene            262147..264021
FT                   /locus_tag="Smal_0216"
FT   CDS_pept        262147..264021
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0216"
FT                   /product="Patatin"
FT                   /note="PFAM: Patatin; KEGG: sme:SMc01492 probable
FT                   suppressor of E.COLI RpoH thermosensitive MUTATION
FT                   transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49921"
FT                   /db_xref="GOA:B4SSN9"
FT                   /db_xref="InterPro:IPR002641"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="UniProtKB/TrEMBL:B4SSN9"
FT                   /protein_id="ACF49921.1"
FT                   /translation="MAAKYCDLVMKGGITSGIVYPNAVLALAREYRFKSIGGTSAGAIA
FT                   AAVAAAAACGDRRQQAGEHLPGDAGYSGLSAVSAQLSRRGFIYSLFQPARGARAAYRLL
FT                   VVLTGNARLPHKLLCLAVAVFEIAPLEVLVSLSLLLGLGWWGGGWSGVAATLLPSLLCA
FT                   YGAGVAGAALRVARVARRNLLGLCSGLGRDARRPALTEWLHESLQQLSGKPLDAPLTFA
FT                   DLHDAPRYAGEPDSPHAISLQMITTCVSHNEPRTLPLGGAQFWFLREEFEQLFPASVVQ
FT                   WLVTQAGPPLEVEGRRYYHLPQGPKLPVLVATRMSLSFPLLISAVPLHEPSRRERRCEP
FT                   TAPAADQEHNVADSMEGLTSAGQTCGPVITAFRICWFSDGGISSNFPIHLFDAALPRWP
FT                   TFAINLVYPQHAEDVSHGSSGRQALEHAVFLPTENRHGWQRTYQSIATPLAAAELGRFL
FT                   FAVVATMQNWRDLLQARAPGYRDRIVHVSLQGDEGGMNLDMPQDVLTRIADKGSLAGAR
FT                   FCSFSFENHYWIRWRNLASAYQRYTLEVARTDDPAQQVLAYRAAYAMVASGQPAPPSYK
FT                   LGSEDKRLASQQLWGLMVEQGRSWDDLGPDLTDGAPRPLPQMKVTPIY"
FT   gene            complement(264101..265075)
FT                   /locus_tag="Smal_0217"
FT   CDS_pept        complement(264101..265075)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0217"
FT                   /product="protein of unknown function DUF1028"
FT                   /note="PFAM: protein of unknown function DUF1028; KEGG:
FT                   ade:Adeh_0307 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49922"
FT                   /db_xref="InterPro:IPR010430"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:B4SSP0"
FT                   /protein_id="ACF49922.1"
FT                   /translation="MPALEMAMSPLRSCLALLLTAFAAPAWATFSIAACNEVGDCGVAV
FT                   ATHNLAVGGVGVPWAQAKVGAVASQFETNPTYGSNGLELLAKGRTPSQVLKQLLDEDGN
FT                   FDGTTLAERQVGLVSARGGNAQYTGATAQQADWAGAQGEGMLSVQGNGLAGPEVLAAMQ
FT                   RVFAASHGELAVRLLAALEAGQAAGGQRSGQWSAALLVRTPGGDWQDTDLRVDADPLAV
FT                   ARLRELYDMRLSNEAIIHAEERWEKGDVAGARAALATSLSLAHGWDRTWARAARLAMRQ
FT                   GDTALAREYLAGLRALNPGWVKQELALPLYAPLQGDAVVAPWR"
FT   sig_peptide     complement(264989..265075)
FT                   /locus_tag="Smal_0217"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.765 at
FT                   residue 29"
FT   gene            complement(265373..266740)
FT                   /locus_tag="Smal_0218"
FT   CDS_pept        complement(265373..266740)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0218"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="PFAM: helix-turn-helix domain protein; protein of
FT                   unknown function DUF955; KEGG: xac:XAC1311 transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49923"
FT                   /db_xref="GOA:B4SSP1"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010359"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR018653"
FT                   /db_xref="InterPro:IPR026281"
FT                   /db_xref="UniProtKB/TrEMBL:B4SSP1"
FT                   /protein_id="ACF49923.1"
FT                   /translation="MNYSATQRQLGLRLLRLREQRGYSQAALAQALGLSASYLNQIERN
FT                   KRPLTPAVQKKLGEVLGDVSALFDDDEPAALQEALGETLRDLGLAEVSATELRALAGNL
FT                   PQVSRALLDLHRRHLALREHAAALEFQLGEPGAGSTLPAGDQVREFFNRMHNHIPELDE
FT                   LAEQLFAEWGLSPGHVAPRLRQLLADRHGVLVEVAALQAGREKRQYDAGARRLWLPDYL
FT                   EPGQQAFQMAAELALHGYLPQIDAVVARAGFTDDARIAQARIGLSNYFAGALVMPYMRF
FT                   LRAAEASSYDIELLAHQFGVGFEAVCHRLSTLARRSAPGLPFFFIRVDRAGNVSKRHSA
FT                   TDFHFSQVGGSCPLWIVYEAFNQPGRILTQTARMPDGRRHFWLARQVSSGPVGHGQPRK
FT                   TFAVALGCDLQHAERLVYSLGLDVQSPGNSVSIGPGCRVCPREDCMQRAFAQLPGR"
FT   gene            266856..268361
FT                   /locus_tag="Smal_0219"
FT   CDS_pept        266856..268361
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0219"
FT                   /product="methylmalonate-semialdehyde dehydrogenase"
FT                   /note="TIGRFAM: methylmalonate-semialdehyde dehydrogenase;
FT                   PFAM: Aldehyde Dehydrogenase_; KEGG: xcv:XCV1363 putative
FT                   aldehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49924"
FT                   /db_xref="GOA:B4SSP2"
FT                   /db_xref="InterPro:IPR010061"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniProtKB/TrEMBL:B4SSP2"
FT                   /protein_id="ACF49924.1"
FT                   /translation="MTVAAPRIRMLIDGQFVESATSHWQDVINPATQDVLAKVPFATTG
FT                   EVDAAVAAAKEAFKTWRKTPIGTRARIFLKYQQLIRENMSELAHILTAEQGKTLPDAEG
FT                   DVFRGLEVVEHAAAIGNLQLGELANNVATGVDTYSIMQPLGVCAGITPFNFPAMIPLWM
FT                   FPMAIATGNTFILKPSEQDPMVTMRLVELALEAGIPKGVLNVVHGGEEVVNAICDHPDI
FT                   KAVSFVGSTRVGTHVYNRASLAGKRVQCMMGAKNHAVVLPDANKEQTLNAMVGAAFGAA
FT                   GQRCMAASTLVLVGEARNWVQDLVTKAKTLKVSAGTVSGTDVGPVISCSARERVEGLIA
FT                   SGVEQGAKLVLDGRKPQVDGFEKGNFVGPTIFAGVTTDMRIYQEEIFGPVLVILEAETL
FT                   EDAIAMVNSNPNGNGTALFTQSGAAARKFQEDIDVGQVGINVPIPVPVPLFSFTGSRAS
FT                   KLGDLGPYGKQVVLFYTQTKTVTARWFDDETLSHGVNTTISLK"
FT   gene            268376..269542
FT                   /locus_tag="Smal_0220"
FT   CDS_pept        268376..269542
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0220"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain protein;
FT                   Acyl-CoA dehydrogenase type 2 domain; KEGG: xac:XAC1313
FT                   acyl-CoA dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49925"
FT                   /db_xref="GOA:B4SSP3"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:B4SSP3"
FT                   /protein_id="ACF49925.1"
FT                   /translation="MSHSMTTELEEAQQAYREAARDFAQAELAPHAARWDAEGIFPREA
FT                   IAKAGELGFCGLYMDPEVGGSGLSRLDAAVVIEELANVDPSTAAYISIHNMASWMVSKW
FT                   GQPALRDAWGTDLSSGSKLASYCLTEPGAGSDAASLKTTAVRDGDFYVLNGSKAFISGA
FT                   GATELLVVMARTGGAGAGGVSAIAVPADLPGISFGRKEEKMGWNSQPTRGITFENVRVP
FT                   VSHLLGEEGGGFKLAMKGLDGGRINIAACSLGAAQGALDAARRYMGERRQFGKTLSEFQ
FT                   ALQFKLADMAIELVAARQMVHTAARKLDAGASDANVWCAMAKRFATDAGFNICNEALQI
FT                   HGGYGYIREYPIERLLRDSRVHQILEGTNEIMRVIVARHLLNTEEELR"
FT   gene            269539..270336
FT                   /locus_tag="Smal_0221"
FT   CDS_pept        269539..270336
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0221"
FT                   /product="Enoyl-CoA hydratase/isomerase"
FT                   /note="PFAM: Enoyl-CoA hydratase/isomerase; KEGG:
FT                   xcv:XCV1365 enoyl-CoA hydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49926"
FT                   /db_xref="GOA:B4SSP4"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:B4SSP4"
FT                   /protein_id="ACF49926.1"
FT                   /translation="MKDWRTQEHVGLKVEADGHTAVITLHNPPAHTWTVHSLSALRDLV
FT                   GALNADREIYALVITGDGEKFFSAGADLNQFASGDKAAAREAARRFGEAFEALSAFRGV
FT                   SIAAINGYAMGGGLECALACDLRIIEDHAQVALPEATVGLLPCAGGTQNLPRLVGEGWA
FT                   KRMILLGERINAETALRIGLAEEKVGKGEAKALALEWAAKAGKQSPTSIAACKTLVQAT
FT                   RTGTHASALVAEREAFVDLFDTADQVEGVSAFLEKRAAQWKNA"
FT   gene            270333..271508
FT                   /locus_tag="Smal_0222"
FT   CDS_pept        270333..271508
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0222"
FT                   /product="Enoyl-CoA hydratase/isomerase"
FT                   /note="PFAM: Enoyl-CoA hydratase/isomerase; KEGG:
FT                   xcv:XCV1366 enoyl-CoA hydratase/isomerase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49927"
FT                   /db_xref="GOA:B4SSP5"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR032259"
FT                   /db_xref="UniProtKB/TrEMBL:B4SSP5"
FT                   /protein_id="ACF49927.1"
FT                   /translation="MSTDTAADDAPVLFEERAAGNGTRIGIATLNAPRTLNGFSLPMAH
FT                   LLLKQLNAWADDDGIAMVVLQGAGEKAFCAGGDLHSLYKSMAAFREAGRSDIRENDYAA
FT                   EFFDVEYRVDYLIHTYAKPILCWGHGIVMGGGIGLMSGASHRVVSERSKLAFPEITVGL
FT                   FPDVGGSWLLPRVPGKGGLFLALTGALLNPGDAIYAGLADVHVAEERRSAVFDALLQVA
FT                   WSSNAAHNHERLSHLLQSHASDAATGPLLANAAQVEALCEGDELQAIVARIAGLQTDDA
FT                   WLQAAQKTLAAGAPGSARLSYELQRRSAGQDLAEIYRLEYIVALHCAAHGDFAEGIRAL
FT                   LIDKDRNPQWNPATLAEATGAWADTFFASPWADAAHPLADLGTPLVERSLA"
FT   gene            271505..272395
FT                   /locus_tag="Smal_0223"
FT   CDS_pept        271505..272395
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0223"
FT                   /product="3-hydroxyisobutyrate dehydrogenase"
FT                   /EC_number="1.1.1.31"
FT                   /note="KEGG: xcv:XCV1367 3-hydroxyisobutyrate
FT                   dehydrogenase; TIGRFAM: 3-hydroxyisobutyrate dehydrogenase;
FT                   PFAM: 6-phosphogluconate dehydrogenase NAD-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49928"
FT                   /db_xref="GOA:B4SSP6"
FT                   /db_xref="InterPro:IPR002204"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR011548"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR015815"
FT                   /db_xref="InterPro:IPR029154"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B4SSP6"
FT                   /protein_id="ACF49928.1"
FT                   /translation="MSRIAFIGLGNMGGPMAANLVKNGHTVRVFDLVPAAVQAAVDAGA
FT                   SAAASARETLADAEVVISMLPASRHVEGVYLGDDGILAAIPAGALVIDCSTIAPASARK
FT                   VSEAAAARGLQMIDAPVSGGTAGAQAGTLTFIVGGEEDALERARPVLQAMGKNIFHVGA
FT                   SGAGQVAKLCNNMALGVIMAVTGEAIALGVAHGLDPKVLSQMMAVSTGRSWATEVCNPW
FT                   PGVLENAPASRGYSGGFGSDLMLKDMGLAVEAAMSVGASIPLGEVARNLYSMNHQAGRG
FT                   KLDFSSVVQLITSEK"
FT   gene            complement(272531..272956)
FT                   /locus_tag="Smal_0224"
FT   CDS_pept        complement(272531..272956)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0224"
FT                   /product="OsmC family protein"
FT                   /note="PFAM: OsmC family protein; KEGG: psa:PST_0169
FT                   organic hydroperoxide resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49929"
FT                   /db_xref="GOA:B4SSP7"
FT                   /db_xref="InterPro:IPR003718"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR019953"
FT                   /db_xref="InterPro:IPR036102"
FT                   /db_xref="UniProtKB/TrEMBL:B4SSP7"
FT                   /protein_id="ACF49929.1"
FT                   /translation="MSIEKVLYTAQATSTGGREGRSVSSDNVLDIQLSTPRELGGAGGP
FT                   GTNPEQLFAAGYSACFLGALKFVAGQAKVALPAETTVTGNVGIGQIPTGFGIEAELTIN
FT                   VPGVPREQVEDLVQKAHIVCPYSNATRGNIDVTLIVA"
FT   gene            complement(273068..274180)
FT                   /locus_tag="Smal_0225"
FT   CDS_pept        complement(273068..274180)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0225"
FT                   /product="cation diffusion facilitator family transporter"
FT                   /note="TIGRFAM: cation diffusion facilitator family
FT                   transporter; PFAM: cation efflux protein; KEGG:
FT                   rpd:RPD_3086 cation diffusion facilitator family
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49930"
FT                   /db_xref="GOA:B4SSP8"
FT                   /db_xref="InterPro:IPR002524"
FT                   /db_xref="InterPro:IPR027469"
FT                   /db_xref="UniProtKB/TrEMBL:B4SSP8"
FT                   /protein_id="ACF49930.1"
FT                   /translation="MCGKGQGGVITAGGRRYVGGAQSTGSGPTGVERLAGEGSETQRSM
FT                   APLYNHSMAADHTHFFDPATEQGVLRLSIAGALLLAAAAVVFGLLANSSLIIFDGIYGL
FT                   IDVVMTWLSLLVARLIALSTQTDALQSRLNQRFTMGFWHLEPIVLGVSGTLMIGAALYA
FT                   LVNAVDALMSGGRHIALGPAIIFAGLSLVAESALGWFVLRANRRIGSEFIALDAKNWVV
FT                   AASMSACYMVAFLGGVLVQGTSWAWVGPYIDPAILAFVCVLVMIAPLGTVRRALAGILL
FT                   VTPPELQAHVDAVARGIVAKHGFVEHRSYVAQVGRGEQIELFFVVPENDPPRPLVEWDQ
FT                   LRDEIGDALGEASPDRWLTIMFTTDREWTI"
FT   gene            274267..275721
FT                   /locus_tag="Smal_0226"
FT   CDS_pept        274267..275721
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0226"
FT                   /product="sulphate transporter"
FT                   /note="PFAM: Sulfate transporter/antisigma-factor
FT                   antagonist STAS; Xanthine/uracil/vitamin C permease;
FT                   sulphate transporter; KEGG: xcv:XCV3891 sulfate permease"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49931"
FT                   /db_xref="GOA:B4SSP9"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR011547"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:B4SSP9"
FT                   /protein_id="ACF49931.1"
FT                   /translation="MQTSYPLRQQWLGNIRGDLLSGIVVALALIPEAIAFSLIAGVDPK
FT                   VGLYAAFSIAVITAIAGGRPGMISAATGAMALVMVDLVKDHGLQYLFAASILAGLLQVL
FT                   AGVFKLGSLMRFVSRSVITGFVNALAILIFLAQMPELIGRGPTVYVLCAAALAIIYLLP
FT                   RITRAVPSPLVAIVVLTAVVIGFGVDVRSVGDMGQLPDSLPHFLLPDVPLTWETLRILL
FT                   PVSATLAVVGLLESMMTLQIVEDITETPSERNRECVGQGVANTVTGFLGGMAGCAMIGQ
FT                   SVINVTSGGRGRLSCLVAGVFLLILVVYGSELVRQIPMAALVAVMIMVSIGTFSWRSLR
FT                   DLRTHPRSSSAVMLLTVVVTVATHDLAKGVLSGVLLSALFFARKVGRMLDVQRDDAGDT
FT                   QVYRVRGQVFFASAGQLGAAFDYQHVAPKVLIDLRDAHLWDLTAVAALERAQEKLAAHG
FT                   AEVTVVGLNAASQTLIEQVGGARGRH"
FT   gene            276483..277514
FT                   /locus_tag="Smal_0227"
FT   CDS_pept        276483..277514
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0227"
FT                   /product="dihydrouridine synthase DuS"
FT                   /note="PFAM: dihydrouridine synthase DuS; KEGG: xcb:XC_4033
FT                   tRNA-dihydrouridine synthase A"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49932"
FT                   /db_xref="GOA:B4SSQ0"
FT                   /db_xref="InterPro:IPR001269"
FT                   /db_xref="InterPro:IPR004653"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018517"
FT                   /db_xref="InterPro:IPR035587"
FT                   /db_xref="UniProtKB/TrEMBL:B4SSQ0"
FT                   /protein_id="ACF49932.1"
FT                   /translation="MPVSTINTPMTSATARYADSLRLSVAPMMDWTDRHCRVFHRVLAP
FT                   GARLYTEMVHANAVIHGDRERLLGFDRSEQPLALQLGGSDPALLAQAARIAAEWGYDEV
FT                   NLNCGCPSDRVQAGRFGACLMREPALVAECVAAMVNAVDIPVTVKCRLGVDEDNDYDVF
FT                   AAFVDRQVAAGAAMVVVHARNAWLKGLSPKENREVPPLKYDWAYRLKQERPALPVVLNG
FT                   GLASLEAVQAQAVHVDGVMLGRAAYHDPYLLHQLEALHTGAPLQARGDLLRALRPYVEA
FT                   RLGEGLALKHITRHVLGLFHGQAGGRAFRQVLSEGAHRPGADWRLIEQALAVTERASDR
FT                   AVA"
FT   gene            277727..278101
FT                   /locus_tag="Smal_0228"
FT   CDS_pept        277727..278101
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0228"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xom:XOO_0384 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49933"
FT                   /db_xref="UniProtKB/TrEMBL:B4SSQ1"
FT                   /protein_id="ACF49933.1"
FT                   /translation="MSSAPFHRRIALATCVVLAAAPLSSALAQQPPRGDQGRAEMMERG
FT                   ERGGRGDERSLSDAVRRVQRTTGGHILGAERVPFDGRDINRVKYMDDRGRVRYMDDPAP
FT                   SRSQPRTPRSDMSSLRGDNP"
FT   sig_peptide     277727..277813
FT                   /locus_tag="Smal_0228"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.994 at
FT                   residue 29"
FT   gene            278175..278858
FT                   /locus_tag="Smal_0229"
FT   CDS_pept        278175..278858
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0229"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein; KEGG: xom:XOO_0385 two-component
FT                   system regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49934"
FT                   /db_xref="GOA:B4ST91"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:B4ST91"
FT                   /protein_id="ACF49934.1"
FT                   /translation="MRILLVEDEAPLRETLAARLKREGFAVDAAQDGEEGLYMGREVPF
FT                   DVGIIDLGLPKMSGMELIKALRDEGKKFPVLILTARSSWQDKVEGLKQGADDYLVKPFH
FT                   VEELLARVNALLRRAAGWSKPTLECGPVALDLAAQTVSVAGSNVDLTSYEYKVLEYLMM
FT                   HAGELVSKADLTEHIYQQDFDRDSNVLEVFIGRLRKKLDPDGELKPIETVRGRGYRFAI
FT                   PRNEG"
FT   gene            278881..280308
FT                   /locus_tag="Smal_0230"
FT   CDS_pept        278881..280308
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0230"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase HAMP region domain protein; histidine
FT                   kinase A domain protein; KEGG: xac:XAC4022 two-component
FT                   system sensor protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49935"
FT                   /db_xref="GOA:B4ST92"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B4ST92"
FT                   /protein_id="ACF49935.1"
FT                   /translation="MMSGRLWFFRRWRPRSLQARQMLAASVGLVAFLALAGYALDAAFA
FT                   DTAKANLRERLKNYATAYAAGIDFTRDRSLYIREQPPDSRFDVPGSGLYLQVVMPHGKG
FT                   NSMSAEGPMLPTVGGGLLAPRQEVFEGPLPMIQIDGSQGSVYRYGLGLVWDADADPATE
FT                   FPYTIYVMEDSRALGAQLRVFRGRVWFYLGGIGLILLLLQTVILQWSLRPLRRVITELT
FT                   KVQRGETARMSERHPRELEPLTDSINAFIESERENLERQRNTLADLAHSLKTPIAVLRT
FT                   QMDSGAGDGALREELDVQLQRMNNLVSYQLARAASSGHKLFSAPLPIESNAEEIVRGLE
FT                   KVYASKGVLCEFDIDPAARFHGEPGDLQELLGNLLENAFKWANRRVLLTAQPLPAPNAR
FT                   RAGLLLAVDDDGPGIAPDDIGKVLQRGVRGDERVQGHGIGLSIVQDLIKDYRGELTVGR
FT                   SSELGGARFEVQLPPGP"
FT   sig_peptide     278881..279000
FT                   /locus_tag="Smal_0230"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.608 at
FT                   residue 40"
FT   gene            complement(280402..281190)
FT                   /locus_tag="Smal_0231"
FT   CDS_pept        complement(280402..281190)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0231"
FT                   /product="protein of unknown function DUF980"
FT                   /note="PFAM: protein of unknown function DUF980; KEGG:
FT                   xcv:XCV4112 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49936"
FT                   /db_xref="GOA:B4ST93"
FT                   /db_xref="InterPro:IPR010384"
FT                   /db_xref="InterPro:IPR024079"
FT                   /db_xref="InterPro:IPR042252"
FT                   /db_xref="UniProtKB/TrEMBL:B4ST93"
FT                   /protein_id="ACF49936.1"
FT                   /translation="MAQLPAGNVPLIKSLLQWLRPAPRPIDNALWDDACRRAAWLHGLD
FT                   DERRARLRVLATRFLHEKTITPIGELQLQAGDGVLLAALCCLPLLEFGEVGLEGWSQLI
FT                   VYPDAFRVHRSHMDAAGVLHEWDDELIGESWDSGPLILSWADVQADLAAPHEGYCVAVH
FT                   EMVHKLDALDGAMDGTPPLPREWQREWAATFQRAYDAFCVQVDAGEETLIDPYAAEAPE
FT                   EFFAVASEYHFSAPDLLQQALPEVAAQLRRFYGEPPKMVD"
FT   gene            complement(281157..281441)
FT                   /locus_tag="Smal_0232"
FT   CDS_pept        complement(281157..281441)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0232"
FT                   /product="putative secreted protein"
FT                   /note="KEGG: xcv:XCV4111 putative secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49937"
FT                   /db_xref="UniProtKB/TrEMBL:B4ST94"
FT                   /protein_id="ACF49937.1"
FT                   /translation="MRRYAHCLILLMMPFAASATAALDDSRGACVSSNGDAASQRAPTA
FT                   TTSAATTKPAPVRPAASSATSTGGGGSDDDVLQRIRAPKWHSYLPGMFR"
FT   sig_peptide     complement(281376..281441)
FT                   /locus_tag="Smal_0232"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.916 at
FT                   residue 22"
FT   gene            281586..282554
FT                   /locus_tag="Smal_0233"
FT   CDS_pept        281586..282554
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0233"
FT                   /product="biotin/acetyl-CoA-carboxylase ligase"
FT                   /note="TIGRFAM: biotin/acetyl-CoA-carboxylase ligase; PFAM:
FT                   biotin protein ligase domain protein; biotin/lipoate A/B
FT                   protein ligase; Helix-turn-helix type 11 domain protein;
FT                   KEGG: xcb:XC_4026 biotin--protein ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49938"
FT                   /db_xref="GOA:B4ST95"
FT                   /db_xref="InterPro:IPR003142"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="InterPro:IPR004408"
FT                   /db_xref="InterPro:IPR008988"
FT                   /db_xref="InterPro:IPR013196"
FT                   /db_xref="InterPro:IPR030855"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B4ST95"
FT                   /protein_id="ACF49938.1"
FT                   /translation="MDDRQLLAKLAAGRLSGDALARELGQTRAAIWKRIQGLRAAGVDV
FT                   EGRAGEGYGLTRPVDLLDPDAIRAGLPAGVLPLLHDLQVAWTVDSTNAELLRCSAPQRG
FT                   VSVLLAERQTGGRGRRGRAWASPLAAHIYLSVLRLYSGGLGRLAGLSLVAGIAVAEALH
FT                   DLGYTQAQLKWPNDLIVDGRRKLVGLLAEGGGEYAGPARAVIGIGINTHMPPSFAEQIT
FT                   QPWVDLDTLAGKPVDRNVVVAAVLTRLLPALEEFDREGLAPFLPRYAAFDMLAGREVRV
FT                   ELDGQWQHGTALGLADDGALRVRIDGQERLLHAGEVSVRAA"
FT   gene            282551..283282
FT                   /locus_tag="Smal_0234"
FT   CDS_pept        282551..283282
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0234"
FT                   /product="putative transcriptional acitvator, Baf family"
FT                   /note="TIGRFAM: transcriptional activator, Baf family;
FT                   PFAM: Bvg accessory factor; KEGG: xcb:XC_4025 pantothenate
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49939"
FT                   /db_xref="GOA:B4ST96"
FT                   /db_xref="InterPro:IPR004619"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4ST96"
FT                   /protein_id="ACF49939.1"
FT                   /translation="MSDWLFDLGNSRFKFAPLQGDRAGDVQAWAHGAEGMAGQPPHSLP
FT                   SGTTAFVASVAAPSLTSAMLDQLQRRFEHVHVVRTSAECAGVRIAYAKPEKFGVDRFLA
FT                   LLAAAKAQRPVLVVGVGTALTIDLLDANGQHHGGRISASPTTMREALHARAVQLPATGG
FT                   DYSEFANDTADALASGCDGAAVALIERSAQQAHALLGVAPSLLVHGGGAPALMPLLPGA
FT                   DYHPSLVLDGLARWAVHQPAG"
FT   gene            283292..284140
FT                   /locus_tag="Smal_0235"
FT   CDS_pept        283292..284140
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0235"
FT                   /product="Sporulation domain protein"
FT                   /note="PFAM: Sporulation domain protein; KEGG: xac:XAC4016
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49940"
FT                   /db_xref="GOA:B4ST97"
FT                   /db_xref="InterPro:IPR007730"
FT                   /db_xref="InterPro:IPR036680"
FT                   /db_xref="UniProtKB/TrEMBL:B4ST97"
FT                   /protein_id="ACF49940.1"
FT                   /translation="MLTRALIVVLAILNLGVACWWLLRDAPQPPAPPPQPAGVAELRWV
FT                   PGGVDATAAAEASAAAPTAPLMEREPAAKTAVAATPAPATPAQPEVAKPQVAEATPVAA
FT                   AAKPGTPPAPAPAPEKPVTPPVAAEPPRCIALGPFADRAAATSAQGKASTVLSQVRLRE
FT                   QPAASGSARFRVMLPAAANREEAQATVKRIVAAGLSDYYIISQGEDINAVALGQYRNRE
FT                   GAERRMAAVQAAGFQPRLVASGDAGQWWLEGQLAAGTQPAQAQQRSGAAQSRSLECTRL
FT                   R"
FT   gene            284181..284256
FT                   /locus_tag="Smal_R0001"
FT                   /note="tRNA-Thr1"
FT   tRNA            284181..284256
FT                   /locus_tag="Smal_R0001"
FT                   /product="tRNA-Thr"
FT   gene            284440..284727
FT                   /locus_tag="Smal_0236"
FT   CDS_pept        284440..284727
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0236"
FT                   /product="addiction module killer protein"
FT                   /note="TIGRFAM: addiction module killer protein; PFAM:
FT                   protein of unknown function DUF891; KEGG: gme:Gmet_2533
FT                   protein of unknown function DUF891"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49941"
FT                   /db_xref="InterPro:IPR009241"
FT                   /db_xref="InterPro:IPR014056"
FT                   /db_xref="UniProtKB/TrEMBL:B4ST98"
FT                   /protein_id="ACF49941.1"
FT                   /translation="MKIQRTRQFATWIDALKDVTGRARILARIGRLSEGHLGDHRYLAD
FT                   GVSELRIDVGPGYRVYYTQRGRQWVILLAGGDKGSQQRDIEKAREIARAL"
FT   gene            284786..285088
FT                   /locus_tag="Smal_0237"
FT   CDS_pept        284786..285088
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0237"
FT                   /product="putative transcriptional regulator"
FT                   /note="TIGRFAM: addiction module antidote protein; PFAM:
FT                   helix-turn-helix domain protein; KEGG: noc:Noc_0569
FT                   transcriptional regulator, Cro/CI family"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49942"
FT                   /db_xref="GOA:B4ST99"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR014057"
FT                   /db_xref="UniProtKB/TrEMBL:B4ST99"
FT                   /protein_id="ACF49942.1"
FT                   /translation="MVIKKKVELKAFDVAEHLRTPEEMAAYLDACIEESDGDSAFIAKA
FT                   LGDIARAQGMSKVARAAGLSRESLYRALSGERSPDFATILKVTRALGVRLHASAA"
FT   gene            285891..286811
FT                   /locus_tag="Smal_0238"
FT   CDS_pept        285891..286811
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0238"
FT                   /product="arginase"
FT                   /note="TIGRFAM: arginase; PFAM:
FT                   Arginase/agmatinase/formiminoglutamase; KEGG: xcv:XCV4102
FT                   arginase"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49943"
FT                   /db_xref="GOA:B4STA0"
FT                   /db_xref="InterPro:IPR006035"
FT                   /db_xref="InterPro:IPR014033"
FT                   /db_xref="InterPro:IPR020855"
FT                   /db_xref="InterPro:IPR023696"
FT                   /db_xref="UniProtKB/TrEMBL:B4STA0"
FT                   /protein_id="ACF49943.1"
FT                   /translation="MAHPISVSLIGVPTDVGAGHRGARLGPEALRVAGLPEALEARGVD
FT                   VRDLGNLDGPRNPWTAPVEGYRHLDEVVAWNHALMEASYAELQAGRMPIMLGGDHCLGI
FT                   GSITAVARWCREQGKTLRVLWLDAHSDFNTSDVTPSGNIHGMPVACLCGLGPDALTRLG
FT                   GTVPAITPAQMHQIGIRSVDPEEKRLIKTHKVDVYDMRYIDENGMKRTVEAALAGIDEN
FT                   THLHVSFDVDFLDPSIAPGVGTTVPGGVNYREAQLVMEMIADTGRMGSLDIVELNPLLD
FT                   KQNATAELAVDLVESLFGKSTLMRD"
FT   gene            286974..287111
FT                   /locus_tag="Smal_0239"
FT   CDS_pept        286974..287111
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0239"
FT                   /product="Entericidin EcnAB"
FT                   /note="PFAM: Entericidin EcnAB; KEGG: xcb:XC_4013 putative
FT                   entericidin A"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49944"
FT                   /db_xref="GOA:B4STA1"
FT                   /db_xref="InterPro:IPR012556"
FT                   /db_xref="UniProtKB/TrEMBL:B4STA1"
FT                   /protein_id="ACF49944.1"
FT                   /translation="MKRVVALMLLSMFSVALLAGCNTIAGAGKDVQKAGEKVEDTAKGR
FT                   "
FT   sig_peptide     286974..287033
FT                   /locus_tag="Smal_0239"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.513 at
FT                   residue 20"
FT   gene            287315..287536
FT                   /locus_tag="Smal_0240"
FT   CDS_pept        287315..287536
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0240"
FT                   /product="CsbD family protein"
FT                   /note="PFAM: CsbD family protein; KEGG: xac:XAC4007
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49945"
FT                   /db_xref="InterPro:IPR008462"
FT                   /db_xref="InterPro:IPR026042"
FT                   /db_xref="InterPro:IPR036629"
FT                   /db_xref="UniProtKB/TrEMBL:B4STA2"
FT                   /protein_id="ACF49945.1"
FT                   /translation="MNKDIISGKWSQLKGKAQAKWGDLTNDDFDVAEGNAEYLAGRLQE
FT                   RYGWAKDRAEKEVREFQDSVSKDYPDYK"
FT   gene            complement(287610..288410)
FT                   /locus_tag="Smal_0241"
FT   CDS_pept        complement(287610..288410)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0241"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: afw:Anae109_3503 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49946"
FT                   /db_xref="UniProtKB/TrEMBL:B4STA3"
FT                   /protein_id="ACF49946.1"
FT                   /translation="MKRLLPLLLILPLAGFRPAPMPPPVYEGGPVRMALVDRDRGTELR
FT                   AYPADGQRWVAGERGHRYAVRLYNDSPRRVLVVLSVDGVNAISGEDADPSQTGYVLNPG
FT                   QRADITGWRKSQDEVAQFVFSSPSGSYASRTGRPDNIGVVGVAVFEEARRWYPQPILRR
FT                   GLPAPAPAAEAAADASASNSRIEGYASKSQSPALGTGHGAREQSSVRDTDFERASRSPA
FT                   QVLQLRYDSARNLRARGILVDSPSRLPREPQAFPNRYVPDPPAR"
FT   sig_peptide     complement(288327..288410)
FT                   /locus_tag="Smal_0241"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.606) with cleavage site probability 0.600 at
FT                   residue 28"
FT   gene            288519..289811
FT                   /locus_tag="Smal_0242"
FT   CDS_pept        288519..289811
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0242"
FT                   /product="tryptophanyl-tRNA synthetase"
FT                   /EC_number="6.1.1.2"
FT                   /note="KEGG: xcc:XCC3923 tryptophanyl-tRNA synthetase;
FT                   TIGRFAM: tryptophanyl-tRNA synthetase; PFAM: aminoacyl-tRNA
FT                   synthetase class Ib"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49947"
FT                   /db_xref="GOA:B4STA4"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002305"
FT                   /db_xref="InterPro:IPR002306"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR024109"
FT                   /db_xref="InterPro:IPR036913"
FT                   /db_xref="UniProtKB/TrEMBL:B4STA4"
FT                   /protein_id="ACF49947.1"
FT                   /translation="MTTRVLTGITPSGTPHLGNYVGAIRPAIAASRAPGIESFFFLADL
FT                   HSLIKSQDPQRTQRATLEIAASWLACGLDPEHVWFYRQSDIRETTELMWFLTAIASKGI
FT                   LNRAHAYKAAVDKNREEGVDEDAGVSAGLFMYPVLMAADILIFKANQVPVGRDQIQHIE
FT                   MARDFAQRFNHVYGKEYFPLPDVVIDEQVATLAGLDGRKMSKSYHNTIPLFVPREELKK
FT                   LVFSILTDSRAPGEPKDTEGSALFQMYQAFATPEQTAEFAKAFAAGISWGDAKQQLFER
FT                   IDSELSPLRERYNALMAEPEKIEALLKRRGQQLREQLAAPLLDELRHAVGLRDLSSAGD
FT                   IASEDAGVARVAPPLFKQYREKDGRFYFKLTAGDGTLLIQSEGFDSPRDAGQLIAVLKQ
FT                   AEQGDQLQSDLFKLDAEVDAVLAALAMLREA"
FT   gene            289950..290252
FT                   /locus_tag="Smal_0243"
FT   CDS_pept        289950..290252
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0243"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49948"
FT                   /db_xref="GOA:B4STA5"
FT                   /db_xref="UniProtKB/TrEMBL:B4STA5"
FT                   /protein_id="ACF49948.1"
FT                   /translation="MAWLSLLLFLPWFLLLGSLYWLFPRQPRTARRRLFDGAALALALL
FT                   LSILAMLWGHHIGLVQPGAGPIWPQVLAVLYAYGAFLAVLVLALLLRPRFALRCD"
FT   gene            290408..291340
FT                   /locus_tag="Smal_0244"
FT   CDS_pept        290408..291340
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0244"
FT                   /product="beta-lactamase domain protein"
FT                   /note="PFAM: beta-lactamase domain protein; KEGG:
FT                   xac:XAC4005 beta-lactamase related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49949"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="InterPro:IPR037482"
FT                   /db_xref="UniProtKB/TrEMBL:B4STA6"
FT                   /protein_id="ACF49949.1"
FT                   /translation="MTADPSIHTIDTGFQRPDFDAAYLIVENGRAAFVDCGTGLSVPAM
FT                   LQALADAGLGVEAVDWLLLTHVHLDHAGGAGLLMQQLPNAKAVLHPRGAPHMIDPTRLI
FT                   AGATAVYGAEEIARSYGRIEAIPEHRVVVAEDGRRIDLAGRELVLLHTPGHALHHYCVW
FT                   DARSRSWFTGDTFGISYRELDSAQGAFIFPTSSPVQFDPEAMKASIRRMLGYGPQAMYL
FT                   THYGRVEPVEKLADDLFEQIDAMAAIGRQCDGRPDRHRCLLAALQALYLERAQLHGCAL
FT                   DDAAVTAVLAMDIELNAQGLACWLDRISR"
FT   gene            291446..293098
FT                   /locus_tag="Smal_0245"
FT   CDS_pept        291446..293098
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0245"
FT                   /product="peptidase M28"
FT                   /note="PFAM: peptidase M28; KEGG: xcv:XCV4096 putative
FT                   peptidase precursor"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49950"
FT                   /db_xref="InterPro:IPR003137"
FT                   /db_xref="InterPro:IPR007484"
FT                   /db_xref="UniProtKB/TrEMBL:B4STA7"
FT                   /protein_id="ACF49950.1"
FT                   /translation="MRVLLLSSCLFVGGLAHAANDLPGGGIDPQALSRHVRVLASDEFE
FT                   GRAPATEGEERTVQYLIEQFRSYGLQPGGVDGSWVQPVPLVRAQLDGAAKASLSLKQGK
FT                   RALANGVDVTLQSLQPRKRVQIKDAPLVFVGYGIDAPERQWNDYKDVDLHGKIAVVLIN
FT                   DADFEADAPGAFDGKAVTYYGRWTYKFEEAARRGAEGVLIVHETAPAAYGWATVKSSGT
FT                   SPLFDIERGQAEAMAQHTPLRGWMQRELAEAIFADAGLDFDAEKRKAMRADFRPVALDN
FT                   AKLSVDFALKREQVVTRNVVAKLPGGEHADEAVIFSAHWDAFGIGQADAKGDRIRRGAI
FT                   DNATGVATVLELGRVFAAGPQPQRTLYFVALTAEEKGLLGASYYAAHPLAPLDKTAAVL
FT                   NIEMFSPDGATRDIASWGKGRVSLEGDLERVAKARGRSYSPDPNLEAGFFYRADHFAFA
FT                   RLGVPAITIGPGLDKLDGGVEAGRALREKYFADCYHQACDAWTPSWDPAGHAADTLLVY
FT                   DLGAELANSRRWPTWEKESEFRGARDKSEAARR"
FT   sig_peptide     291446..291502
FT                   /locus_tag="Smal_0245"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 19"
FT   gene            complement(293225..293578)
FT                   /locus_tag="Smal_0246"
FT   CDS_pept        complement(293225..293578)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0246"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49951"
FT                   /db_xref="GOA:B4STA8"
FT                   /db_xref="UniProtKB/TrEMBL:B4STA8"
FT                   /protein_id="ACF49951.1"
FT                   /translation="MIAATGAMPVAAASPATPLMWIAATLAAATALAWLLRRPNAQAAW
FT                   PRIGFGIALLVFCAALALQLAVDLGSGHSSLQMRLHRGISPGSPVGLRTMVACYLAALV
FT                   ASGWGAWKLLRRR"
FT   sig_peptide     complement(293492..293578)
FT                   /locus_tag="Smal_0246"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.980) with cleavage site probability 0.402 at
FT                   residue 29"
FT   gene            complement(293589..294923)
FT                   /locus_tag="Smal_0247"
FT   CDS_pept        complement(293589..294923)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0247"
FT                   /product="General substrate transporter"
FT                   /note="PFAM: General substrate transporter; major
FT                   facilitator superfamily MFS_1; KEGG: xcb:XC_4259
FT                   dicarboxylate transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49952"
FT                   /db_xref="GOA:B4STA9"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B4STA9"
FT                   /protein_id="ACF49952.1"
FT                   /translation="MSTTSHSAVPSTDGAALRRSISNTLKGSAGNLVEWYDVYVYSVFA
FT                   VYFESQFFSPDDKNSTMYVWAIFAATFLMRPIGAWFFGRFADRHGRRQALTVSVTLMAA
FT                   CSFLIAITPTAASIGIWAAVILLFARLLQGFATGGEYGASATYMSEAAIPGRRGFLSSF
FT                   HYVTLVGGHVLAQLTLLLMLTFWGKPEISEWGWRIAFGIGGIAAVVVFWLRRGMDESLS
FT                   ESSIEAAREGKAQKSGSMYELFVHQWRPLLLCFLITAGGTVAFYTYSVNGPKMIQSAFA
FT                   ANDPMTGTLINLGVLAFLMVLQPVGGWLSDIIGRKTLLVFFGVGGVLYSWYLITQLPHQ
FT                   HDATLAFLTLALGFVILTGYTSINAVVKAELFPTHVRALGVGLGYALANSLFGGTAPLL
FT                   YQGALKTGHVDWFAIYVTATIAVSLVVYVFFLTNKGPNWLDGTRK"
FT   gene            295236..296141
FT                   /locus_tag="Smal_0248"
FT   CDS_pept        295236..296141
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0248"
FT                   /product="protein of unknown function DUF6 transmembrane"
FT                   /note="PFAM: protein of unknown function DUF6
FT                   transmembrane; KEGG: xac:XAC4003 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49953"
FT                   /db_xref="GOA:B4STB0"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:B4STB0"
FT                   /protein_id="ACF49953.1"
FT                   /translation="MSAPPVPSAAAPRGGLVALALLLVYVVWGSTYLGIAKALHGGALP
FT                   LTMVSGSRFIIAGGLMFLALRLFWKMPNPTLRQWRNLVIMGVTMLVLGNGMVVLAEREV
FT                   SSGLAATAVASVPLWMALFSALRGQHASKGEWLGIAVGFVGVVWLNAGSSLTASPTGLV
FT                   LLLIAPIGWAFGSVWARGLDLPGPFMTAAGQMLCGGVLLVLIGLAVGERPTTLPDTGGL
FT                   LAMAYLCVFGSIVAFTAYVWLLQNVRPALAGSYAYVNPVIAVLLGAALNGERFGWRDFL
FT                   AMAVILLGVVVLTMARTRKK"
FT   gene            296138..297034
FT                   /locus_tag="Smal_0249"
FT   CDS_pept        296138..297034
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0249"
FT                   /product="RarD protein, DMT superfamily transporter"
FT                   /note="TIGRFAM: RarD protein, DMT superfamily transporter;
FT                   PFAM: protein of unknown function DUF6 transmembrane; KEGG:
FT                   xcv:XCV4093 drug/metabolite transporter superfamily
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49954"
FT                   /db_xref="GOA:B4STB1"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="InterPro:IPR004626"
FT                   /db_xref="UniProtKB/TrEMBL:B4STB1"
FT                   /protein_id="ACF49954.1"
FT                   /translation="MSMDEKEQRRGLLVTASTFVIWGLVPVYWHLLNEVPSFQIIAHRI
FT                   IWSTVMVLGWLLLSSKLGWWQKIAAQPRALSILLVSSLTIAFNWGLYIWAINAGHVIET
FT                   SLGYFINPLVNVLLGVLVLKERLRRLQWVAVAMAAIGVAWLTIDAGTPPWIALGLACSF
FT                   GLYGLLRKLVSVDPVAGLGVESLYLFLPALAFAIWAENGHGGAFFHGWGWRNDLLLIFG
FT                   GAITAVPLIGFAYGVKRIPLSLVGILQYIAPSLQLLLGVFFFHEAFDTAKAIGFAAIWA
FT                   GLILFVGDNIRTMRAKR"
FT   gene            complement(297266..300124)
FT                   /locus_tag="Smal_0250"
FT   CDS_pept        complement(297266..300124)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0250"
FT                   /product="TonB-dependent receptor"
FT                   /note="PFAM: TonB-dependent receptor; TonB-dependent
FT                   receptor plug; KEGG: xcv:XCV3187 TonB-dependent outer
FT                   membrane receptor"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49955"
FT                   /db_xref="GOA:B4STB2"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="UniProtKB/TrEMBL:B4STB2"
FT                   /protein_id="ACF49955.1"
FT                   /translation="MSLKTNPLRNAIVIALAASCTTPAFAQSAGDTPTNLDRIEITGSR
FT                   IRQASVETAQPVVALSRAEIEKKGYINVADILQDVTAAGAPSLSRSSSLSSSRDFGGTY
FT                   VSLRNLGPERSLVLIDGRRMGVSAGGYSDLASIPSAIVERVEVLTDGASALYGSDAIAG
FT                   VVNIITRKNFDGGEASVYVGQYGEGDGQKRSYSATFGKTFDRGWFSVGAERTKEDEILG
FT                   SEREFSRYPGGPRHPDDVKALNQTTQWGSVTVDGKSLTVGPGGDPSQKGNFHTPDPADG
FT                   ANTKTNMSLLSGMERTSVFANGGFSITDDLRIVADALYSKRESTKHLAGYPYSVSTAQA
FT                   RNGSRAALSKDSAFNHWGQDVLFSHRTEEMPRATENNLDTKRASIGLEGSFETGSRYWD
FT                   WNVSYMYNRNEGERIGTGSMYQPHVDLAVGPSFMDGTVARCGSPGAVIAGCVPWNPAAP
FT                   MGYAGPGSLSNQDVQDYLFTRFVDKMKSTTKVASANISGSVFSLPAGDVMAAMGFEHRS
FT                   EEASYTPDLMVQKGQIAGTTGQPTRGDYSLNEVYLELQVPLLADMPFARELSLDLAGRY
FT                   TDYNTFGSTTNSKFGLKWKPIDSLLVRATYGTGFRAPTVDDLYSGGAKSRDSFTDPCDT
FT                   SFGIAASSATVAARCQALKVPANFRQQTASEGNVANRPGQQGIADFDSGSNANLKPETA
FT                   KTWTVGLVYSPEFVPGLDVSLDWWKIRIDNAIVGESATDILNQCYVQGVDSACGRFTRS
FT                   TSAKTLGQVTALDRSLVNAGYRETAGYDFSLRYRLPETSFGRFAATWNTTYTDYLEQRN
FT                   DSAATTPVEQKTGWQGNFRVRSTFNLDWQYGDLGIGWTARYYSGMKEACSYDLGGGPDC
FT                   NMAGFVSPYTDAQPSRKVGSNTFHDLQVRYSLPWDGTVSLGVNNVFDHQGPIMYSQPNS
FT                   SFTYYGGFDIGRFMYMKYQQRF"
FT   sig_peptide     complement(300044..300124)
FT                   /locus_tag="Smal_0250"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.947 at
FT                   residue 27"
FT   gene            complement(300495..301817)
FT                   /locus_tag="Smal_0251"
FT   CDS_pept        complement(300495..301817)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0251"
FT                   /product="protein of unknown function DUF214"
FT                   /note="PFAM: protein of unknown function DUF214; KEGG:
FT                   xom:XOO_0138 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49956"
FT                   /db_xref="GOA:B4STB3"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR025857"
FT                   /db_xref="UniProtKB/TrEMBL:B4STB3"
FT                   /protein_id="ACF49956.1"
FT                   /translation="MFKSKLKKWLGNALTALLLVIGLVLWIGLPWIGVLAVAVLVALWL
FT                   LLTRGGRLALAATRIGVASLPQRWGASSVIVVGIAGVVGVLVAMLAMGEGFQATLNNTG
FT                   DDTTAIVLRGGSQAETNSVITREQVPTLSTLPGISRDAEGRPLLSPELSQVVNLVSKSD
FT                   GTDVNAQFRGVGPQAWAVHDKVKIVEGRTFATGLREIVVGQGAKGQFRDLDVGKTLTLG
FT                   NQTWTVVGVFATGDAHDSELWTDADTLATTYQRSAWQSISVRTDGKPGFEQFKAAVAAD
FT                   PRLKLDVETTRVYYSKQGGGLTKLIDILGKVIGTIMAVGAVFGALNTMYAAVATRAREI
FT                   ATMRAIGFRGLPVVTAVMLETMLLALLGGLLGCAVAWLLFNGYSVSTIGSNFSAVVFKF
FT                   HVSSELLWTGLKWALGIGLVGGLFPALRAARLPITTALRET"
FT   sig_peptide     complement(301701..301817)
FT                   /locus_tag="Smal_0251"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.996) with cleavage site probability 0.548 at
FT                   residue 39"
FT   gene            complement(301831..302988)
FT                   /locus_tag="Smal_0252"
FT   CDS_pept        complement(301831..302988)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0252"
FT                   /product="protein of unknown function DUF214"
FT                   /note="PFAM: protein of unknown function DUF214; KEGG:
FT                   xom:XOO_0137 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49957"
FT                   /db_xref="GOA:B4STB4"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR025857"
FT                   /db_xref="UniProtKB/TrEMBL:B4STB4"
FT                   /protein_id="ACF49957.1"
FT                   /translation="MKYFSLVWAQLFRTRTRTLLTLLSVVAAFLLFGMLDSVRVAFTSG
FT                   GSVEGANRLVTASRLSITQSLPIRLETQIRQVAGVRDVAYGMWFGGIYQDPKNFFPNFS
FT                   VSPNYFDVYRELQIDPAQLEDWKNTRTGAIVGETLAKQFGWKIGDTIPLQATIFPRGGS
FT                   NDWPLELKGIYRSRDPAQASNEERQLMMNWKYFDESNDYIKNQVSWYTVTLDNPDHSSR
FT                   VAQAIDAISANSDHETKTQTESAFQQAFVKQFADIGMIVTSIMGAVFFTLLLLTGNTMA
FT                   QAVRERVPELATLKTLGFKDSTVLMLVMVESVLLIGLGGLIGMGLAALILPAIGPKSMG
FT                   MLPPHVPTPTWLMGLGLIVVIGIIVGLLPALRAKRLKIVDALAGR"
FT   sig_peptide     complement(302887..302988)
FT                   /locus_tag="Smal_0252"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.972) with cleavage site probability 0.547 at
FT                   residue 34"
FT   gene            complement(303003..303692)
FT                   /locus_tag="Smal_0253"
FT   CDS_pept        complement(303003..303692)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0253"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: xac:XAC3996 ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49958"
FT                   /db_xref="GOA:B4STB5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B4STB5"
FT                   /protein_id="ACF49958.1"
FT                   /translation="MSTLVSLRNITKTYQRGPEKVQVLHGIDLDIASGDFVALMGPSGS
FT                   GKTTLLNLIGGLDNPSGGEISIEGERIDQMSGGQLSTWRSHHVGFVFQFYNLMPMLTAQ
FT                   KNVELPLLLTHLSAAQRKRNAEIALTLVGLADRRSHRPNELSGGQQQRVAIARAIVSDP
FT                   TFLICDEPTGDLDRQSAEEILGLLQQLNREHGKTIIMVTHDPKAAEYATHTVHLDKGEL
FT                   ADAPLTH"
FT   gene            complement(303795..305048)
FT                   /locus_tag="Smal_0254"
FT   CDS_pept        complement(303795..305048)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0254"
FT                   /product="efflux transporter, RND family, MFP subunit"
FT                   /note="TIGRFAM: efflux transporter, RND family, MFP
FT                   subunit; PFAM: secretion protein HlyD family protein; KEGG:
FT                   xcv:XCV4088 membrane fusion protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49959"
FT                   /db_xref="GOA:B4STB6"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:B4STB6"
FT                   /protein_id="ACF49959.1"
FT                   /translation="MNASAELLKELRIDRKSPPPASGGSGSGGGRRWLWIAIIVIVLLL
FT                   AAAAFALFGRTPAVDVETAPAVAIQQGNASSSVLDASGYVVARRMATVSAKITGKVREV
FT                   MIEEGMRVEQGQIMATLDPIDADAQRSLYASQLQAARSQVAGLEAQQKQAAAEASRLQA
FT                   LVGQQLVSRSQYDQAVAQRDSLRAQLDTAQRNVKVANDQLAIADLGVDNNIVRAPFSGV
FT                   VTAKAAQPGEIVSPLSAGGGFTRTGIGTIVDMESLEIEVEVGEAFIGRVQPKMPVEATL
FT                   NAYPEWKIPGEVIAIIPTADRGKATVKVRVALKVKDPRIVPEMGVRVSFLEQAQPQAAA
FT                   KPQGVRVPGGAVVQREGTSVAFVLGDESRVQQRTVEAGQAMGKDRQILKGVSAGESVVV
FT                   NPPDTLRDGAKVQQKQAQ"
FT   gene            305251..306147
FT                   /locus_tag="Smal_0255"
FT   CDS_pept        305251..306147
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0255"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: ccr:CC_1147 ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49960"
FT                   /db_xref="GOA:B4STB7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B4STB7"
FT                   /protein_id="ACF49960.1"
FT                   /translation="MDPIAPSLARLQQVQVRYRDHTALHGIDLQVRAGQVLALLGRNGA
FT                   GKSTAISVLLGLRRADGGQVELLGGDPQQRTSRLGLGVMLQSTSLPPMLQVDELVAQAS
FT                   ACYPDPMPLQEVLQRAGLQALARRRYGQLSGGQQRAVQFAIALCGRPRVLFLDEPTTGL
FT                   DIQARRVMWQAIRQLVAEGCGVLLTTHYLEEAEALAQQVVVLEQGRVLADAPLSELRLA
FT                   DRPRRIRCRSGLPMEDVQQWPGVQEVQRDGEHLQLLASPAEPVVARLLAADAQLRELEV
FT                   QGAALADAFLDMTREAA"
FT   gene            306144..306920
FT                   /locus_tag="Smal_0256"
FT   CDS_pept        306144..306920
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0256"
FT                   /product="ABC-2 type transporter"
FT                   /note="PFAM: ABC-2 type transporter; KEGG: ilo:IL0311
FT                   ABC-type multidrug transport system, permease component"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49961"
FT                   /db_xref="GOA:B4STB8"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/TrEMBL:B4STB8"
FT                   /protein_id="ACF49961.1"
FT                   /translation="MNTLIRTARLPLPAWRQALRPYRAELLAELRRAWRTPAFAVPSLL
FT                   FPVLFYLLFGVLLGRGHAPLYLLATYCVFGAMAPALFGFGVQLALDREGGLLTLKRALP
FT                   MPAAAPLLARLAMAVMFALLVALLLIGVARVFGGVQLQALQMVQLLAVAGLAALPLGAI
FT                   GLLIGSHVSASAAPAMVNLVYLPLALLSGLWLPLSALPKFFSTMAPLWPTWHLAQLALP
FT                   VVGLPSVGSLAGHLLVLLAVTVVALLLARRRLRRIG"
FT   gene            306927..308141
FT                   /locus_tag="Smal_0257"
FT   CDS_pept        306927..308141
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0257"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase dimerisation and phosphoacceptor region;
FT                   KEGG: xcv:XCV4087 two-component system sensor kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49962"
FT                   /db_xref="GOA:B4STB9"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B4STB9"
FT                   /protein_id="ACF49962.1"
FT                   /translation="MIGSDRPRLDSPVSSSWLASLLRPAPDSAVAELLRRGKSPWSGAI
FT                   HLLWSVWIFLTPVLGNGFTLRWLLLTLVSYPLFLLFYAKVMLAPRHHAWRYALGMIVMA
FT                   LVLLPWYPSGLSYFVFGCVMIRMSSRGGWWQYLLQLTGLNLLFCSTALYFGYPWQAMVW
FT                   MPAVSFIVGLVVNVEALSQQRDVALQLSQDEVRRLATTAERERIGRDLHDLLGHTLSLI
FT                   TLKLELARKLYDRDDERARQEIGEAEAIAREALAQVRSAVTGIRASDLAGELASARLLL
FT                   ECQQVHLQYTAPPAMPVEVERGLALVLREAATNIVRHAQATRVQVDFMLEDRQLAMQIR
FT                   DDGRGGVQAEGNGLSGMRERAAALGGQLTLQSPRGEGTLLTVRVPLMAATTPLSPASLA
FT                   QGGAA"
FT   gene            308138..308740
FT                   /locus_tag="Smal_0258"
FT   CDS_pept        308138..308740
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0258"
FT                   /product="two component transcriptional regulator, LuxR
FT                   family"
FT                   /note="PFAM: regulatory protein LuxR; response regulator
FT                   receiver; Bacterio-opsin activator HTH domain protein;
FT                   sigma-70 region 4 domain protein; Sigma-70 region 4 type 2;
FT                   KEGG: xcv:XCV4086 two-component system response regulator,
FT                   LuxR family"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49963"
FT                   /db_xref="GOA:B4STC0"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:B4STC0"
FT                   /protein_id="ACF49963.1"
FT                   /translation="MIRILLAEDQAMVRGALSALLGLEPDIEVLGSAADGEAAWRMLQQ
FT                   LQPDILVTDIEMPGLSGLELAQRIARHELPIKVVIVTTFARAGFLRRALEAGVLGYLLK
FT                   DAPAENLADALRKVKQGIRAIDPQLALDAWSQADPLTDRERRVLRLAGEGRTASEIAEQ
FT                   LGLSHGTVRNYLSECIGKLGVANRIEAYRLARQKGWL"
FT   gene            complement(309349..309885)
FT                   /locus_tag="Smal_0259"
FT   CDS_pept        complement(309349..309885)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0259"
FT                   /product="cytochrome B561"
FT                   /note="PFAM: cytochrome B561; KEGG: xac:XAC3991 cytochrome
FT                   b561"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49964"
FT                   /db_xref="GOA:B4STC1"
FT                   /db_xref="InterPro:IPR011577"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="UniProtKB/TrEMBL:B4STC1"
FT                   /protein_id="ACF49964.1"
FT                   /translation="MSTGNGHFNLLARVLHWSMALMIIAMLFIGVTMVASLHLRPMLID
FT                   LHRPLGIAIGVLVLLRLYNRLRHRPPPLPADLPVWQVMAAKASHWMLYALMLAMPLIGW
FT                   AMLSAGGYPIVLWGGLHLPPIVPHTPALYAALRNAHSLLAYVLFATVLMHVGAALFHLW
FT                   VRRDGVFQAMARGKD"
FT   sig_peptide     complement(309781..309885)
FT                   /locus_tag="Smal_0259"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.633) with cleavage site probability 0.561 at
FT                   residue 35"
FT   gene            complement(309882..310985)
FT                   /locus_tag="Smal_0260"
FT   CDS_pept        complement(309882..310985)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0260"
FT                   /product="Catalase domain protein"
FT                   /note="PFAM: Catalase domain protein; KEGG: xac:XAC3990
FT                   catalase"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49965"
FT                   /db_xref="GOA:B4STC2"
FT                   /db_xref="InterPro:IPR011614"
FT                   /db_xref="InterPro:IPR018028"
FT                   /db_xref="InterPro:IPR020835"
FT                   /db_xref="InterPro:IPR024168"
FT                   /db_xref="UniProtKB/TrEMBL:B4STC2"
FT                   /protein_id="ACF49965.1"
FT                   /translation="MSLFRYTRAGQTPGAPRKHSPLLWIALIALILGAVALAFAWLAGW
FT                   IGGRLTAQRFTDTIEATGPAHPGFRRAHSKGICVSGWFEPSSQAPTLSSARVFSQQKVP
FT                   VMGRLSIGGGDPYGADNTARVRSLAVQMVSDDGQEWRMAMNSFPFFAAPNAEAFYEQTR
FT                   ASIPDPATGKPDPQKMAAVLAKYPSAQAFQQWAKTAPWTSSWADTTFNSVNSFWFTNVQ
FT                   GQKRAVRWRWQPQAPVVEMDADTRKKASVDFLSQELQQRLASGPVRWNLVVTTAEPGDA
FT                   IDDPSVPWPESREQVVAGVLSLDRLQSQEQGACGQINFDPLILPSGVRGSDDPILAARS
FT                   AVYSQSFNRRERERASGNVEQPKEAAR"
FT   sig_peptide     complement(310863..310985)
FT                   /locus_tag="Smal_0260"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.985) with cleavage site probability 0.760 at
FT                   residue 41"
FT   gene            complement(311121..312488)
FT                   /locus_tag="Smal_0261"
FT   CDS_pept        complement(311121..312488)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0261"
FT                   /product="Leucyl aminopeptidase"
FT                   /EC_number="3.4.11.1"
FT                   /note="PFAM: peptidase M17 leucyl aminopeptidase domain
FT                   protein; KEGG: xcb:XC_3992 leucine aminopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49966"
FT                   /db_xref="GOA:B4STC3"
FT                   /db_xref="InterPro:IPR000819"
FT                   /db_xref="InterPro:IPR011356"
FT                   /db_xref="UniProtKB/TrEMBL:B4STC3"
FT                   /protein_id="ACF49966.1"
FT                   /translation="MSEITGFTADTAAALPLHVLGREQFAAWKDGQPAATQAWLASQGF
FT                   NAGAHSVALLPGADGLAGAVIGVGDRADAYSYAHAPHALPEGSVWQLATELPAEEQALL
FT                   QLGWGLGSYRFDRYRKRNRAPAQLVAAPSGEVADLIAASLRVRDWVNTPTEDMGPQQLE
FT                   DAARALAQAHGAQVEAITGDELLKQNFPAIHAVGRASHRAPRMVVLRWGKETDPALVLV
FT                   GKGVCFDTGGLDIKPADGMRNMKKDMGGAAHALALAGLVMARRLPVHLTLLVPAVENAI
FT                   GPDAFRPGEVIATRKGLSVEIDNTDAEGRVILCDALTFASEQKPDLVLDFATLTGAARI
FT                   ALGPDLPALFSNDDAVAQQWLQAGDATRDPVWRMPLWRPYLRYLSSGIADLANAGSRMA
FT                   GSVTAALYLERFLEDGQRWAHLDVYAWNDGERPGRPAGGEALALRSAWAMLKARYS"
FT   gene            complement(312492..313211)
FT                   /locus_tag="Smal_0262"
FT   CDS_pept        complement(312492..313211)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0262"
FT                   /product="HAD-superfamily hydrolase, subfamily IA, variant
FT                   1"
FT                   /note="TIGRFAM: HAD-superfamily hydrolase, subfamily IA,
FT                   variant 3; HAD-superfamily hydrolase, subfamily IA, variant
FT                   1; PFAM: Haloacid dehalogenase domain protein hydrolase;
FT                   KEGG: xcb:XC_3991 hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49967"
FT                   /db_xref="GOA:B4STC4"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:B4STC4"
FT                   /protein_id="ACF49967.1"
FT                   /translation="MKFPVLAITLDLDDTLWPFAPIGARIDLVLHEWMREHSPATAAMY
FT                   PLAAMRELRERSFRDNPHLHHDLSALRRLTLQEALQNSGASLELLEPAYEAFYAARNQV
FT                   ECYPDAIDALARIAARVPVAALSNGNADLERIGLAHHFAFQLGAREHGAAKPEASIFHA
FT                   ACTRLGVAPAQVLHVGDHAEMDVAGAIAAGLRGCWINREAATWTHPQLQPDLQFDTLTG
FT                   LADWLDDNLDAAAPRST"
FT   gene            complement(313243..314352)
FT                   /locus_tag="Smal_0263"
FT   CDS_pept        complement(313243..314352)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0263"
FT                   /product="protein of unknown function UPF0118"
FT                   /note="PFAM: protein of unknown function UPF0118; KEGG:
FT                   xcb:XC_3990 transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49968"
FT                   /db_xref="GOA:B4STC5"
FT                   /db_xref="InterPro:IPR002549"
FT                   /db_xref="UniProtKB/TrEMBL:B4STC5"
FT                   /protein_id="ACF49968.1"
FT                   /translation="MSESLLSPSPAGPEAPEAPLPPPSRPRGPMSLVVLAALAVGYTLW
FT                   AAQDIILPVLLAMFFALVGNPILRLLQKLWIPRALGALLILGAGLGVTGSLAVQLIGPA
FT                   MEWAQEAPQQLRKVARQVQDLTKPVQQANQAAENFARVAGGDSNRKVQVIRTQLDDPYR
FT                   MLTRAPRLAASVLAVVLLTLFFMIYGQSLQRAAIALFPNRQQQRFTSDILRSIEREVSR
FT                   YVLTISVINTLVGLVFAGVLMLLGISLQEALLWGTVAALLNFAPYVGPLIGVALMLLMG
FT                   FVEFRDPLQALLPAAAYLGLHTLEGQMVTPIVLGRRMKLSPLVLILALMLFGWAWGMIG
FT                   LLLAVPLLVCIKLVLARLDGMQGWARLLE"
FT   gene            complement(314420..314887)
FT                   /locus_tag="Smal_0264"
FT   CDS_pept        complement(314420..314887)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0264"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xcb:XC_3989 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49969"
FT                   /db_xref="UniProtKB/TrEMBL:B4STC6"
FT                   /protein_id="ACF49969.1"
FT                   /translation="MKFGALQRRVKRCEQVVTVRMGETQDHWGTLSQVWRQGWSPLRII
FT                   VVGLAGGFIAGKLEVPGRVNGARWLQMVGSVSNLFASAQAAFATAMAAQAAATADDAAE
FT                   EADDASEHAQAAASAAEARPAPAPRSVPEPVPEPDPRGPRPAEAATELSER"
FT   gene            complement(314884..315354)
FT                   /locus_tag="Smal_0265"
FT   CDS_pept        complement(314884..315354)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0265"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xcv:XCV4076 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49970"
FT                   /db_xref="GOA:B4STC7"
FT                   /db_xref="InterPro:IPR009937"
FT                   /db_xref="UniProtKB/TrEMBL:B4STC7"
FT                   /protein_id="ACF49970.1"
FT                   /translation="MSEENAQAPDPAATPPLDESIRQVGAAGRAAADSAKHTVRSLRRL
FT                   ASADFALARSAFGRALAWAGVAIVFGASAWLLMAATLIALLQSWGLSWLQALLITSLLS
FT                   LAVTGYAIWRVSYFFHHTGMHATRRQLSRLGLFDEPSEDDPDAGVQLPEGKP"
FT   gene            complement(315363..315728)
FT                   /locus_tag="Smal_0266"
FT   CDS_pept        complement(315363..315728)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0266"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xcb:XC_3987 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49971"
FT                   /db_xref="UniProtKB/TrEMBL:B4STC8"
FT                   /protein_id="ACF49971.1"
FT                   /translation="MSPTNTENLKDHLGEAGSHLKQAASAAGGAIKGATGAATDELRIG
FT                   KANVKAELSDSALSGLAAAEFGGAAAKEQVDALMDKGKDLIDSAAELIRERPLASFGVA
FT                   FAAGWIIAKLARGSSDK"
FT   gene            complement(315830..317263)
FT                   /locus_tag="Smal_0267"
FT   CDS_pept        complement(315830..317263)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0267"
FT                   /product="protease Do"
FT                   /EC_number="1.3.1.74"
FT                   /note="KEGG: xcv:XCV4074 protease DO precursor; TIGRFAM:
FT                   protease Do; PFAM: peptidase S1 and S6 chymotrypsin/Hap;
FT                   PDZ/DHR/GLGF domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49972"
FT                   /db_xref="GOA:B4STC9"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR001940"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR011782"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:B4STC9"
FT                   /protein_id="ACF49972.1"
FT                   /translation="MRPLPTLLTLAIAAAFGGFVATGLNAHLDNRADAAPLPAVLPTAA
FT                   ALPASVAGQAVPSLAPMLEKAMPAVVSVNTKQVVRVRNPFFNDPFFRRLFPDIPQERIN
FT                   ESLGSGVIIDAKEGLVLTNHHVIDNADDVQVTLADGRTVKAEFLGSDRDTDIALIRIPA
FT                   QNLTDIKLGNSDQLRVGDFVVAIGNPFGFSQTVTSGIVSAVGRSGIRGLGYQNFIQTDA
FT                   SINPGNSGGALVDLQGQLVGINTASFNPQGSMAGNIGLGLAIPSNLARSVVDQLVKHGV
FT                   VVRGTLGVESQNLTAQIAQGLGLGETRGALVTRVLAGSAAAAAGLKPGDVVVSANGQRV
FT                   DSAEALHNVEGLATVGSPLTLDVRREGKPLQIKAILKEQARAVTGDSLDPRLGGATFVD
FT                   LPESLRQSGAGGVLVSEVKRGSRAASNGLQQGDIITDATVGEFADLASWRANFQQRPPT
FT                   LVLRVLRNNGQQQGQLVMR"
FT   sig_peptide     complement(317183..317263)
FT                   /locus_tag="Smal_0267"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.869 at
FT                   residue 27"
FT   gene            317755..318663
FT                   /locus_tag="Smal_0268"
FT   CDS_pept        317755..318663
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0268"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bvi:Bcep1808_0573 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49973"
FT                   /db_xref="UniProtKB/TrEMBL:B4STD0"
FT                   /protein_id="ACF49973.1"
FT                   /translation="MSNGNGVSVVTDAVENVKETATNVGETIAHAAEDAVKSVKKTVKR
FT                   ATKAAGTRVAKAKKAVAKVEKTVAKKAEKAAKSVGKTVANAKKKLEAAKKNAKAEAAAL
FT                   KKEVAKKKAAAGKAVTKKAAAAKKTTKAATKAAGKKVATVKKAATKKAAVAKKTVAKKA
FT                   AAAKKVVDKKVATAKKAVAKKTVAAKKVAGKKVVAAKKVVGKKAAVAKKVATKKTAAAK
FT                   KVVGKKAAVAKKVVGKKTAVAKKAVGKKAAVAKKAVGKKVAATRKTVAKKAAPLKKVAA
FT                   KKAPAKKAPAKKAVRKVAKRK"
FT   gene            318771..319460
FT                   /locus_tag="Smal_0269"
FT   CDS_pept        318771..319460
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0269"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pde:Pden_1723 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49974"
FT                   /db_xref="GOA:B4STD1"
FT                   /db_xref="UniProtKB/TrEMBL:B4STD1"
FT                   /protein_id="ACF49974.1"
FT                   /translation="MRGIDFSSWQGVLSTLAGLVLITLLGVGIRLLVMQTLQQRREREN
FT                   RQINERLRTLMAAYKTLGGSFTGELGVDPSHRRDLRQRQDAEGIAEPRSDRARRIRDAV
FT                   EAALSDILLLGTDEQVRLAARAANELAQGRPVHTHDLVVSLRDFVREALDLAPIPADLQ
FT                   IPPQGPTRPGGASGKGRAEGDAKGGRTGGGGGGGGGMGAGMGGVGLGAGAALGAGHASA
FT                   SDEVDAR"
FT   gene            complement(319476..319835)
FT                   /locus_tag="Smal_0270"
FT   CDS_pept        complement(319476..319835)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0270"
FT                   /product="protein of unknown function DUF1428"
FT                   /note="PFAM: protein of unknown function DUF1428; KEGG:
FT                   xcb:XC_3061 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49975"
FT                   /db_xref="InterPro:IPR009874"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:B4STD2"
FT                   /protein_id="ACF49975.1"
FT                   /translation="MSYIDGFVLAVPTANKEKFLAHARAGNPIFVEFGALRVVECWGDD
FT                   VPHGKTTDFFGAVKATADETVVFSWIEWPDKPTRDAGMKKMMEDPRMDPAKNPMPFDGA
FT                   RMIYGGFVPIYELTR"
FT   gene            320118..320690
FT                   /locus_tag="Smal_0271"
FT   CDS_pept        320118..320690
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0271"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xcb:XC_0215 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49976"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="InterPro:IPR026364"
FT                   /db_xref="UniProtKB/TrEMBL:B4STD3"
FT                   /protein_id="ACF49976.1"
FT                   /translation="MKNSLIALALAAALPFTASAAENLSYNYAEADYAKTDIDAFKADG
FT                   WGVKGSYGFLPNFHAFGDYSRQEIDNTNIKLDQWKIGAGYNVEIAPTTDFVARVAYQKR
FT                   DQKHGLDFNGYSAEAGIRTAFGAHAEVYGMVGYEDFSKKHGINPEGQWYGRLGGQVKLN
FT                   QNWGLNGELKMNRDGDKEYTVGPRFSW"
FT   sig_peptide     320118..320180
FT                   /locus_tag="Smal_0271"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.995 at
FT                   residue 21"
FT   gene            320881..321615
FT                   /locus_tag="Smal_0272"
FT   CDS_pept        320881..321615
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0272"
FT                   /product="two component transcriptional regulator, LuxR
FT                   family"
FT                   /note="PFAM: regulatory protein LuxR; response regulator
FT                   receiver; KEGG: bpd:BURPS668_A0190 capsula synthesis
FT                   response regulator transcription regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49977"
FT                   /db_xref="GOA:B4STD4"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:B4STD4"
FT                   /protein_id="ACF49977.1"
FT                   /translation="MPTFPSPRDSPYRLLLLDPHPLLRHGVQEVLARQAGLQVDGSYGR
FT                   SGDLLQRLQQQAAAIDLLLVDALPMGDSGEGLELLRHLSRHWPAVPILVLSAHCNAGVV
FT                   SLALQAGARGFLSKACAPQMLLRAVSVVARGGRFVPPELRAQWNQSRRQRQQPVRPPRL
FT                   STRERTVLQWVLRGCSTGEMAHRSGRTASTISTQKRAAYRKLGIRNDGELFRFRHLIDA
FT                   DRGGVTRPGTASLPPALNRPRG"
FT   gene            complement(321560..321949)
FT                   /locus_tag="Smal_0273"
FT   CDS_pept        complement(321560..321949)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0273"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xcb:XC_3253 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49978"
FT                   /db_xref="UniProtKB/TrEMBL:B4STD5"
FT                   /protein_id="ACF49978.1"
FT                   /translation="MDAILTPVSIGELIDKITILEIKAERIDDAAKLSNVRTELDGLLP
FT                   LLQLQLQAQPALAMLKQQLKAINERMWDIQDQLRDKEAAQVFDDAFIQLARGVYGTNGE
FT                   RVQVKNEINRVAGSALVEEKQYQGE"
FT   gene            322128..322826
FT                   /locus_tag="Smal_0274"
FT   CDS_pept        322128..322826
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0274"
FT                   /product="conserved hypothetical protein"
FT                   /note="PFAM: conserved hypothetical protein; KEGG:
FT                   pap:PSPA7_3711 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49979"
FT                   /db_xref="InterPro:IPR010239"
FT                   /db_xref="UniProtKB/TrEMBL:B4STD6"
FT                   /protein_id="ACF49979.1"
FT                   /translation="MNSKGMMAAMVAALAGMLGIGSAQAQVQVSGSAALTSDYVWRGSS
FT                   QSDGDPAVQAGAKVALASGWYASAWGSNVSFKPDNGARSEFDLVAGWSGALAPDWTLDA
FT                   NLTRYVYPGTGRALDWTELNTTLNWKQRAWLQVAHSSDALAGGHRGTYAQFGVRVPLHE
FT                   RVRLEAVVGQYWLATAQGPDYLHGQLSAIATLTPAWELRATVHDTDNAAKRLFPGNAGG
FT                   RWELALQGSF"
FT   sig_peptide     322128..322205
FT                   /locus_tag="Smal_0274"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.994 at
FT                   residue 26"
FT   gene            complement(322823..324064)
FT                   /locus_tag="Smal_0275"
FT   CDS_pept        complement(322823..324064)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0275"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   ppu:PP_1850 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49980"
FT                   /db_xref="GOA:B4STD7"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B4STD7"
FT                   /protein_id="ACF49980.1"
FT                   /translation="MTAAGGHCAPRILEHRVSPSLPPLHRWQVLLMSVATGVAVASNYY
FT                   AQPLLHTIADAFGVPFGQVGMVVTVAQLSYAAGLILLVPLGDLFERRRLIVVMSLLSAT
FT                   GLVISACAPSLAWLLVGTAITGLFSVVAQVLVPFAATLASPEHRGRVVGTLMSGLLLGI
FT                   LLARTVAGLLSSLGDWRLVYAIAAGTLVLTALALQRGLPRFHHSAGLGYFALLRSIGSL
FT                   FVQEPVLRHRTLLGACSFAMFAIFWTPLAFLLAQPPYAYSDATIGLFGLVGAAGTLAAG
FT                   LAGRMSDRGQTGRATAIALVLLLLSWLPLGLSAHSLLALLVGVVVLDLAAQLLHVSNQN
FT                   LIYALQPAARNRLNAGYMTGYFIGGSLGSLLSAQVYQRFGWTGVCVAGAAVAALALLLW
FT                   LPGALRARQTTAAN"
FT   gene            324115..325002
FT                   /locus_tag="Smal_0276"
FT   CDS_pept        324115..325002
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0276"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: ppg:PputGB1_1427 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49981"
FT                   /db_xref="GOA:B4STD8"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B4STD8"
FT                   /protein_id="ACF49981.1"
FT                   /translation="MNLKQLEFAVALAEEGNFTRAAERCHVVQSALSHQIANLEQELGT
FT                   PLFERLPRQVRATAAGEVLLVHARQVLASLRHLRADVAAVSGEVRGLLAIGQISSLTDI
FT                   DVVAMLAAFQQAHPQVEFQLRVDKSEDLIAQVQSRELDVALVGLAPSAGLDGVCHQMLQ
FT                   EEDLVAVLAPSHRLAGHTRLPLAALQDEALVDFPRGTGARRQTDDAFAAAGLPHTVRFE
FT                   VNLMELIERFVRHGLAVGIVPALIADGFQGVVQIPLQPTPTRRVHLVWQRLPTPAARAF
FT                   VAAVLSRAGAGSGP"
FT   gene            complement(324971..325438)
FT                   /locus_tag="Smal_0277"
FT   CDS_pept        complement(324971..325438)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0277"
FT                   /product="protein of unknown function DUF1456"
FT                   /note="PFAM: protein of unknown function DUF1456; KEGG:
FT                   xcb:XC_0287 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49982"
FT                   /db_xref="InterPro:IPR009921"
FT                   /db_xref="UniProtKB/TrEMBL:B4STD9"
FT                   /protein_id="ACF49982.1"
FT                   /translation="MINNDVLRSVRYSLDLGDHHVVTLCQLADPAFAVDTEQVKAWLRR
FT                   DDEAGFEAMNDSALAHFLDGLIVHLRGRDESQPQRAVETRIDNNLVLKKLRVAFQLRDV
FT                   DLMEIFASAGFNVSKSEIGALFRQPGHTNYRRCLDQMLRNFLKGLSLRLRG"
FT   gene            325601..326353
FT                   /locus_tag="Smal_0278"
FT   CDS_pept        325601..326353
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0278"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase;
FT                   short-chain dehydrogenase/reductase SDR; KR domain protein;
FT                   KEGG: xcv:XCV4032 putative oxidoreductase precursor"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49983"
FT                   /db_xref="GOA:B4STE0"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B4STE0"
FT                   /protein_id="ACF49983.1"
FT                   /translation="MTRTVLITGATSGFGAAAVHRFAQAGWKVIATGRRGERLQPLVER
FT                   YGKDVVHAAVFDIRDPVAMEAALLALPPAFGEIDLLVNNAGLAQGTAPAQSAKLSDWTT
FT                   MIDTNITALVTLTHRLLPQLVERKGAIINISSVAGVYPYPGGNAYGGTKAFVSQFSLGL
FT                   RSDLHGTGVRVTTIEPGMAETEFTVVRTHGDQAASDKLYTGANPMTAEDIAEQIFWVAT
FT                   LPPHLNINRLELMPVSQSFAGFQVAREG"
FT   sig_peptide     325601..325678
FT                   /locus_tag="Smal_0278"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.994) with cleavage site probability 0.553 at
FT                   residue 26"
FT   gene            complement(326515..327426)
FT                   /locus_tag="Smal_0279"
FT   CDS_pept        complement(326515..327426)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0279"
FT                   /product="Sporulation domain protein"
FT                   /note="PFAM: Sporulation domain protein; KEGG: xcv:XCV4030
FT                   putative secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49984"
FT                   /db_xref="GOA:B4STE1"
FT                   /db_xref="InterPro:IPR007730"
FT                   /db_xref="InterPro:IPR036680"
FT                   /db_xref="UniProtKB/TrEMBL:B4STE1"
FT                   /protein_id="ACF49984.1"
FT                   /translation="MAARRGKNQARRNSSSQGTPGWVWLVAGVAIAAVVFLAAPNLFKG
FT                   EGDGFLRAGPQPNPNAQPAPVADADSDVGTQPAAQPATPKPAEAEKPAATQYDFYTLLP
FT                   GKEVEMSDAELAASARAEDQRRAKAEAQRAQAALEGKPVPPATATATAPAPTATASVAS
FT                   TAPVTATSRPLPAPLSERPAAATPAANTTAASSNTAATTAAPRAEAAPAATSTAATAAP
FT                   AAADNARYILQAGAFGASGDAEATKAKLAMMGLAARVESAQINGKTVYRVRMGPYGSAG
FT                   ELSEAKQKLDGTGLQAMAIKAQ"
FT   gene            complement(327448..329136)
FT                   /locus_tag="Smal_0280"
FT   CDS_pept        complement(327448..329136)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0280"
FT                   /product="arginyl-tRNA synthetase"
FT                   /EC_number="6.1.1.19"
FT                   /note="KEGG: xcv:XCV4029 arginyl-tRNA synthetase; TIGRFAM:
FT                   arginyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49985"
FT                   /db_xref="GOA:B4STE2"
FT                   /db_xref="InterPro:IPR001278"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR005148"
FT                   /db_xref="InterPro:IPR008909"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR035684"
FT                   /db_xref="InterPro:IPR036695"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4STE2"
FT                   /protein_id="ACF49985.1"
FT                   /translation="MKNLLRALISQGIEALRANGTLPADSLPPDFVVERPKTRDHGDFA
FT                   TNAAMLLAKAARSNPRALAQALVEALPRSEDVSKVEIAGPGFINFYLAPAAYQREAASV
FT                   IKEGHDYGRNLSGNGRTVGVEYVSANPTGPLHVGHGRAAAIGDCVARVLDANGWNAKRE
FT                   FYYNDAGVQIENLSLSVQARVKGIAPDQDGWPEGGYRGEYIADVARAYMAGASVDLEGT
FT                   LVVGAKDAKDMQAIRRFAVAYLRNEQNLDLAAFGVDFDIYFLESSLYADGKVAEAVAKL
FT                   QASGHTYEEGGALWLRSTDFGDDKDRVMRKSDGTFTYFVPDVAYHLSKWQRGYERAITE
FT                   LGADHHGSLARVRAGLQAMEVGIPQGWPEYVLHQMVTVMRGGEEVKLSKRAGSYFTLRD
FT                   LIEEAGRDATRWFLIARKPDSQLTFDIDLARQQSNDNPVFYVQYAHARVCSLLRQAQEK
FT                   GLVYEQGNGLANLGRLSDDASLLLMNEISRYPEVVEAAGVALEPHLVAQYLRELAHAFH
FT                   TWYHGTPVLVDDSADRNAKLTLACAARQVLANGLELLGVSAPEKM"
FT   gene            complement(329251..329955)
FT                   /locus_tag="Smal_0281"
FT   CDS_pept        complement(329251..329955)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0281"
FT                   /product="DNA repair protein RadC"
FT                   /note="PFAM: DNA repair protein RadC; KEGG: xcv:XCV4028 DNA
FT                   repair protein RadC"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49986"
FT                   /db_xref="GOA:B4STE3"
FT                   /db_xref="InterPro:IPR001405"
FT                   /db_xref="InterPro:IPR020891"
FT                   /db_xref="InterPro:IPR025657"
FT                   /db_xref="InterPro:IPR037518"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4STE3"
FT                   /protein_id="ACF49986.1"
FT                   /translation="MPIHDWPEQERPREKLMARGPTALSDAELLALFLGSGFGGRDAVQ
FT                   TARDLLQAHGPLRVLLDRPARELARLPGLGPARSCTLAAGLELAHRYLAAELEHGEAVG
FT                   NNPAAVGRYLQHRLRGQAREIFMALFLDNRHRLIACEELFHGTINAAPVYPREVVRRAL
FT                   LHNAAAVILSHNHPSGDPEPSSADTRITDELQQALAMVDVRLLDHFVVGEGRPVSFAER
FT                   GLLSPPQPRLFG"
FT   gene            330107..331162
FT                   /locus_tag="Smal_0282"
FT   CDS_pept        330107..331162
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0282"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: atc:AGR_C_1421 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49987"
FT                   /db_xref="UniProtKB/TrEMBL:B4STE4"
FT                   /protein_id="ACF49987.1"
FT                   /translation="MKRLSLILILSTSILPGPAGAGGAAATYEELSSLANSGAAVVAAS
FT                   FDGAVLAGTGRRGCCFSQAFRWSSQDGVRWLSRQHEAEDSSARAISRDGQIILVETRIS
FT                   TAMQVLRWLPDGERVAVTPVSQSHRGLAMNADGTVVGGAEYLYHSPDSEQPYLWSEAEG
FT                   YRILPAPGGADGTRPTHFDPDPAVVHGIFFVDGPEPGNPARPMRIRWRNDEIDPASLAP
FT                   MPDDTLQIGQIAMEQSLQVAGIDRYEPMSIVWMDLQGGILLGSEPFSNQALIWTRSNGV
FT                   CRLEDWLRALPVELPEETRWEGSLVSPDGRVLVGVGHRKEGEEQVPWRVSSEVPLADIV
FT                   LSAPGCAASAS"
FT   sig_peptide     330107..330172
FT                   /locus_tag="Smal_0282"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.938 at
FT                   residue 22"
FT   gene            complement(331174..331800)
FT                   /locus_tag="Smal_0283"
FT   CDS_pept        complement(331174..331800)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0283"
FT                   /product="two component transcriptional regulator, LuxR
FT                   family"
FT                   /note="PFAM: regulatory protein LuxR; response regulator
FT                   receiver; KEGG: bcm:Bcenmc03_4702 two component
FT                   transcriptional regulator, LuxR family"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49988"
FT                   /db_xref="GOA:B4STE5"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:B4STE5"
FT                   /protein_id="ACF49988.1"
FT                   /translation="MHPRIIIADDHPVVLHGIRVVLQTHLMDVVGSACDGAELLQLVDN
FT                   NDCDAVLTDLSMPGAGPDGPELIDALRARHPGLPVVVLTGARHPGLLDGLLREGISGLV
FT                   DKCADFTELPQALSAALAGQVFVSQQLRHHLQARDLLFPREPAPLSAREQEVLDLLAAG
FT                   LSVNAVAERCGRSPKTISRQKAEAKRKLGLQNNQELFDYLQTRRD"
FT   gene            332029..333291
FT                   /locus_tag="Smal_0284"
FT   CDS_pept        332029..333291
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0284"
FT                   /product="phosphopantothenoylcysteine
FT                   decarboxylase/phosphopantothenate/cysteine ligase"
FT                   /EC_number="4.1.1.36"
FT                   /EC_number="6.3.2.5"
FT                   /note="KEGG: xcb:XC_3943 bifunctional
FT                   phosphopantothenoylcysteine
FT                   decarboxylase/phosphopantothenate synthase; TIGRFAM:
FT                   phosphopantothenoylcysteine
FT                   decarboxylase/phosphopantothenate/cysteine ligase; PFAM:
FT                   flavoprotein; DNA/pantothenate metabolism flavoprotein
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49989"
FT                   /db_xref="GOA:B4STE6"
FT                   /db_xref="InterPro:IPR003382"
FT                   /db_xref="InterPro:IPR005252"
FT                   /db_xref="InterPro:IPR007085"
FT                   /db_xref="InterPro:IPR035929"
FT                   /db_xref="InterPro:IPR036551"
FT                   /db_xref="UniProtKB/TrEMBL:B4STE6"
FT                   /protein_id="ACF49989.1"
FT                   /translation="MADSPNASPAPARALEGQKLLLCVGGGIAAYKALELVRRLRDAGA
FT                   QVQVAMTAGAQQFVTPLSFQALSGQPTRTTLWDSAAEQAMGHIELARWADRIVVAPGTA
FT                   DLLARLAQGHADDLVSTLCLASTAPLTICPAMNHRMWLHPATQANIALLRQRGAQVIGP
FT                   VDGPLAEGESGPGRLAEPGDIVAALAANGSAEAPAAAPETRALQGLRLLISAGPTYEDI
FT                   DPVRYVGNRSSGKMGFALAAAAAALGAQVVLVSGPVQLPTPQGVQRIDVRSAAQMRDAV
FT                   LKSLPADIYIGAAAVSDYTPRQVAPQKLKKTADSQSLVIELVRTPDILAEVAAQTQSLK
FT                   LVVGFAAETHDVEKYARGKLVDKRLDLVIANQVGISGGGFESDNNAATAFWQDGEQVFP
FT                   ATSKRELAEQLLALIARRLQA"
FT   gene            333288..333761
FT                   /locus_tag="Smal_0285"
FT   CDS_pept        333288..333761
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0285"
FT                   /product="deoxyuridine 5'-triphosphate nucleotidohydrolase
FT                   Dut"
FT                   /EC_number="3.6.1.23"
FT                   /note="KEGG: xom:XOO_0464 deoxyuridine 5'-triphosphate
FT                   nucleotidohydrolase; TIGRFAM: deoxyuridine 5'-triphosphate
FT                   nucleotidohydrolase Dut; PFAM: deoxyUTP pyrophosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49990"
FT                   /db_xref="GOA:B4STE7"
FT                   /db_xref="InterPro:IPR008181"
FT                   /db_xref="InterPro:IPR029054"
FT                   /db_xref="InterPro:IPR033704"
FT                   /db_xref="InterPro:IPR036157"
FT                   /db_xref="UniProtKB/TrEMBL:B4STE7"
FT                   /protein_id="ACF49990.1"
FT                   /translation="MTQASTSQPLQVKLLDPRFGDSWPLPAYATAASAGMDLRAALDTA
FT                   LTLQPGDTALVPSGLAIHIADPHLCAVILPRSGLGHRHGIVLGNGTGLIDADYQGPLLI
FT                   SVWNRGREAFTIEPGDRIAQLVVVPIARVNLQVVDTFTDSVRGTGGFGHTGVR"
FT   gene            333774..336122
FT                   /locus_tag="Smal_0286"
FT   CDS_pept        333774..336122
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0286"
FT                   /product="Phosphomannomutase"
FT                   /EC_number="5.4.2.8"
FT                   /note="PFAM: phosphoglucomutase/phosphomannomutase ;
FT                   phosphoglucomutase/phosphomannomutase alpha/beta/alpha
FT                   domain I; phosphoglucomutase/phosphomannomutase
FT                   alpha/beta/alpha domain II;
FT                   phosphoglucomutase/phosphomannomutase alpha/beta/alpha
FT                   domain III; KEGG: xcv:XCV4025 phosphomannomutase"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49991"
FT                   /db_xref="GOA:B4STE8"
FT                   /db_xref="InterPro:IPR005841"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="UniProtKB/TrEMBL:B4STE8"
FT                   /protein_id="ACF49991.1"
FT                   /translation="MSGIGEGQRGRSLGRSAPLLGVLLILLAGWFGWSAVQQWRQEANG
FT                   QALEEARDQAVQGLQDAAAGQLKQLQQQLKNERVQQALQAGDAAAAALAVRESWTGVEQ
FT                   AEVLSADLASAYADPATFGYARLALLEAALAEAKPSLRVVRDGGGNRLGLAAPVQLGSL
FT                   GPAVLYVRQPLLRLTAPLDQVSAPATGFLGLRQGMHDLVTQGDASLAESAEALARPIPG
FT                   TPLRLVAAVPNVESGPLGLGALASAIVALLLAFIAVLLVIGRGRLPKTLPLPRRAAAAD
FT                   ADHGPTLSESLQQAPPAVAAVTSSGDATPPSPPPVPAEALAAGIFRAYDIRGVVGSELT
FT                   PKTAALIGQAIGTVALEQGLREVVIGRDGRLSGQELAAGLAEGLRRAGCAVIDIGLAPT
FT                   PLVYYAAFHLRTGTCVAVTGSHNPPEYNGFKVVIGGETLSGDAITDLYQRIVEGRLVQA
FT                   AEPGDYQQRDVAADYIQRIADDVQLDRPLKVVADAGNGVAGALAPQLLEAIGAEVIPLY
FT                   CDVDGTFPNHHPDPSEPANLEDLVQTVKRFGADLGVAFDGDGDRLGVVTAEGKIIYADR
FT                   LLMLFAADVLMRNPGAMVIYDVKCTGKLSDHVLRNGGSPLMWKTGHSLMKAKMRETDAE
FT                   LAGEMSGHFFFKERWFGFDDGLYAAARLLEILAQREETPDEVLAELPEMVATPELKVPV
FT                   AEGTPHALVAMLVAAAQSPDNPYVGGRLSTIDGLRVDFPDGWGLVRASNTTPVLVLRFE
FT                   GNDEAALERIQALFRSQLQPVLGDTPLGF"
FT   gene            complement(336218..336931)
FT                   /locus_tag="Smal_0287"
FT   CDS_pept        complement(336218..336931)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0287"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein; KEGG: xac:XAC0760 two-component
FT                   system regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49992"
FT                   /db_xref="GOA:B4STE9"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:B4STE9"
FT                   /protein_id="ACF49992.1"
FT                   /translation="MSPTPIDASVPAARVLVIDDETQIRRFLDISLRAQGYQVRQAATG
FT                   QEGLQLAASEDMDLVILDIGLPDMEGHEVLEQLRQWSQVPVIMLTVRAGETEKVRALDT
FT                   GANDYVTKPFGTQELMARVRALLRTRSVPSDGTPPVFDDGHLHVDLVRREVALDGEPVA
FT                   LTRKEYALLSLLLRNAGRVVTQPQILQEIWGPTHQHDTHYLRILVGKLRHKLGDSALDS
FT                   RYLFTEPGVGLRFKG"
FT   gene            complement(336912..339587)
FT                   /locus_tag="Smal_0288"
FT   CDS_pept        complement(336912..339587)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0288"
FT                   /product="osmosensitive K+ channel signal transduction
FT                   histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase A domain protein; Osmosensitive K channel
FT                   His kinase sensor; UspA domain protein; KEGG: xcb:XC_3529
FT                   two-component system sensor protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49993"
FT                   /db_xref="GOA:B4STF0"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR003852"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR025201"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR038318"
FT                   /db_xref="UniProtKB/TrEMBL:B4STF0"
FT                   /protein_id="ACF49993.1"
FT                   /translation="MTAAPMTDARTRQADALVEGLQREAGGKLTVFLGAAPGVGKTYTM
FT                   LTRAQEQLRRGVDLVVGLVETHGRADTQALLEGLPQLPLKEVAYHGHSLQEMDLDAVLA
FT                   RHPALVLVDELAHRNAPGSRHERRWQDVMELLDAGIDVWTTVNIQHLESLNDVVMRITG
FT                   VRVSETVPDGVLDRLHDIVLVDLPPRELIARLQQGKVYVPEQAAQALQAFFSPANLTAL
FT                   RELAMQEAADRVDSSLREARAARGESNLPLRRGVLVAIDGGGQSEYLVRVARRIAERRD
FT                   APWTVVTVQGRRQDEATRREIDAAFALARRLGGDAELLHGSSIADALLDHAAHNGVSTL
FT                   VLGRTRERPLARMFNRTLTQQLIQRGAHYEITIISTPQARARSRREGLLPPVRGISHEP
FT                   AQALIATALACAVAWLAERWVGMADLSMVFIVAVVVVAARTRASVAVMAAILCFLAYNF
FT                   LFIAPRFTFAIGARQGVITVFLFLAAALVAGRLASRLRMQVIALRAANRHARARQQLGR
FT                   QLASAAGNGEVAQAGRLALEQAMDVPAWLRIGTDTAAGGRSQPGDTDLAAADWALRHGQ
FT                   PSGRFTDTLAGAQWWFLPLLDGEDRAIGVAGLYLPGAQARLLPEQRQLAEAMVDDIAQA
FT                   ALRTRLVAELEQAHVSNETERLRSALLSSVSHDLRSPLAAMIGSADSLASYGAAMDTTD
FT                   RRALLDTILVEGERLDRYIQNLLDMTRLGHEGLKINRDWIGVDELIGSAARRLQRYQPK
FT                   VRLELDIPSSLAPIWVHPALVEQAVFNVMENAAKFSPPDAAVQVQARELDGQLRIDVID
FT                   AGPGIPDDERARIFDMFYSVERGDRGRHGTGLGLTICQGMIGAHGGSVQALPGRDGRGT
FT                   LIRITLPLLKPASHDESDPD"
FT   gene            complement(339624..340274)
FT                   /locus_tag="Smal_0289"
FT   CDS_pept        complement(339624..340274)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0289"
FT                   /product="potassium-transporting ATPase, C subunit"
FT                   /EC_number="3.6.3.12"
FT                   /note="KEGG: xcv:XCV0810 potassium-transporting ATPase
FT                   subunit C; TIGRFAM: potassium-transporting ATPase, C
FT                   subunit; PFAM: K transporting ATPase KdpC subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49994"
FT                   /db_xref="GOA:B4STF1"
FT                   /db_xref="InterPro:IPR003820"
FT                   /db_xref="UniProtKB/TrEMBL:B4STF1"
FT                   /protein_id="ACF49994.1"
FT                   /translation="MNRTASTSSSLPREQKAEARVASLQDGASWRPAIGLGLATLLLAG
FT                   AVYAGIATGFAGLAYPTQAEGSLLRDGNGQVRGSAWLSQPFTGDGYFQARPSAANYDPM
FT                   AAAGSNLARSNPALAERVAASTAAVAARESVAPAQVPADLVTQSAGGLDPQLSPAAAQL
FT                   QVARVARARGLPVERVQALVQAHTEGRQWGLFGQPRVNVVTLNFALDHAAKAP"
FT   gene            complement(340271..342328)
FT                   /locus_tag="Smal_0290"
FT   CDS_pept        complement(340271..342328)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0290"
FT                   /product="K+-transporting ATPase, B subunit"
FT                   /note="TIGRFAM: ATPase, P-type (transporting), HAD
FT                   superfamily, subfamily IC; K+-transporting ATPase, B
FT                   subunit; PFAM: Haloacid dehalogenase domain protein
FT                   hydrolase; E1-E2 ATPase-associated domain protein; KEGG:
FT                   xcb:XC_3531 potassium-transporting ATPase subunit B"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49995"
FT                   /db_xref="GOA:B4STF2"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR006391"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:B4STF2"
FT                   /protein_id="ACF49995.1"
FT                   /translation="MSTQASSTRSTHAPRPALLDGAGLRRALIEAVLKLSPMHLVRSPV
FT                   MAVVMAGTIVAAIVTLTGNAPLGFGLAVTAILLVTVLFGNFAEAVAEARGRGQAASLRR
FT                   ARQDLVARRLATPQPGAAETQVPAAELRPGDHVIVSAGELVPADGEIVQGLATINEAAV
FT                   TGESAPVLREAGTDRSGVIGGTKVLSDQIIVRVTAEPGHSFLDRMIALVEGANRQKTPN
FT                   EIALTLLLAAMTLTFLVVVATLPAIGASVGVKVDPLLLIALLVCLIPTTIGGLLPAIGI
FT                   AGMNRALAANVLAKSGKAVEVAGDVDVLLLDKTGTITYGDRQASHFHPLAGIDASQLRE
FT                   AALLSSLADPTPEGKSIVRLAREQGCATAEPDHADYLAFSAQTRMSGVDLEHGRQIRKG
FT                   AADAIRAHVQALGGSVPAELAGRVEQVARNGATPLVVAEGRHVLGVIELSDVVKHGMRE
FT                   KFAQLRAMGIRTVMITGDNPLTAAAIAAEAGVDDYIAEARPEDKLARIRQEQAGGRLVA
FT                   MVGDGTNDAPALAQADIGLAMNSGTQAAKEAGNMVDLDSDPAKLLAVVEVGKQQLITRG
FT                   ALTTFSLANDVSKYFAILPALFAAAVPTMAALNVMQLSSPRNAVLAALIFNALVIPALI
FT                   PLALRGVRFRPATATALLRRNMLVYGLGGVLLPFAAIKAIDLLLVLVFGA"
FT   gene            complement(342339..344048)
FT                   /locus_tag="Smal_0291"
FT   CDS_pept        complement(342339..344048)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0291"
FT                   /product="potassium-transporting ATPase, A subunit"
FT                   /EC_number="3.6.3.12"
FT                   /note="KEGG: xcb:XC_3532 potassium-transporting ATPase
FT                   subunit A; TIGRFAM: potassium-transporting ATPase, A
FT                   subunit; PFAM: K transporting ATPase A subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49996"
FT                   /db_xref="GOA:B4STF3"
FT                   /db_xref="InterPro:IPR004623"
FT                   /db_xref="UniProtKB/TrEMBL:B4STF3"
FT                   /protein_id="ACF49996.1"
FT                   /translation="MTEIIVILAASLLLAWPLGLYLARVMRGAPMKVDVLFHWIEKPLY
FT                   RVFGVDPSRSMSWRGYVLAFVLSNVVVAVLTQAVFMTQAWLPLNPDQIPNMRWDTALHT
FT                   MISFLTNTNQQHYSGQAQLSYLSQMTGITGLQVVTPMMGLALAVATLRALFARSSQAAA
FT                   ASGAGDDRQVAVGNYYVDVVRLCVRFLLPLCLVWTLLLTSQGVPSTMAGGPQATPIDAS
FT                   AGMAEQKLPLGPVAAMVAAKQLGANGGGWYGPNSSFPLENPTPVSNALEILGILLVPMS
FT                   VIFMIGAFTGRRRFGVLVFSCMLGMSLLSTGAMVWSEGHSPSAATPLLMEGKEVRFGAD
FT                   GTALWAAVTTQVSNGSVNGMHDSLAPLSGGIAMVNMLVSAIWGGIGCGLQQFIVYLLLG
FT                   VFLAGLMTGRTPELFGRKLETPQVRLLALLVLLQPITLLVFTAITLAVPGLAGTSNPGF
FT                   HGISQVFYEYVSAYANNGSGFEGLGDATLWWNLSCSLVLLLGRFPLLIIPLVVAAQLAA
FT                   KRQSPESAGSLQIETPTFALTLVSVIVILTVLQFMPALVLGPIADHLSLGLH"
FT   gene            complement(344061..344153)
FT                   /locus_tag="Smal_0292"
FT   CDS_pept        complement(344061..344153)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0292"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xom:XOO_3625 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49997"
FT                   /db_xref="GOA:B4STF4"
FT                   /db_xref="InterPro:IPR011726"
FT                   /db_xref="UniProtKB/TrEMBL:B4STF4"
FT                   /protein_id="ACF49997.1"
FT                   /translation="MSPWLSLLCGVVVLVAAAYLLYVVLRPESF"
FT   sig_peptide     complement(344097..344153)
FT                   /locus_tag="Smal_0292"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.911) with cleavage site probability 0.667 at
FT                   residue 19"
FT   gene            complement(344373..345035)
FT                   /locus_tag="Smal_0293"
FT   CDS_pept        complement(344373..345035)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0293"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xom:XOO_0473 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49998"
FT                   /db_xref="UniProtKB/TrEMBL:B4STF5"
FT                   /protein_id="ACF49998.1"
FT                   /translation="MSRVPAVLFAGLLLAVPFAVPAQSRDSGKAEKKLYCWNEGKERIC
FT                   SDSLPADAVNHAREEFNAKSGLRNAQVQRALTDEERAAASTVAQQQQLDLMATQTRQRT
FT                   EQAMLSTYGSEDDLRRVFTERQEVLDNNLKTAEYNVTSLRESLVALLSAAGDRELAGGK
FT                   VADKQAEAIRQRHVQLQAQQRLQAGFLQQQQALKAEIDSSLQRYRELKGLVPADQAR"
FT   sig_peptide     complement(344961..345035)
FT                   /locus_tag="Smal_0293"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.989 at
FT                   residue 25"
FT   gene            complement(345055..345714)
FT                   /locus_tag="Smal_0294"
FT   CDS_pept        complement(345055..345714)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0294"
FT                   /product="orotate phosphoribosyltransferase"
FT                   /EC_number="2.4.2.10"
FT                   /note="KEGG: xcb:XC_3931 orotate phosphoribosyltransferase;
FT                   TIGRFAM: orotate phosphoribosyltransferase; PFAM:
FT                   phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49999"
FT                   /db_xref="GOA:B4STF6"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR004467"
FT                   /db_xref="InterPro:IPR023031"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4STF6"
FT                   /protein_id="ACF49999.1"
FT                   /translation="MSDHRHRFLQLALTADALRFGQFTLKSGRLSPYFFNAGRFDSGSL
FT                   LSQLGACYSDAIDATGIKYDVVFGPAYKGIPLATAMACELAQRGRELPLSFNRKEAKAH
FT                   GEGGQLIGADMNGKRVLIVDDVITAGTAIREALGIIRDAGGIPAGIVVALDRQEIASDT
FT                   DHRSAAQAVAEEAGIPVIAVATLADLLDFASGNPELVGYRQPLEAYRAQYGVRSIR"
FT   gene            345877..346677
FT                   /locus_tag="Smal_0295"
FT   CDS_pept        345877..346677
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0295"
FT                   /product="exodeoxyribonuclease III Xth"
FT                   /EC_number="4.2.99.18"
FT                   /note="KEGG: xcb:XC_3930 exodeoxyribonuclease III; TIGRFAM:
FT                   exodeoxyribonuclease III; exodeoxyribonuclease III Xth;
FT                   PFAM: Endonuclease/exonuclease/phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50000"
FT                   /db_xref="GOA:B4STF7"
FT                   /db_xref="InterPro:IPR004808"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR020847"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/TrEMBL:B4STF7"
FT                   /protein_id="ACF50000.1"
FT                   /translation="MRIISFNANGIRSAATKGFLDWFRAQDADVLCIQETKAQEDQLTD
FT                   PMFRPDGHHCFYRDAITKKGYSGVAIYSKREPDQVITSLGWAPFDDEGRYIEARYGNLS
FT                   VVSFYIPSGSSGDLRQGFKFEVMEWLRPILEEWARSGRDYVLCGDWNIVRSALDIKNWK
FT                   SNQKNSGCLPEERDWLNALCADHGQATDVATGRGWADAYRLLNPTGEDYTWWSNRGAAR
FT                   ANNVGWRIDYQFITPGLRDRLRSCSIYRDERFSDHAPFIVDYDL"
FT   gene            346674..348047
FT                   /locus_tag="Smal_0296"
FT   CDS_pept        346674..348047
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0296"
FT                   /product="AmpG protein"
FT                   /note="KEGG: bba:Bd0333 AmpG protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50001"
FT                   /db_xref="GOA:B4STF8"
FT                   /db_xref="InterPro:IPR004752"
FT                   /db_xref="InterPro:IPR024371"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B4STF8"
FT                   /protein_id="ACF50001.1"
FT                   /translation="MTEAAKPRRPWQQVVSNLSQRKVLAMLLLGFSSGLPIYLVGNTLG
FT                   FWMRKEGIELSTIGFLSWVGLAYTMKFLWAPIVDKTDVPLFGRFGRRRGWMLLSQLVVV
FT                   VGLVGMALVQPKGGHVHFLGIAWEHIVVFGVMAVIVAFASATQDIVIDAWRIESADNSE
FT                   QLGLLTSSSALGYRTALLVTDALILIIAARVGWQVSYEIMAVLMALGVVAVIMAREPAR
FT                   EVAAVQAQATSLWTPRGLFDAVAGPFIAFVREHRSGAILILVAISVYRMADFVMGPMAN
FT                   PFYVDLGLDEDTVGAVRGSVGLVATFVGIAAAGLVSVRWGVLAALLVGAVLGPASNLAF
FT                   AWLAYSGPDTTHFAVAMAVDNFASGFAGTALIAYMSSLTSIGYTATQYALLSSFYAMPG
FT                   KALKGLSGWSVQTLAQGRTLLEGYALFFIGTALVAIPVVILCGLLILQQRRRQTANPA"
FT   gene            348126..348356
FT                   /locus_tag="Smal_0297"
FT   CDS_pept        348126..348356
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0297"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xac:XAC3900 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50002"
FT                   /db_xref="UniProtKB/TrEMBL:B4STF9"
FT                   /protein_id="ACF50002.1"
FT                   /translation="MADVVLRDLDPLLLERIRRVGVARGWTHEQTCEALLEQGLFSSEL
FT                   EVRSGFGDPEVDALSDAIAALQALPAGQGFD"
FT   gene            complement(348463..349599)
FT                   /locus_tag="Smal_0298"
FT   CDS_pept        complement(348463..349599)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0298"
FT                   /product="protein of unknown function UPF0075"
FT                   /note="PFAM: protein of unknown function UPF0075; KEGG:
FT                   xcb:XC_3927 anhydro-N-acetylmuramic acid kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50003"
FT                   /db_xref="GOA:B4STG0"
FT                   /db_xref="InterPro:IPR005338"
FT                   /db_xref="UniProtKB/TrEMBL:B4STG0"
FT                   /protein_id="ACF50003.1"
FT                   /translation="MPAMNTTADSDAPLYLGLMSGTSADGIDAALVQFPASGGCRFVHG
FT                   LTARWEPVLRARLVALGEGGPLDSLEELGELDARIAIRFAEAANQLLAEAGVDRSQVRA
FT                   IGSHGQTVRHRPLADPAFTVQLGDGNRIAELTGITTVCDFRRRDVAAGGHGAPLMPAFH
FT                   LGMLGTADEDRAVLNLGGIANLTLIPREGAVRGFDTGPANALMDAWCQRHTGRTFDADG
FT                   AYAASGAVDEGLLAGWRSDPWFALPPPKSTGREQFHLAWAEAHMGEGQYAAADIQATLL
FT                   ELTVATVVDALLAQQPRTRRLLVCGGGMRNTQLMRRLAAQLPGVVVESSAVHGLDPEYV
FT                   EAMGFAWLAQRTMDGLAGNLPSVTGAKGPRILGAIHLA"
FT   gene            complement(349655..351127)
FT                   /locus_tag="Smal_0299"
FT   CDS_pept        complement(349655..351127)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0299"
FT                   /product="Peptidase M23"
FT                   /note="PFAM: Opacity-associated protein A; Peptidase M23;
FT                   KEGG: xcb:XC_3926 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50004"
FT                   /db_xref="GOA:B4STG1"
FT                   /db_xref="InterPro:IPR007340"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="UniProtKB/TrEMBL:B4STG1"
FT                   /protein_id="ACF50004.1"
FT                   /translation="MHNSEQGRARKQRFQERLHVLHDNALHRKLRQHLPAAFNERWTRR
FT                   HWMHASLFATIGALVATIVPGFSHTIDAPFADSHTSLALPLPPLTMARQQQVPGDSWQV
FT                   LRVQRGQTLSDLFDKAGIPATTLHRVLDHPGAREALTKLRPGAEIAFDMPLSGDLRSIR
FT                   FDRDADNRVELSLSGDDIKEKVTKRETSTRTVVTSGEITSSLYAAARRAGLSPSAIATM
FT                   TDDIFKYDIDFSKDLQPGDRFSVVMDETWREGEKVDTSKILAATFTTGGKTYSGFRFDR
FT                   NGKAEYYDINGRSLKKSFIRMPIPFARLSSTFGARKHPVLGKMRMHKGVDYAARTGTPI
FT                   MAAGDARVQFAGVQRGYGNVVILDHGRGHTTLYGHMSRFASIRTGQRVAQGTVIGYVGS
FT                   TGLATGPHLHYEFRVNGEHRNPLTVTMPPPEPLKGAELVAFRAQTAPAMARIQGMEKLI
FT                   YADASPAPTSRDEAAPEVASAKDKPGNGRKRG"
FT   gene            351295..352506
FT                   /locus_tag="Smal_0300"
FT   CDS_pept        351295..352506
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0300"
FT                   /product="tyrosyl-tRNA synthetase"
FT                   /EC_number="6.1.1.1"
FT                   /note="KEGG: xac:XAC3897 tyrosyl-tRNA synthetase; TIGRFAM:
FT                   tyrosyl-tRNA synthetase; PFAM: aminoacyl-tRNA synthetase
FT                   class Ib; RNA-binding S4 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50005"
FT                   /db_xref="GOA:B4STG2"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002305"
FT                   /db_xref="InterPro:IPR002307"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR024088"
FT                   /db_xref="InterPro:IPR024108"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:B4STG2"
FT                   /protein_id="ACF50005.1"
FT                   /translation="MSSIEEALALIGRGADEILKLEDLRARLQEGRPLRIKAGFDPTAP
FT                   DLHLGHTVLLNKMRQFQDLGHQVIFLIGDFTGMIGDPSGKSLTRKPLSKDDVLANARTY
FT                   EEQVFKVLDRSRTEVRFNSEWFGKMGAADMIRLAGQHTVARMLERDDFAKRYAAQQSIA
FT                   IHEFLYPLVQGYDSVALEADVELGGTDQKFNLLMGRGLQEHHGQKPQVVLTMPLLEGLD
FT                   GVNKMSKSLGNYIGISEPAIDIVTKTMKVDDTLMWRWIELLSFDISQAEAVQLREQVAN
FT                   GGLNPRVVKLRLARELATRFHDAAAAEQAVAGWEAAVTGQGDITQLPLQDVAIPAEGLR
FT                   IAALLTAAGLTPSNSEANRKLKERAVKVDGEVVEDGQQVLQPGFEGLLQVGKRTFARVR
FT                   LVAA"
FT   gene            353034..354573
FT                   /locus_tag="Smal_R0002"
FT   rRNA            353034..354573
FT                   /locus_tag="Smal_R0002"
FT                   /product="16S ribosomal RNA"
FT   gene            354666..354741
FT                   /locus_tag="Smal_R0003"
FT                   /note="tRNA-Ala1"
FT   tRNA            354666..354741
FT                   /locus_tag="Smal_R0003"
FT                   /product="tRNA-Ala"
FT   gene            354772..354848
FT                   /locus_tag="Smal_R0004"
FT                   /note="tRNA-Ile1"
FT   tRNA            354772..354848
FT                   /locus_tag="Smal_R0004"
FT                   /product="tRNA-Ile"
FT   gene            355075..357954
FT                   /locus_tag="Smal_R0005"
FT   rRNA            355075..357954
FT                   /locus_tag="Smal_R0005"
FT                   /product="23S ribosomal RNA"
FT   gene            358081..358195
FT                   /locus_tag="Smal_R0006"
FT   rRNA            358081..358195
FT                   /locus_tag="Smal_R0006"
FT                   /product="5S ribosomal RNA"
FT                   /note="5S ribosomal RNA as predicted by Rfam (RF00001),
FT                   score 82.76"
FT   gene            358704..360243
FT                   /locus_tag="Smal_R0007"
FT   rRNA            358704..360243
FT                   /locus_tag="Smal_R0007"
FT                   /product="16S ribosomal RNA"
FT   gene            360336..360411
FT                   /locus_tag="Smal_R0008"
FT                   /note="tRNA-Ala2"
FT   tRNA            360336..360411
FT                   /locus_tag="Smal_R0008"
FT                   /product="tRNA-Ala"
FT   gene            360442..360518
FT                   /locus_tag="Smal_R0009"
FT                   /note="tRNA-Ile2"
FT   tRNA            360442..360518
FT                   /locus_tag="Smal_R0009"
FT                   /product="tRNA-Ile"
FT   gene            360745..363624
FT                   /locus_tag="Smal_R0010"
FT   rRNA            360745..363624
FT                   /locus_tag="Smal_R0010"
FT                   /product="23S ribosomal RNA"
FT   gene            363750..363864
FT                   /locus_tag="Smal_R0011"
FT   rRNA            363750..363864
FT                   /locus_tag="Smal_R0011"
FT                   /product="5S ribosomal RNA"
FT                   /note="5S ribosomal RNA as predicted by Rfam (RF00001),
FT                   score 82.76"
FT   gene            363997..364111
FT                   /locus_tag="Smal_R0012"
FT   rRNA            363997..364111
FT                   /locus_tag="Smal_R0012"
FT                   /product="5S ribosomal RNA"
FT                   /note="5S ribosomal RNA as predicted by Rfam (RF00001),
FT                   score 82.76"
FT   gene            complement(364491..366206)
FT                   /locus_tag="Smal_0301"
FT   CDS_pept        complement(364491..366206)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0301"
FT                   /product="peptidase M28"
FT                   /note="PFAM: peptidase M28; KEGG: xcb:XC_0024 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50006"
FT                   /db_xref="InterPro:IPR003137"
FT                   /db_xref="InterPro:IPR007484"
FT                   /db_xref="UniProtKB/TrEMBL:B4STG3"
FT                   /protein_id="ACF50006.1"
FT                   /translation="MPRKLLLCLAAAAALSACKGEDTPAPAPATDTAAAKPAAHSFSPE
FT                   INAGDFAEMVKTLASDEFEGRAPGSKGEELTVNYIRDQMQRIGLQPGNGDSWFQDVPMT
FT                   ETTANESTVLKITQGGKTTELKFGTDMVVGTRTGQAEVKVDASDLVFVGYGVDAPEQKW
FT                   NDYAGQDWKGKTVVMFVNDPGFHVDDAKLFDGKRMTYYGRWTYKFEEAARKGAAAALIV
FT                   HDSAGASYGWDVVKNSWAGPQYDLPAKDDPEARIPVQGWLSADAAKTLFAGAGLDLAQA
FT                   YKDASKRGFKPVPLKATAAVDLKSQIAQKQSRNVVGVLPGSKRADEAVLYMAHWDHLGK
FT                   HEGETGDNIYNGAVDNATGVAGILEVAEAMAHQDPKPERSVVFLAVTLEESGLLGSKYY
FT                   VAHPTFPLDKIAGVINIDAMSVAGRAKDVTVTGFGSSELEDILKPLAAAQDRTLHGETS
FT                   VQSGFYFRSDHFNFAKAGVPALYADGGEDLRDGGVDAGRKAAADYGANRYHGPKDEFDA
FT                   ATWKLDGTVEDLQLMYGVGKELAGGDRWPNWYAGNPFKAARDAMMKDKAPAAAK"
FT   sig_peptide     complement(366147..366206)
FT                   /locus_tag="Smal_0301"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.612 at
FT                   residue 20"
FT   gene            complement(366293..366955)
FT                   /locus_tag="Smal_0302"
FT   CDS_pept        complement(366293..366955)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0302"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xcb:XC_0023 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50007"
FT                   /db_xref="UniProtKB/TrEMBL:B4STG4"
FT                   /protein_id="ACF50007.1"
FT                   /translation="MKTLSIPLLFGVLLATGPVAAQEDISKVNGSISADAGQRYGKLDT
FT                   VNGGIRVGEGVETGSIDTVNGGVKVADRARTGQIETVNGGVRLGREVIARGDVSTVNGS
FT                   IFSDRGSQIEGGVETVNGGIGLVESRVGKDVETVNGDITVGIGSQVNGGVHVRKPNFSV
FT                   SLTASRKPRVIIGPNAVVSGPLQFEREVVLYVHRTARIGPVTGAEPISFDAETAPAD"
FT   sig_peptide     complement(366890..366955)
FT                   /locus_tag="Smal_0302"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.989 at
FT                   residue 22"
FT   gene            367051..368349
FT                   /locus_tag="Smal_0303"
FT   CDS_pept        367051..368349
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0303"
FT                   /product="Peptidase M23"
FT                   /note="PFAM: Peptidase M23; KEGG: xom:XOO_4323 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50008"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="UniProtKB/TrEMBL:B4STG5"
FT                   /protein_id="ACF50008.1"
FT                   /translation="MRNNAFPSRRHHIAAIRGGRCLLLGLALALALPLPGAAQTTRETE
FT                   RKLQKLRTELKGVAQERRQIEGQRGQASQQLRDADEKVARSGRALAQTESALREQSQAL
FT                   AEAEQRRSTLQTNLAQQHRELAGLLRAAYQLGNHAPLKLLLSQDTVADANRALAYHRYL
FT                   QRERAQRITTLTADLKELEALQAQIAERRQKLQGSQRDQKQQAATLAADRRDRAQTVAS
FT                   LDERFKDKREKEQALGQDAKALETLLANLRAAAARAEAERRAAARRAAAEKAAAERAAR
FT                   QAAAQGRPPPPTKVPPAVASAPAPKVGGLGWPLSGNLLARYGGKLPDGRTSSGVLIGAP
FT                   AGSTVTAVADGTVVFSDWMTGYGMILIVDHGNGYMSLYAHNDTLLKDAGARVSRGDAVA
FT                   KVGNSGGQGVTALYFELRRGGQPVNPDSWLQRR"
FT   sig_peptide     367051..367167
FT                   /locus_tag="Smal_0303"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.977 at
FT                   residue 39"
FT   gene            368458..369954
FT                   /locus_tag="Smal_0304"
FT   CDS_pept        368458..369954
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0304"
FT                   /product="carboxyl-terminal protease"
FT                   /EC_number="3.4.21.102"
FT                   /note="KEGG: xom:XOO_4322 carboxyl-terminal protease;
FT                   TIGRFAM: carboxyl-terminal protease; PFAM: PDZ/DHR/GLGF
FT                   domain protein; peptidase S41"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50009"
FT                   /db_xref="GOA:B4STG6"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR004447"
FT                   /db_xref="InterPro:IPR005151"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:B4STG6"
FT                   /protein_id="ACF50009.1"
FT                   /translation="MRAARTATLLLALLPALSWAQQTAPAPSQETSGQAANSEEAVTSK
FT                   VPLEDIRRFVAVYNAVRAAYVDPVDDKKLMQSAVRGLLLDLDPHSTYFNKEDAQAFDEQ
FT                   ASGAYEGIGVELQQQPDNASMKVISPIDDTPAAKAGILAGDLIIAIDGKPISKIDASEP
FT                   LRGAAGSKVVLTIVREGKPKPFDVSLTRQTIRVTSVRSRLLEPGYGYIRLSTFQADTGS
FT                   DFQKHVQQLQKQSGGQLKGLVLDLRSNPGGLLTAAVQVADDLLDKGNIVSTRGRISISD
FT                   ARFDATPGDLLKGAPVVVLVDAGSASASEVLAGALRDNKRARVVGSRTFGKGSVQTVLP
FT                   LDNGDSVKLTTARYYTPSGKSIQATGIVPEVELKPAATPVEDALPASLSDYSEATLPGH
FT                   LRGDDEGTEGYHAGAVLPGDGPINDALAELKNPGSVAARLKAEAAKAAAAKGAKAAAAK
FT                   PEATPDAKAEPKAESKPEAKPEAKPEAKPEAKPAPAPAKP"
FT   sig_peptide     368458..368520
FT                   /locus_tag="Smal_0304"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.982 at
FT                   residue 21"
FT   gene            complement(370064..370756)
FT                   /locus_tag="Smal_0305"
FT   CDS_pept        complement(370064..370756)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0305"
FT                   /product="Rhomboid family protein"
FT                   /note="PFAM: Rhomboid family protein; KEGG: xcb:XC_0018
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50010"
FT                   /db_xref="GOA:B4STG7"
FT                   /db_xref="InterPro:IPR022764"
FT                   /db_xref="InterPro:IPR035952"
FT                   /db_xref="UniProtKB/TrEMBL:B4STG7"
FT                   /protein_id="ACF50010.1"
FT                   /translation="MFVSLPSRKKAALRWATPVLFAALWLAFLWSISRPDDARGSLWLD
FT                   WGALSTGLTHPLDWWATLQDGSVLRLFTALFLHADWSHLLGNLVFLLIFGLPAERVLGP
FT                   WRLLLLFLVGGAVSNLVAIYTMGSPDQIIIGASGAVSALIGAYLALFPGARLGVVIPLG
FT                   LFLEFVRAPAYLLIGVWAALQVVFAHIGPSFGMVAWWAHIGGFMFGLVYGVYVRAAIAR
FT                   KLRKRHGF"
FT   sig_peptide     complement(370640..370756)
FT                   /locus_tag="Smal_0305"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.613) with cleavage site probability 0.346 at
FT                   residue 39"
FT   gene            370983..372332
FT                   /locus_tag="Smal_0306"
FT   CDS_pept        370983..372332
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0306"
FT                   /product="membrane protein involved in aromatic hydrocarbon
FT                   degradation"
FT                   /note="PFAM: membrane protein involved in aromatic
FT                   hydrocarbon degradation; KEGG: xcb:XC_0017 outer membrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50011"
FT                   /db_xref="InterPro:IPR005017"
FT                   /db_xref="InterPro:IPR042117"
FT                   /db_xref="UniProtKB/TrEMBL:B4STG8"
FT                   /protein_id="ACF50011.1"
FT                   /translation="MQTASTIARLTLLAVGVAGALAAADANAAAFQLKENSAKGLGRAF
FT                   AGSGSAEGDASIIAVNPAGMRQLEGTMVQGDLSAISFKAEFKGQGRNAAGRPQTGGDGG
FT                   DAGMIAPVPAAYFHMPIGEKAHFGVSLTAPFGFKTEYDNGWVGRYSGLKTDLKAIDLGF
FT                   AASYDVNPYVSFGASVFVEHLTIELSNAVDYGSILAGAGAPGFAPGSSDGTLKIEGDNN
FT                   AVGWTVGGLFSIDENTHIGLSYRSKVEHKITGGDATFSGADRARSLLTNSPRTRGWFMD
FT                   TSGKATVTMPASATLSVTHKVNDRWTVMGDVTRTAWSTAFDSVTVDYASPQPDSVLEFG
FT                   YRDTTFVSLGADYKLSDTVTLRGGVALDQTPTTDAHRDVRVPDTSRKWLSLGVGWTPSA
FT                   NTEYNFGYTHLFTSDPNVNVPATTANQGNSLSGKYKVRGDVLAASFQYKF"
FT   sig_peptide     370983..371069
FT                   /locus_tag="Smal_0306"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.705 at
FT                   residue 29"
FT   gene            372418..373017
FT                   /locus_tag="Smal_0307"
FT   CDS_pept        372418..373017
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0307"
FT                   /product="nicotinamide mononucleotide transporter PnuC"
FT                   /note="TIGRFAM: nicotinamide mononucleotide transporter
FT                   PnuC; PFAM: Nicotinamide mononucleotide transporter PnuC;
FT                   KEGG: pmy:Pmen_1541 nicotinamide mononucleotide transporter
FT                   PnuC"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50012"
FT                   /db_xref="GOA:B4STG9"
FT                   /db_xref="InterPro:IPR006419"
FT                   /db_xref="UniProtKB/TrEMBL:B4STG9"
FT                   /protein_id="ACF50012.1"
FT                   /translation="MAWIHDNSAMNLSDPNFQLELAANIAVAGSILLAGRNNVHTWWLG
FT                   IVGCALFAAVFERSHLYADMVLQFFFIAISVLGWWQWLRGDHGAPLPITSLRPRAWAWL
FT                   APLAVVATFGYGWMLTRLTNAYAPYIDSAVLVLSVIAQILMMRRKLESWWVWLLVNTVA
FT                   VPLYYSRGLHLTSILYVGFWINALVALRHWRHLMRG"
FT   gene            complement(373136..376393)
FT                   /locus_tag="Smal_0308"
FT   CDS_pept        complement(373136..376393)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0308"
FT                   /product="delta-1-pyrroline-5-carboxylate dehydrogenase"
FT                   /note="TIGRFAM: delta-1-pyrroline-5-carboxylate
FT                   dehydrogenase; PFAM: Proline dehydrogenase; Aldehyde
FT                   Dehydrogenase_; KEGG: xcv:XCV4008 bifunctional proline
FT                   dehydrogenase/pyrroline-5-carboxylate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50013"
FT                   /db_xref="GOA:B4STH0"
FT                   /db_xref="InterPro:IPR002872"
FT                   /db_xref="InterPro:IPR005933"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR024082"
FT                   /db_xref="InterPro:IPR024089"
FT                   /db_xref="InterPro:IPR025703"
FT                   /db_xref="InterPro:IPR029041"
FT                   /db_xref="InterPro:IPR041349"
FT                   /db_xref="UniProtKB/TrEMBL:B4STH0"
FT                   /protein_id="ACF50013.1"
FT                   /translation="MIKIAKFSIGRTGMNAPFSSPAASDASRPGALLSPELPASPNPFR
FT                   QAITDGWLKDEASHVRELLAQARLPAEEQAKVQALAADLVGRVRVRAKDQGAIEAFMRQ
FT                   YDLGSEEGVLLMCVAEALLRIPDQDTADKLIRDKLADADWEKHLGGSDSVLVNASTWGL
FT                   MLTGKLVQMNDATRADAPSAFKRLVGRVGEPVVRLAVRQAMKIMGHQFVMGRTISEALS
FT                   RSHKGDNASYRYSFDMLGEGALTMKDALRYLEDYRRAIHAIGGDHKARGGRPDGDVNNA
FT                   PGISIKLSALYPRYEHAKRERVLKDLVPGVLELAQLARSYGIGCTVDAEESDRLELSLD
FT                   IIEQVFSDASLAGWDGFGVVVQAYQKRTPYTIDHLADMARRAGRRLQVRLVKGAYWDAE
FT                   IKRAQIEGYPGYPVFTRKQNTDVSYLACAKRLFTHADAIYPMFATHNAHTIAAVRSIAN
FT                   GGVYEHQKLHGMGDDLYAEVVPADRLNLPCRVYAPVGSHEDLLPYLVRRLLENGANSSF
FT                   VNRITDERVPIADLIRDPVEMVASFESIPHPKIPLPVDLLRSQNHDRKNSMGANLANDN
FT                   ELRALAEQLNTAVKPWSAAPLVPGANPAGATQPVTNPADTREVVGQWQAADAATVQKAL
FT                   ANAVAAQPAWNRTPAASRAAILEHAADQLEARMPEFMALCVKEAGKSLPDGIAEVREAV
FT                   DFLRYYAKQAREQFSHAEKLPSPTGESNELQLHGRGVFVCISPWNFPLAIFLGQVAAAL
FT                   AAGNSVIAKPAEQTNLIGYYAVKLLHDAGVPADVVQYLPGDGATVGAALTADPRVAGVA
FT                   FTGSTDTARAINRAMAARDAAIGVLIAETGGQNAFIADSSALPEQLVKDAIGSAFTSAG
FT                   QRCSAARVLFVQDDIADKVMTMLAGAMKELKVGNPGLLSTDVGPVIDADALKILQDHAE
FT                   RMDREARLIAAAELSVEAANGTFFAPRAYELKDLGQLQKEVFGPVLHVIRWKGDQLDAV
FT                   IDQINATGYGLTLGVHSRIDETVDRISNGVHVGNVYVNRNQIGAVVGVQPFGGQGLSGT
FT                   GPKAGGPHYLLRFATEKTVTVNTTAAGGNASLLTLGD"
FT   gene            376629..377105
FT                   /locus_tag="Smal_0309"
FT   CDS_pept        376629..377105
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0309"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xcv:XCV4007 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50014"
FT                   /db_xref="GOA:B4STH1"
FT                   /db_xref="InterPro:IPR019253"
FT                   /db_xref="UniProtKB/TrEMBL:B4STH1"
FT                   /protein_id="ACF50014.1"
FT                   /translation="MIEVLTAPDGSGTQLRLRPPRALDARQFVLLFAVLSGAMWLVSAF
FT                   GWLAGNAFAPLFALLYSLLLAAALRALWRSGERQEEIRVVPACVEVIPVPGGSPVFRAH
FT                   PHWVRLLTDDEKVRLASSGRQVEVGSFLAPAERQTLVETLEDLLAASDGGNRRR"
FT   gene            377117..378079
FT                   /locus_tag="Smal_0310"
FT   CDS_pept        377117..378079
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0310"
FT                   /product="cytochrome c oxidase, subunit II"
FT                   /EC_number="1.9.3.1"
FT                   /note="KEGG: xac:XAC3888 cytochrome c oxidase subunit II;
FT                   TIGRFAM: cytochrome c oxidase, subunit II; PFAM: cytochrome
FT                   c oxidase subunit II; cytochrome C oxidase subunit II
FT                   transmembrane region"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50015"
FT                   /db_xref="GOA:B4STH2"
FT                   /db_xref="InterPro:IPR001505"
FT                   /db_xref="InterPro:IPR002429"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR011759"
FT                   /db_xref="InterPro:IPR014222"
FT                   /db_xref="InterPro:IPR034210"
FT                   /db_xref="InterPro:IPR036257"
FT                   /db_xref="UniProtKB/TrEMBL:B4STH2"
FT                   /protein_id="ACF50015.1"
FT                   /translation="MKQSRGWGTKCVAMVATMAALLSMPGTALAQAADPKPWQLNMGKG
FT                   VTQTSRLAWESNNLSLIVCTVIGVIVFGAMAYAMFKFRKSKGAVAATFSHNTKAEIIWT
FT                   VIPVIILVVMAWPATANLIKMYDTRDAEMTVKVTGYQWMWKYEYLGENVTFTSRLDRES
FT                   DRVRQSGVVPTRESHPHYLLDVDNRLVLPVDTKVRFVITSDDVIHAWWVPALGWKQDAI
FT                   PGFINEAWTSIEQPGVYRGQCAELCGKDHGFMPIVVEAVSKEEFKQWLAQRKPAPPAGP
FT                   ATPAAPAEPAAPAAPASEAPAAPAAAEAGSAPATAASGA"
FT   sig_peptide     377117..377209
FT                   /locus_tag="Smal_0310"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.636 at
FT                   residue 31"
FT   gene            378139..379746
FT                   /locus_tag="Smal_0311"
FT   CDS_pept        378139..379746
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0311"
FT                   /product="cytochrome c oxidase, subunit I"
FT                   /EC_number="1.9.3.1"
FT                   /note="KEGG: xac:XAC3887 cytochrome c oxidase subunit I;
FT                   TIGRFAM: cytochrome c oxidase, subunit I; PFAM: cytochrome
FT                   c oxidase subunit I"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50016"
FT                   /db_xref="GOA:B4STH3"
FT                   /db_xref="InterPro:IPR000883"
FT                   /db_xref="InterPro:IPR014241"
FT                   /db_xref="InterPro:IPR023615"
FT                   /db_xref="InterPro:IPR023616"
FT                   /db_xref="InterPro:IPR033944"
FT                   /db_xref="InterPro:IPR036927"
FT                   /db_xref="UniProtKB/TrEMBL:B4STH3"
FT                   /protein_id="ACF50016.1"
FT                   /translation="MAHSAVGHDDHHHQQSFFERWFFSTNHKDIGTLYLGFSFIMFIIG
FT                   AAMSVVIRAELAQPGLQFVKPEFFNQMTTVHALVMIFGGVMPAFVGLANWMIPLQIGAP
FT                   DMALPRMNNWSFWLLPVAFSLLLLTLFLPGGAPAGGWTLYPPLSLQGGYNVAFSVFAIH
FT                   VAGISSIMGAINIIATVLNMRAPGIDLLKMPIFCWAWLITAFLLIAVMPVLAGAVTMLL
FT                   TDKFFGTSFFNAAGGGDPVMYQHIFWFFGHPEVYIMILPAFGVVSEIIPTFSRKPLFGY
FT                   QAMVYATAAIAFLSFIVWAHHMFTVGMPLGGEIYFMFATMLISIPTGVKVFNWVSTMWR
FT                   GSLTFEAPMLWSVAFVILFTIGGFSGLMLAIVAADFQYHDTYFVVAHFHYVLVTGAVFA
FT                   LIAAVYYWWPKWTGRMYSEKWAKVHFWWSIVFVNLLFFPQHFLGLAGMPRRIPDYSVAF
FT                   ADWNLISSIGAFGMFATPFMMAAILLSSLRNGEKAEARSWEGARGLEWTLPSPAPAHTF
FT                   TTPPTIRPGDLAHDDISH"
FT   gene            379755..379988
FT                   /locus_tag="Smal_0312"
FT   CDS_pept        379755..379988
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0312"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: xom:XOO_3918 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50017"
FT                   /db_xref="GOA:B4SHH4"
FT                   /db_xref="UniProtKB/TrEMBL:B4SHH4"
FT                   /protein_id="ACF50017.1"
FT                   /translation="MHNEGPLQTCRAEPCSADALGRVEPCSTDEKQPTSGRLYQGGSIE
FT                   QQRQRARRTALWVGAIAVLVYVGFILSGVIGR"
FT   gene            379985..380575
FT                   /locus_tag="Smal_0313"
FT   CDS_pept        379985..380575
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0313"
FT                   /product="cytochrome c oxidase assembly protein CtaG/Cox11"
FT                   /note="PFAM: cytochrome c oxidase assembly protein
FT                   CtaG/Cox11; KEGG: xom:XOO_3917 cytochrome c oxidase
FT                   assembly protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50018"
FT                   /db_xref="GOA:B4SHH5"
FT                   /db_xref="InterPro:IPR007533"
FT                   /db_xref="InterPro:IPR023471"
FT                   /db_xref="UniProtKB/TrEMBL:B4SHH5"
FT                   /protein_id="ACF50018.1"
FT                   /translation="MSEAPASTPSPSAGLPRLIGVAVAVFLLTFSLVPLYRIACEKVFG
FT                   VRLERGPGSEASTGAVTGKRTVRVEFDGGVNSRLPWSFHPEQLTMDVVPGELNEALYFA
FT                   RNDSQQAVVGSAVPSVAPARASGFFSKTECFCFTAQTLQAGEKRDMPVRFIVDPDLPPE
FT                   IKTITLSYTFYRNDALSDRLAPAATSEGAHAAP"
FT   gene            380590..381465
FT                   /locus_tag="Smal_0314"
FT   CDS_pept        380590..381465
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0314"
FT                   /product="cytochrome c oxidase subunit III"
FT                   /note="PFAM: cytochrome c oxidase subunit III; KEGG:
FT                   xcb:XC_3901 cytochrome c oxidase subunit III"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50019"
FT                   /db_xref="GOA:B4SHH6"
FT                   /db_xref="InterPro:IPR000298"
FT                   /db_xref="InterPro:IPR013833"
FT                   /db_xref="InterPro:IPR024791"
FT                   /db_xref="InterPro:IPR033945"
FT                   /db_xref="InterPro:IPR035973"
FT                   /db_xref="UniProtKB/TrEMBL:B4SHH6"
FT                   /protein_id="ACF50019.1"
FT                   /translation="MAQTPTDANVYFVPAQSKWPFVGSIAMMVTMVGVASWLNDASWGR
FT                   WTFYIGIAMLVLTLFWWFSDVVRESQAGNYNHQVDGSFRMGMIWFIFSEVMFFGAFFGA
FT                   LFYTRNLGLSWLSGEGRGVMTNELLWQGYSAGWPTNGPAAIGGAFQTIPAWGLPLINTL
FT                   ILLTSGVTLTIAHHALKAGNRRQLLIWLGLTVVLGLGFLTLQAEEYIHAYKELNLTLGS
FT                   GIYGSTFFMLTGFHGAHVLLGTIMLIVMWLRSAKGHFTRDNHFGFEAAAWYWHFVDVVW
FT                   LMLFMFVYVL"
FT   gene            complement(381486..381704)
FT                   /locus_tag="Smal_0315"
FT   CDS_pept        complement(381486..381704)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0315"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xcb:XC_3900 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50020"
FT                   /db_xref="GOA:B4SHH7"
FT                   /db_xref="InterPro:IPR021313"
FT                   /db_xref="UniProtKB/TrEMBL:B4SHH7"
FT                   /protein_id="ACF50020.1"
FT                   /translation="MSDSLKTLLVIAFLIVIVWNLGAGLYYLLVDRGQTKRTVNALTRR
FT                   IGVSVALIVLVIVSIYMGWIKPHGIGG"
FT   gene            381762..382490
FT                   /locus_tag="Smal_0316"
FT   CDS_pept        381762..382490
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0316"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xcv:XCV4000 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50021"
FT                   /db_xref="GOA:B4SHH8"
FT                   /db_xref="InterPro:IPR002994"
FT                   /db_xref="UniProtKB/TrEMBL:B4SHH8"
FT                   /protein_id="ACF50021.1"
FT                   /translation="MMRQHTRVIGWLLALLAMAGFSALGLWQLQRMHAKQAMLDAQGPA
FT                   VAQALPLAQALAQALAAPGALHGVADHGRFLPGVVLLDNQTRHGRAGVKIYRPFRSDGG
FT                   SVLLVDLGWRALPPDRTLPDVPAPPSPVAVRGLLAPPPSAGLALGPAFSATDEAGRWLA
FT                   SRLPAEGLAQALGLPALPDRVLRLDPALPFGDERDLDLLPNTLPPQRHLGYAVQWFGLA
FT                   LTVLVVALVLEWRRRRPIAR"
FT   sig_peptide     381762..381839
FT                   /locus_tag="Smal_0316"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.964 at
FT                   residue 26"
FT   gene            382587..383156
FT                   /locus_tag="Smal_0317"
FT   CDS_pept        382587..383156
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0317"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xac:XAC3881 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50022"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B4SHH9"
FT                   /protein_id="ACF50022.1"
FT                   /translation="MNTATSPQARGSGRRTLVLLFAVFFGAMALAAVLRFTGWQPTGHR
FT                   NAGQLLKPPVDLRQQAPALANGQPYPWNPEARTWRLLVAPAGACDAQCVTLSQGLGKVW
FT                   QLFGHNADNVEILWLGTPPASIASLPALRPLAPSPALRAALPGVDDPAGLPVYVIDPNG
FT                   FVIMRHAPGSDLGGLRKDMATLLKLK"
FT   sig_peptide     382587..382682
FT                   /locus_tag="Smal_0317"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.985 at
FT                   residue 32"
FT   gene            383167..384330
FT                   /locus_tag="Smal_0318"
FT   CDS_pept        383167..384330
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0318"
FT                   /product="cytochrome oxidase assembly"
FT                   /note="PFAM: cytochrome oxidase assembly; KEGG: xac:XAC3880
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50023"
FT                   /db_xref="GOA:B4SHI0"
FT                   /db_xref="InterPro:IPR003780"
FT                   /db_xref="UniProtKB/TrEMBL:B4SHI0"
FT                   /protein_id="ACF50023.1"
FT                   /translation="MSLSARPALHRNFHRLAWFAMIMTASTIMFGAFVRLSDAGLSCPD
FT                   WPTCYGQATWPQHVEETLGHPATEIRPLETHKAWREQVHRFLAGALGIEILTLALLATR
FT                   KRRFGSTAVVTACVLVAAGIPLYMMGWHGTASALALIGEAILLIAALRWSNIDLARAAL
FT                   LTLAVVIFQALLGMWTVTLLLKPVVVMGHLLGGMLMFGLLVWMAWRATHMPITLAEAPK
FT                   LKWLLRIGVAVLVTQIALGGWVSANYAALACGGGSASLDNFPRCANQWWPQHNFVEGFT
FT                   LWRGIGVDYEGGVLDGASRIAIQMAHRMFAVVVAVYLLWLGVRLFRLPSMRGWASALIA
FT                   LLVLQVTLGILNVKLALPLEVAVAHNGVAVALLFVLVSLLARLRAPD"
FT   sig_peptide     383167..383280
FT                   /locus_tag="Smal_0318"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.912) with cleavage site probability 0.481 at
FT                   residue 38"
FT   gene            384335..385228
FT                   /locus_tag="Smal_0319"
FT   CDS_pept        384335..385228
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0319"
FT                   /product="protoheme IX farnesyltransferase"
FT                   /note="TIGRFAM: protoheme IX farnesyltransferase; PFAM:
FT                   UbiA prenyltransferase; KEGG: xcb:XC_3896 protoheme IX
FT                   farnesyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50024"
FT                   /db_xref="GOA:B4SHI1"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR006369"
FT                   /db_xref="InterPro:IPR030470"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4SHI1"
FT                   /protein_id="ACF50024.1"
FT                   /translation="MFSNYRQYWDLTKPKVVALIVFTALVGMVLAIPGVPSWEQVRAGV
FT                   LGFLGIWLAASAAAAINQLLDAHIDAQMARTSWRPLVVGKVKPWQVLVFASVLIVLSMV
FT                   ILVLWVNLITAVLTFASLIGYAVIYTVYLKRATSQNIVIGGLAGAMPPMLGWAAVTGMQ
FT                   GSSDWAYSSLLVLIIFIWTPPHFWALAIFRREDYAKAEIPMLPVTHGVVHTRKQIMVYS
FT                   VVLALVCLLPYLVGMSGAFYLGGAIVLNAVFLWYAWRMLDPPDELFSMKMFYYSIVYLM
FT                   ALFAFLLVDHWILPWL"
FT   sig_peptide     384335..384430
FT                   /locus_tag="Smal_0319"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.807) with cleavage site probability 0.761 at
FT                   residue 32"
FT   gene            385420..386241
FT                   /locus_tag="Smal_0320"
FT   CDS_pept        385420..386241
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0320"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mxa:MXAN_1009 putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50025"
FT                   /db_xref="UniProtKB/TrEMBL:B4SHI2"
FT                   /protein_id="ACF50025.1"
FT                   /translation="MHSIFRWTTALLLALGMALNAHADDTAAQIRQHAGDHRLLVLGEF
FT                   HGTRETPLLVRELMEAYAADGAPVRLALELPTDENAALATYMASAGTARARAALRGTTY
FT                   WNVRSRMHDGRRNEDMLDLIEAVRVLRSQGRDVQVFGFDRVLPAEMAGTGARDRVMAEE
FT                   VRARAQVLPKKGRLLVLTGNVHGMRTQPKAIAYPPMTALLKDLDLYNVRIEARGGEGWG
FT                   CTAVQRCGARQLGSHEGASPRLDTDADRSYDLWVWLPRFSVARLLDSASVW"
FT   sig_peptide     385420..385491
FT                   /locus_tag="Smal_0320"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 24"
FT   gene            complement(386374..387345)
FT                   /locus_tag="Smal_0321"
FT   CDS_pept        complement(386374..387345)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0321"
FT                   /product="Bile acid:sodium symporter"
FT                   /note="PFAM: Bile acid:sodium symporter; KEGG: xcb:XC_3894
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50026"
FT                   /db_xref="GOA:B4SHI3"
FT                   /db_xref="InterPro:IPR016833"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:B4SHI3"
FT                   /protein_id="ACF50026.1"
FT                   /translation="MTRWWSRLRPDNFTLALLCTVGLASLLPMKGAAAIVLDDVTTVAI
FT                   AALFFLHGARLPRESIIGGMLHWRLHLTILACTFILFPLLGLMVKPLSGWLLTPELYLG
FT                   VLFLCTLPSTVQSSIAFTSMARGNVPAAVCSASLSSILGVFLTPLLLTALAGTSGGVHD
FT                   PLHAIGGIMLQLLVPFVAGHLLRPWIAGWVEKQRALLRYTDQATILLVVYSAFGEAVTE
FT                   GLWSKTPLLSLLAVAVVAAVLLGIAMPLITFIARRLRFNREDEIAIVFCGSKKSLATGV
FT                   PIAKVLFAGGSLGAIVLPVMIYHQIQLIVCGVIAQRYARRKP"
FT   sig_peptide     complement(387244..387345)
FT                   /locus_tag="Smal_0321"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.758 at
FT                   residue 34"
FT   gene            complement(387374..387874)
FT                   /locus_tag="Smal_0322"
FT   CDS_pept        complement(387374..387874)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0322"
FT                   /product="protein of unknown function DUF442"
FT                   /note="PFAM: protein of unknown function DUF442; KEGG:
FT                   xcb:XC_3893 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50027"
FT                   /db_xref="GOA:B4SHI4"
FT                   /db_xref="InterPro:IPR005939"
FT                   /db_xref="InterPro:IPR029021"
FT                   /db_xref="UniProtKB/TrEMBL:B4SHI4"
FT                   /protein_id="ACF50027.1"
FT                   /translation="MLLRLTCLLLLSLCLPLTALAEDAPLNEVRPGLYAGGQPSATQLQ
FT                   ALAAQGVRTVIDLRQPDEDRGFDETRVAESLGLRYVRIPVAGADGLDAANIRAVHQALQ
FT                   QSQGPVLLHCASGNRAGAVLGLINARYEHASPEQALQLGQRAGLKSLEAATRQRLATPV
FT                   TSP"
FT   sig_peptide     complement(387809..387874)
FT                   /locus_tag="Smal_0322"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 22"
FT   gene            complement(387903..389642)
FT                   /locus_tag="Smal_0323"
FT   CDS_pept        complement(387903..389642)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0323"
FT                   /product="DNA primase"
FT                   /note="KEGG: xac:XAC3876 DNA primase; TIGRFAM: DNA primase;
FT                   PFAM: zinc finger CHC2-family protein; TOPRIM domain
FT                   protein; DNA primase DnaG DnaB-binding; DNA primase
FT                   catalytic core domain; SMART: Toprim sub domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50028"
FT                   /db_xref="GOA:B4SHI5"
FT                   /db_xref="InterPro:IPR002694"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR006295"
FT                   /db_xref="InterPro:IPR013173"
FT                   /db_xref="InterPro:IPR013264"
FT                   /db_xref="InterPro:IPR016136"
FT                   /db_xref="InterPro:IPR019475"
FT                   /db_xref="InterPro:IPR030846"
FT                   /db_xref="InterPro:IPR034151"
FT                   /db_xref="InterPro:IPR036977"
FT                   /db_xref="InterPro:IPR037068"
FT                   /db_xref="UniProtKB/TrEMBL:B4SHI5"
FT                   /protein_id="ACF50028.1"
FT                   /translation="MARIPDAFIDDLLARSDIVEVVGSRVPLKRQGKEYAARCPFHDER
FT                   SASFTVSPTKQFYHCFGCGAHGTAISFLMNYDRLEFLDAVDELAKRAGMEVPRSENPRS
FT                   PQQQDDSRELYSALEAATKFFQSNLQGSDKARSYLDGRGVDEENRARFQIGYAPDGYSG
FT                   LRDALGKDERRMKLLDRAGLFSKNDRGHVYDKFRDRVMFPIFDRRGRVIAFGGRVFEKD
FT                   DGPKYLNSPETALFHKGRELYGLWQVRQANQKIERLIVVEGYMDVVSLFQFGVTQAVAT
FT                   LGTATTPDHAELLFRNAPDVFFCFDGDAAGRRAGWKALESVLPRMKDGRQAFFLFLPDG
FT                   EDPDTIVRKEGAEAFNERLKQATPLSQFFFDELTREINLGTLDGKARLAERAKPMLAQI
FT                   PDGAFGDLMKQQLAQLTGLGGNAQAARAPMPQRQPSRAIQPVAKRSLVRGAIAVLLQQP
FT                   SLALTLGGKHHFQGLRLPGVELLLELLDLVEQRPDISTGALLEHFDGREEQASLHTLAA
FT                   QTMPGDDAMWTQELHDAVAQLEKQLLVQRLEELLAKQRQQGLDDTDKYELRELLKARAG
FT                   LRL"
FT   gene            complement(389703..390647)
FT                   /locus_tag="Smal_0324"
FT   CDS_pept        complement(389703..390647)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0324"
FT                   /product="ribonuclease BN"
FT                   /note="PFAM: ribonuclease BN; KEGG: xcv:XCV3993 putative
FT                   ribonuclease BN"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50029"
FT                   /db_xref="GOA:B4SHI6"
FT                   /db_xref="InterPro:IPR017039"
FT                   /db_xref="UniProtKB/TrEMBL:B4SHI6"
FT                   /protein_id="ACF50029.1"
FT                   /translation="MVEQSHSPADTRPHGIPARLRHYADRLQDSFPMAVAKRFVEIDVL
FT                   TQAASVSFYALLSMAPLLVLLLWLTASLYPPAQQTLISQIGSVAGSSVASVADTVLHNA
FT                   NSQPSVGSLAGLWSTLLLFIGATAVFAQLQNALNRIFHTSGQRLEGVKAWLRKRVFSFG
FT                   VVLALGFLLILSMTATTALQVVFAQLPSVLPAIGYLTSLLLYTLAFAFLYHYLPDRRVA
FT                   WRQAFIGGAITSVLFTLGRYGIGVYIATVAPGSAYGSMGALVISLVWIYYATAVFFVGA
FT                   LMTAVIDERQHARAQLARAGIEAEQASPGTASE"
FT   gene            complement(390751..391194)
FT                   /locus_tag="Smal_0325"
FT   CDS_pept        complement(390751..391194)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0325"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xac:XAC3873 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50030"
FT                   /db_xref="GOA:B4SHI7"
FT                   /db_xref="InterPro:IPR003789"
FT                   /db_xref="InterPro:IPR019004"
FT                   /db_xref="InterPro:IPR023168"
FT                   /db_xref="InterPro:IPR042184"
FT                   /db_xref="UniProtKB/TrEMBL:B4SHI7"
FT                   /protein_id="ACF50030.1"
FT                   /translation="MSMKLQLTEDMKAAMKAGEKHKLGVIRLINAAIKQREVDERIELD
FT                   DTAVIAVLDKMVKQRKDSVSQFEAANREDLAEIERAEIVVIEAYLPAKMGEAEIVAAIQ
FT                   AAIAETGASGPTDMGKLMGALKPKLAGQADMGLVSKLVKQQLA"
FT   gene            complement(391327..391542)
FT                   /locus_tag="Smal_0326"
FT   CDS_pept        complement(391327..391542)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0326"
FT                   /product="ribosomal protein S21"
FT                   /note="PFAM: ribosomal protein S21; KEGG: xom:XOO_3902 30S
FT                   ribosomal protein S21"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50031"
FT                   /db_xref="GOA:B4SHI8"
FT                   /db_xref="InterPro:IPR001911"
FT                   /db_xref="InterPro:IPR018278"
FT                   /db_xref="InterPro:IPR038380"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4SHI8"
FT                   /protein_id="ACF50031.1"
FT                   /translation="MPSVKVRENEPFEFALRRFKRTCEKAGVLAETRKREFYEKPTQER
FT                   KRKAAAAVKRQLRRSSRDVTKRQRLY"
FT   gene            391709..392734
FT                   /locus_tag="Smal_0327"
FT   CDS_pept        391709..392734
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0327"
FT                   /product="metalloendopeptidase, glycoprotease family"
FT                   /EC_number="3.4.24.57"
FT                   /note="KEGG: xcv:XCV3990 O-sialoglycoprotein endopeptidase;
FT                   TIGRFAM: metalloendopeptidase, glycoprotease family; PFAM:
FT                   peptidase M22 glycoprotease"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50032"
FT                   /db_xref="GOA:B4SHI9"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR017861"
FT                   /db_xref="InterPro:IPR022450"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4SHI9"
FT                   /protein_id="ACF50032.1"
FT                   /translation="MRVLGIESSCDETGVAVYDTDLAGSAALRAHAVYSQIALHAEYGG
FT                   VVPELASRDHVRKLLPLVRQTLAEAGLGVGDIDGVAYTAGPGLVGALLVGAGVARSLAW
FT                   ALEVPAVGVHHMEGHLLAPLMEDDPPQAPFVALLVSGGHTQLVAVDAIGQYRLLGETLD
FT                   DAAGEAFDKTAKMMGLPYPGGPQLARLAEQGTPGVYRFARPMIDRPGLDFSFSGLKTQV
FT                   LMAWRDSDQSEQTRADIARGFEDAVVETLSIKCERALEAAGTNVIVVAGGVGANKRLRA
FT                   RLQQMAERLGGRACFPRPALCTDNGAMIAFAGALRLQAGQHSPPKVDVTPRWDMATLPA
FT                   V"
FT   gene            complement(392872..393537)
FT                   /locus_tag="Smal_0328"
FT   CDS_pept        complement(392872..393537)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0328"
FT                   /product="protein of unknown function DUF1526"
FT                   /note="PFAM: protein of unknown function DUF1526; KEGG:
FT                   pst:PSPTO_0149 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50033"
FT                   /db_xref="UniProtKB/TrEMBL:B4SHJ0"
FT                   /protein_id="ACF50033.1"
FT                   /translation="MTMAPHDVLRRALSAERLSTYERIASTCSPDVTAESLYLWNMRMC
FT                   GALMMPVHLCEVVTRNAAATVLARQHGPRWPWNDAFRRRLPTSSCTSARAALEHVAGRT
FT                   TDTPEIVAKLPMVFWQQLFTCRFDDTLWIPALNGVLRHAPSAHPSVIRKAIHADIGRIR
FT                   HLRNRIAHHEPILERDIGADLAAIGRLIHARCPHTLGWLQRHERATTVLAASPLAGRP"
FT   gene            394054..394407
FT                   /locus_tag="Smal_0329"
FT   CDS_pept        394054..394407
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0329"
FT                   /product="dihydroneopterin aldolase"
FT                   /note="TIGRFAM: dihydroneopterin aldolase; KEGG:
FT                   xcb:XC_3887 dihydroneopterin aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50034"
FT                   /db_xref="GOA:B4SHJ1"
FT                   /db_xref="InterPro:IPR006156"
FT                   /db_xref="InterPro:IPR006157"
FT                   /db_xref="UniProtKB/TrEMBL:B4SHJ1"
FT                   /protein_id="ACF50034.1"
FT                   /translation="MDKVFIEGLTIDALIGIYDWERRIRQDLVFDLEMGFDNRRPAASD
FT                   DIAHTLNYKAVSKRLEQFVRESEFGLVETLAERCAQIVLSEFDVKWLRLKLSKPGAVRG
FT                   ARAVGVIIERTRD"
FT   gene            394466..395737
FT                   /locus_tag="Smal_0330"
FT   CDS_pept        394466..395737
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0330"
FT                   /product="MscS Mechanosensitive ion channel"
FT                   /note="PFAM: MscS Mechanosensitive ion channel; KEGG:
FT                   mxa:MXAN_4113 mechanosensitive ion channel family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50035"
FT                   /db_xref="GOA:B4SHJ2"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR030192"
FT                   /db_xref="UniProtKB/TrEMBL:B4SHJ2"
FT                   /protein_id="ACF50035.1"
FT                   /translation="MVDAVVAVQWLERLQNTLEPYPGAYLALMITALLVAAGLANWVTK
FT                   RILVRGLRRLLQRLPGAESGRGSHLMRVISRLSNVVPSQVIASGITLIPDLPPGLVNVI
FT                   IKLCIVWAVLTVSMAFSHALDAANSLYERKPDARNKPIKGYLQVVKIVVFVAAGLSIIA
FT                   TLLGVKLGPLVTGLGAATAVLMLIFQDTILSLVASVQISGDGRVRIGDWIEMPSQNADG
FT                   DVIDIALHTVTVQNFDKTITTIPTKKLVTESFKNWRGMQEAGGRRIKRALYLDQHSVGF
FT                   LDEGDLAFLGQFALLRDYLQEKEQELGQWNGRLREQGVAEVNSRRVTNLGTFRAYVERY
FT                   LRNHPGIHTDMTLLVRQLQPTTEGLPLELYCFTRSTAWGEYESVQSDIFDHLLAILPAF
FT                   GLRVFQASSDAMLMAGQRQLAGSE"
FT   gene            395866..398040
FT                   /locus_tag="Smal_0331"
FT   CDS_pept        395866..398040
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0331"
FT                   /product="glycoside hydrolase family 3 domain protein"
FT                   /note="PFAM: glycoside hydrolase family 3 domain protein;
FT                   KEGG: xcb:XC_3886 beta-glucosidase"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50036"
FT                   /db_xref="GOA:B4SHJ3"
FT                   /db_xref="InterPro:IPR001764"
FT                   /db_xref="InterPro:IPR002772"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR019800"
FT                   /db_xref="InterPro:IPR026891"
FT                   /db_xref="InterPro:IPR036881"
FT                   /db_xref="InterPro:IPR036962"
FT                   /db_xref="UniProtKB/TrEMBL:B4SHJ3"
FT                   /protein_id="ACF50036.1"
FT                   /translation="MASDRIESLIAQMTVEEKVGQLGVFADMVRPFAPDVNPEANVRNA
FT                   DQVLQQVREGKVGSLFNGVGAELGRRIQQVATEESRLGIPVILAADVIHGMRTVFPIPL
FT                   GEAASFEPELAERTARATAVEATAAGLHWTYAPAVDIARDQRWGRGAEGAGEDVVLGCA
FT                   FAAARVRGFQGSDLRADDSLLATPKHFAAYGAVMAGMEYNMVDISPQTLRDVHLPPFKA
FT                   AFDAGAITVMSSFNDINGVPASANAELLTDILRGEWKFPGVVISDYTADMELVAHGYAA
FT                   DDRDATAKAFTAGLDLSMQSGFYAEHLPGLVESGDVPMAVLDEGVRRILWLKETIGLFD
FT                   DPYRSLDPAREADTSHIADHDELSRDAARRSIVLLNNRDNVLPLQKTGQKIALIGPFVQ
FT                   DRENIEGCWTLFGDKQRYVDLETGVRAAIGDESLLEIVPGCELEVAIPGGTEAAVAAAL
FT                   RADVVVLALGEPQRYSGEAQSRVEITLPPAQQALAEAVAMTGKPLVVLLRNGRALALQG
FT                   AVRNAQAVAVTWYLGTQTGHAVADVLFGDYSPSGRLPVSFPQVSGQQPYFYNHPRTGRP
FT                   ELPTMSEFKARWREIPNEPLYPFGHGIGYTTFAYGVPQLSAAQLGWDDTLTITTTLTNS
FT                   GDVAGEEVVQLYIHDRVASRVRPVRELKDFRKVALQPGESTEVVFTLSREQLAFTGRDG
FT                   VLRAEPGQFDVWVCASSAVGEAVQFELLKA"
FT   gene            398172..398708
FT                   /locus_tag="Smal_0332"
FT   CDS_pept        398172..398708
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0332"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gvi:gsl1632 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50037"
FT                   /db_xref="UniProtKB/TrEMBL:B4SHJ4"
FT                   /protein_id="ACF50037.1"
FT                   /translation="MRMIAVLIPALFLAACSQPPAEPAVDAPPPMEASAAATPAAEPAK
FT                   AAAEPAGAAPTDAPAEDARARIESLLGDAAQYEKVFNAFRTAVVGGDRAAVVEEVRFPL
FT                   NIANGKKITGPGEFQRSYEKIITPAVVKAVSEQDFGKVFVNQQGVMIGDGQVWLNGQCL
FT                   DQACTKTEVKVITIQ"
FT   sig_peptide     398172..398225
FT                   /locus_tag="Smal_0332"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.844) with cleavage site probability 0.814 at
FT                   residue 18"
FT   gene            complement(398826..399989)
FT                   /locus_tag="Smal_0333"
FT   CDS_pept        complement(398826..399989)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0333"
FT                   /product="glucose sorbosone dehydrogenase"
FT                   /note="PFAM: glucose sorbosone dehydrogenase; KEGG:
FT                   xcv:XCV3987 putative secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50038"
FT                   /db_xref="GOA:B4SHJ5"
FT                   /db_xref="InterPro:IPR011041"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR012938"
FT                   /db_xref="UniProtKB/TrEMBL:B4SHJ5"
FT                   /protein_id="ACF50038.1"
FT                   /translation="MTRTPLLLALGLLPILATTACSAAGPDASGQKAAATSAAADQRPF
FT                   TATEVSRFDQPWAMTFLPDGSLLVTEKRGKLQHLDLASGQKHEITGVPKVAYGGQGGFG
FT                   DVILHPQFASNHVIYLSYAEEGTLDTRGAAVARATLALDAKGGGELKDLKVIWRQTPKV
FT                   SGEGHYGHRLVFGPDGKLWISSSERQKFDPAQDMGGNLGKIIRLNDDGSLPTDNPFASQ
FT                   GGVAAQVWSLGHRNILGMAFDANGKLWAHEMGPAGGDELNLIVRGANYGYPIVSNGDHY
FT                   DGRPIPDHSTRPEFAAPKVTWTPVISPAGFVIYSSNLFPQWKGSGFIGGLSSTSLVRVA
FT                   FDGDSAREAERFNMGERIREVEQGPDGALWLLEDGNKARLLKLTPKT"
FT   sig_peptide     complement(399918..399989)
FT                   /locus_tag="Smal_0333"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.867 at
FT                   residue 24"
FT   gene            400160..400612
FT                   /locus_tag="Smal_0334"
FT   CDS_pept        400160..400612
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0334"
FT                   /product="YiaAB two helix domain protein"
FT                   /note="PFAM: YiaAB two helix domain protein; KEGG:
FT                   xcb:XC_3884 membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50039"
FT                   /db_xref="GOA:B4SHJ6"
FT                   /db_xref="InterPro:IPR008024"
FT                   /db_xref="InterPro:IPR038972"
FT                   /db_xref="UniProtKB/TrEMBL:B4SHJ6"
FT                   /protein_id="ACF50039.1"
FT                   /translation="MNAPIIHRPSPAFIAASWVALLLGAVAYLVGLFNAEMPLNEKGYY
FT                   LTLLLFGLFAAVSLQKSVRDRVEGIPVSGLYYALCWFALLSALLLLLVGLWNATLVLSE
FT                   KGFYGMAYALSLFGAVAVQKNTRDLIAAGGGESKRSAGVPPLPEQE"
FT   sig_peptide     400160..400243
FT                   /locus_tag="Smal_0334"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.794) with cleavage site probability 0.505 at
FT                   residue 28"
FT   gene            complement(400665..400994)
FT                   /locus_tag="Smal_0335"
FT   CDS_pept        complement(400665..400994)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0335"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xcb:XC_3883 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50040"
FT                   /db_xref="UniProtKB/TrEMBL:B4SHJ7"
FT                   /protein_id="ACF50040.1"
FT                   /translation="MAEYQIPGRVPDDSTPRDAVSNYWRERYTSEPYYDDQLFFDDYEP
FT                   AYRIGHSARAQDMIRAYEEMEGELESRWASERGKSRLEWAQARNAVRRGWEEAQQVEPR
FT                   LARGP"
FT   gene            complement(401103..402404)
FT                   /locus_tag="Smal_0336"
FT   CDS_pept        complement(401103..402404)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0336"
FT                   /product="amino acid permease-associated region"
FT                   /note="PFAM: amino acid permease-associated region; KEGG:
FT                   xcb:XC_3881 cationic amino acid transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50041"
FT                   /db_xref="GOA:B4SHJ8"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:B4SHJ8"
FT                   /protein_id="ACF50041.1"
FT                   /translation="MSAQDEPQLQRAVSRWQIVGLSINDVIGSGIYLLPAATVALLGPF
FT                   SLWGVVAAGIVVALLVLCYAQAASYFDEPGGSYLYAREAFGRFAGFEIGWMIWLTRISS
FT                   AAALSNALADAVARFWPWAGAGMGRIAVIVVSLGFLTGVNIIGVRSAARTGVVLVIGKM
FT                   LPLLLFVAIGAFYIDPQLVFSGQRPDPHDLQRMGEAALLLLYAYAGFENIPAAAGEYRN
FT                   PRRDIPFALITMIITVTVIYGAVQVVAQGTLAGLSSSATPLADAAAGFGGEALALILTV
FT                   GATISILGTNSNTMMMGPRFLFALARDGYGPKILAQVHPRFHTPAASILCQGLIALGLA
FT                   LSGSFVQLALLSMTTRLFAYIGTAAAVLVLAKRYADRPGALKLPGGPLIPVLALLLCLA
FT                   LFASASWQNIAAALVAFAIGAVIYKLPRKDADAG"
FT   gene            complement(402401..403162)
FT                   /locus_tag="Smal_0337"
FT   CDS_pept        complement(402401..403162)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0337"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xcb:XC_3880 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50042"
FT                   /db_xref="GOA:B4SHJ9"
FT                   /db_xref="InterPro:IPR005490"
FT                   /db_xref="UniProtKB/TrEMBL:B4SHJ9"
FT                   /protein_id="ACF50042.1"
FT                   /translation="MNSLARLATTALLLAAAMSAYAAPLDGARQLIVVTSDNWSSTQGQ
FT                   LQAYERDGKGWRTHGQGFPVALGRTGSAWGLGLHPAQGDGPQKQEGDGRSPAGVFALGS
FT                   AFGYAITRPRTAMAYQPMLESSYCMDVPGSPFYNRIVDAKKVGSAAIKGSTEPMRLDLH
FT                   NKGDVRYQEGFVIAHNPDNQPGKGSCIFAHLWRAPGEATAGCTAMPQARMQALLDWLRP
FT                   QDTPRFVLLPRAEYTRLQAQWQLPALSGDAR"
FT   sig_peptide     complement(403094..403162)
FT                   /locus_tag="Smal_0337"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 23"
FT   gene            complement(403178..404026)
FT                   /locus_tag="Smal_0338"
FT   CDS_pept        complement(403178..404026)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0338"
FT                   /product="transcriptional regulator, RpiR family"
FT                   /note="PFAM: helix-turn-helix protein RpiR; sugar isomerase
FT                   (SIS); KEGG: sdy:SDY_2751 putative DNA-binding
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50043"
FT                   /db_xref="GOA:B4SHK0"
FT                   /db_xref="InterPro:IPR000281"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR035472"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:B4SHK0"
FT                   /protein_id="ACF50043.1"
FT                   /translation="MPPLLKIRSERGQMSAIERRIADFILDNAHLLRDYSSQQLASALG
FT                   ISQSSVVKFSQKLGFKGYPDLKYSIGQDVARAGADPQQAPSEPDSGDDYLRLGEALRRS
FT                   KAQAEEETRQANPREEIERIVQLLDGAPKLFVYGLGDDGLYAREFAMRLSLLGLLVVPH
FT                   TDPILMLANLSAARPGDVLLMFSEFGNLPQLSQLSRQFQDMGGKVISITRHTANPLRAH
FT                   ADAALAVCAHDRTPQVAQLLYRSAMHALLDFLFVLLCHANPDRQQQLAVNLERIDHLLD
FT                   S"
FT   gene            complement(404448..405542)
FT                   /locus_tag="Smal_0339"
FT   CDS_pept        complement(404448..405542)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0339"
FT                   /product="Mandelate racemase/muconate lactonizing protein"
FT                   /note="PFAM: Mandelate racemase/muconate lactonizing
FT                   protein; KEGG: xcv:XCV3980 putative chloromuconate
FT                   cycloisomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50044"
FT                   /db_xref="GOA:B4SHK1"
FT                   /db_xref="InterPro:IPR013341"
FT                   /db_xref="InterPro:IPR013342"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR029065"
FT                   /db_xref="InterPro:IPR034603"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="UniProtKB/TrEMBL:B4SHK1"
FT                   /protein_id="ACF50044.1"
FT                   /translation="MKITAIELGMLRVPLKTPFKTALRTVETVEDVVVLIRTDTGHTGY
FT                   GEAPATAVITGDTHGSIIEAIRHFIAPRLIGQDVVNLNHLCTLVQTAMERNSSAKAAVE
FT                   IALYDLWAQLHGAPLYQMLGGGDPVITTDITISVDYIDKMVADSLSAIERGFESLKIKV
FT                   GKDIGLDIERVKAIHAAVEGRALLRLDANQGWTAKQAVHAMRTLEEAGVVLELLEQPVK
FT                   AADISGLKYVTDRVNTPVMADESVFSPSQVMDLIQQRAADIINIKLMKTGGLSNAIRIA
FT                   DIAGIYGVPCMIGCMIESSISVAAAVHLAVAKSDVITKVDLDGPSLGQFDPVSGGVHFN
FT                   ESEISISDVPGLGITEVRGLEMLG"
FT   gene            complement(405539..406978)
FT                   /locus_tag="Smal_0340"
FT   CDS_pept        complement(405539..406978)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0340"
FT                   /product="NLP/P60 protein"
FT                   /note="PFAM: NLP/P60 protein; KEGG: xcv:XCV3979
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50045"
FT                   /db_xref="InterPro:IPR000064"
FT                   /db_xref="InterPro:IPR027017"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="InterPro:IPR039439"
FT                   /db_xref="UniProtKB/TrEMBL:B4SHK2"
FT                   /protein_id="ACF50045.1"
FT                   /translation="MILASREPRRHWPRRLTLALCLLAAPAFAQATPAPDPGAPLPYVI
FT                   GLHEAYLTPGYWAARLENADTPILDRMQIDAQNARMRAQDRHIQDIAVLPAQLDAAAVR
FT                   GSITALSSWPTRTLYNDEGQAITPALRSAIEANLGLDAIPAQTTPQYGLVVKRAALRTF
FT                   PTRERVFSTVGDTDIDRFQESALFPGDKVAVVHRSADGRWLFVHSERYSAWIEADAIAS
FT                   GDKATVLGYGAKGPYRIVTGATAQTAYTPEEPRVSRLQLDMGVRLPVLADWPAAEPVNG
FT                   QQAHAAWVVQLPVRESDGRLKLVPALLPRSQDTAADYLPLTPRLLLQQAFKFLGERYGW
FT                   GHDYDTRDCSGFVSEIYRSFGVLLPRNTSAQAVSPALDRVPFTGKDGKAVRDSAVTDLQ
FT                   VGDLVYIPGHVMMAIGHVDGRTWVIHDTAGGSWYGADGKRVQAHLNGVSVTPLEPMMAS
FT                   DSVRYIDRITNIQRLRAKTPE"
FT   sig_peptide     complement(406883..406978)
FT                   /locus_tag="Smal_0340"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.562 at
FT                   residue 32"
FT   gene            407240..408601
FT                   /locus_tag="Smal_0341"
FT   CDS_pept        407240..408601
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0341"
FT                   /product="transglutaminase domain protein"
FT                   /note="PFAM: transglutaminase domain protein; KEGG:
FT                   bfs:BF2762 putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50046"
FT                   /db_xref="InterPro:IPR002931"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:B4SHK3"
FT                   /protein_id="ACF50046.1"
FT                   /translation="MIDAGRFFEAGSALNTWSAADAAEPGVSEQDIGFQQERMRRIRLD
FT                   FSLDQAAAKAAVRRWIPDLTDEEFARWDQLGLIEHLDIDGTRWYFKRAPSNLFLLSDEA
FT                   RARRRADAPLPAPGPNEVLNAHHARVIAVAEQSGQASVLPQRIEFIQSLTVKADAVPAG
FT                   ETVRAWIPYPREIPGQQERVQWLGGTPGRARVAPASAQQRTAYLEAKAVAGQPTHFEIR
FT                   YAVSIFAHHTAIDPAKVQATPADAALKPYLAEQLPHVRFTPALKLFSDQVLQGETRPYD
FT                   VVRKLFTAVDRIPWAGAREYSTISSISDYALRAGHADCGQQTLLLIALLRMNGIPARWQ
FT                   SGMVFSDDGSGYNNLHDWGQVYLAPYGWLPMDVTTGALASDTPALRDFYLGGLDGYRIA
FT                   FNDDFGQALVPAKQHHRSETVDSQRGEAEWAGGNLYFDQWNYDFQWRVLPAGQR"
FT   gene            408653..411676
FT                   /locus_tag="Smal_0342"
FT   CDS_pept        408653..411676
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0342"
FT                   /product="TonB-dependent receptor plug"
FT                   /note="PFAM: TonB-dependent receptor; TonB-dependent
FT                   receptor plug; KEGG: saz:Sama_3060 TonB-dependent receptor,
FT                   plug"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50047"
FT                   /db_xref="GOA:B4SHK4"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR013784"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039426"
FT                   /db_xref="UniProtKB/TrEMBL:B4SHK4"
FT                   /protein_id="ACF50047.1"
FT                   /translation="MKAYTIKRAALCVALGACLGAMLPSIALAQNVSGAVAGRATAGDQ
FT                   VTVVSSSTGLTRTVTVGADGSYRLGQLPVGDYQLQLSREGQALGDQVAVSVAVGGTTTV
FT                   NLASGGGVTNLDALQVRGTRVINRVDVYSTETSFNINRQEISRLPVAQDLSAVALMAPG
FT                   VVGGNSSFGGLSFAGSSVAENAVFINGLNVTDMYTRRGFSTAPFAFFNEFQVKTGGYSV
FT                   EFGRSTGGVINAVTRSGSNVFEGGVEVTAEPSAWRSSGGDHFHRDGTPHSYGSRDNNSF
FT                   LKTNVWGSGPIIKDKLFLFAMYEDRSDKGHNTSSDGSTWFKNDSGNGFWGTKLDWNIND
FT                   NHSLALLAFSDEGDVTNASYGYNWNNDRLGAWGGDSITETGGRNWSATYTGHFGQNFTA
FT                   RAMVGQNKQRAFTNSSLDQACSPVFTDSTYGPRLGKLQGLRAGCHPTGTAVAERDDTRD
FT                   VARLDFEWQLGDHLLRFGVDRELMTTDQSTRYPGPTALSYTAYVARPGDEVWDGANAYV
FT                   PAGVTEMLRARNRQSGGKFETEANAFYLEDIWNITPNLMLNLGVRWDRFENRTAAGKAF
FT                   IKMDDLIAPRVGFSWDMRGDGSTKLFGNAGRYYLPVTNNINVNFAGGLTDEYSYYVLNG
FT                   WEQKTSPTGSPYMAPIVGQQIGPTDTRMNTGGADLRQSVDRDLKAVYQDEYILGFQNMI
FT                   NQAWSWGVNATYRRMTRALDDIRINYTPCGPTPSTLWPIANPGESLTIWGDKSIGCANE
FT                   GWITIDTANSGYRKGGSGEVIGYSKPKRTYKALEFQIDRAWDEKWMLNASYLWSKSEGN
FT                   FEGPVNSDTNYGDTGMVQFWDHPATNERYGVLFNDFRHQFKLRAAYALNKQWSFGTTLQ
FT                   VQSGGPITAYGVMWPNDSIAGGSTSSEGSGGGTGWLCVANCSGPYDKRQFEYSPRGAFG
FT                   RLPWTWTMGANVTWRLPVEGIDLSARLSVYNLFNNQKTINVHQRYEAQPGQYREATFAT
FT                   GTRWQAPRYTQLVVTWNF"
FT   sig_peptide     408653..408742
FT                   /locus_tag="Smal_0342"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.973 at
FT                   residue 30"
FT   gene            411732..413285
FT                   /locus_tag="Smal_0343"
FT   CDS_pept        411732..413285
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0343"
FT                   /product="beta-lactamase"
FT                   /note="PFAM: beta-lactamase; KEGG: pat:Patl_4159
FT                   beta-lactamase"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50048"
FT                   /db_xref="InterPro:IPR001466"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:B4SHK5"
FT                   /protein_id="ACF50048.1"
FT                   /translation="MHHLLILAAALTAPSASAADTASIDADVAAVVRVEHLPGLAMAVV
FT                   ENGQVVHRHVEGTRGDGGRIDDDTLFKIASNSKAMTAALLARLVQQGKLRWDDPVQRHL
FT                   PGFRMHDAWVGRQMQVRDLLIHNSGLGLGAGDLMLWPEPNAFTRADIIAGLAHLKPVSS
FT                   FRSHYAYDNLMYVVAGEVAAAAGGKPYDQLMREQVFEPLGMTRCQVGAWSVKRVGNVAQ
FT                   PHAWRGERNEVVNADGETSPDLPSMAAGGIRCSLRDMTRWMQVLLDPALVPDWLGSEQR
FT                   RTLWTLHMPMPLGERQRRWDNAHFHGYGYGWRVSDMDGQWKVAHTGTLSGMYSSLALLP
FT                   DRKVGVVMLINGEGEDARVALMQAALKRFTAPDEARPAMEYLAELKADQATRAATGHSR
FT                   PSTVAAQETSRTDLPRWQGRYRDPWLGPASLCPGADGLRFSVDKSPKLRATVLQLQGRW
FT                   LLRWDTLGEDAQAWLQPGDGAPPTLDLRAIDPDIDFSYDFQDLHFTRTGDCAGSDHPRR
FT                   "
FT   sig_peptide     411732..411788
FT                   /locus_tag="Smal_0343"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.908 at
FT                   residue 19"
FT   gene            413218..413931
FT                   /locus_tag="Smal_0344"
FT   CDS_pept        413218..413931
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0344"
FT                   /product="peptidase M15D vanX D-ala-D-ala dipeptidase"
FT                   /note="PFAM: peptidase M15D vanX D-ala-D-ala dipeptidase;
FT                   KEGG: xcb:XC_3873 D-alanyl-D-alanine dipeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50049"
FT                   /db_xref="GOA:B4SHK6"
FT                   /db_xref="InterPro:IPR000755"
FT                   /db_xref="InterPro:IPR009045"
FT                   /db_xref="UniProtKB/TrEMBL:B4SHK6"
FT                   /protein_id="ACF50049.1"
FT                   /translation="MTSRICISLVLATALAATTRAAEPPRVSPATDAASAGLVEIRTLS
FT                   PGIDMDIRYAGANNFTGARVPGYEAPSCYLLAPVAKALAQVEQDLRADGFGLRIYDCYR
FT                   PVRSVQAFMAWVNDPSELSRKALQYPDLDKPRLLADGYIAERSGHSRGATVDLGLLDCR
FT                   NGRCKPMDMGTDFDFFGPRAHTQTSGLSDAQQANRQQLVSAMARRGFANYPKEWWHYTL
FT                   QPEPDPGTAYDVPVR"
FT   sig_peptide     413218..413283
FT                   /locus_tag="Smal_0344"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.924 at
FT                   residue 22"
FT   gene            414164..414535
FT                   /locus_tag="Smal_0345"
FT   CDS_pept        414164..414535
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0345"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xcb:XC_3871 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50050"
FT                   /db_xref="GOA:B4SHK7"
FT                   /db_xref="UniProtKB/TrEMBL:B4SHK7"
FT                   /protein_id="ACF50050.1"
FT                   /translation="MNLPLHFGLLGTLEAGAIALLVGLLVYFLWSQLCRLLHWTVGHAI
FT                   GWSCVIAVIISAGIDAWKLFYMGIVRLESPLYARLFLATIHDPNELGSRVVLEIAGALA
FT                   GVALGWVMFSSRSSAQNVD"
FT   gene            414768..415178
FT                   /locus_tag="Smal_0346"
FT   CDS_pept        414768..415178
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0346"
FT                   /product="Calcium-binding EF-hand-containing protein"
FT                   /note="PFAM: Calcium-binding EF-hand-containing protein;
FT                   KEGG: xac:XAC3856 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50051"
FT                   /db_xref="GOA:B4SHK8"
FT                   /db_xref="InterPro:IPR002048"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="UniProtKB/TrEMBL:B4SHK8"
FT                   /protein_id="ACF50051.1"
FT                   /translation="MTIRNRKPLIALIVAAGSVLAIPAMAQSAKQQAAQAQNEAAQAQQ
FT                   SAAQAGQAADQATNAAAAASAQANGGGQTWASIDTDGNGTISKTEAQVNAGLAQVFDQA
FT                   DTNKDGELSADEYKAYVAAQQAGAGAGAAQGR"
FT   sig_peptide     414768..414848
FT                   /locus_tag="Smal_0346"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.919 at
FT                   residue 27"
FT   gene            415274..416026
FT                   /locus_tag="Smal_0347"
FT   CDS_pept        415274..416026
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0347"
FT                   /product="Haloacid dehalogenase domain protein hydrolase"
FT                   /note="PFAM: Haloacid dehalogenase domain protein
FT                   hydrolase; KEGG: xcc:XCC3796 hydrolase, haloacid
FT                   delahogenase-like family"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50052"
FT                   /db_xref="GOA:B4SHK9"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:B4SHK9"
FT                   /protein_id="ACF50052.1"
FT                   /translation="MNTPTPAPSRAIGLVGFDGDDTLWKSEDYYRKAEQDYLDLLSRYV
FT                   DVHDTQTARHLLEVQQRHLGTFGYGVKSMTLSMIEAAIDITGQRIEAKDIQRILEIGHD
FT                   TLRHPVELIDGVREAVAAIAEDYPVVLITKGDLFHQEAKIKVANLAELFPRIEIVSEKD
FT                   PETYARVLAEFDLPMQRFVMVGNSLRSDIEPVVTLGGWGVHTPYAVTWAHETQHGVADD
FT                   EPRMVTADTAHDWPAALAAIEAKASAAA"
FT   gene            416058..416546
FT                   /locus_tag="Smal_0348"
FT   CDS_pept        416058..416546
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0348"
FT                   /product="putative secreted protein"
FT                   /note="KEGG: xcv:XCV3969 putative secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50053"
FT                   /db_xref="UniProtKB/TrEMBL:B4SHL0"
FT                   /protein_id="ACF50053.1"
FT                   /translation="MNVRLRALLLSLLLAPATVLAQQTAERSAAYEVETGDRWVDAQLQ
FT                   DINHYAERYPDAFLDEVSRYAGVPRGYISALFTTHGWQAGDIYFACFWAKASGQTCRDS
FT                   VRAFSQDPEGGWETVVKRMPTKPDNLHYRAVRHAIVASYQHWDRPITLDATLKRQLKR"
FT   sig_peptide     416058..416123
FT                   /locus_tag="Smal_0348"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 22"
FT   gene            416709..418073
FT                   /locus_tag="Smal_0349"
FT   CDS_pept        416709..418073
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0349"
FT                   /product="protein of unknown function DUF1338"
FT                   /note="PFAM: protein of unknown function DUF1338; KEGG:
FT                   xcc:XCC3793 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50054"
FT                   /db_xref="InterPro:IPR009770"
FT                   /db_xref="UniProtKB/TrEMBL:B4SHL1"
FT                   /protein_id="ACF50054.1"
FT                   /translation="MSASFVSPDVIRRLFAQAMSRMYRTEVPLYGTLVELVERINAQVL
FT                   DQDPALAAQLQRNDERARLDEERHGAIRVGTVQELATLRRLFAVMGMYPVGYYDLSVAG
FT                   VPVHSTAFRPLTGAALAQNPFRVFTSLLRLELIEDETLRAESAKILARRRIFTDGALAL
FT                   IDQAERDGGLSQADAERFVDEALETFRWHGDATVDLPTYHALHNAHRLVADVVSFRGPH
FT                   INHLTPRTLDIDAAQAAMIEYGMAAKAVIEGPPRRACPILLRQTSFKALEEAVQFPDSE
FT                   GGDAGTHTARFGEIEQRGLALTPKGRALYDQLLSQARDAGGEGSTGGDYGQRLQAVFAS
FT                   FPDDHDTLRQEGLGYYRYQLTDAGRAAPERVADLPAEVLVAAGLATADPIVYEDFLPVS
FT                   AAGIFQSNLGGEEQRAYAAHANREAFEQALGVAVHDEFEIYERLQAESLAALRTA"
FT   gene            complement(418193..419707)
FT                   /locus_tag="Smal_0350"
FT   CDS_pept        complement(418193..419707)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0350"
FT                   /product="succinate CoA transferase"
FT                   /EC_number="3.1.2.1"
FT                   /note="KEGG: xcb:XC_0550 CoA tranferase; TIGRFAM: succinate
FT                   CoA transferase; PFAM: acetyl-CoA hydrolase/transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50055"
FT                   /db_xref="GOA:B4SHL2"
FT                   /db_xref="InterPro:IPR003702"
FT                   /db_xref="InterPro:IPR017821"
FT                   /db_xref="InterPro:IPR026888"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="InterPro:IPR038460"
FT                   /db_xref="UniProtKB/TrEMBL:B4SHL2"
FT                   /protein_id="ACF50055.1"
FT                   /translation="MSVDRIANARLRDRVVSAEAAAALIQPGETVAMSGFTGSGYPKAV
FT                   PVELARRIEAVHAQGQPFQISLMTGASTAPELDGALAKADGIAMRMPFQSDPDARNRIN
FT                   EGKLDYIDIHLSHVAQHVWFGFYGEIDTAVIEVSAIREDGSLVPSTSVGNNKTWLDLAK
FT                   KVIVEVNEWQPAGVDGMHDIYYGTALPPHRKPIPLVNANDRIGDTALRCDPDKIVAVVR
FT                   TNGPDRNSPFSPIDATSEQIASHLIEFLKHEVKKGRLPPNLLPLQSGVGNIPNAVLAGL
FT                   AKSGFRDLAAFTEVIQDGMLDLLRDGVLSYASCTGFALSPQANETFKENIDFYRERIIM
FT                   RTQEISNHPELVRRLGCIGMNGMIEVDIYGNVNSTHVMGTRIMNGIGGSGDFARNGFLS
FT                   AFLSPSTAKNGTISAIVPMASHVDHTEHDVSVIVTEQGLADLRGLTPRKRAQVLIDNCA
FT                   HPDFRPQLQDYFDRASRESYGKHTPHLLPEALSWHQRWLDTGTMKG"
FT   gene            420094..422889
FT                   /locus_tag="Smal_0351"
FT   CDS_pept        420094..422889
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0351"
FT                   /product="(Glutamate--ammonia-ligase) adenylyltransferase"
FT                   /EC_number="2.7.7.42"
FT                   /note="PFAM: glutamate-ammonia ligase adenylyltransferase;
FT                   KEGG: xac:XAC0550 glutamine synthetase adenylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50056"
FT                   /db_xref="GOA:B4SHL3"
FT                   /db_xref="InterPro:IPR005190"
FT                   /db_xref="InterPro:IPR013546"
FT                   /db_xref="InterPro:IPR023057"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4SHL3"
FT                   /protein_id="ACF50056.1"
FT                   /translation="MTLAPADLPASLQPLVDRALARLAQVLPEPIPANLLPLLTRLAVT
FT                   SDFALDTLVRQPALLAQLAAPGCPPIPAPVLDPLQPSDWPAQIRRWRTAMSTRLIWRDL
FT                   TGLDDVAQTLAGATALAEDCLRLALDALQQEFAQRHGVIADEHGIPQQLVVFGLGKLGG
FT                   GELNFSSDVDLVYAYPQGGESDGPRPLAAEEYFARLGQRLAKLLDETTVDGFSHRVDLR
FT                   LRPFGSAGRVALSFAAMDQYFQREGRDWERYAWLKARAVAGDIEAGEAWLQTLRPFVYR
FT                   RYLDFTALDGLREMKAAITAEVARRELHDDIKRGAGGIREIEFLCQALQLIRGGREPAL
FT                   RERRLLVALDALVAAGQIAPEDGSALREAYLFLRRLENRLQMLRDAQTHVLPSDALDRE
FT                   RIAVGLGYPDWEVLRAALAVQQQRVSTEFAALLAPRKGQAAPDALANYWRSLPEGSNAP
FT                   LLAEAGFLDANGADQSLRDFAQGTGVKSLSDAARARLDRVLPALLHAATRSPQPDAALK
FT                   RVLGLLQAVLRRTSYLALLDEQPSALARLVDVLARSALLAERLAAYPLLLDELLDVRVS
FT                   GPMPDAAGMLAECQQVLAVEDPESALRWLNETRLALSFRMAMATLDGRQGAVDSTRQLA
FT                   ELAQAVVVTVLAMAEADMHAAHGEIPGGRFAIIGYGSLGGLELGFGSDLDLVFLHDNPA
FT                   GVDASDGARPLEPGRWYARLAQKVMALLGAVTAAGRLYDIDVRLRPDGGKGSLVSSLAS
FT                   YTEYQRERAWTWEHQALVRARGVAGDASLLADFEQVRAQTLGRERDTGVLYADVLKMRG
FT                   RMRTELDRSDAARLDLKQGAGGVVDLEFLLQTGVLARSARHAALLQPRDTPSLIDALAV
FT                   AEFLPEDTAQALHGAHATLLDVGLACTLDRRPRLAPTTPAIEEACAAITAACIAAELPF
FT                   A"
FT   gene            complement(423194..423754)
FT                   /locus_tag="Smal_0352"
FT   CDS_pept        complement(423194..423754)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0352"
FT                   /product="conserved hypothetical integral membrane protein"
FT                   /note="TIGRFAM: conserved hypothetical integral membrane
FT                   protein; PFAM: protein of unknown function DUF165; KEGG:
FT                   xac:XAC0551 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50057"
FT                   /db_xref="GOA:B4SHL4"
FT                   /db_xref="InterPro:IPR003744"
FT                   /db_xref="UniProtKB/TrEMBL:B4SHL4"
FT                   /protein_id="ACF50057.1"
FT                   /translation="MSVRPAPVFAPLTARALVLAVLAMGAVVLLSNVLVQYPINDWLTW
FT                   GAFSYPVAFLVSNLINRRFGPGPARRVAWIGFAVAVLLSIWVATPRIAIASCSAFIVAQ
FT                   LLDITVFDRLRRGSWWRAPMVATTCSATVDTTIFWSIAFAGSTLPWVSWAAGDLAVKLA
FT                   IGVCLLAPFRALLWKMAPLRTTS"
FT   sig_peptide     complement(423677..423754)
FT                   /locus_tag="Smal_0352"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.887) with cleavage site probability 0.543 at
FT                   residue 26"
FT   gene            complement(423830..424345)
FT                   /locus_tag="Smal_0353"
FT   CDS_pept        complement(423830..424345)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0353"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xcv:XCV0584 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50058"
FT                   /db_xref="GOA:B4SHL5"
FT                   /db_xref="UniProtKB/TrEMBL:B4SHL5"
FT                   /protein_id="ACF50058.1"
FT                   /translation="MFRCLRVPATALLLSALVVPTVHAGAAPQLNSGQTSVLVTSLIVL
FT                   SIPLATSMGLAELSKAPFKASERNGKVAARTPAVPLPPMEVKQVATTPAGDRQVHLQVP
FT                   GKADQTATLQWPAAAGDDPIAGFVVGQQVRFDPTDAGAGWTVKSAQGQALAYVPTAYAA
FT                   GDVMSETL"
FT   sig_peptide     complement(424271..424345)
FT                   /locus_tag="Smal_0353"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.936 at
FT                   residue 25"
FT   gene            complement(424378..424881)
FT                   /locus_tag="Smal_0354"
FT   CDS_pept        complement(424378..424881)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0354"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xcc:XCC3602 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50059"
FT                   /db_xref="UniProtKB/TrEMBL:B4SHL6"
FT                   /protein_id="ACF50059.1"
FT                   /translation="MRTLPAVLMPMLIVASLAWSTAAHAERRIVIIHDPGPQGPSLEMS
FT                   TQMVTSARAAAAKEAQDAADAGRPLARPQQIKLPQMQVSAIATTVDGRREVLLRDANDP
FT                   QNTASMQYPRGIGDPAVQFTVGQTVNFEPTGADQGWQLKDNQGRPLEYLPEATGPRDIF
FT                   DTRH"
FT   sig_peptide     complement(424804..424881)
FT                   /locus_tag="Smal_0354"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.971 at
FT                   residue 26"
FT   gene            complement(424901..425752)
FT                   /locus_tag="Smal_0355"
FT   CDS_pept        complement(424901..425752)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0355"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xcv:XCV0585 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50060"
FT                   /db_xref="InterPro:IPR014547"
FT                   /db_xref="UniProtKB/TrEMBL:B4SHL7"
FT                   /protein_id="ACF50060.1"
FT                   /translation="MDRFSRLPRAALLIASLLATAPARANSTECRERYPSVAAQAAMLD
FT                   VAWTTAERLDALPDVDVVVAARGGQDLSRYGLRHSHLAFLVREDNGRWRAMHLLNRCKT
FT                   DSSQLYHEGLGNFVGESGGHTDLRIGVPSAPLRAALKAMLVSPSIQPKALHETRYNVVA
FT                   YPFATDYQNSNQWVLEVLAAAMAQAEGAPAIVKREQAQQWLRQQKYQPSVLHIGLGKRV
FT                   GARLFVANATTTDHPAGERISGNYSVVTVESVFDFLHQRSQLQQELVIPHVPVAGAAAA
FT                   TP"
FT   sig_peptide     complement(425675..425752)
FT                   /locus_tag="Smal_0355"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.994 at
FT                   residue 26"
FT   gene            complement(425801..426028)
FT                   /locus_tag="Smal_0356"
FT   CDS_pept        complement(425801..426028)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0356"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50061"
FT                   /db_xref="UniProtKB/TrEMBL:B4SHL8"
FT                   /protein_id="ACF50061.1"
FT                   /translation="MRTLLLLPLALLAACSTTPTELDPISYQCQQQLDAYREQPALRDP
FT                   KGQRPPLPVAPISDACDRELKRKGVDRPLR"
FT   sig_peptide     complement(425960..426028)
FT                   /locus_tag="Smal_0356"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.917) with cleavage site probability 0.535 at
FT                   residue 23"
FT   gene            complement(426228..427193)
FT                   /locus_tag="Smal_0357"
FT   CDS_pept        complement(426228..427193)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0357"
FT                   /product="protein of unknown function DUF1022"
FT                   /note="PFAM: protein of unknown function DUF1022; KEGG:
FT                   xcv:XCV0586 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50062"
FT                   /db_xref="InterPro:IPR009367"
FT                   /db_xref="UniProtKB/TrEMBL:B4SHL9"
FT                   /protein_id="ACF50062.1"
FT                   /translation="MPQVKRSSAPWTVTDGRAGNVRQAVALASALRQGTHRPLVLQPRA
FT                   PWRWLSPRRLPGDVNGYGEAFASLAAEPPALAIGCGRQAAGALRVLRARGSQVVQILDP
FT                   RISARHWDMVVVPEHDALRGSNVLTLLGSLNPVDDDWLAWGRAAFASFSTLPGPRTALL
FT                   VGGPTPLAPWDETAMVGVFQALADQIRAEGGSLLATTSRRTPPALAEILRATFADLPHV
FT                   IWGDGGDGTNPYGGLLGWANRVVVSPDSVNLLSEACATRMPVMVALADTAQGRLARFQQ
FT                   QLRERGRLQAHWLDWQYDRIEPLRETARVAAEVKLRLALR"
FT   gene            427315..427905
FT                   /locus_tag="Smal_0358"
FT   CDS_pept        427315..427905
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0358"
FT                   /product="nitroreductase"
FT                   /note="PFAM: nitroreductase; KEGG: xcb:XC_0568 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50063"
FT                   /db_xref="GOA:B4SHM0"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR023936"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4SHM0"
FT                   /protein_id="ACF50063.1"
FT                   /translation="MSHALDAAALDQLFRTARTQNGFLDKPVPASLLQELYDLVKWGPT
FT                   AANTTPARFVFVTSKEAKAKLAPALSEGNHDKTMAAPVTVIIGFDLDFHEKLPYLFPHT
FT                   DAKAWFDGPQEGRHEAAIRNGSLQGAYLILAARALGLDAGPMSGFDAAKVDEAFFAGTS
FT                   IKSNFLVNLGYGDSAGLFPRLPRLSFDEAARIA"
FT   gene            427981..428688
FT                   /locus_tag="Smal_0359"
FT   CDS_pept        427981..428688
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0359"
FT                   /product="YceI family protein"
FT                   /note="PFAM: YceI family protein; KEGG: xac:XAC0555
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50064"
FT                   /db_xref="InterPro:IPR007372"
FT                   /db_xref="InterPro:IPR036761"
FT                   /db_xref="UniProtKB/TrEMBL:B4SHM1"
FT                   /protein_id="ACF50064.1"
FT                   /translation="MSATRKLLLPLALTLAIAACSKPADTAAPAADAAAPATTEQAATP
FT                   AADAAAAAPAAEAIQIASGTYKLDPTHTDVLAQWSHFGFSNPSAHFGNVEGTLVYNAED
FT                   VTKSTVEVKLPLSGLNSFTAKFDEHLKSADFFDAAKFADATFKSTKVEAAGTNKLTVTG
FT                   DLTIKGITKPVTLDVTVNGGGEHPMAKVPAAGFDATTTLKRSDFGVGAYAPNVSDEVKI
FT                   RITTEATGEKPAA"
FT   sig_peptide     427981..428061
FT                   /locus_tag="Smal_0359"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.599 at
FT                   residue 27"
FT   gene            complement(429204..429605)
FT                   /locus_tag="Smal_0360"
FT   CDS_pept        complement(429204..429605)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0360"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50065"
FT                   /db_xref="UniProtKB/TrEMBL:B4SHM2"
FT                   /protein_id="ACF50065.1"
FT                   /translation="MAKLTLASVDALRTRFADDAACDTALAAFADPAALRAPLRELVEA
FT                   QHRYLQAEFEVAQVADVLRRDQKYAPVGRPSINIVQLRKQQAATKQAALIARQVVAQAA
FT                   QTFARASGMTVKAKQSPSEACVAWLGALR"
FT   gene            429842..430786
FT                   /locus_tag="Smal_0361"
FT   CDS_pept        429842..430786
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0361"
FT                   /product="Integrase catalytic region"
FT                   /note="PFAM: Integrase catalytic region; KEGG: bpe:BP3519
FT                   transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50066"
FT                   /db_xref="GOA:B4SHM3"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR024967"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:B4SHM3"
FT                   /protein_id="ACF50066.1"
FT                   /translation="MNNHKNARLTPFSRALLVRRILHEGLRPEEAAQACGVSVRTAYKW
FT                   LARFRQFGAPGLENRSSRPHQTPHATPAPVVEQIKEHRRKRQTYLTISKALGVGHSTIS
FT                   RLMRAHGLNRLCRLDPPKEVIRYEYDQPGGLLHLDIKKLGNFQRPGHRTDAKRRGNAAG
FT                   GGWGYVHVAIDDHSRVAFSSVHPNEQGETACQALLGALEYYASLGITFKRILTDNGACY
FT                   RSTAFAKLLKSLGIKHIRTKPYTPRTNGKAERFIQTSLREWAYACEYASSDQRNSVLNQ
FT                   WLHHYNWHRPHMAIGGQPPISRVRLNNVVGLHN"
FT   gene            430845..431678
FT                   /locus_tag="Smal_0362"
FT   CDS_pept        430845..431678
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0362"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50067"
FT                   /db_xref="GOA:B4SHM4"
FT                   /db_xref="UniProtKB/TrEMBL:B4SHM4"
FT                   /protein_id="ACF50067.1"
FT                   /translation="MQDTQYWLNEFWTGLSVLDLLGGSVLGTLLGLVLGIFAWRWLHRR
FT                   GWLQRRKRWHHWLLASYVVLLPLATAFFGLQLGFTAGAHRALFKQLDHFQPHLQTLVEG
FT                   WSEGFTDSLDDPRMREALRSEGTVGDVADTIASAYLSEHPLPGLDRLGDGPLARGTGWV
FT                   IGKVREGLLRGMVEDTLVDKAGTLGLEPKVVREALTMHVDELLHTRGVLRLVKAQINGM
FT                   MPGVYFGLLLPLLIIALLVALEIWAAHRFGWTRQVASSAVVPAAGRQLQVPAEGS"
FT   gene            complement(431753..432550)
FT                   /locus_tag="Smal_0363"
FT   CDS_pept        complement(431753..432550)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0363"
FT                   /product="Siderophore-interacting protein"
FT                   /note="PFAM: Siderophore-interacting protein; FAD-binding 9
FT                   siderophore-interacting domain protein; KEGG: xac:XAC0558
FT                   iron utilization protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50068"
FT                   /db_xref="GOA:B4SHM5"
FT                   /db_xref="InterPro:IPR007037"
FT                   /db_xref="InterPro:IPR013113"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="InterPro:IPR039374"
FT                   /db_xref="UniProtKB/TrEMBL:B4SHM5"
FT                   /protein_id="ACF50068.1"
FT                   /translation="MTEHNNTRLRLDVRFRELTVLRTEEVTPHMRRIVLGGAELAGFDS
FT                   PGADDHIKLFFPNASGEMVLPVVTAEGRSYPAGKEPSPARDYTPRWWDHETGELAIDFV
FT                   LHDQGIAGPWAEQAKADDTLVIGGPRGSFVVADSYDAYVLIGDETALPAIARWLDVLPE
FT                   DAEVQAFIEVSDEAERQDLPQYENVRIHWLERNGFPAASSTLLEDMLTDFEAPDGDVFY
FT                   WIATESRRARMMRKFIEGHLGVPRDWIRSTGYWKAHPDETDGD"
FT   gene            complement(432610..433170)
FT                   /locus_tag="Smal_0364"
FT   CDS_pept        complement(432610..433170)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0364"
FT                   /product="transcriptional regulator, PadR-like family"
FT                   /note="PFAM: transcriptional regulator PadR family protein;
FT                   KEGG: xcb:XC_0571 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50069"
FT                   /db_xref="InterPro:IPR005149"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B4SHM6"
FT                   /protein_id="ACF50069.1"
FT                   /translation="MSRTASPRARSTNPEVPRRNGQPRVLSRGDLRLLVLALIGEQPRH
FT                   GYELMQLISNQFMQAYTPSAGTMYPLLASFEQAGWIEAEEVDGKRIFRITAAGEFELKV
FT                   QRTQVRLAQRRAFDRAREITKASLPPPLAGALREFKRALVHHHGRWAEGEAEEVAALLT
FT                   RASALLNGAAGSESQAFSTTQPD"
FT   gene            433739..436426
FT                   /locus_tag="Smal_0365"
FT   CDS_pept        433739..436426
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0365"
FT                   /product="2-oxo-acid dehydrogenase E1 subunit, homodimeric
FT                   type"
FT                   /EC_number="1.2.4.1"
FT                   /note="TIGRFAM: 2-oxo-acid dehydrogenase E1 subunit,
FT                   homodimeric type; KEGG: xcv:XCV0611 pyruvate dehydrogenase
FT                   subunit E1"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50070"
FT                   /db_xref="GOA:B4SHM7"
FT                   /db_xref="InterPro:IPR004660"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR035807"
FT                   /db_xref="InterPro:IPR041621"
FT                   /db_xref="UniProtKB/TrEMBL:B4SHM7"
FT                   /protein_id="ACF50070.1"
FT                   /translation="MNWLNEVLNNDPNPVETQEWIESLKAVIDVEGSERAHQLLEGMVE
FT                   LTRRSGAYLPFSPTTEYVNTIEPQLEAKSPGNAELEWRIRSIIRWNAMATVVRANRKPG
FT                   DLGGHIASFASGATLYDVGFNHFWRAPSENHPGDLLFIQGHSAPGIYARSFLEGRISEE
FT                   QLDKFRMEVDGGGLSSYPHPWLMPEYWQTPTVSMGLGPLAAIYQAQFMRYLENRGLIEK
FT                   SDRKVWCFIGDGESDEPETLGAIALAGREGLDNLIFVVNCNLQRLDGPVRGNGKIIQEL
FT                   EGVFRGGGWNVIKLLWGGYWDALLAKDSDGVLKKLMMETVDGEYQNCKAFGGAYTREHF
FT                   FGKYPETAAMVAGLSDDDIWRLNRGGHDPHKVYAAYHQAVNTKGMPTVILAKTVKGYGM
FT                   GSAGEALNPTHQTKKLDDEAVRHFRDRFNIPVTDAQLADGQVPFYHPGPDSPEVQYLQE
FT                   RRAALGGYLPQRRRKADKTFVAPKLEAYERLLKSSGERSYSTTMAFVQSLNITLRDKEL
FT                   GPHIVPIVADEARTFGMEGLFRQIGIYAPFGQKYKPVDADQLMFYREDQSGQVLQQGIS
FT                   EPGAISSWMAAGTSYSVSNVPMLPFYIYYSMFGFQRVGDIAWQAADMRTRGFLLGGTAG
FT                   RTTLNGEGLQHEDGFSHLVAGGIPNVRSYDPTFGFEVTVVLQHGTKRMMEDQVDEYYYV
FT                   TLMNENYTHPEMPEGAAEGIVKGMYLLTDAGKPKKGELRVQLLGSGTILREAIAAAELL
FT                   DKDFGVTADIWSCPSFNELRRDGFDVERANRLHPEGEQRKAYVTELLEGRQGPAIAATD
FT                   YVRAYADQIRAFVPMSYTVLGTDGFGRSDTRANLRRFFEVDRYYIAHAAIAALAKEGKM
FT                   TAKDVARAIKQYKIDPEKANPVGV"
FT   gene            436501..439539
FT                   /locus_tag="Smal_0366"
FT   CDS_pept        436501..439539
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0366"
FT                   /product="type III restriction protein res subunit"
FT                   /note="PFAM: helicase domain protein; type III restriction
FT                   protein res subunit; DEAD/DEAH box helicase domain protein;
FT                   SMART: DEAD-like helicases; KEGG: shl:Shal_2181 type III
FT                   restriction protein res subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50071"
FT                   /db_xref="GOA:B4SHM8"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B4SHM8"
FT                   /protein_id="ACF50071.1"
FT                   /translation="MLTTGEEFAVAAAMREGQRRAANAVREYLARDYAGKSFLVVMPTG
FT                   AGKSGLIASVCQSHPRGPIVVLSPRAAVCRQLMDEISGKFFSDRGVLVESPRSVKELGG
FT                   EIKEDCIYVGTFQKLIRMKSTAFRRLAESCSLLIVDEGHSEPAPLWGKAVRQFSCHKII
FT                   VTATPYRNDLFQFDIGLETTFCYTFKKAVEHQVILEPAFEQCTIADAAQRTSIFLSENP
FT                   TAKAIVKAKSLGDVKMLKELMGGAGLSTLAIHDKLPDDTSAGTAKTVPSGLNSRDVRVV
FT                   IHQRKLDEGVDLPSAKLCVLTYPVASGQELVQTVGRIVRNFESIQPLVLDCGSSSNTKM
FT                   WANYLEFDSSISSDDGWAKFVNSLDTAKLIESYLDTFPQYMYLGAAFREKFELLSLDVD
FT                   RDIRVPTASVCFLGVEEGFTIESFVDAMLWRNDHAGELAKCYDSAHGFKVIVSIRFESS
FT                   KYLKSKLFFEPSLHVVVAKKIGNYLAVFDSRSINHAGDTALGTKQPVDPQRLFNLSARG
FT                   AFTRVKETHARSISSARRRPERVSHVGPELSASYSGQSAASYALSVTKVDNLDLAQGVE
FT                   SSYYLSTGSGRVSDQKNGSFSLERLSEWVDEVASVLDEDAPSLSPVIGAFALPIDAMAV
FT                   SGPLSMTIDFTDLPAGTKMVSGAKSTPLDAGFLFLECPNWQVKVGSSTLRFAYIEEVER
FT                   IVFTASPDVMLVSPDGEAVSLVQDMNSRSLKILFADGVSYVDGKFYKSALPTTVGIDLE
FT                   STVIGASIYPVPELQLAGLSEKGLFQDREYVGTSAENFDANSVFNLIDSLARGDYQKYR
FT                   STQYDVLRRLVPDIDLVVCTDMGTEAADFIVSSPKSLCFVHVKCGESKRPKSPAGALAE
FT                   VGAQAIKNIEYLVSSNESLPFGNEGRLALPWPHRGAIHKLKHRVRFIAKDGVERTVPST
FT                   PKAYSKCVASAIETIKKRRRSPGCKKEVWIVAANSFSYGSFKKEIKMGAAAKAESLQAY
FT                   QLIDAWLAVCSANDVDLKIMVSP"
FT   gene            complement(439638..440006)
FT                   /locus_tag="Smal_0367"
FT   CDS_pept        complement(439638..440006)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0367"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50072"
FT                   /db_xref="UniProtKB/TrEMBL:B4SHM9"
FT                   /protein_id="ACF50072.1"
FT                   /translation="MNTSDFRSLHAQYDPDNAEPEREPSVDPNAFVATLHRIGSGVAAD
FT                   GQPWPERHQLPGRCLQLADADCALAGLRVVAELMLAAERTRQNGAPEEYVGDRVMEGLK
FT                   MACVALTAQVTERLHGGG"
FT   gene            complement(440459..441037)
FT                   /locus_tag="Smal_0368"
FT   CDS_pept        complement(440459..441037)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0368"
FT                   /product="TonB family protein"
FT                   /note="TIGRFAM: TonB family protein; KEGG: xfn:XfasM23_0009
FT                   TonB family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50073"
FT                   /db_xref="GOA:B4SHN0"
FT                   /db_xref="InterPro:IPR006260"
FT                   /db_xref="InterPro:IPR037682"
FT                   /db_xref="UniProtKB/TrEMBL:B4SHN0"
FT                   /protein_id="ACF50073.1"
FT                   /translation="MPTILAGRLEGFTHALSPATTTSAWARPAGPSGSQPGDSRYAGSA
FT                   PEWIPRMPRLNAALALNLALMLLSATHAMAMAADLQVSTEVFVEAGDNPSFKLRQAPAI
FT                   EYSTAPATSPDTFLQAPMAVLLVAQLDELGHVSNVMVARSSGLREMDRAALTAVDQWRF
FT                   DPVVVEGIAQHARVRVRLTFVATTEAPPG"
FT   gene            complement(441159..441806)
FT                   /locus_tag="Smal_0369"
FT   CDS_pept        complement(441159..441806)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0369"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: she:Shewmr4_1721 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50074"
FT                   /db_xref="InterPro:IPR041229"
FT                   /db_xref="UniProtKB/TrEMBL:B4SHN1"
FT                   /protein_id="ACF50074.1"
FT                   /translation="MDSTALKEVHRQIRDAQPDSTRVRLHRAISWLNRAEQEDEDTDAR
FT                   FLFLWIALNAAYAQEFGFENAEREQLRRFFDALLRHDKQGSLQDILFKQFPGPIRTLIG
FT                   NRFVYARFWKALREHDSSDQWAERFAKDQRSALQAVVERRTEVVLSIVLDRLYVLRNQL
FT                   VHGGATWDSHANREQLRDGAAILGQLVPAILHLMMRDDAPDLGEVAYPMIPI"
FT   gene            complement(442089..442187)
FT                   /locus_tag="Smal_0370"
FT   CDS_pept        complement(442089..442187)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0370"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50075"
FT                   /db_xref="UniProtKB/TrEMBL:B4SHN2"
FT                   /protein_id="ACF50075.1"
FT                   /translation="MFKIIGATVVYGFALYGLGRWLTDQQLVGADD"
FT   gene            442710..443714
FT                   /locus_tag="Smal_0371"
FT   CDS_pept        442710..443714
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0371"
FT                   /product="transcriptional regulator-like protein"
FT                   /note="KEGG: hha:Hhal_1283 transcriptional regulator-like
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50076"
FT                   /db_xref="InterPro:IPR026881"
FT                   /db_xref="UniProtKB/TrEMBL:B4SHN3"
FT                   /protein_id="ACF50076.1"
FT                   /translation="MDTDNRSSLARQWRLLQLLQPAPHYRTVKELAQTLAAESYKGGTR
FT                   TIERDLNALSLQFPIESNDLQKPYGWAWMRGAAAFSMPGMSVSQAVVLLTAQRNLQGLL
FT                   PANHWPALTPFFDQAEKTLAAVRTTRSTRRWHEKVAVVPASQSLLPAAVDTDVAVNVHQ
FT                   ALFNEKQLRLYYVARGRSDASEYVFHPYGMIQRGTSSYLAGRIDGRTETTTLSLHRVQR
FT                   AEMLDADTEGAESFELGNYASRVAAGFESKGPLSVELELDEALAQHLAETPLSRDQKLD
FT                   VGDGLVPRLRATVDDSAQLRWWLLGLGASVRVLAPAALADDIAARHRSAAQRY"
FT   gene            443803..445566
FT                   /locus_tag="Smal_0372"
FT   CDS_pept        443803..445566
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0372"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pap:PSPA7_6053 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50077"
FT                   /db_xref="GOA:B4SHN4"
FT                   /db_xref="InterPro:IPR022812"
FT                   /db_xref="InterPro:IPR027094"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B4SHN4"
FT                   /protein_id="ACF50077.1"
FT                   /translation="MFAVKNQCLGLLDRITTLADSAAIELPENHSLAEEMQRAELLVPI
FT                   IGAFSAGKSSLINTFLGADILPVGITPETELATELRFSRDPHVLAHRADGGSDRLAVED
FT                   LLSIKPRASSYTHLELHLDDPRLEALYPQVLVDMPGFGSSLDSHNKAIAHYLPRGAHFI
FT                   VAVSVPDGTLAESTLRQLETMHTYEAGFSILLSKANLRSAEEVDAVEVAVREQLELRLG
FT                   VAPAMARDDRKQGNGLASLLPKISASDLWIGRFLPRISSQLAHARAQVKMARKALDQSD
FT                   ADIDRSVRQLNDALDDLNAQRDALVAKLGRSRLSQVVEQCVEEVGQALREASSELQAAA
FT                   AGGNNPRFAQVVSDISRQRLSRVVKERMEGLSQQAIGDLAKSLSQREVDEVGSVGGPDW
FT                   TQQMQTRVQETLTQTGQALERWQGNLQKAREDEKLLRPYAGDDENDREKTQRARVAFRS
FT                   ITTVLAVTTSVVAPAIELVVIFLPEILGFVSRKLREEELRKTIDNQVIPSVQREFRTKL
FT                   PELLQAQVDGLIEQAVHEFKTAIEEKRQLLESVVAEQSSPARAARVKALDAAEAGLTSV
FT                   ANEVVALESAR"
FT   gene            445563..447776
FT                   /locus_tag="Smal_0373"
FT   CDS_pept        445563..447776
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0373"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pap:PSPA7_6054 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50078"
FT                   /db_xref="GOA:B4SHN5"
FT                   /db_xref="InterPro:IPR022812"
FT                   /db_xref="InterPro:IPR027094"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B4SHN5"
FT                   /protein_id="ACF50078.1"
FT                   /translation="MSAEVILDRQQKLITWLAAHADILNGAVGASSQWEIDTIDSLKEA
FT                   LLRLDDENRLMDIGIVGRVKAGKSTLLNALVFNGESVLPQAATPMTAALTTLTYGERFK
FT                   ATARFYSQADLANIEQAAAVYSDLLEKSLIEELRRTEGRAGLDPERRRELAERGARRAL
FT                   ATQQPSLQASHEQWAKITASGLSLAHLKEDKPLEADDVEGLAALLADYVAAEGHYMPVT
FT                   KSVDIEMPVEALRGLRIIDTPGLNDPVASREARTHDLLKCCDVVFVVSPAAQFMSQEDL
FT                   DVMARITAAEGIRELVLVASQVDNTLHGSEMQAQLHASLTGLRRELAGHAGKVLDKLKL
FT                   SNPEVGDVFQSLVDKGEDAIIHSSGMCHSMSVEFDSVADWQGGRLTAWQNLKETYPDYF
FT                   RDDNPGLSRTNLDQLANMAGLHEVVEQTRLAKARVLAARRQDLLDAKERKQVELLRELR
FT                   RQLSLRRGEIGEAGLTELKKNKRGLERRKFNLTVALDDELMGIKTGFVNGLRKAMKEVI
FT                   DGAYDAADSGVSRTVGTEKTTRRTESPGAFNWVARKLWDGGYREYEENNRTVLPAAVKS
FT                   AVSAFASGLRTDLDSRATELQAKFGKRLFAELLQTARRQLDDELDIEAVYSSLKSIVNG
FT                   VEFPPVSLRAPVLKASTMKLKGSEADTFLEQAQHAIETLRETAEAAVYEYVETVKRAIP
FT                   KSVADDFIGHIQAQFDALQALMEDAEKTRATLTMMDAELEAMQ"
FT   gene            447773..449638
FT                   /locus_tag="Smal_0374"
FT   CDS_pept        447773..449638
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0374"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pap:PSPA7_6055 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50079"
FT                   /db_xref="InterPro:IPR022812"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B4SHN6"
FT                   /protein_id="ACF50079.1"
FT                   /translation="MSGDNGRPLFEGTSAQHLTYLAGWKPWGRRLHVTAIQEQMDAASQ
FT                   RWISIVEDHRRLNITAEQRALALAEREAELKHASGALAERETELERASEALAERGTELK
FT                   NVSEALAESETTRSRERDDAQTREQALAGELDAQRQASQELQKELQEAGRRELDLSQRY
FT                   GAEKMARAQLTTSLVDAQDRLKVQSMQHAATQAALESEQEQSRQLGGDLDLLQAEHAAT
FT                   QIRFALVSRLLAVPPPRNEGIEAFQKLLDDDYMRFASAEASLADEAKALRLLQSIQQEL
FT                   HLMAANPDIFRRTVVGVVGGFSSGKSAFINSFLGKDFKLLSSVTPATVIPSYVYPAQQT
FT                   KIQAYSFNGGCIDLDAGFYQEMSRAFVEKFSFDLKRIMPLVSVGTSMDTERTGNICLMD
FT                   TPGYNPGTEGSFSQSDRAVAVSHSRKSDVLFWVIGIDANGTTPDSDIEFLKEIGFEGRP
FT                   VYVVLNKADLRSADQIEEILGQIEDEIELNGITVEGISVYSSKYGKEYEFRGKSMQDFL
FT                   RERPKGRLPMEHVEDRINEVFELYRSAITESIATAKACRSAARALALDLMQGDVQDAAT
FT                   MRSATQNVETINAAMNLDALSRLLVDADQINAAFLDAARRVLTPA"
FT   gene            450169..451359
FT                   /locus_tag="Smal_0375"
FT   CDS_pept        450169..451359
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0375"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rpa:RPA2213 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50080"
FT                   /db_xref="UniProtKB/TrEMBL:B4SHN7"
FT                   /protein_id="ACF50080.1"
FT                   /translation="MPSSLTWLDHDAAAQARSATLLALLDQPGTRDELGFGGIRDALSD
FT                   QLFPGTSVIQTRLRYMLLLPRMFMGLEASSVRPRDFAERARQDELKLNDCLAAEDGAFG
FT                   RDSGHTLKRLASSVYWAGMRSWGIFARSGSQQDYFSAIEQIRRERSWKQQRDDGMEDAE
FT                   LIAQTWHPSLEKLVPVAALEEGSLSLTADEAEFIREQWKVHHPQTLLVWLAQDKGRLGD
FT                   CADAGFPWLHPQIRQAPQPLRELVEHARQFSRLANGASLVYNLALAEASSNDERREEYG
FT                   QELKTWIDGVPASQLGEWDMVQFWEQVERVGRPIHPRTREFVSSWLALVKAGQADSPQS
FT                   RSLVRERERSLKGNLSRFNPENLDRWSGASGLGILNYRWGITRRHLADLLHGLEAA"
FT   gene            451356..453194
FT                   /locus_tag="Smal_0376"
FT   CDS_pept        451356..453194
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0376"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_A0848 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50081"
FT                   /db_xref="UniProtKB/TrEMBL:B4SHN8"
FT                   /protein_id="ACF50081.1"
FT                   /translation="MIHPSARSTLTEALQPPSGYRFDAGVATTYSLSLGALLGLPAHFA
FT                   LLGDHDNSAEEDPLRLVEGLRRASRRLAVFCERGRMEAPPAGNALAVLAEGMVHEVCAP
FT                   HGGAFHPKIWALRYVAIDAAAEPATVVRLLVLTRNLTWDRCWDVSLRLDGVPGKAKEAS
FT                   NKPLADFLRWLPLNTEGASPDLERQAMIVSLAKDIERADWEKPPGFTQLAFHVLGTAKR
FT                   AVPWSPLEGGGKAQDVLIVSPFVRAGALQTLREHCNGDFMLVSRADELDRLPAGACLAD
FT                   DSAYVLKPDTLLSEGEEAGQADTLQGLHAKVAVFQRGQRVHVAVGSANYTNAVVQNGSN
FT                   VEVVAELSGPVSRIPAPRQWLDEHLQPLLDTYTPGGGEDAEGAERRQLQDQLEAIRRQI
FT                   AAAAWTLHCETHPVSGWNLALSCPGLPLDGATLHAWPLAVVSERARPVQAGQVDLGTFA
FT                   GHEVSSLVGFQVTPNSTRAEELAVPPLRFALEVSLEGAPDDRADALVAQLLGNRAAFLR
FT                   YLALLLDDPQAAGCGARNRSEGSGGGSRDASGLMANYPLFEQLLRIYSREPERLEAIDR
FT                   MVKRLKDKQFDGQPCLPDDFLALWEVVGNAIGKEAA"
FT   gene            453194..456406
FT                   /locus_tag="Smal_0377"
FT   CDS_pept        453194..456406
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0377"
FT                   /product="helicase domain protein"
FT                   /note="PFAM: helicase domain protein; KEGG: bxe:Bxe_A0849
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50082"
FT                   /db_xref="GOA:B4SHN9"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B4SHN9"
FT                   /protein_id="ACF50082.1"
FT                   /translation="MNRNTDLSDPTPVLERLKGFQRRTVNYAFRRMYEDHDPALRFLVA
FT                   DEVGLGKTQVAKGLIARVVAHKAASKERMDIIYICSNASIASQNLERLRLRSTKAVRAT
FT                   RLTLLPLALADGGLEGDGVNFISFTPGTSFETTSRGGLARERVLIHRMLQGVSRLNANG
FT                   LAWVLRGGLGDGWRQHFEHEDGVDEPDEAITRTFVKSLDKKRLRQLVEVCDRHAGRRTR
FT                   ALDSDERAEALELTSWLRTTLAHCCLKALKPDLVVLDEFQRFRELLAVQDPDSDDEAAP
FT                   ASSAAKLAQELFDHENKPRVLLLSATPYKMFVAQQEQEDHYRDFLATASFLFNDPEEVT
FT                   ALRADLAAFRASLVGVGASQDDARVLKGAIESRLKKVMCRTERVGVTRGRDAMVRDVPL
FT                   PLSLTSEDLADYACVDALARAAGTNDVMEFWRSSPYLLNFMREDGYTFKRRMMDRQGKA
FT                   ALGRALSQHPQYRTLDQDALQRYSPLVAANPRMDVLAKDMEDQGSWRLLWVPPSMPYWA
FT                   GEGAYAQVSHFSKTLVFSSWNMVPDAIAGLLSYHAEQLAMAGHALQPGYDAPGKSLSAR
FT                   LRFNSGKSGHEDMNALTLLVPSLALATMVDPLAMSVAAGGSLHLADARREAAGRIRERM
FT                   ESLDLPASRHSGPPDVRWYWLTLLLLERAHVQSHVDPCWGSEDLTIGAGEDEEDGGASV
FT                   SGQGFSRHVAYWRQVWGRGFDEPSLQTLGPRPDDIAEVLADIALAAPGVCALRALLRLL
FT                   PGDNEADLRQAAIKIADVFRRQLNMPEAVAIITHEEGGVYWRRAVAYCAEGNLQALLDE
FT                   YLHLLHEQNAADEKSTHAQAIAKGVSDAGHVRASQLHPEGVKLLDGKLVRDDALSLRCR
FT                   YAMRYGNATEDDKVVARKDALQHAFNSPFRPFVLASTSVGQEGLDFHSWCHSIVHWNLP
FT                   GNPVDLEQREGRVHRYKGLAVRRNVARLAGFVPDQAAGDPWAGLFTNAEVPHKETPLAG
FT                   LIPYWICEAPGGVAVERKVFHFPLSQDKHRFDRLKSSLALYRMVFAQPRQQDLLGHLQA
FT                   RAEGGEDVQALLDTWRIELLPD"
FT   gene            complement(456460..457752)
FT                   /locus_tag="Smal_0378"
FT   CDS_pept        complement(456460..457752)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0378"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xcc:XCC1056 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50083"
FT                   /db_xref="UniProtKB/TrEMBL:B4SHP0"
FT                   /protein_id="ACF50083.1"
FT                   /translation="MGELTRKDLEILREYADSGNRERYWSYLAHKEHSDGYGLLALGVV
FT                   RNDNLPGQVANAYAQSQARDQHDRNPALQNRNLTEREWEAFGQTLLHRDLERREHWMEA
FT                   KRPDLALNLPGRDVQQAHDEAFKRHHLDPNCWTPRVLLEATRKERGEGKAEEVWKEMLN
FT                   NDVGGTQRAANTLGSAYLAMPFWSATGYVGRLGLYEGSLMAEALPSSDPNVIGSRSSYH
FT                   MYSEKEQAWYLQVPGSIPLREHNPRIIASLDDARAVRLERAEKATHFHPEDSYRTRLET
FT                   PKVVMNEPLERDGRETQLAANRPDHANDPVYQQIRGQVASLQAEHGLVLGNNPDGVTAR
FT                   LAVLAKENNLSQVDHVMLGKANGPGGAGQNLFLVQGALDDPAHLRVAISAEQAVQAPVE
FT                   HSYRQLDALAQRQAQDVESAQQVQRDAMRMA"
FT   gene            complement(457780..458640)
FT                   /locus_tag="Smal_0379"
FT   CDS_pept        complement(457780..458640)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0379"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: xcb:XC_4270 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50084"
FT                   /db_xref="UniProtKB/TrEMBL:B4SHP1"
FT                   /protein_id="ACF50084.1"
FT                   /translation="MNLPPPGRWLALAIALASSTACSKAPSKEPEHRETPMTDTAQSHT
FT                   VDGYTYTTAPVEATLGPHRYAFPANLYDDQMGPAVGGGIGLTLLWPDLQAAPPGTRASR
FT                   SMSDHHRAISLSLDYIDALPIAELLPRKTSTEATTEDGSINRDDPRRRLDLRNAGTPHF
FT                   GLTPYAIDEARMTRFSEAYAAQRGTPPVRTPETDQEWYIARDTQGALATFITCNPPQDG
FT                   REGLTVQGTTLVDDPDVPVATCTHTFTDPQDGLSVRAIYPRVLLKDWKAVEDATRVLLA
FT                   RYKLR"
FT   sig_peptide     complement(458569..458640)
FT                   /locus_tag="Smal_0379"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.995) with cleavage site probability 0.705 at
FT                   residue 24"
FT   gene            458860..459786
FT                   /locus_tag="Smal_0380"
FT   CDS_pept        458860..459786
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0380"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xcc:XCC1902 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50085"
FT                   /db_xref="UniProtKB/TrEMBL:B4SHP2"
FT                   /protein_id="ACF50085.1"
FT                   /translation="MEQATRYTATLYLAAPGTPLKSGGISPRGHMYLQVAAGGEAHSYG
FT                   FAPPRQAPGETRTDVQYAQVRHDDADEHLDPYYSRTLEITEEHYGCLRDFAEEPAEFEF
FT                   DVDRPATINRCSDFVWAALHYAGLHPLPAPLDGGSNLGEFAVLFNLPEIQCIAAPFPGS
FT                   DLNAETHHAMPEREAEHHRQGDRASDEPPPTPIEVAGTLLDPSHPDHRLFAQLIQKVAE
FT                   LDAAHGRPFDAASQRISASLLVLAKQNNLSRVDHVLLSQPTKSSHAAESIFIVQGDRND
FT                   PGHRRASIATEVAAKTDVADSLRLKEQ"
FT   gene            459952..461097
FT                   /locus_tag="Smal_0381"
FT   CDS_pept        459952..461097
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0381"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: spe:Spro_0979 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50086"
FT                   /db_xref="InterPro:IPR011045"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniProtKB/TrEMBL:B4SHP3"
FT                   /protein_id="ACF50086.1"
FT                   /translation="MFRNPLFRSAALAVAVSLSLGVPSAFADNAPTASATAAVQRQAVA
FT                   KGLYELAYSPKQNAVFVASSGGFGDDAGPAQVLRLNPTTLAVETRIPLERKAFGVVLDD
FT                   TQNRLYVGNTVDLSVTVVDTAQNKAVGTIQLMEKKTGKDGKAAYTHDLRELVVDSAANR
FT                   LYLTGHSSQPDVSSVLFVIDTTTLKVVNTIDGLGYAKAPGLALDAANKRVYTSNLLADL
FT                   VVVGTDSNKVVAQHKIAAEQPMNIALDPAGKRLFVTDQGSEFLRGYQTKSSGLVSKHPG
FT                   QRVLVLDRSTGKELASIPTDAGPLGILLDAPRKRLYVTNREAGTVTAYNSDSYQKVATY
FT                   TVPTHPNSLALDAKNNVLFVSIKNGEKDDKGADESVARIQL"
FT   sig_peptide     459952..460035
FT                   /locus_tag="Smal_0381"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 28"
FT   gene            461241..461816
FT                   /locus_tag="Smal_0382"
FT   CDS_pept        461241..461816
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0382"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: xcv:XCV1271 putative secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50087"
FT                   /db_xref="UniProtKB/TrEMBL:B4SHP4"
FT                   /protein_id="ACF50087.1"
FT                   /translation="MMGIHRWLRAGLIFTLAGALGACNSRIPDAPEPLDLVKPIIVAEP
FT                   GQAVRFEFETNARNFHPGRTYALELEVEHQGPEDTREPSIATMQIPFEVSLQRLTAGTW
FT                   QDVATYDSYQAMARNAGEALPEWHASSEWRYTSPHMGSDGQYTLSLVALPMEINSRYRV
FT                   DVRTVQRTAALQDYSARLRIHAARPAGK"
FT   gene            461894..462469
FT                   /locus_tag="Smal_0383"
FT   CDS_pept        461894..462469
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0383"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: xcv:XCV1271 putative secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50088"
FT                   /db_xref="UniProtKB/TrEMBL:B4SHP5"
FT                   /protein_id="ACF50088.1"
FT                   /translation="MLGIHRWLLAGLIFTLAGALGACNSRIPDAPEPLDRVKPIDVAEP
FT                   GQEVRFEFETNARNFHPGRPYVLDLEVQRHGPAPDSEPDMDSLHVPFQLYLQRWVAGAW
FT                   QDVATSDVHQATTSNLGEPLPEWHASAGWRYAQQVSMDASRYRLSIVTLPMEMGARYRL
FT                   EVRTVQPTAALQHYPAQLRVHADPLSGK"
FT   sig_peptide     461894..461962
FT                   /locus_tag="Smal_0383"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.965) with cleavage site probability 0.769 at
FT                   residue 23"
FT   gene            462510..463577
FT                   /locus_tag="Smal_0384"
FT   CDS_pept        462510..463577
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0384"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xcb:XC_3104 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50089"
FT                   /db_xref="UniProtKB/TrEMBL:B4SHP6"
FT                   /protein_id="ACF50089.1"
FT                   /translation="MDKPRYAVEIIIAAPGTPLIDKKTGSQEVIDGVPQTSGPGHMFYV
FT                   LRAPGQQPQSYGFAPIEHGSVNGQGKVMNDDATIYKDPHYSRTLEISEEQYRKLEAFGT
FT                   YPSKYGFDLQYKDVRHNCVDFTWEALNHAGIERKRSIDVNALGGGIGQLLPDVRIPLES
FT                   KGAGKDGFRPLRNIHGVDSIDPPFPDSELNQKKTNPLPARSFQQRILSDAEGVGERSGD
FT                   HLARHGNDLLLSQIHQGVALLDAERGRAFDATSENISASLYALAKANGLTQVDHVLVSD
FT                   RTAQADVAQNIFIVQGERDDPAQLRASMPTAVAAQTPAETSFERAEQLSQSAQSRTQDE
FT                   LQQRQVQEQSGPRMA"
FT   gene            complement(463641..464057)
FT                   /locus_tag="Smal_0385"
FT   CDS_pept        complement(463641..464057)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0385"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xcc:XCC1056 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50090"
FT                   /db_xref="UniProtKB/TrEMBL:B4SHP7"
FT                   /protein_id="ACF50090.1"
FT                   /translation="MADITPNHPEYGLNQQIRQGVAALDAQHGRPFDQTSERLTASLTV
FT                   LAREQGLQQVDHVLVSNATGNHPAGHNIFVVQGDPANPAHLRAMMPTAVAAQTPVEQSM
FT                   QKLGIAPQQPAMGQLPEQQAREQEQQQNPAHRLG"
FT   gene            complement(464133..464612)
FT                   /locus_tag="Smal_0386"
FT   CDS_pept        complement(464133..464612)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0386"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ccr:CC_0890 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50091"
FT                   /db_xref="InterPro:IPR027843"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:B4SHP8"
FT                   /protein_id="ACF50091.1"
FT                   /translation="MLLLTLPLLAAGLAAAPSPAEDLRQQIRQADTQLFAVAFEACDAD
FT                   RAAAMTTEDMEFFHDKDGKSASSREDFRRSVANMCSNARKGGWSLRRELVEPSLQVFPL
FT                   HDERALEIGDHRFHERGKDGVERWVGQARFIQVWRRVDGRWLAERVISYDHRAAD"
FT   sig_peptide     complement(464565..464612)
FT                   /locus_tag="Smal_0386"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.719) with cleavage site probability 0.402 at
FT                   residue 16"
FT   gene            464835..465644
FT                   /locus_tag="Smal_0387"
FT   CDS_pept        464835..465644
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0387"
FT                   /product="alpha/beta hydrolase fold"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG: cmi:CMM_1933
FT                   putative arylesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50092"
FT                   /db_xref="GOA:B4SHP9"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR000639"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B4SHP9"
FT                   /protein_id="ACF50092.1"
FT                   /translation="MPASRIRLHVEDTGGDGRPVILIHGWPLSADAWKTQVSILRDAQY
FT                   RVISYDRRGFGRSDKPAEGYDYDTLAADLAGLIEERDLRDVTLVGFSMGGGEVARYVAN
FT                   HGQDRLHSVVFAAAVPPYLLRSDDNPEGPLTQEKADEMRSGLEKDREAFFDGFTRDFFS
FT                   ANGQLMVTEETRQAAIALCHQSDQTAALGCMHSFATTDFREDLKKTTVPTLILHGDSDA
FT                   IVPFERSGERTHQAIVGSEVVILDGAPHGCNTSHADHFNLALLNFLR"
FT   gene            465764..466714
FT                   /locus_tag="Smal_0388"
FT   CDS_pept        465764..466714
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0388"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: plu:plu4879 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50093"
FT                   /db_xref="UniProtKB/TrEMBL:B4SHQ0"
FT                   /protein_id="ACF50093.1"
FT                   /translation="MATELAFSIEFNDTINAERAYELYWADVITDKRAFLCPEHESGCP
FT                   AKYTCANMDTEQLQLKQVPHFRNQHDSELHMEGCPHVAELDVRGCSGESRPSEVGQPAP
FT                   DRFLLTRPVGHFDVRQGTASETDFGAGGRSGSGEASGTRSRRTQFYSLAALVSRWLKAR
FT                   QDNMDDTMIVSAGTQEPMTYRELFENFFEKRPYLSGNTRVYWSKAWIRKTDDGFKIIFC
FT                   EPITALVGEMLAEPLRPSAMVWNSVLAASEMKSLHARRLQRFAESEAPCVVFLYGTPAL
FT                   QEKHSRTYLNFDVKSLDLVDVQGTDIFDRIRRPQD"
FT   gene            466959..467576
FT                   /locus_tag="Smal_0389"
FT   CDS_pept        466959..467576
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0389"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50094"
FT                   /db_xref="GOA:B4SHQ1"
FT                   /db_xref="UniProtKB/TrEMBL:B4SHQ1"
FT                   /protein_id="ACF50094.1"
FT                   /translation="MSDVAMLLDAGLPVAVVAVISGVVLGAKVVQALCAYLRQGRKECL
FT                   ELWDRSKVDDAFWLESYINHRYNVRSPPADLVRACLEAGNSTTMMRDLVMNWRFFQGNS
FT                   LPTLRWRGASRNHPILLWVELAMLPLVYFGFVVLGLLVIDKGGERGIVAAGPLIALGAL
FT                   SFWSFLTLIGARRALSDLRRQDETDERVSLSHPPADKHRALG"
FT   gene            467606..468265
FT                   /locus_tag="Smal_0390"
FT   CDS_pept        467606..468265
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0390"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50095"
FT                   /db_xref="GOA:B4SHQ2"
FT                   /db_xref="UniProtKB/TrEMBL:B4SHQ2"
FT                   /protein_id="ACF50095.1"
FT                   /translation="MVSAASRFCRICGPGPILMVLQVVALLSMALAAGFFHYRVDLLLE
FT                   PVDETCGGPDPVARMQVAEQLMARSLALEPWQPLHWIPLAGVTLAMLGAMSISLYRLGR
FT                   LPGRLRLANWGMMALHGAILALASWALRLYDTAWTSVATLSPAACLVELGEQGRLPLAQ
FT                   AQQVVFEILTHEHAPLLRNPDDLALVLVALMLTAMTAGFMLWRAIVRIREAELPAA"
FT   gene            468400..469368
FT                   /locus_tag="Smal_0391"
FT   CDS_pept        468400..469368
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0391"
FT                   /product="polysaccharide deacetylase"
FT                   /note="PFAM: polysaccharide deacetylase; KEGG:
FT                   aba:Acid345_1565 polysaccharide deacetylase"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50096"
FT                   /db_xref="GOA:B4SHQ3"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:B4SHQ3"
FT                   /protein_id="ACF50096.1"
FT                   /translation="MRWLLRAVPLLLCSLAVHAAEVDRRIAVTIDDLPWARVDEIVPPD
FT                   LQARHEALMAQLRQAGVPVVGFVNENKLEIDGQVQPARVQMLRDWLDGGYVLGNHTYSH
FT                   MDLNAKGVPAFQRDFLRGETVLRPLLAERGLKPQWMRHPYLRAGRTPEERAEMDVFFKA
FT                   HGYRVAPVTVDNSEWVWAFAYANVMNEQPDSPEREATLAQLRKGYVPYMLNKLDYYEKQ
FT                   SQALLGYTLPQVWLMHANELNAATFAELVAATKRRGYRFISLDEAMRDPAYARGAEGYS
FT                   GRYGPSWLHRWAMAEKKPKDFYAGEPVVPAWVMKLAKVDSE"
FT   sig_peptide     468400..468459
FT                   /locus_tag="Smal_0391"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 20"
FT   gene            complement(469372..470214)
FT                   /locus_tag="Smal_0392"
FT   CDS_pept        complement(469372..470214)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0392"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xcv:XCV0651 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50097"
FT                   /db_xref="GOA:B4SHQ4"
FT                   /db_xref="InterPro:IPR008471"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B4SHQ4"
FT                   /protein_id="ACF50097.1"
FT                   /translation="MPHYTGPLLTRDSADNLRRAHDKGAAEWQGSLDLGRSQDSVALNA
FT                   DGFHFRGQAYPWPGKLKDRTLYYWDGEDFAPISRYSGSLIKLVPTEWGAPTFEIDGIKM
FT                   LPTSKLSPFEDARRKVELVAPAGKVILDTCGGLGYFAACALEAGVGQIRSFEKNADVMW
FT                   LRTLNPWSPDPESAAAGGRLRFSHGDVSQQIEQVASNSVDAILHDPPRFGIAGELYSQV
FT                   FYDHLARVIRKGGRLFHYTGAPNKLTSGRDVPREVAKRLEKAGFKAELALDGVLAVKR"
FT   gene            complement(470669..471331)
FT                   /locus_tag="Smal_0393"
FT   CDS_pept        complement(470669..471331)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0393"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50098"
FT                   /db_xref="UniProtKB/TrEMBL:B4SHQ5"
FT                   /protein_id="ACF50098.1"
FT                   /translation="MKLQIAILTFIVSASVQAGDGAPADGQIADEAKTPSRIVRSAEWP
FT                   DFIGGTISVEQSLNRNSKGQYVYRYDDQTEATKQYHEASCADIGMNPAKGESITVGPGS
FT                   AAWHCSSIESNSASDAKSTDYVIAYAPNGQVSAGQNFISYGTVRFNSSVSGNIQGSAQI
FT                   DNGRCHTFYNEYYPPNTVGSHTARVLCFAHAPQTMNTLMEGCVPRACASNRGSIRAN"
FT   sig_peptide     complement(471275..471331)
FT                   /locus_tag="Smal_0393"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.994 at
FT                   residue 19"
FT   gene            complement(471443..471859)
FT                   /locus_tag="Smal_0394"
FT   CDS_pept        complement(471443..471859)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0394"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pcr:Pcryo_0856 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50099"
FT                   /db_xref="UniProtKB/TrEMBL:B4SHQ6"
FT                   /protein_id="ACF50099.1"
FT                   /translation="MRTLRLLLPGALLLLTACSGDAGLPFSADPLQGCFATSARKPADF
FT                   RIEKEGGQYFVSFSRGEQWQREPNALHKATRSEISRYFRDDADQIDSALIRMAGGFGIF
FT                   HFNKGATLKGKASDSDYMALMLIGAGPVYAVKCQ"
FT   sig_peptide     complement(471776..471859)
FT                   /locus_tag="Smal_0394"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.388 at
FT                   residue 28"
FT   gene            471950..472234
FT                   /locus_tag="Smal_0395"
FT   CDS_pept        471950..472234
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0395"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xcb:XC_0620 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50100"
FT                   /db_xref="GOA:B4SHQ7"
FT                   /db_xref="UniProtKB/TrEMBL:B4SHQ7"
FT                   /protein_id="ACF50100.1"
FT                   /translation="MAKGKAPWCGVASWLGILVGWGAGSLAAQAAVAAGGNGMAAGLGV
FT                   GVLGAALVGCGLAVASRVRGERWPWIGIGGAVLSALPLLMYLLRMMLKL"
FT   sig_peptide     471950..472042
FT                   /locus_tag="Smal_0395"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.879 at
FT                   residue 31"
FT   gene            complement(472323..473297)
FT                   /locus_tag="Smal_0396"
FT   CDS_pept        complement(472323..473297)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0396"
FT                   /product="cation diffusion facilitator family transporter"
FT                   /note="TIGRFAM: cation diffusion facilitator family
FT                   transporter; PFAM: cation efflux protein; KEGG: xcb:XC_4064
FT                   heavy metal transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50101"
FT                   /db_xref="GOA:B4SHQ8"
FT                   /db_xref="InterPro:IPR002524"
FT                   /db_xref="InterPro:IPR027469"
FT                   /db_xref="UniProtKB/TrEMBL:B4SHQ8"
FT                   /protein_id="ACF50101.1"
FT                   /translation="MQLDALAAARRHEHRFDDGNPLAERNTRRALWLTVAMMLVEIVGG
FT                   WWFNSMAVLADGWHMSSHALALGLSVFAYRCARRYAHDPRFAFGTWKIEILAGYTSAIA
FT                   LLGVAALMAVQSLERLWVPAPIHYNEAIAIAAVGLGVNLLCAWWLHDSPGHAHHHHGHG
FT                   HNHHHGHDHDHHDHSHAHGHDLNLRSAYVHVLADAATSVLAIVALLGGKLLGLTWLDPV
FT                   MGLVGAVLVTVWAIGLLRDSGRILLDAQMDAPVVAEVREVIEQGPWPARLADLHVWQVG
FT                   RGKYAVSASVVTSDASLDADTVRNALAIHEELVHVTVEIHRSA"
FT   gene            473346..473630
FT                   /locus_tag="Smal_0397"
FT   CDS_pept        473346..473630
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0397"
FT                   /product="protein of unknown function DUF156"
FT                   /note="PFAM: protein of unknown function DUF156; KEGG:
FT                   cph:Cpha266_2130 protein of unknown function DUF156"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50102"
FT                   /db_xref="GOA:B4SHQ9"
FT                   /db_xref="InterPro:IPR003735"
FT                   /db_xref="InterPro:IPR038390"
FT                   /db_xref="UniProtKB/TrEMBL:B4SHQ9"
FT                   /protein_id="ACF50102.1"
FT                   /translation="MAHVHKNRKQLLTRVRRIAGQVAALEQALDRPEGEAGDCADVLVQ
FT                   VAAVRGAAHSLLMELLHEHLQEHVVGAEDPQQRAAEAEVLVELLRRYGK"
FT   gene            complement(474092..474466)
FT                   /locus_tag="Smal_0398"
FT   CDS_pept        complement(474092..474466)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0398"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xcv:XCV0283 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50103"
FT                   /db_xref="GOA:B4SHR0"
FT                   /db_xref="InterPro:IPR004891"
FT                   /db_xref="UniProtKB/TrEMBL:B4SHR0"
FT                   /protein_id="ACF50103.1"
FT                   /translation="MKSPSAVLLDAGAVALSSLCLLHCLALPLLAAALPLFGAWAEAEW
FT                   VHLLFVAIALPLTGYALWRAERRHPLPVLAWATAGVGLGLLLAGALALPTHAWETPMTV
FT                   TGSLLLAATHIWNARHRHAG"
FT   sig_peptide     complement(474371..474466)
FT                   /locus_tag="Smal_0398"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.997) with cleavage site probability 0.922 at
FT                   residue 32"
FT   gene            474536..475861
FT                   /locus_tag="Smal_0399"
FT   CDS_pept        474536..475861
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0399"
FT                   /product="cobalamin synthesis protein P47K"
FT                   /note="PFAM: cobalamin synthesis protein P47K; cobalamin
FT                   synthesis CobW domain protein; KEGG: xom:XOO_4133 nitrile
FT                   hydratase activator"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50104"
FT                   /db_xref="InterPro:IPR003495"
FT                   /db_xref="InterPro:IPR011629"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B4SHR1"
FT                   /protein_id="ACF50104.1"
FT                   /translation="MNTVSRADRRLPVTVLSGFLGAGKTTLLNQILRNREGLRVAVIVN
FT                   DMSEVNIDAQLVREGGAELRRTEETLVEFSNGCICCTLRDDLLQEVRRLADADRYDYLL
FT                   IESTGIGEPMPVAATFAVRDEHGFSLSDIARLDTMVTVVDGSAFLADFGSTLRLAERGQ
FT                   QAGPDDDRGVVDLLCEQVEFADVIVVSKVDQVDDEVLQDTLAVLRGLNRDAKLLLSSFG
FT                   DVPLAELLDTGRFDMERAQRAPGWVKELRGEHTPETEEYGIGSFVYRSRRPFHPARFAR
FT                   ALQSGMPGVIRSKGWFWLANRMDWVGELNTVGAATRTQAAGFWYAARDRVRARLEDTTP
FT                   LLPPTPLPYSDLGWARQQADCWSAPLPGLEEFPDSAAHTAMQRLWHPLWGDRRQELVVI
FT                   GVHMDERAVRAELDACLLNDQELRAGPLLWHQLPQAFPVWKR"
FT   gene            complement(475966..477573)
FT                   /locus_tag="Smal_0400"
FT   CDS_pept        complement(475966..477573)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0400"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: cti:RALTA_B0293 putative ABC transporter ATP-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50105"
FT                   /db_xref="GOA:B4SHR2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B4SHR2"
FT                   /protein_id="ACF50105.1"
FT                   /translation="MTPHSLTLDRVSYRLADGRVLFSDLSFSFEPVATGLVGANGTGKS
FT                   VLARLLAGRLSPDSGQVRGSDRVFLLPTPGYPPAGTVGELAGVGEALSALARIEAGSVD
FT                   EADFTCVGERWDLRERLQQQWQALGLPDDLDHAQPAARLSGGQAMQVALSGAWASGADW
FT                   LILDEPSNHLDARHRQQLYKQLQQWRGGLLAISHDRELLGRMQQIVELDARGLHRYGGA
FT                   WQHYAEVRAAEREAAAAQLDHARAQHRQQQRSAREQNERQQQRQARGNREAKQANQAPI
FT                   LLGRQKQRAEASLGRAQQVQSERLQASAEQLRAAISAVHTAPELALFAGAGERGSTRLL
FT                   QAEALVLPHGCSAPLQLEIRRGQRIAVVGDNGSGKSTLLRVLAGQLRARDGTVQRHAPL
FT                   ALLDQQLLGLSGEHSILDSVQAANPGADPGELRTRLALLGLDAQRIQRPASSLSDGERV
FT                   KGALASVLYADPAPQLLLLDEPGNALDLSALQALEELLAAWPGALMMVSHDLHLLQALR
FT                   PTQVLQVTANSWQWRDSL"
FT   gene            complement(477814..478713)
FT                   /locus_tag="Smal_0401"
FT   CDS_pept        complement(477814..478713)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0401"
FT                   /product="transcriptional regulator, LysR family"
FT                   /EC_number="4.2.1.1"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: bur:Bcep18194_A5921
FT                   transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50106"
FT                   /db_xref="GOA:B4SHR3"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B4SHR3"
FT                   /protein_id="ACF50106.1"
FT                   /translation="MSVLDNLANLQTFVHAADTRSFVETGRLQGISASAAGKCVARLEH
FT                   ALGVRLFHRSTRSITLTAEGQLFLARCRRILDERDAARTELAQPHAAPSGTLRIGLPLV
FT                   GDLTLPLMAEFMAAYPDIRLDLDFSDRLVDVIEEGFDAVLRVGEPSDSRMNARRLGVFP
FT                   RRIVASPAYLQRRGVPRAPADLLQHTLLHYRFPSTGKLELWPIQWPGNEAPQELPVHMV
FT                   ANTIEARVALALRDIGLAFVPVHSVRDALADGRLLTVLDEHVHSCGIFHLLWPSGRHVL
FT                   PKLRVFIDFVSARLETVP"
FT   gene            478941..480119
FT                   /locus_tag="Smal_0402"
FT   CDS_pept        478941..480119
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0402"
FT                   /product="beta-lactamase"
FT                   /note="PFAM: beta-lactamase; KEGG: bcm:Bcenmc03_4045
FT                   beta-lactamase"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50107"
FT                   /db_xref="InterPro:IPR001466"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:B4SHR4"
FT                   /protein_id="ACF50107.1"
FT                   /translation="MNAALSLDPAPALPSVQRLLQQVHPQRLVGAVVLVREHGVLRHAS
FT                   ATGLADRESGAAMQRDQLFRLASVSKPLLTTVILRLVADSVLDLDAPVQRWLPDFRPAL
FT                   ADGSTPPISLRQLLSHSSGLGYRFLEADADGPYARAGVSDGMDANPLTLADNVHRVAQA
FT                   PLLFEPGSQWLYSLGVDVAGAVAEAATGETLQALFERLLAARLGLRDTAFATTDAARLA
FT                   TPYVSDTPQPHRLQEGEVVAPFEGTVGIEYSLARATDASRFPSAGAGLIGSADEVMAVL
FT                   EALRDVQASNLLPPALVAEMATPQVGEQGPPEPAGWGFGLGFAVLRDAAASGTPQSEGS
FT                   WRWGGAYGHSWFVDPARGLSVVALTNTLYEGMDGAFVDELRDAVYADLEAAR"
FT   gene            480116..481300
FT                   /locus_tag="Smal_0403"
FT   CDS_pept        480116..481300
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0403"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   shw:Sputw3181_2194 major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50108"
FT                   /db_xref="GOA:B4SHR5"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B4SHR5"
FT                   /protein_id="ACF50108.1"
FT                   /translation="MSGHAIDAASPAGEATRLPWAGLLALAGGGFITLLTETLPAGVLR
FT                   PMGESLGVSDAGVGQLVSVYALGSVMAALPMTALTQRLPRRPLLLAAIAGFVVVNTLTA
FT                   VSSSYPLILAARFLAGVCGGLLWSLVAGYAARMVVPSLQGRAIAVAMVGSPLALSLGVP
FT                   AGTLLGQQIGWRWAFVLMSVLGVGLLAYARWTLPALPAAGAGQRTSLGTVWRMPGVRSA
FT                   LLVMVLYVLAHNVLYTYIEPLAVDAGAGPWLDRLLLAFGVAAIVGIGIAGWGVDRHLRA
FT                   LVWAAVIGFLLPVLALLLWPGQATALLLATILWGVAFGAVPTLFQTALARRAGAAADLA
FT                   QSMLVTGWNLAIAGGGVAGGVLLQASGPSQLGWLPLLLLAVSAAWLLARPKAWA"
FT   gene            complement(481619..483235)
FT                   /locus_tag="Smal_0404"
FT   CDS_pept        complement(481619..483235)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0404"
FT                   /product="EAL domain protein"
FT                   /note="PFAM: EAL domain protein; KEGG: swi:Swit_2925 EAL
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50109"
FT                   /db_xref="GOA:B4SIA4"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR024744"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:B4SIA4"
FT                   /protein_id="ACF50109.1"
FT                   /translation="MSRLRIIIGGTALALLAAAVPIAVMAYATWDRAVSVEQQRLRDIA
FT                   GRALRRSDQSYHDALAALKSAEAGAHVPCSPDHIQRMQTLVMTTPSIDQMGYFEGGTLR
FT                   CTSWGPFLADVKQPKADHVTSEGAGIAVDVRPEASGRRQVLSILYGAYDVLVDPRRFVD
FT                   VIADPNVRLALASPDGRLLAKQDGMDPALLETLLRNPGEGLDHNTLYATARNGEWLAIA
FT                   TTPRTALAATFRQQAWLYVPLGLLMAAVGAGLVIWLSRRRLSLRGELATAIRRRELYLH
FT                   YQPIIELDTGICVGAEALIRWQRQDGTQVRPDLFIPLAEETGMIGAITDLVIENVVRDM
FT                   RELLVADRSAHIAINLAAEDISSGRALKLIAKHMAGSGILPQQIWMEATEHGFLDLDRA
FT                   RTMLAQARRAGHSVAIDDFGVGFSSLQYLEQLPLDALKIDKSFIDAIGTESATSPVTPH
FT                   IIDMAKELGLWVVAEGVETEAQLAYLHTRKVEFAQGWLFSRPLPRDEFVVFHQKRQQRY
FT                   GAAREHMQNPRSVPIEREGIE"
FT   sig_peptide     complement(483155..483235)
FT                   /locus_tag="Smal_0404"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.754 at
FT                   residue 27"
FT   gene            483465..484838
FT                   /locus_tag="Smal_0405"
FT   CDS_pept        483465..484838
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0405"
FT                   /product="amino acid permease-associated region"
FT                   /note="PFAM: amino acid permease-associated region; KEGG:
FT                   xac:XAC0600 D-alanine/D-serine/glycine permease"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50110"
FT                   /db_xref="GOA:B4SIA5"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004840"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniProtKB/TrEMBL:B4SIA5"
FT                   /protein_id="ACF50110.1"
FT                   /translation="MTEPATPPEHLRRSLSNRHLQLIAIGGAIGTGLFMGSGKTISLAG
FT                   PSIVFVYLIIGAMLFFVMRAMGELLLSNLQYKSFIDFSTDLLGPWAGFFCGWTYWFCWI
FT                   VTAIADVIAIAAYAQFWFPGLDAWIPALACVMLLLALNLVTVKLFGEMEFWFALIKIVA
FT                   ICALIITGAGLVAWGFTSPSGHTAALSNLWNDGGMFPMGLVGFFAGFQIAVFAFVGIEL
FT                   VGTTAAETANPERNLPKAINSIPVRIIIFYVLALIAIMAVTPWRQVVPDKSPFVQLFVL
FT                   AGIPAAASLINFVVLTSATSSANSGIFSTSRMLYGLAEEGHAPRGLSKLSRAAVPARGL
FT                   LFSCLCLLGGTLLIYLIPNLVTAFTLVTTLATVLFIFVWSLILVAYMVYRRRYPERHAA
FT                   SIFKMPGGVAMCWACLVFFAGVLVLLSLQADTRQALIASPAWFVLLGVGYWVRRRTAK"
FT   gene            485157..485933
FT                   /locus_tag="Smal_0406"
FT   CDS_pept        485157..485933
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0406"
FT                   /product="Lytic transglycosylase catalytic"
FT                   /note="PFAM: Lytic transglycosylase catalytic; KEGG:
FT                   xfm:Xfasm12_1946 soluble lytic murein transglycosylase
FT                   precursor"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50111"
FT                   /db_xref="GOA:B4SIA6"
FT                   /db_xref="InterPro:IPR000189"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:B4SIA6"
FT                   /protein_id="ACF50111.1"
FT                   /translation="MSRHPLLLALLLLPSLWPGLAAARTVYRCVQGNTVSLATAPEPGS
FT                   RCTPKEIDDNAVQAPNLWGNMGVFSGVLYEREQDGALVYSTRNLPGSRVFLKFTVATPP
FT                   GEPAHEGLGKVGKPQLAQHAKQFKAAAKATGVDDAWLRAIAHAESNFDALAVSTKGAQG
FT                   VMQLMPDTAQEYGVSDPFSPQQSIDGGARYMRALLRRYNGDRPLAAAAYNAGIGAVTRY
FT                   KGVPPYAETLAYVDKVMALYARYREAMGIRTEVPAR"
FT   sig_peptide     485157..485228
FT                   /locus_tag="Smal_0406"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.928 at
FT                   residue 24"
FT   gene            complement(486028..487548)
FT                   /locus_tag="Smal_0407"
FT   CDS_pept        complement(486028..487548)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0407"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cak:Caul_4326 tetratricopeptide TPR_4"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50112"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:B4SIA7"
FT                   /protein_id="ACF50112.1"
FT                   /translation="MPRVLPLTALLLAALAGSPASASIAVAPQKPSVTSDAVHTAYATR
FT                   WDEAIQQSRSGNTLGALIAMEQLMEDPLLDDFDAEHRGRAAQVAGWTALMQKKPAQARR
FT                   YLQRAQESLPDDAQILLTLVSLELSENQPAPATRYLVQALKHAEGPLPIERQPINYLQY
FT                   RLRDQPQRRMELLQALFDNGWKGGGVEPTGLWLALATLQADNGRGDDIPTTLARINGPA
FT                   EIIRLRSDKRFDRYVDRGDARFDPVQAAQKHLDELRVSGLLDRALDARMAEFSNTLLML
FT                   DRNEEVLALTDGMARAAAEGESPSAAEAEWVAWLLNSRLTALRRLGRTDDALATAKLAA
FT                   RIGALGPDGAEHQFNVGFVLSSLGRLQDATAAVNDMQGLGGYGKAAQALLQFAAARERG
FT                   DAKAMDAARAAILAEGDDARLFHREMLLDEGNLDGAAAVLIEQLRSPVERGETLASLQD
FT                   MRTYPSLPGDVKIDAAWRALKQRADVQAEVTRVGRIERYELVGSATSR"
FT   sig_peptide     complement(487480..487548)
FT                   /locus_tag="Smal_0407"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.853 at
FT                   residue 23"
FT   gene            487716..489797
FT                   /locus_tag="Smal_0408"
FT   CDS_pept        487716..489797
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0408"
FT                   /product="SMP-30/Gluconolaconase/LRE domain protein"
FT                   /note="PFAM: NHL repeat containing protein;
FT                   SMP-30/Gluconolaconase/LRE domain protein; KEGG:
FT                   ote:Oter_2854 SMP-30/gluconolaconase/LRE domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50113"
FT                   /db_xref="InterPro:IPR001258"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR013017"
FT                   /db_xref="UniProtKB/TrEMBL:B4SIA8"
FT                   /protein_id="ACF50113.1"
FT                   /translation="MARWQWMAAGVALATAVALAATWWDSPLQTLAEPAGPAPTPLAWT
FT                   AQIEMLAGDGHPGDRDGASAQARFADPYALLRSADGSIYFTDAGDNNRIRRRQPDGRIE
FT                   TVAGQGEGRIDGPALQASFNTPSGIAADAQGNLYVADTGNHAIRRIGTDGQVTTLAGGE
FT                   QGYADGPAAQARFDAPMGIAVDAQGQVYVADTFNDRIRVIGTDGNVRTLAGGERPGLAD
FT                   GLGVAARFDTPVALAFDAHGALLVADLFNNAVRRVGADGMVSTLLGDGGVINGPLSLAT
FT                   THDGVLYVGDLDGRIVQVTPQGHQIALVGNGRLPRLARPSGLAMDADGSVLVADSASYR
FT                   LHRLRPLPVGDLPAPALVGPAADAALPDTGGRWPLAPQDGWHEVVGTLGEVRGNFKGES
FT                   RHHLHGGFDVRGDVGQTVLAIADGKISSPVAAWSLGGQAEGLAVDRLKYIHMRVGRTPR
FT                   DQPFDARWQALYDEQGKLERMRVRRGTRIHVGDRLGSINNQAHVHLAVGTGGFETNAVA
FT                   LGFHNYADHFAPRITDVALLDDNDQPLAAGSDGVVMLARQGRGVQIVVEAWDQVDNNLP
FT                   RRRLGMYQVGYQILDAGGQPLQGYEQPRWNIVFNRMPPQMEAVRVAYAPDSGITVHGSA
FT                   VTRFRYLATNTVRDGLMETGRWQPAALPPGEYIVRASVRDYSGNEGVGPREIRVRLLP"
FT   sig_peptide     487716..487778
FT                   /locus_tag="Smal_0408"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.982 at
FT                   residue 21"
FT   gene            complement(489775..490182)
FT                   /locus_tag="Smal_0409"
FT   CDS_pept        complement(489775..490182)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0409"
FT                   /product="DGPFAETKE family protein"
FT                   /note="PFAM: DGPFAETKE family protein; KEGG: xcb:XC_3733
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50114"
FT                   /db_xref="InterPro:IPR005545"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:B4SIA9"
FT                   /protein_id="ACF50114.1"
FT                   /translation="MQQYLLLIYIEPALLQALPTEEFNALMRDCLAHADKLQAEGTLLA
FT                   AQKLQPVDTAQTLRVRDGHSRVLDGPFAETRELLAGFNLIVARDRDEAMRIARDFPWAR
FT                   FGSIEVRPLEDMDAERERCGAPAAAMAAAVP"
FT   gene            490914..491327
FT                   /locus_tag="Smal_0410"
FT   CDS_pept        490914..491327
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0410"
FT                   /product="DGPFAETKE family protein"
FT                   /note="PFAM: DGPFAETKE family protein; KEGG:
FT                   bvi:Bcep1808_3442 DGPFAETKE family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50115"
FT                   /db_xref="InterPro:IPR005545"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:B4SIB0"
FT                   /protein_id="ACF50115.1"
FT                   /translation="MKVMVIVKANADSEAGRMPSEQELSDMGAFNEQLVAAGIMLAGEG
FT                   LHATQRGRRIHFGGGAPKVEAGPFGPASEQIAGFWLWDVRSLDEAVEWASRAPFNTGGT
FT                   LELRPLISAEDFGEAFTPELQQQEQRLRAQLEG"
FT   gene            491397..491819
FT                   /locus_tag="Smal_0411"
FT   CDS_pept        491397..491819
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0411"
FT                   /product="3-demethylubiquinone-9 3-methyltransferase"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; 3-demethylubiquinone-9
FT                   3-methyltransferase; KEGG: rpe:RPE_4736
FT                   glyoxalase/bleomycin resistance protein/dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50116"
FT                   /db_xref="GOA:B4SIB1"
FT                   /db_xref="InterPro:IPR028973"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="UniProtKB/TrEMBL:B4SIB1"
FT                   /protein_id="ACF50116.1"
FT                   /translation="MKLIPFLGFSGQAHEAMAFYAKALGGQVTSEMKYRDMPPSDGSPG
FT                   CNEMPPETLDHVAHSQLEIGSAIVMAADGPGGGEGGSTTINVDVDSIEEAERVFAALAD
FT                   GGQVQMPIAETFWAHRWGMLIDRYGKPWMVNCMKQP"
FT   gene            491854..492264
FT                   /locus_tag="Smal_0412"
FT   CDS_pept        491854..492264
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0412"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; KEGG: mpt:Mpe_A0020 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50117"
FT                   /db_xref="GOA:B4SIB2"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:B4SIB2"
FT                   /protein_id="ACF50117.1"
FT                   /translation="MNAPQPQMIFVNLPVKDLEKSKAFFTALGYSFNPTYTNDDAAGMV
FT                   ISESIYVMLLTQPFFQQFTNKPIADAHTHTEVINALSAPSRKAVDELVDKALAAGGSEP
FT                   QPPRDLGFMYQRGFQDLDGHLWEIAHMDGEPG"
FT   gene            492288..492644
FT                   /locus_tag="Smal_0413"
FT   CDS_pept        492288..492644
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0413"
FT                   /product="protein of unknown function DUF1428"
FT                   /note="PFAM: protein of unknown function DUF1428; KEGG:
FT                   rpe:RPE_4844 protein of unknown function DUF1428"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50118"
FT                   /db_xref="InterPro:IPR009874"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:B4SIB3"
FT                   /protein_id="ACF50118.1"
FT                   /translation="MAYVDAYVLPCPQDKVAAYRGLARKAGAVWKDHGALQYMECVADD
FT                   VEPGKSTSFPRAVKAKPGETVIVAFVVFRSRAARDRINAKVMADPRLASLGPKDMPFDT
FT                   KRMFWGGFKPIVEA"
FT   gene            492690..493952
FT                   /locus_tag="Smal_0414"
FT   CDS_pept        492690..493952
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0414"
FT                   /product="putative RNA polymerase, sigma-24 subunit, ECF
FT                   subfamily"
FT                   /note="TIGRFAM: RNA polymerase sigma factor, sigma-70
FT                   family; PFAM: sigma-70 region 2 domain protein; Sigma-70
FT                   region 4 type 2; KEGG: bmu:Bmul_4925 putative RNA
FT                   polymerase, sigma-24 subunit, ECF subfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50119"
FT                   /db_xref="GOA:B4SIB4"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:B4SIB4"
FT                   /protein_id="ACF50119.1"
FT                   /translation="MLEPALTQRLETLWRMESPVLIARLARLLGGDVGRAEELAQDTWL
FT                   AALERWPEQGIPDNPGAWLMTTARNRAIDVLRQHQRVAQQHAQWGEELHPAPLPAPDDS
FT                   QALEDDLGDDLLRLMFVACHPVLPADARVALTLRLLGGLTTVEIARAFLQPEPTIAQRI
FT                   VRAKRTLAQKQVPYEVPRADAMPERLGSVLEAIYLVFNEGYAASAGDDWMRPALCEEAL
FT                   RLARILAHRLPVPPVLGLLALMELQASRAAARTDAQGVPVLLDQQNRARWDWLQIERGQ
FT                   QVLARALAAGGADDPYVLQARIAACHAAARRPEDTDWPRIAALYTQLLQVQPSPVVALN
FT                   RVVAVLRSDGAFAAWAQLQPLLVDARLREYAPLQVVRGELLQALGRDLDARHAFAEAAR
FT                   LSQNQAERGLLRQRAGLPPTE"
FT   gene            494060..495256
FT                   /locus_tag="Smal_0415"
FT   CDS_pept        494060..495256
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0415"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rme:Rmet_5702 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50120"
FT                   /db_xref="UniProtKB/TrEMBL:B4SIB5"
FT                   /protein_id="ACF50120.1"
FT                   /translation="MYSRTKSASRAFARLLACALCLAVWPMAGQAADKSQQAYWAGFAY
FT                   TADAAAVQATTPHAHAVLEKRGLIPLNQTLGQGLKRRPPANLELIDQPVAMLDGTTSAT
FT                   VLAAALDRELVSVEPIGDQYKVLVEVALQALFFDFRERQVIASYPLTLQRIDVQDYRPD
FT                   NDDIDAIVADLLYGSADTSLSQVLAASLAQARLPDAAVRRLQVGGVTLSDAVRAKLPDP
FT                   KWEAPLRATLAHELSKTLSSNTGVGLLPPASGQAIGGAMAARFADGKVYQLKIPEPDYV
FT                   INLQVDALKNGVIEETPAMKTMLFGAFFTAKVTEPFSGKVYFEQPLRKGATKVVPVTQW
FT                   QVDQWSASYETLLAGFDAFAGAAAKRADSRGWLDEQKPGGRPLQQQTQALQELIKSCR"
FT   sig_peptide     494060..494155
FT                   /locus_tag="Smal_0415"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.997 at
FT                   residue 32"
FT   gene            495247..496347
FT                   /locus_tag="Smal_0416"
FT   CDS_pept        495247..496347
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0416"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rme:Rmet_5701 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50121"
FT                   /db_xref="UniProtKB/TrEMBL:B4SIB6"
FT                   /protein_id="ACF50121.1"
FT                   /translation="MSLMRTILLILIALVVASPVAAQTASSRGTGSASYGLRLSADTRA
FT                   QALNKAKVNALEAYIAETGAAKLRLFEARRAEFIGEIDRYVLSAVQLSDNEDKKAKTYS
FT                   VTVRAEINTTLLQTKLDAGSAVAGATAAQRSLLTFLFMARSQDTVQSFQDKEYRRVDAS
FT                   SSYSENTREGDSFRGNSVSTNGSINQNGSMSVTSGGSTTQRSDNISWKVANAAEVNTAM
FT                   TGAFSAAGYEVVEAEYVEGESRGLLSIERIRKDFSTGNDLAPATLRDTANGIRAANIPY
FT                   IAVGTLDVGMRDRDPASGNTRVFVTVTGKVLDVTGRFPRTVSSVGPVQFSGTGPNETVA
FT                   RTNALQLAAEKAAQQMINELNVKAVR"
FT   sig_peptide     495247..495315
FT                   /locus_tag="Smal_0416"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.950 at
FT                   residue 23"
FT   gene            496482..497159
FT                   /locus_tag="Smal_0417"
FT   CDS_pept        496482..497159
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0417"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: dac:Daci_1236 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50122"
FT                   /db_xref="UniProtKB/TrEMBL:B4SIB7"
FT                   /protein_id="ACF50122.1"
FT                   /translation="MIRNTALVVAIAAATLSMPAHAQFGKLKDLAGAATGTSSSSASSA
FT                   AAPDEAAQEALVRRFVSSQSHSLQAQTSFARAFGLAEQVQLLEAERQALSSGSVSVDAM
FT                   KKSVSVSEAAQAAINERQAAQPELNAESKQHYAEGLVSLLSSAAEAQKLGGEASSFTAG
FT                   MKNLGATQLATVGRKLAAGAWVAKESPGFIKGLYGSTKSAVTFAKKSKVKVPSNADSML
FT                   DSL"
FT   sig_peptide     496482..496550
FT                   /locus_tag="Smal_0417"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 23"
FT   gene            497176..498831
FT                   /locus_tag="Smal_0418"
FT   CDS_pept        497176..498831
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0418"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dac:Daci_1237 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50123"
FT                   /db_xref="GOA:B4SIB8"
FT                   /db_xref="InterPro:IPR005534"
FT                   /db_xref="UniProtKB/TrEMBL:B4SIB8"
FT                   /protein_id="ACF50123.1"
FT                   /translation="MRMTTRLIGLGLAAALLAACGKQDTPAAAPTPAKDKATSALASNA
FT                   PVEAAPLRGTPDFGGTTQVAREADGIGSTPELAVLAALQSAVAQVNGVRVASQMQSLRA
FT                   GLHVDVDGEHVGDIRADAFTQQMIAGSQGAVLGYEILSQDEVRQLDEETVARVRASDEG
FT                   WSFKGSASASASGEASAKSGSASASVRESYDEKVNVDAKRGASSFDSDVTHRSMRSYWK
FT                   VRVRAQIAQYRAPDEQGKPKIVVALPRTKAGSYAVGDGRVDADEVADAIRARLSDTLTQ
FT                   TQRFIVLDREFGDELQAEIDHINSGNVRLQDTARVGQQLATDLILIPTIERFEYPRSVR
FT                   NLRMSDRQVTSYSGGGRITLRLINATTGQVVMSDSFDHQLASTGPSTLPRVVNGRNMAA
FT                   AMMESLSGQIGTTIVTTLFPVSVVSVDGDQVVLSQGGDTVQAGQRWQAVRLGEELKDPQ
FT                   TGRSLGRSEHPCCTIRIDRVAAQTSYGTIEDGVDAMRGGFRPGQIELRQKLGSKPAAAA
FT                   AGSATASAAPAAAARPAAKPKPKPAAAPAEDPNW"
FT   sig_peptide     497176..497241
FT                   /locus_tag="Smal_0418"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.997) with cleavage site probability 0.769 at
FT                   residue 22"
FT   gene            499213..500862
FT                   /locus_tag="Smal_0419"
FT   CDS_pept        499213..500862
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0419"
FT                   /product="peptidase M28"
FT                   /note="PFAM: peptidase M28; KEGG: xac:XAC0615
FT                   aminopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50124"
FT                   /db_xref="InterPro:IPR003137"
FT                   /db_xref="InterPro:IPR007484"
FT                   /db_xref="UniProtKB/TrEMBL:B4SIB9"
FT                   /protein_id="ACF50124.1"
FT                   /translation="MKRAVLGVLALSVSSALMAATPKFDGARISADVKELASDAYEGRS
FT                   PATAGEEKTVTYLSKQFADAGLQPGGDLKDGKRLWTQAVPLRKGDIVGAPQLALHQGGK
FT                   TVSLEQGKQIAVRAAMNGASNVDISKAPLVFLGYGVKAPERNWDDFKGVDLKGKIAVVL
FT                   INDPDFETGQGDFDGKGMTYYGRWTYKYEEGARQGALGVLIVHETAPASYGWATVAGSN
FT                   TNTMFDVVRDNPAESHPLLEGWIQRDLAVELFRSAGQDFEALKKKAQQRDFTPVPLTGA
FT                   SLDAKYAVKTEVITSHNVAARLEGSSHPDETVIYSAHWDHIGVGEPDARGDRIFNGALD
FT                   NASGTASLIELARGFAKQKRPQRSVLFLAVTAEEKGLLGSEYYATHPLYPLEKTVAMIN
FT                   MDGMAPFGPSRDFGIYGAARFELLDQLKDVAKGWDIRYTPDPKPEAGLFFRSDHFPFAK
FT                   RGVPALSWSAGQDWVDGGVAAGKKASEDYTAKRYHQQGDEWQPDWVFAGAARDLEVLYT
FT                   LGNQLANSRSWPNWSKDESFRAVRDASADQRK"
FT   sig_peptide     499213..499272
FT                   /locus_tag="Smal_0419"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 20"
FT   gene            501075..502334
FT                   /locus_tag="Smal_0420"
FT   CDS_pept        501075..502334
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0420"
FT                   /product="signal transduction histidine kinase, LytS"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase internal region; KEGG: xcv:XCV3840
FT                   putative two-component system sensor kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50125"
FT                   /db_xref="GOA:B4SIC0"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR010559"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B4SIC0"
FT                   /protein_id="ACF50125.1"
FT                   /translation="MIASLSLILRHLLAWAAALFVAGMVWSGIFSGMNDGPGWVFGLLV
FT                   MFLMISALGSAVTHVRRVWLVAGRLDGATLSGRQRRQIELPMDAGHAFAVVEAAVGELP
FT                   RVEEVESSAGSLQVRAYVRRVDLWNGRQPSRWNLPARLAIKRNSVLATVTPGQGTSTVT
FT                   LLFEPDAGWWADLLALDEGSNYENAEAVTRAISRRVADQRRDEQAAAEQTQVEKELSVA
FT                   RLNLLHAQVEPHFLYNSLANAQVLTRTDPARAEQMLGHLIQYLRSSLPQVDESVSTLGV
FT                   ELERTRAYLEILRIRMGARLAVEVQVPTELHEVKLPAMALQTLVENAIKHGLEPKPGGG
FT                   TIWILARGFDDHVTVTVADDGLGFGQGTSGTGIGLKNLRERLRLTCGEQAGVAIVANFP
FT                   SGVAATMTLPQSAKERSHAA"
FT   sig_peptide     501075..501158
FT                   /locus_tag="Smal_0420"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.990) with cleavage site probability 0.932 at
FT                   residue 28"
FT   gene            502324..503094
FT                   /locus_tag="Smal_0421"
FT   CDS_pept        502324..503094
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0421"
FT                   /product="two component transcriptional regulator, LytTR
FT                   family"
FT                   /note="PFAM: response regulator receiver; LytTr DNA-binding
FT                   region; KEGG: xcb:XC_3747 transcriptional regulator
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50126"
FT                   /db_xref="GOA:B4SIC1"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR007492"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:B4SIC1"
FT                   /protein_id="ACF50126.1"
FT                   /translation="MPLEALIAEDEELLRQSLVEQLGRLWPELKLVAECEDGASALEQL
FT                   AEKQPDIAFLDIRMPGISGIEVARSLSELSPRTQVVFVTAYDQYAIDAFEQGAMDYLLK
FT                   PVSDERLLATRERILSRLPSTRQDDAVLERLLQRLGPSQGSADHPPLAWITASNGRETQ
FT                   LIMLEDVAYFRADNKYTTVVTAAGESLLRTPLRELLEVLDPQHFRQIHRSTIVNMKAVA
FT                   AVSRDDTGRGVLRLRQRAETLVVSQPFMSLFRGM"
FT   gene            503128..503472
FT                   /locus_tag="Smal_0422"
FT   CDS_pept        503128..503472
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0422"
FT                   /product="putative secreted protein"
FT                   /note="KEGG: xcv:XCV3838 putative secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50127"
FT                   /db_xref="UniProtKB/TrEMBL:B4SIC2"
FT                   /protein_id="ACF50127.1"
FT                   /translation="MRSFLLMGLAALALAGCQKSTETAITRTNANGVDTLYSKRTVVDG
FT                   VARFECIASRSGQCHYLVLDPACSPDAVCAKAPIRSFAVAVGETREFSDLPKGFNQCVS
FT                   EERKEQCHRE"
FT   sig_peptide     503128..503190
FT                   /locus_tag="Smal_0422"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.990) with cleavage site probability 0.335 at
FT                   residue 21"
FT   gene            complement(503512..504126)
FT                   /locus_tag="Smal_0423"
FT   CDS_pept        complement(503512..504126)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0423"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xcb:XC_3744 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50128"
FT                   /db_xref="GOA:B4SIC3"
FT                   /db_xref="UniProtKB/TrEMBL:B4SIC3"
FT                   /protein_id="ACF50128.1"
FT                   /translation="MIALFKGLGILLRDNELYSSPFDKQVAHWRNLSEQQIRDEVAVLA
FT                   QAKCQWLIASIVGWQAASLLILGLIANYLWRDDFHITFTRVVIVFGSWVSILFVIWFMA
FT                   NMFDRTAGFERWMKAFNSRARISSKADSVEHVAEALDLAEHYPEVLDYKQAVTARRELR
FT                   HEDIRIMTEIGRMKQHSELVGRLNHVGETEHHHELTLQPAY"
FT   gene            504436..505365
FT                   /locus_tag="Smal_0424"
FT   CDS_pept        504436..505365
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0424"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xcv:XCV3835 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50129"
FT                   /db_xref="InterPro:IPR018713"
FT                   /db_xref="UniProtKB/TrEMBL:B4SIC4"
FT                   /protein_id="ACF50129.1"
FT                   /translation="MPALLQRLSRPVTAPIRRWVLEAFPRGQSGIDYDHPLGDPGWFGP
FT                   DSVTWRLHAEFPSMLAGGLCALMLQTLHPRALAGVYDHSNFRQDLVGRLRRTTAFVAGT
FT                   SYAPAGEVEMLVAKVRRIHAQIRGQTAQGEHYAADDPQLLTWVHVTEAFGFLQGFRRYG
FT                   REVPAHIADRYYDEYRCVAEALGAVDVPRSEAEVAAYFCARQPELRVDERSREVLEVLS
FT                   GVRLPVPVPGLSREVFLGAGAALLPDWAEGMLERNGRQRAQAAASAKLMRGMAPLFRRA
FT                   LPDGLASRACTRVGVPVDVLREWPTVPR"
FT   gene            complement(505477..506064)
FT                   /locus_tag="Smal_0425"
FT   CDS_pept        complement(505477..506064)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0425"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: eca:ECA1819
FT                   TetR-family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50130"
FT                   /db_xref="GOA:B4SIC5"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:B4SIC5"
FT                   /protein_id="ACF50130.1"
FT                   /translation="MVRRTRAEMEETRATLLATARRVFSEHGYAATSMDDLTAQAGLTR
FT                   GALYHHFGDKKGLLAAVVAQLDAETDLRLQAISDTADDAWEGFVQRCRAYLEMALEPEI
FT                   QRIVLRDARAVLGGASPESQRHCVNSMQRLIEQLITQGAVAPVDAQALASLIYGSLAEA
FT                   AFWIADGEQGDARLRQATAALEMLLRGLKSTE"
FT   gene            506198..507412
FT                   /locus_tag="Smal_0426"
FT   CDS_pept        506198..507412
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0426"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   eca:ECA1818 putative transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50131"
FT                   /db_xref="GOA:B4SIC6"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B4SIC6"
FT                   /protein_id="ACF50131.1"
FT                   /translation="MATPYRDLFAAPGTAGLALAGLLARLPLPMTGIGIITLLSQLRGS
FT                   YALAGTVSATFVLTYALLSPQVSRWVDRHGQGRVLPWATALSASGLVVLLACTVLQAPD
FT                   WTLFAAAMLAGCMPSVSAMVRARWTAIHRGRPQLQTAYSLETVFDEVTFIAGPPLSVGL
FT                   SVAVWPQAGVLAAALLLVIGLTALVLQRGTEPPLQPVDSATPRRSLLRQPEIRLLALLM
FT                   LAMGVIVGTVDITSVAFAEQRGQPLAASVVLSAYALGSCAAGLLFGALKLQVPLPRLLL
FT                   LGAAATALTTLPLLWVGNLPALAVAVLLAGVFFAPTMIVAMSLVEQYVPESRLTEGMTW
FT                   LLAGLNIGVALGAALSGQSVDAGGVRSGFVVALVAGSGALLFAVLAQRALRPSASTTSP
FT                   EGIVP"
FT   gene            507409..508581
FT                   /locus_tag="Smal_0427"
FT   CDS_pept        507409..508581
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0427"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   eca:ECA1817 probable transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50132"
FT                   /db_xref="GOA:B4SIC7"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B4SIC7"
FT                   /protein_id="ACF50132.1"
FT                   /translation="MSASSPAHAAPVPRHLWWAVSAVGLATFSVVTTEMLPVGLLTPIA
FT                   ESLGASTGTAGLMISLPALLAAVFAPLVVIAAGGIDRRRILCALLALLLVANLASALAP
FT                   GIGWLLAARVLVGFCMGGIWAIAGGLAARLVPADRIGLATSIIFGGVAAASVLGIPLGA
FT                   LIGDALGWRSAFAAMALFSAAVMLLHLRVIPALPVSTSVRPAQFVQLLGHRGLQRGLCL
FT                   TLLLVAGHFIAFTYVRPLLTTVSGVEASLIGALLFAYGLAGIASNFIAGPLAARHPRGT
FT                   LLAIASGLLLTPLLLLWVGSTPTGGIAVLLLWGLAYGGVSVGLMSWMMKAVPHALEIAT
FT                   ALYVGVFNIGIAAGAWGGGRLLDGVGLHAILWAAVVLAASALLMVATTRR"
FT   gene            complement(508713..510824)
FT                   /locus_tag="Smal_0428"
FT   CDS_pept        complement(508713..510824)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0428"
FT                   /product="Endothelin-converting enzyme 1"
FT                   /EC_number="3.4.24.71"
FT                   /note="PFAM: peptidase M13 neprilysin; peptidase M13; KEGG:
FT                   xcb:XC_3742 metallopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50133"
FT                   /db_xref="GOA:B4SIC8"
FT                   /db_xref="InterPro:IPR000718"
FT                   /db_xref="InterPro:IPR008753"
FT                   /db_xref="InterPro:IPR018497"
FT                   /db_xref="InterPro:IPR024079"
FT                   /db_xref="InterPro:IPR042089"
FT                   /db_xref="UniProtKB/TrEMBL:B4SIC8"
FT                   /protein_id="ACF50133.1"
FT                   /translation="MSKLRRPTLALAIVASLSLAACDRPAEPAAGTAAPADAAPAAAKP
FT                   MLGSFGFDASGMDRSIAAGDDFFGFANGTWVKNTEIPADRSRFGSFNVIAEKTLADTRA
FT                   ILEGAAGNAQANGDDKLIGDYYAAFMDEAGIEQHGLAPVQPQLKAIEAIADKAGLARTL
FT                   GGDMRADVDLLNATNFYTDRLFGLWVSVDMLQPDRTAPYLVQGGLGMPDRDFYLGGGRM
FT                   AELRKQYQAYIAQMLQLAGVADPAGKAQRILALETKIAQAHATQEETNDVTKGANPWTQ
FT                   ADFNAKAPGMDWNAFLDAAALGKQQDFIVWQPKAVAGLSKLVATEPLDAWKDYLAFHAL
FT                   DRAAAYLPKKFADARFAFHGTALSGTPQQSDRWKRAVDDANHAVGEAIGKRYVEKHFDA
FT                   KTKERADEMAKNIIAAFAKRIDALAWMSPQTKASAKAKVAGLTVGMGYPEKWRDYSGLE
FT                   IRRDDALGNAQRAELFEYQRNIAKLGKPVDHSEWAMLPQTINAMNVPLENRLVFPAAIL
FT                   QPPFFDGAADDAVNYGAIGAVIGHEISHGFDNAGALFDETGKLHNWWTAEDLKQFNAAG
FT                   DALAAQFSSYEPFPGVHVNGKLSLGENIADVAGLGTAYDAYQLSLQGKPAQTLEGFTPD
FT                   QRFFLGFAQAWRSKSREQALRNSLLTDVHAPGQFRALTVRNIDAWYPAFEVKEGQKLYL
FT                   APDKRVKVW"
FT   sig_peptide     complement(510759..510824)
FT                   /locus_tag="Smal_0428"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.986 at
FT                   residue 22"
FT   gene            511001..514063
FT                   /locus_tag="Smal_0429"
FT   CDS_pept        511001..514063
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0429"
FT                   /product="diguanylate cyclase/phosphodiesterase with
FT                   PAS/PAC sensor(s)"
FT                   /note="KEGG: mms:mma_2307 sensory box/GGDEF family protein;
FT                   TIGRFAM: PAS sensor protein; diguanylate cyclase; PFAM:
FT                   GGDEF domain containing protein; EAL domain protein; PAS
FT                   fold-3 domain protein; PAS fold-4 domain protein; PAS fold
FT                   domain protein; SMART: PAS domain containing protein; PAC
FT                   repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50134"
FT                   /db_xref="GOA:B4SIC9"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:B4SIC9"
FT                   /protein_id="ACF50134.1"
FT                   /translation="MRGGARRQEWRPPAVEVGDVEDSFAHEASRLHKEDRPMPALKRAL
FT                   ARPLRAITWGGVLLGVLLVAGLTTMLANDHHRRLEAAQRQSRALAVGSERLLALELRNL
FT                   ERAMSGIAADAAELFRRVPVQAPALLDAAIGGVLSRHAELHSIVVLDRHGRAITAGKGD
FT                   LNLPLWTDPQRRGQGSALYIGPPQQAGDDGWVVPLALSMADDRWLLARLRCGELQRIIG
FT                   GLDVGPNGLVSISDAEGYMLARVPDPHGTVGRRFDLPRRDLLGKQAVVELGSVPGAVDG
FT                   VPRIITVSTLERSPLAVQVGLADEDVLAPWWPYLQASVAIVLAYIGVLLVLLYAVRRST
FT                   RRQQSMAEELKTGHAELRLAHQVGRVCTWYVDEDAALLRWSPLAREIFGVQTDALPVAD
FT                   FFARVHRDDAARLQHAFDQAFAGSAVLDQVFRLVLPGGEVRWVGARGQRVEVADSERRM
FT                   IGALTDLSERYQAREQMGEAERRFRLLFDRNPAPFWVFDPDTLRFIEVNDAAVRQYGYS
FT                   REEFLAMSILDIRPREGWDEVKGAIAKARVGELQDATVRLHRRKDGSVFEVRAHLSRLD
FT                   FDGQPACLVLAEDVSERLAYERDLAYQARHNPATGLLNVRALTEQLDEHDAGYTIAFVQ
FT                   LRGLQLVADTLGREIGDAVLQSMATRLGGLGARCGTLAFQPAEDFVFAIGAGQDVQRVL
FT                   DDLLQIVSAPMRGKDSLHQFEPRIGVATHVAGDGHSAEQVIGMAAQAAHAARAEGNVVV
FT                   WFDASVTTRLADRLRLAGRIHAAIDNEFQLYFQPIRHAGDGSPAALEALLRWPQADGSF
FT                   IPPNEFIPLCEDTGLILALGRWVIRAAAKAQRRLVDAGWGELPIAVNVSAVQFFNSDLV
FT                   TEFTRAQQDFGLARGALHVELTESSLMRKPAQAMQTMQRLHEQGISVSLDDFGTGYSSM
FT                   SYLQHLPLDILKIDRSFVADVETNPRNASICRALLSLGHSMGLTIIAEGVETPGQLDWL
FT                   AAHGCDQVQGYLLGRPAPLEQIIDALDEVPA"
FT   gene            complement(514157..515038)
FT                   /locus_tag="Smal_0430"
FT   CDS_pept        complement(514157..515038)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0430"
FT                   /product="transcriptional regulator, LysR family"
FT                   /EC_number="4.2.1.1"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: xcv:XCV3828 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50135"
FT                   /db_xref="GOA:B4SID0"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B4SID0"
FT                   /protein_id="ACF50135.1"
FT                   /translation="MDTLEAMRVFVAVVERNGFSAAAQALDLSTAGVTRHVAALEKRLA
FT                   TRLLHRTTRRVSPTSAGAAYYAQCVRLLAEFDALEASIGAQALEPSGTLRINAPVSWGI
FT                   ARLGPLLASYRERFPQVELDLALSDRLVDMVEEGYDVAIRITREPSPTLIARRLGESRV
FT                   SLCAAPSYLAARGAPKTPQELQAHACLSYSYWSAGDHWPLQGPGGEVKVAVSSLLHANN
FT                   GDVLREAAIAGMGVILQPDFLLEDALADGRLVRILPEWEASPIGIFAVYTSRSHLAPKV
FT                   RSFIDHLVETGV"
FT   gene            515136..515546
FT                   /locus_tag="Smal_0431"
FT   CDS_pept        515136..515546
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0431"
FT                   /product="DoxX family protein"
FT                   /note="PFAM: DoxX family protein; KEGG: xac:XAC3707
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50136"
FT                   /db_xref="GOA:B4SID1"
FT                   /db_xref="InterPro:IPR032808"
FT                   /db_xref="UniProtKB/TrEMBL:B4SID1"
FT                   /protein_id="ACF50136.1"
FT                   /translation="MHTTTAPVSPLAPYGATLLRLALGVLFLVHALTKLLVFTPAGTAA
FT                   FFESLGLPGVLGYLTIGVELVITAALLLGIYARWVGLIGVPLLLGTIVTVHGANGFSFA
FT                   NAGGGWEYPAFWALALVVLFLVGDGKWTLRSR"
FT   gene            515578..516366
FT                   /locus_tag="Smal_0432"
FT   CDS_pept        515578..516366
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0432"
FT                   /product="Extradiol ring-cleavage dioxygenase class III
FT                   protein subunit B"
FT                   /note="PFAM: Extradiol ring-cleavage dioxygenase class III
FT                   protein subunit B; KEGG: xom:XOO_0607 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50137"
FT                   /db_xref="GOA:B4SID2"
FT                   /db_xref="InterPro:IPR004183"
FT                   /db_xref="InterPro:IPR014436"
FT                   /db_xref="UniProtKB/TrEMBL:B4SID2"
FT                   /protein_id="ACF50137.1"
FT                   /translation="MSRLPSLYISHGSPMTALHPGQVGVRLAELARDLPAPRAIVMASA
FT                   HWLGRQPLVGAHPQPPTIHDFGGFPRALFELQYPAPGDPALAEEVAGRIAAAGLPVALD
FT                   PQRGLDHGAWVPLRLLRPQADIPVVPVSIQPLLGPEHQFALGRALAPLREQGVLLVGSG
FT                   SITHNLHDWGDYQDGKEAPYVRPFIEWVEQRLAANDRQALLDYRRQAPFAERAHPTDEH
FT                   LLPLFFAMGAAGEGGFGARRIDAGIDAGFLAMDLYRFDGA"
FT   gene            516484..518133
FT                   /locus_tag="Smal_0433"
FT   CDS_pept        516484..518133
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0433"
FT                   /product="Na+/H+ antiporter"
FT                   /note="TIGRFAM: Na+/H+ antiporter; PFAM: sodium/hydrogen
FT                   exchanger; KEGG: xoo:XOO0675 Na+:H+ antiporter"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50138"
FT                   /db_xref="GOA:B4SID3"
FT                   /db_xref="InterPro:IPR004705"
FT                   /db_xref="InterPro:IPR004709"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR018422"
FT                   /db_xref="UniProtKB/TrEMBL:B4SID3"
FT                   /protein_id="ACF50138.1"
FT                   /translation="MHTIEVVLAMLVAVVASGYLVRVLPFSLPLPLVQIGLGAVIAGVF
FT                   NRGHALEPEVFFLLFLPPLLFLDGWRIPKQGLFRDKGAILELAFGLVVFTVIGAGLLIH
FT                   WMIPVMPLAVCFALAAIVSPTDPVAVGAIASKAPIPKRLMHILEGESLLNDASGLVCFR
FT                   FAVAAVMTGTFSLATASLTFLWVAVAGLAVGVAVTLGVSTFQRWLWRRFGEEPGAAMLV
FT                   NLLIPFAAYLLAEEINASGILAAVAAGISMSYVEMTGRVSGSMRVQRAGVWNMLQFSFN
FT                   GIMFVLLGEQLPGIVERATTTMNESGHQSAWWLLVYVLVINATLITLRLLWVWLSLRWN
FT                   LLRARRRGLERGEAPNWRIVVATSVAGVRGAITLAGVLTLPLFLPDGSPFPARDLVIFL
FT                   AAAVILFSLVGASVALPQLLKGLQLPADSGERKEEDLARRLSSKAALAGVERMRQQMVM
FT                   NQNTENVQLYNDAASRVSLLYQRHLEKDSDGPDVDPEKVQRMELGYRQLRSAGLNAERE
FT                   ELFRLTRRGVISDEISRRLIRNLDLLESRKRE"
FT   gene            complement(518201..518449)
FT                   /locus_tag="Smal_0434"
FT   CDS_pept        complement(518201..518449)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0434"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xcb:XC_3729 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50139"
FT                   /db_xref="InterPro:IPR021724"
FT                   /db_xref="UniProtKB/TrEMBL:B4SID4"
FT                   /protein_id="ACF50139.1"
FT                   /translation="MSDTPPDHLAINPASPFHDAQALERGVGVRFNDVERDNVEEYSVS
FT                   EGWIRVQAGKARDRRGNPMTIKVKGKVEAYFLETKPE"
FT   gene            518539..519081
FT                   /locus_tag="Smal_0435"
FT   CDS_pept        518539..519081
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0435"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xcb:XC_3728 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50140"
FT                   /db_xref="UniProtKB/TrEMBL:B4SID5"
FT                   /protein_id="ACF50140.1"
FT                   /translation="MPDNSDYFDFEEDVQDFDEADFEARVWNLLVLINPGDDEQALQQF
FT                   NRWREQLAEQGQPLEADSDWLPALFTAIAWQSGFEVERDDLDSLQSAVNELSARFNVQL
FT                   DWGGDLDDEDFAEELDGVQLMSTAFDRLREHNYTLWSVDAGSDGFTGVMALTRDDDAML
FT                   ALCSLLNVEIRLGSDPF"
FT   gene            complement(519163..519438)
FT                   /locus_tag="Smal_0436"
FT   CDS_pept        complement(519163..519438)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0436"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xom:XOO_0622 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50141"
FT                   /db_xref="InterPro:IPR025109"
FT                   /db_xref="UniProtKB/TrEMBL:B4SID6"
FT                   /protein_id="ACF50141.1"
FT                   /translation="MSVYVDDAVHPWRGQRWAHLMADTLTELHAMAAQLGIAPRAFQNK
FT                   ASGAHYDVTADLRAQAIALGARAISRHTDRALVKAVIATARAQYRP"
FT   gene            complement(519452..519964)
FT                   /locus_tag="Smal_0437"
FT   CDS_pept        complement(519452..519964)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0437"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xcv:XCV3816 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50142"
FT                   /db_xref="UniProtKB/TrEMBL:B4SID7"
FT                   /protein_id="ACF50142.1"
FT                   /translation="MSQNSKAKRDKRKKQQAKRPFLRLNAREQVQNHAVLLSEDGQAVA
FT                   AIGLQGREWLLAIGGQTMGNADNPVPMLAMLKHLSNMQEAEGRTVTLEYSELMQKLLDT
FT                   LAAEAGQTAEEYLDKLVAEFASEQAEDAAAEGEAAADDAAAETTGAEGAADAEATPAAD
FT                   ADGKPQA"
FT   gene            complement(520096..521052)
FT                   /locus_tag="Smal_0438"
FT   CDS_pept        complement(520096..521052)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0438"
FT                   /product="OmpA/MotB domain protein"
FT                   /note="PFAM: OmpA/MotB domain protein; KEGG: xom:XOO_0624
FT                   flagellar motor protein MotB"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50143"
FT                   /db_xref="GOA:B4SID8"
FT                   /db_xref="InterPro:IPR006664"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR025713"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="UniProtKB/TrEMBL:B4SID8"
FT                   /protein_id="ACF50143.1"
FT                   /translation="MAETKPTVIVRRVRKAGHAAHHGGSWKVAYADFVTAMMAFFLVLW
FT                   LMASTSKPERAAISEYFRNPSPLVGSSATPAPGMAGPGGASTSMIKLGGATDISRGSSN
FT                   DPFQNQKEAVPQPVDQQQRDKQQLEALMKELQEAISRSQALEPFKDQLLLDLTPEGLRI
FT                   QIVDKQNRPMFDLGSATLKPYTQQILHELAEYLNHVPNRISLTGHTDITAYSAARGYGN
FT                   WELSADRANAARRALIDGGLEDSKITRVVGLSSSVLFDKADPQNPINRRISIVVMTQAA
FT                   EQAALAGAGPQVGLSATTADPDVQAAQGEAATSAVTP"
FT   gene            complement(521056..521910)
FT                   /locus_tag="Smal_0439"
FT   CDS_pept        complement(521056..521910)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0439"
FT                   /product="flagellar motor protein MotA"
FT                   /note="KEGG: xom:XOO_0625 flagellar motor protein MotA"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50144"
FT                   /db_xref="GOA:B4SID9"
FT                   /db_xref="InterPro:IPR000540"
FT                   /db_xref="InterPro:IPR002898"
FT                   /db_xref="InterPro:IPR022522"
FT                   /db_xref="UniProtKB/TrEMBL:B4SID9"
FT                   /protein_id="ACF50144.1"
FT                   /translation="MLIIVGFLVVIISVLGGYLGAHGRLGALWQPYELVIIGGAALGAF
FT                   LVGTPAKTVKQTLQAMVGVFKGPRYKQQDYIDVLSLVYELLNKARREGFMALEDHVERP
FT                   AESALFGNYPKVQADHHLIDFITDCLRLMIGSNIEPHELEPLLELELEKHHAEAMAPSQ
FT                   VLTKVADGLPGFGIVAAVLGIVITMGSIGGDIVEVGGHVAGALVGTFLGILLGYGFVGP
FT                   MASAMEARAEQDSRIYESVKTALLACLRGYNPKIALEFARKTLPSNVRPAFSDFEQHLK
FT                   TVK"
FT   gene            complement(522002..522469)
FT                   /locus_tag="Smal_0440"
FT   CDS_pept        complement(522002..522469)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0440"
FT                   /product="methionine-R-sulfoxide reductase"
FT                   /EC_number="1.8.4.11"
FT                   /note="TIGRFAM: methionine-R-sulfoxide reductase; PFAM:
FT                   Methionine sulfoxide reductase B; KEGG: xom:XOO_0627
FT                   methionine sulfoxide reductase B"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50145"
FT                   /db_xref="GOA:B4SIE0"
FT                   /db_xref="InterPro:IPR002579"
FT                   /db_xref="InterPro:IPR011057"
FT                   /db_xref="InterPro:IPR028427"
FT                   /db_xref="UniProtKB/TrEMBL:B4SIE0"
FT                   /protein_id="ACF50145.1"
FT                   /translation="MTAFDLTPPTTTQTEALVAGLSSEERRVLLQHGTEAPFCGVFLDN
FT                   KREGVYCCRLCALPLFRSSTKFDSGTGWPSFFAPFDPAHVREIRDTSHGMVRTEITCAR
FT                   CGSHLGHVFPDGPPPTYERHCLNSVSLSFTGNGEPWPDPLQRGGAESGVAG"
FT   gene            522610..522978
FT                   /locus_tag="Smal_0441"
FT   CDS_pept        522610..522978
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0441"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xcb:XC_3721 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50146"
FT                   /db_xref="UniProtKB/TrEMBL:B4SIE1"
FT                   /protein_id="ACF50146.1"
FT                   /translation="MKPTLSLLLALLPTLALAQVPTGNPTATRSTTTVAPQPVVPPVQP
FT                   ARPQPQVLPSPQPAQPIKSTGPAQIAPVPAPKPSSKVYDRNGRIIPGVRPAGPNRVFDS
FT                   RTGRYYDSVPSGDGQQIR"
FT   sig_peptide     522610..522666
FT                   /locus_tag="Smal_0441"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 19"
FT   gene            523166..523318
FT                   /locus_tag="Smal_0442"
FT   CDS_pept        523166..523318
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0442"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ddi:DDBDRAFT_0204126 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50147"
FT                   /db_xref="UniProtKB/TrEMBL:B4SIE2"
FT                   /protein_id="ACF50147.1"
FT                   /translation="MKNQQNRHPGKEPQGRNPQQQQQQQQMDPQQPHKGGKQQEQRSQK
FT                   HPQQR"
FT   gene            complement(523436..523915)
FT                   /locus_tag="Smal_0443"
FT   CDS_pept        complement(523436..523915)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0443"
FT                   /product="transcriptional regulator, AsnC family"
FT                   /note="PFAM: regulatory protein AsnC/Lrp family; KEGG:
FT                   xcv:XCV3810 leucine-responsive regulatory protein, AsnC
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50148"
FT                   /db_xref="GOA:B4SIE3"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B4SIE3"
FT                   /protein_id="ACF50148.1"
FT                   /translation="MATRTRELDKIDRKILRILQAEGRISFTELGERVGLSTTPCTERV
FT                   RRLEREAVITGYHAHLDPAAVKASLLVFVEISLAYKSGDIFEEFRRAALKLPNVLECHL
FT                   VSGDFDYLLKARISEMASYRKLLGSTLLTLPHVRESKSYIVMEEVKETLSLPIPD"
FT   gene            524065..525369
FT                   /locus_tag="Smal_0444"
FT   CDS_pept        524065..525369
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0444"
FT                   /product="D-amino-acid dehydrogenase"
FT                   /EC_number="1.4.99.1"
FT                   /note="PFAM: FAD dependent oxidoreductase; KEGG:
FT                   pfl:PFL_6038 D-amino acid dehydrogenase small subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50149"
FT                   /db_xref="GOA:B4SIE4"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR023080"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4SIE4"
FT                   /protein_id="ACF50149.1"
FT                   /translation="MRVLVLGSGVIGTTSAWYLRQAGFEVTVIDRQPGPALETSFANAG
FT                   QLSFGYTSPWAAPGVPKKAIGWLFEKHAPLAIKPGMDLAQYRWLWQMLRNCTHERYAIN
FT                   KARMVRMSEYSRDCLNELRAQIGIEFEGRDLGTTQLFRTQQQLDASAQDIEILAQYGVP
FT                   YEVLDRAGIIQAEPALAHVDGLVGALRLPRDQTGDCQLFTRRLAQMCVDAGVEFRFDQD
FT                   ITGLVSDGERITGVHVNGTLETADRFVVALGSYSPALVAPLGMRLPVYPLKGYSLTLPI
FT                   TDPAMAPTSTILDESYKVAVTRFDDRIRVGGMAEVAGFDLSLSQRRRETLELVVSDLYP
FT                   KGGDLSRAQFWTGLRPATPDGTPVIGATPFRNLYLNTGHGTLGWTMACGSGRYLADLMS
FT                   ARQPQISTEGLDVFRYGQYGHAPQHENRTCVLPAR"
FT   gene            525348..526415
FT                   /locus_tag="Smal_0445"
FT   CDS_pept        525348..526415
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0445"
FT                   /product="alanine racemase"
FT                   /EC_number="5.1.1.1"
FT                   /note="KEGG: xcb:XC_3718 alanine racemase; TIGRFAM: alanine
FT                   racemase; PFAM: alanine racemase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50150"
FT                   /db_xref="GOA:B4SIE5"
FT                   /db_xref="InterPro:IPR000821"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR011079"
FT                   /db_xref="InterPro:IPR020622"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:B4SIE5"
FT                   /protein_id="ACF50150.1"
FT                   /translation="MRPARALIDLGALRSNYRLARELGGGKALAIIKADAYGHGAVRCA
FT                   QALEGEADGFGVATIEEALELRQAGIGAPILLLEGIFEASDMALVAEHDFWFAVGSPWQ
FT                   LEALAAFDSPRPLTVWLKLDSGMHRLGLDVDSFRAAHARLSALPQVERVVLMTHLARAD
FT                   ELDSERTHEQAATFARAIDGLEGETSVCNSPALLGWPDVRSDWVRPGLMLYGANPLPDN
FT                   TDLTARLRPVMTMQSKVIAERWIESGEPVGYGARFVSKARTRVGVVALGYADGYPQFAP
FT                   NGTPVLIDGQPGALIGRVSMDMLTVDLTAHPQAGVGSVVELWGNAPTLSELAPRCGVSA
FT                   YQLPCGVKRVARVYM"
FT   gene            complement(526518..527081)
FT                   /locus_tag="Smal_0446"
FT   CDS_pept        complement(526518..527081)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0446"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xac:XAC3686 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50151"
FT                   /db_xref="InterPro:IPR021557"
FT                   /db_xref="UniProtKB/TrEMBL:B4SIE6"
FT                   /protein_id="ACF50151.1"
FT                   /translation="MKRSLAIALLAGALVAGGANAAPRTVTDAQAPRTLQADGPVNVKW
FT                   DDPAKFTEIRQSSNRFEAERGDWVQQLARYLQTTAAKPLQPGQTLDVTLVDVKRAGDYE
FT                   PWHGPRGRDIRIMRDIYPPRISLQYTLKDASGRIISEGDARLSDTGYLHNVGLKSDSDP
FT                   LRYEKRLIDDWVKRQLTSQATAAR"
FT   sig_peptide     complement(527016..527081)
FT                   /locus_tag="Smal_0446"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 22"
FT   gene            527326..529314
FT                   /locus_tag="Smal_0447"
FT   CDS_pept        527326..529314
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0447"
FT                   /product="PAS/PAC sensor hybrid histidine kinase"
FT                   /EC_number="2.7.13.3"
FT                   /note="KEGG: xcv:XCV3804 two-component system sensor
FT                   histidine kinase-response regulator hybrid protein;
FT                   TIGRFAM: PAS sensor protein; PFAM: response regulator
FT                   receiver; ATP-binding region ATPase domain protein;
FT                   histidine kinase A domain protein; PAS fold-3 domain
FT                   protein; PAS fold-4 domain protein; PAS fold domain
FT                   protein; SMART: PAS domain containing protein; PAC
FT                   repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50152"
FT                   /db_xref="GOA:B4SIE7"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B4SIE7"
FT                   /protein_id="ACF50152.1"
FT                   /translation="MMVPAPEPDLHHGVLERINAGFCVIQVLFDGDRAVDYRFIEVNDA
FT                   FERHTGLKDARGQRMSALEPHHEEDWFRIYGEVARSGRPAQFEMEARALGRSFAVDAVR
FT                   VGRPGEDKVGILFFDITARKQMEVELGESEARFSALADGLPMPVWVLDERGHARFVNSA
FT                   FSEFFGGDETRVPEDVWRGLVHPDDASVFEYELQEALKAQRSMHALVRARRADGQWRWL
FT                   EMNARPRFSRMGRFIGLAGSSPDVTERREIELAREELLQSERAARSAAENMARLKDEFL
FT                   ATLSHELRTPLTTILGWSELLLQRVDNTSPLYKGLGVIANSAGAQKRLISDMLDLSSML
FT                   LGKVQLEVEVLDLCGVLGEAIGAQELVAEGKALDVHLQLPDRPSLVLGDATRLQQVFWN
FT                   LLSNAIKFTPAEGRIDVALQADGNHWVITVRDTGDGIAPEFLNHLFSRFRQADGTTTRR
FT                   HGGLGLGLAIVQQLVELHGGTVTAASEGHGHGATFTVRLPQHLPDAERRPLREVISGPI
FT                   LEPVIVEPYPLRGMHVLAVEDQPEVLEYLRRMLEEQGASVSAASSAGEALALLADTGHL
FT                   QYHVMLTDIGMPGMDGYGLVRTLREDMGVDALTLPAVAVTALARADDRRRALASGFQEH
FT                   VAKPYSVAQLVSAVRKVQVPRADSALH"
FT   gene            529358..529651
FT                   /locus_tag="Smal_0448"
FT   CDS_pept        529358..529651
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0448"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xcb:XC_3713 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50153"
FT                   /db_xref="InterPro:IPR021649"
FT                   /db_xref="UniProtKB/TrEMBL:B4SIE8"
FT                   /protein_id="ACF50153.1"
FT                   /translation="MSRIAPRIHTDPAQIARLEALLPQLEGETQVELTLQDGRRLLGTI
FT                   AVKPTVQQYRNDAGDEGSNGQLRLDDYDTPVQQHHVWLDEIASIRRLPPKAP"
FT   gene            complement(529737..530000)
FT                   /locus_tag="Smal_0449"
FT   CDS_pept        complement(529737..530000)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0449"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xcb:XC_3711 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50154"
FT                   /db_xref="UniProtKB/TrEMBL:B4SIE9"
FT                   /protein_id="ACF50154.1"
FT                   /translation="MRALFVGGVVDNSEMDLEGSHPPVHYPEDTGGGHSRYRLHQVGHG
FT                   ADGSVAYAVYGAPDLADDEVARVAEERAYARRFEATPTLFEH"
FT   gene            530159..531229
FT                   /locus_tag="Smal_0450"
FT   CDS_pept        530159..531229
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0450"
FT                   /product="methyltransferase small"
FT                   /note="PFAM: methyltransferase small; Methyltransferase
FT                   type 12; KEGG: xac:XAC3679 ribosomal RNA small subunit
FT                   methyltransferase C"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50155"
FT                   /db_xref="GOA:B4SIF0"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR007848"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B4SIF0"
FT                   /protein_id="ACF50155.1"
FT                   /translation="MASSDDAPLQTLLLPFSQGALRWPEGPVAFLRARDGWPLREVAGG
FT                   REVHCEQSFAPFAQPLQQAAGWTVSGQLDDEAGKGRYPLVLVLPPRQREEARALFARAL
FT                   ALVAEGGRIVACQSNNEGARSGEGDLKQLTGLGGSLTKNHCRAYWTAPMQGQHDADLAK
FT                   RWSALDAVRPIVGGRFLSRPGVFAWDRIDPASALLAEHLPADLAGRAADLGAGYGYLSR
FT                   ELLERCPEITALDLYEAEQRALALAELNLSPPPRPLPLRFLWRDVTAGIEPDYDVIISN
FT                   PPFHTPSRADRPDIGQRFIAVAAQALRPGGRLYVVANRHLPYEYTLNESFGAVRVVAER
FT                   DGFKLVEAVKGRGKGK"
FT   gene            531226..531927
FT                   /locus_tag="Smal_0451"
FT   CDS_pept        531226..531927
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0451"
FT                   /product="pseudouridine synthase"
FT                   /note="PFAM: pseudouridine synthase; KEGG: xcb:XC_3709
FT                   ribosomal small subunit pseudouridylate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50156"
FT                   /db_xref="GOA:B4SIF1"
FT                   /db_xref="InterPro:IPR000748"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR018496"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="InterPro:IPR042092"
FT                   /db_xref="UniProtKB/TrEMBL:B4SIF1"
FT                   /protein_id="ACF50156.1"
FT                   /translation="MKLVKLIANLGYGSRKQVQWMFREGRVTDADGEVLYADDQVPHEA
FT                   VRVDGEPLDPPVGLSIALHKPAGYTCSTKDKGRLIYDLLPPRYRDRDPVLSTVGRLDRD
FT                   TSGLLLLTDDGGLLHRIISPKSKLPKVYEVELSDDLRGDEVALFASGTLMLESEKTPLL
FT                   PAELEVLDARRARLVLHEGRYHQVRRMFAATGNHVQALHRSRVGGLDLQGLDEGQWRQL
FT                   TPTDLDTLFAP"
FT   gene            531924..532607
FT                   /locus_tag="Smal_0452"
FT   CDS_pept        531924..532607
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0452"
FT                   /product="HAD-superfamily hydrolase, subfamily IA, variant
FT                   3"
FT                   /note="TIGRFAM: HAD-superfamily hydrolase, subfamily IA,
FT                   variant 3; PFAM: Haloacid dehalogenase domain protein
FT                   hydrolase; KEGG: xcb:XC_3708 hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50157"
FT                   /db_xref="GOA:B4SIF2"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:B4SIF2"
FT                   /protein_id="ACF50157.1"
FT                   /translation="MTTIAALPFLPDAIIFDMDGLMIDSERVSLACWSQAADEFGLGLD
FT                   ETVFLRMVGLGDRDTHALLRVQGVEDSVIEAVAARCHDLYEERTQTGLPLRPGILELLE
FT                   LLKAHAIPRAVATTTRQPRANRKLSAAGLLPYFDAVITSGDVARPKPAPDIYLLAAQRL
FT                   GQVPERCLALEDSPAGTRAALAAGMTVIQVPDLVHPDEELRAFGHRIVGSLLDAHALLV
FT                   PLLPK"
FT   gene            complement(532735..533943)
FT                   /locus_tag="Smal_0453"
FT   CDS_pept        complement(532735..533943)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0453"
FT                   /product="Beta-ketoacyl synthase"
FT                   /note="PFAM: Beta-ketoacyl synthase; KEGG: xcb:XC_3652
FT                   beta-ketoacyl-[ACP] synthase I"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50158"
FT                   /db_xref="GOA:B4SIF3"
FT                   /db_xref="InterPro:IPR000794"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR018201"
FT                   /db_xref="InterPro:IPR020841"
FT                   /db_xref="UniProtKB/TrEMBL:B4SIF3"
FT                   /protein_id="ACF50158.1"
FT                   /translation="MRRVVITGMGITSCLGNDLDTVSNALREGRSGITALSDHADAGLR
FT                   SQVGGRVDLDLDALIDRKQKRFMSDAAAFAYLSMRDAIADAGLSPEQVSNLRTGLIAGS
FT                   GGGSSEWQIGAVDLLRERGVRKVGPYMVPRTMCSTVSACLATAYQIKGVSYSLSAACAT
FT                   SAHCIGAAADMIRHGAQDIMFAGGGEDLHWSMSVMFDAMGALSTSFNETPASASRPYDK
FT                   DRDGFVIAGGGGMLVLEDYDHAVARGAHIHAELIGYGVTSDGADMVAPSGEGAVRCMKM
FT                   ALQGVDRPLDYLNTHGTSTPLGDVTELNAIREVFGDAVPPLSSTKALSGHSLGAASVHE
FT                   AIYCLLMMRDGFVAGSANIGELDPKVESFPILRESREQTLDTVMSNSFGFGGTNAALVF
FT                   GRV"
FT   gene            complement(533943..534458)
FT                   /locus_tag="Smal_0454"
FT   CDS_pept        complement(533943..534458)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0454"
FT                   /product="beta-hydroxyacyl-(acyl-carrier-protein)
FT                   dehydratase FabA"
FT                   /EC_number="4.2.1.59"
FT                   /note="KEGG: xcb:XC_3651 3-hydroxydecanoyl-(acyl carrier
FT                   protein) dehydratase; TIGRFAM:
FT                   beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabA;
FT                   PFAM: Beta-hydroxyacyl-(acyl-carrier-protein) dehydratase
FT                   FabA/FabZ"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50159"
FT                   /db_xref="GOA:B4SIF4"
FT                   /db_xref="InterPro:IPR010083"
FT                   /db_xref="InterPro:IPR013114"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4SIF4"
FT                   /protein_id="ACF50159.1"
FT                   /translation="MTRLHAFNREQLLASARGELFGAAAGRLPNDPMLMFDRITEIRED
FT                   GGPHGKGMVRAELDIRPDLWFFGCHFIGDPVMPGCLGLDAMWQLTGFFLTWLGAPGKGR
FT                   ALGCGEVKFTGQVLPDAKLVRYEIDISRVINRKLVMAQSDARMYVDDREIYSARDLRVG
FT                   LFTETGSF"
FT   gene            534649..535719
FT                   /locus_tag="Smal_0455"
FT   CDS_pept        534649..535719
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0455"
FT                   /product="DNA-directed DNA polymerase"
FT                   /EC_number="2.7.7.7"
FT                   /note="PFAM: UMUC domain protein DNA-repair protein; KEGG:
FT                   xcb:XC_3650 DNA polymerase IV"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50160"
FT                   /db_xref="GOA:B4SIF5"
FT                   /db_xref="InterPro:IPR001126"
FT                   /db_xref="InterPro:IPR017961"
FT                   /db_xref="InterPro:IPR022880"
FT                   /db_xref="InterPro:IPR024728"
FT                   /db_xref="InterPro:IPR036775"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4SIF5"
FT                   /protein_id="ACF50160.1"
FT                   /translation="MTRLRKIIHVDMDAFYASVEQRDDPSLRGKPVVVAWRGARSVVCA
FT                   ASYEARVFGVRSAMPAVRAERLCPDAIFVPPDFARYKAVSQQVREIFLRHTDLVEPLSL
FT                   DEAYLDVTEPKSGMELATDIARTIRAQIREETQLTASAGIAPNKFLAKIASDWRKPDGQ
FT                   FVIPPQRVDAFLLPLPVNRVPGVGKVMEGKLAARGIVTCGDLRQWALIDLEEAFGSFGR
FT                   SLYNRARGVDERPVEPDQQVQSISSEDTFAEDLPLEDLGEAIVQLAEKTWNATRKTERV
FT                   GHTVVLKLKTAQFRILTRSFTPERPPESMEELRDIALALRARVDLPADTRYRLVGVGLS
FT                   GFRDKEPVVQGELFEH"
FT   gene            complement(535982..536893)
FT                   /locus_tag="Smal_0456"
FT   CDS_pept        complement(535982..536893)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0456"
FT                   /product="beta-lactamase domain protein"
FT                   /note="PFAM: beta-lactamase domain protein; KEGG:
FT                   pfo:PflO1_4474 beta-lactamase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50161"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:B4SIF6"
FT                   /protein_id="ACF50161.1"
FT                   /translation="MRTAALLLPLALAATFTSAPLLAAPATAAPATVTKSQLHLQTFHP
FT                   GPQAMFSVSSVLVEGRHDAILVNAQFGASDARKLVDLIRASGKQLTTIYISHGDPDYYF
FT                   GLATLQDAFPQARIVATAQTVAHIQQTQAGKLAYWGPKMGADVPARIVVPQVLDGDALQ
FT                   LEGQRLPLIGLDGPSPDRTVLWVPTLRAIVGGIPVVAGEHVWMADTQTPKSHADWLQTL
FT                   QRLQALKPKVVVPGHYAPGAALDASALRFTADYIRAFDVEAAKAKDSAALVKAMQSRYP
FT                   KLAGVASLELSAKVAKGEMQWP"
FT   sig_peptide     complement(536822..536893)
FT                   /locus_tag="Smal_0456"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.744 at
FT                   residue 24"
FT   gene            complement(536979..537617)
FT                   /locus_tag="Smal_0457"
FT   CDS_pept        complement(536979..537617)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0457"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase; KEGG:
FT                   bte:BTH_I2861 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50162"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B4SIF7"
FT                   /protein_id="ACF50162.1"
FT                   /translation="MKIALVGSTGNIGRQIARHALARGHELTVIVRSAQDLPAELAGAH
FT                   PVIASLDDPDALVAAIAGHDVLASAYGPRPGDDIGRVGEVAAQLAAAARKAGVPRLVVV
FT                   GGAGSLEVAPGVQLVDTPTFPEAYKPYALAHREAFNRLQAVDDLDWTFFSPAAEIGPGE
FT                   ERGQYRVQPKAFLADASGHSRISYADYGAAFVAELEAHRYPKQIITAAY"
FT   gene            537726..538655
FT                   /locus_tag="Smal_0458"
FT   CDS_pept        537726..538655
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0458"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: bbr:BB3251 probable LysR-family
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50163"
FT                   /db_xref="GOA:B4SIF8"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B4SIF8"
FT                   /protein_id="ACF50163.1"
FT                   /translation="MDRLTAMTVFVEVAERGSLTAAAEVLDMSRAMVSRYLAEVEGWLG
FT                   ARLLHRTTRRVSLTGPGEAALARFRQMLAIGEELRGELASDDPEPHGTLRVTASVSFGQ
FT                   SHLARAVAGFVARHPAARIELLLVDRTVNLVEERVDLAVRIARQIDPSLIARRLATCRS
FT                   VLCATPSYLQARGTPTAPEHLAAHNCLTHHYVGKSLWQLHREGRSLSVAVGGNISANEA
FT                   SLLLEAVRAGAGIAMLPTYQVAPFLRSGELIELLPEFSLDELGIHAVYASRRQQPAIMR
FT                   RFLDFLAECFASPAFQDLDWRPPGKENT"
FT   gene            538652..539443
FT                   /locus_tag="Smal_0459"
FT   CDS_pept        538652..539443
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0459"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: Methyltransferase type 11; Methyltransferase
FT                   type 12; KEGG: dac:Daci_4070 methyltransferase type 11"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50164"
FT                   /db_xref="GOA:B4SIF9"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B4SIF9"
FT                   /protein_id="ACF50164.1"
FT                   /translation="MNHGQALIDHNRAAWDRQASEVREWSRPVESSTIAAAREGRWQVH
FT                   LTPRALPLDWMGDVRGRRILCLASGGGQQAPVLAAAGADVTVFDLSDGQLEQDRAVAAR
FT                   DGLQLRTVQGDMRDLHVFANDSFDVVFHPISNLYVPDVRPVWTECRRVLARDGMLMASF
FT                   YNPVLFVGARDPQLDAQGLIRPQYAIPYSDLEDLPPAEREAKLARGDALTFGHSLTELI
FT                   GGQLDAGFIIDRFMEDWQPQPRFLIDRYLPTFLATRARRIG"
FT   gene            539475..540164
FT                   /locus_tag="Smal_0460"
FT   CDS_pept        539475..540164
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0460"
FT                   /product="phosphoglycolate phosphatase"
FT                   /note="TIGRFAM: phosphoglycolate phosphatase;
FT                   HAD-superfamily hydrolase, subfamily IA, variant 3;
FT                   HAD-superfamily hydrolase, subfamily IA, variant 1; PFAM:
FT                   Haloacid dehalogenase domain protein hydrolase; KEGG:
FT                   xcc:XCC0584 phosphoglycolate phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50165"
FT                   /db_xref="GOA:B4SIG0"
FT                   /db_xref="InterPro:IPR006346"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR037512"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:B4SIG0"
FT                   /protein_id="ACF50165.1"
FT                   /translation="MDGPTSCRCRPLSYPYPLVVFDLDGTLVDSAADIAEALNRTLEDI
FT                   GVARVPETTVLGWIGDGVRRLVEQAVHAAGREVDLAEVMPVFMVHYRECLLRSPRLFDG
FT                   VAEALARLRARNVPLAICTNKPEALVPPLLQHLGIGDAFALVLGGDSLPQRKPSGEPLR
FT                   HMAAHFGLPVEACLMVGDSLTDYRAAEDAGMPIALVRYGYPRGLDLATAHAVAVIDDLR
FT                   ELPGLKG"
FT   gene            complement(540306..542147)
FT                   /locus_tag="Smal_0461"
FT   CDS_pept        complement(540306..542147)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0461"
FT                   /product="TonB-dependent vitamin B12 receptor"
FT                   /note="TIGRFAM: TonB-dependent vitamin B12 receptor; PFAM:
FT                   TonB-dependent receptor; TonB-dependent receptor plug;
FT                   KEGG: xcb:XC_1091 outer membrane receptor for transport of
FT                   vitamin B"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50166"
FT                   /db_xref="GOA:B4SIG1"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010101"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039426"
FT                   /db_xref="UniProtKB/TrEMBL:B4SIG1"
FT                   /protein_id="ACF50166.1"
FT                   /translation="MKLQSRMLSLAVLAALPALAQAADDTTALDQILVTATRTPIALQY
FT                   SIAPAQVIDRAQIESSQATSLQELLRGRAGINLTNAGGLGKQSSLFLRGTNSGHTVVLV
FT                   DGVRINSADLGLAMYQDLPLAQIERVEIVRGPQSSLYGADAIGGVIQIFTRRNQGDFAP
FT                   HFQLGGGSNGLREASGGIGGGTERGWFGADIAYQHSDGIDACRGSATLFAGCFADEPDR
FT                   DGYRNLSKSLRGGYSFNDQWNVEGSALRADGKNHYDGYYNYSETRQQVLAGKVRYTPSE
FT                   RLAFTANVGRSDNESDNFGAPGVFGSAQTHRDSASLQGDITLAEGQLLSTGVDWSEDNL
FT                   DGSSAGYLVDSRRNTGVFVQYQGRFGRHQLQVSARNDDNQQFGNHATGSVGWAMELEHG
FT                   LRVNASYGTAFKAPTFSDLYDPWSGVPTLNPEKSKSANLGVSQHGKGWHWGLDVYETRI
FT                   DDLITYDASTMKMQQVEKARIRGAELTGGVLLAGFDINAQLSYTDPRNRTHGSTQFDNW
FT                   LPRRAQQTARLDIDRRFGDFRAGLTVQGAGKRYDDAANAVKVGGYGTLDLRAEYALTPE
FT                   WSLLARAANVFDRRYETVAWFNQPGREYQLSVRYQPK"
FT   sig_peptide     complement(542079..542147)
FT                   /locus_tag="Smal_0461"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.976 at
FT                   residue 23"
FT   misc_binding    complement(542264..542487)
FT                   /bound_moiety="adenosylcobalamin"
FT                   /note="Cobalamin riboswitch as predicted by Rfam (RF00174),
FT                   score 98.55"
FT   gene            542619..543197
FT                   /locus_tag="Smal_0462"
FT   CDS_pept        542619..543197
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0462"
FT                   /product="Phosphoglycerate mutase"
FT                   /note="PFAM: Phosphoglycerate mutase; KEGG: bbt:BBta_3134
FT                   putative alpha-ribazole phosphatase (anaerobic pathway of
FT                   cobalamin biosynthesis, CobC)"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50167"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:B4SIG2"
FT                   /protein_id="ACF50167.1"
FT                   /translation="MILDLVRHAGNGRDEFLDGRSDPPQLARLPQELVEAYAAHPWERV
FT                   ISSPRLRSLHTAMALATPRGLDVDADEEWEELDFGDWDGQSLFDLPEDALAAFHADPHA
FT                   FPPPNGESWGHFERRIARALDRLLDDDDPVPTLVVSHGGPLRMVLSQVCGLPMSLCWAL
FT                   RIDHGTRLRVWLERGEVGLVGELLELQQP"
FT   gene            complement(543282..543644)
FT                   /locus_tag="Smal_0463"
FT   CDS_pept        complement(543282..543644)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0463"
FT                   /product="TfoX domain protein"
FT                   /note="PFAM: TfoX domain protein; KEGG: xcb:XC_3648
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50168"
FT                   /db_xref="InterPro:IPR007077"
FT                   /db_xref="UniProtKB/TrEMBL:B4SIG3"
FT                   /protein_id="ACF50168.1"
FT                   /translation="MSAPKLRNIGPKSAAWLRQVGLRSREDLVAIGAVGAFVKVKRAGF
FT                   KPSLNLLYSLEGALLDCHWQELSEPQRDALVQDYEARIAAHPLKAAGPASGPVHEQRFD
FT                   TDDDAEDSVAESADED"
FT   gene            complement(543641..544123)
FT                   /locus_tag="Smal_0464"
FT   CDS_pept        complement(543641..544123)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0464"
FT                   /product="putative GAF sensor protein"
FT                   /note="PFAM: GAF domain protein; KEGG: xom:XOO_0696
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50169"
FT                   /db_xref="InterPro:IPR000614"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="UniProtKB/TrEMBL:B4SIG4"
FT                   /protein_id="ACF50169.1"
FT                   /translation="MFANASLTGSKPEQYAQLLEQARGLVYAESDRIANAANLSALVYH
FT                   ALPDLNWVGFYLYDGKELVVGPFQGLPACVRIPLDKGVCGAAASQRVTQRVDDVDAFPG
FT                   HIACDSASRSELVVPLLRGDELIGVFDIDSPKVGRFDADDQAGLEAIARVFVEALG"
FT   gene            544192..544884
FT                   /locus_tag="Smal_0465"
FT   CDS_pept        544192..544884
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0465"
FT                   /product="dethiobiotin synthase"
FT                   /EC_number="6.3.3.3"
FT                   /note="TIGRFAM: dethiobiotin synthase; KEGG: xcv:XCV3736
FT                   dithiobiotin synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50170"
FT                   /db_xref="GOA:B4SIG5"
FT                   /db_xref="InterPro:IPR004472"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B4SIG5"
FT                   /protein_id="ACF50170.1"
FT                   /translation="MPLPATLPPALFVTGTDTEIGKTAASTALLHALRRRGLRAVGMKP
FT                   VASGSEDLGQGLRNEDALALQAASWPVPDYADLNPYALRQPLAPELAAAEDGVQVELAP
FT                   IVAAFERLRAQADIVVVEGVGGWLAPVSATLDQLDLVRALHLPVVLVVGMRLGCVNHAR
FT                   LTAQSLQASGVECLGWIGNHIDPAMQRQEENIATLQQRLSMPCWGRLPHLPGANGEALS
FT                   ANLHADLR"
FT   gene            complement(544961..546403)
FT                   /locus_tag="Smal_0466"
FT   CDS_pept        complement(544961..546403)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0466"
FT                   /product="transcriptional regulator, GntR family with
FT                   aminotransferase domain"
FT                   /note="PFAM: regulatory protein GntR HTH; aminotransferase
FT                   class I and II; KEGG: cvi:CV_1900 probable transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50171"
FT                   /db_xref="GOA:B4SIG6"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B4SIG6"
FT                   /protein_id="ACF50171.1"
FT                   /translation="MDTDDQSAMIPPRYQRLSDELAEAIHGGRLPVGSRLPSLRQMASQ
FT                   RRLSLNTVIAAYRQLEDAGLVIPRPKAGFEVAPRLSVPQRSLRDTPSAPTAPLQQVLMA
FT                   RVLEAQRRAGVIDLAFAGPRGRQFYPGAQLARHTAQVLRHGQQTVETYARPNGSPRLLA
FT                   QIVRRGPRMGLHTHSERLLLTHGAMEALQLALRAVTQPGDAVGIEAPSYFNLYPLLANL
FT                   GLQAIELPTHPQHGLDVDALEAMLEHTSLAALVVMPTVHNPLGCTMPTPAKQRLAELVN
FT                   ARQLPLIEDAVYAELQFCEPPAPLLKAFDRDGWVMVVGGFSKTLAPDYRIGWLDGGRFA
FT                   ERIALLKFQSTGGEPQLLGDAVAAYLEAGSYEHHLHRMRRLYREQVGRLRQLVAEHFPA
FT                   GTRATEPQGGFLLWLELPGVDTRELFERALVEDIVFMPGQVYSRGARYRHCLRLSCCQT
FT                   LDARFIGAVERLGAIAKELASR"
FT   gene            complement(546609..547346)
FT                   /locus_tag="Smal_0467"
FT   CDS_pept        complement(546609..547346)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0467"
FT                   /product="peptide methionine sulfoxide reductase"
FT                   /EC_number="1.8.4.11"
FT                   /note="TIGRFAM: peptide methionine sulfoxide reductase;
FT                   PFAM: Methionine sulfoxide reductase A; KEGG: dac:Daci_3068
FT                   peptide methionine sulfoxide reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50172"
FT                   /db_xref="GOA:B4SIG7"
FT                   /db_xref="InterPro:IPR002569"
FT                   /db_xref="InterPro:IPR036509"
FT                   /db_xref="UniProtKB/TrEMBL:B4SIG7"
FT                   /protein_id="ACF50172.1"
FT                   /translation="MKLSFEQGIAAGVAGLVATALIAGVLLVDHGAVAAPLEASAQAKA
FT                   LPAPSGDAAFRDDATHASVVFAGGCFWGVQGVFQHVKGVSNAVSGYIGGSAANARYERV
FT                   SSGQTGHAEAVKIDYDPRQVSYGQLMQVFFSVVHDPTQLNRQGPDQGSQYRSAIFSDDA
FT                   RQQAASRAYIAQLGQAGSYRAPIVTQLGSGQRFYPAESYHQNYMTNYPQAAYIRYYDAP
FT                   KLAALGKQFPALYRREAVLVPMR"
FT   sig_peptide     complement(547275..547346)
FT                   /locus_tag="Smal_0467"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.912) with cleavage site probability 0.505 at
FT                   residue 24"
FT   gene            complement(547361..549130)
FT                   /locus_tag="Smal_0468"
FT   CDS_pept        complement(547361..549130)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0468"
FT                   /product="cytochrome c biogenesis protein transmembrane
FT                   region"
FT                   /note="PFAM: alkyl hydroperoxide reductase/ Thiol specific
FT                   antioxidant/ Mal allergen; cytochrome c biogenesis protein
FT                   transmembrane region; Redoxin domain protein; KEGG:
FT                   rme:Rmet_1170 cytochrome c biogenesis protein,
FT                   transmembrane region"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50173"
FT                   /db_xref="GOA:B4SIG8"
FT                   /db_xref="InterPro:IPR003834"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR013740"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR041017"
FT                   /db_xref="UniProtKB/TrEMBL:B4SIG8"
FT                   /protein_id="ACF50173.1"
FT                   /translation="MLLLLLAYLGGALTLLSPCILPVLPFVFARADRPFLRSTLPLLLG
FT                   MALTFTVVASLAAVGSQWVAQANQVGRWIALLLMALFAVALLWPRLADHLLAPFQRVGA
FT                   RLSARADAADAAGRGGAWTSLLIGVATGLLWAPCAGPILGLVLTGAALHGASVGTSSLL
FT                   LAYALGAITALALAVWVGGRVFRALQARLGLGDVLRKVLGVAALLAVVAIGLGWDTGLL
FT                   TRLSTVSTARIEQNLLDAVPGAQPAAPPMMMMAGANAGADAPLPVEGTLPALDGATGWL
FT                   NSPPLSAQQLRGKVVLVDFWTYSCINCLRAMPFVHEWERRYRDHGLVVIGVHTPEFAFE
FT                   RNPSNVMKAVQELKVEYPVALDNQYTIWRAFNNRYWPAQYFVDAQGNIRGHQFGEGNYA
FT                   RSEQVIRRLLTEAGQTNLPPPADPAAADLKGVAVQADMSNLRSPETYLGHARAEQFASP
FT                   GGQRSDSPFDYTLPTTLALNQWGLSGRWTVTDEAAQLQQAGGRIAFQFHARDLHLVLAP
FT                   SQDGTPVRFRVWLDGKPLTAADAGSDVGADGSGVVNEHRLYQLVRQRGTVGPHRFEIEF
FT                   LDTGVQAYAFTFG"
FT   sig_peptide     complement(549035..549130)
FT                   /locus_tag="Smal_0468"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.755) with cleavage site probability 0.385 at
FT                   residue 32"
FT   gene            complement(549133..549705)
FT                   /locus_tag="Smal_0469"
FT   CDS_pept        complement(549133..549705)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0469"
FT                   /product="methionine-R-sulfoxide reductase"
FT                   /EC_number="1.8.4.11"
FT                   /note="TIGRFAM: methionine-R-sulfoxide reductase; PFAM:
FT                   Methionine sulfoxide reductase B; KEGG: nha:Nham_1330
FT                   methionine sulfoxide reductase B"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50174"
FT                   /db_xref="GOA:B4SIG9"
FT                   /db_xref="InterPro:IPR002579"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR011057"
FT                   /db_xref="UniProtKB/TrEMBL:B4SIG9"
FT                   /protein_id="ACF50174.1"
FT                   /translation="MSLSRRHLLGLGGVATAAGLLGLGACSRAAPAAAEARPSRQFEVM
FT                   RSDAQWRQQLTPAQYAVLRQQATERPYSSPLNKEHRQGTFACAGCALPLFSSSTKFESG
FT                   TGWPSFWAPLHNAIGEDRDVTFGMLRVEVHCRRCGGHLGHVFNDGPRPTGLRYCMNGAA
FT                   MVFVPGAPAGTADGWRVPVGSSPASGA"
FT   sig_peptide     complement(549601..549705)
FT                   /locus_tag="Smal_0469"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.490 at
FT                   residue 35"
FT   gene            549850..550569
FT                   /locus_tag="Smal_0470"
FT   CDS_pept        549850..550569
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0470"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein; KEGG: bpt:Bpet2466 two-component
FT                   response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50175"
FT                   /db_xref="GOA:B4SIH0"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:B4SIH0"
FT                   /protein_id="ACF50175.1"
FT                   /translation="MSTKRVLIVEDDAHIADLLRMHLGDEGYDVAHAASGDGGLRLLEQ
FT                   DGPWDALVLDVMLPGVDGLQVCQRARAMARYVPIIIISARGSETQRIVGLELGADDYLA
FT                   KPFSMPELVARVRALLRRAEAMAQSARIDAGAIELGGLQLDPVARTASVDGNALELTPR
FT                   EFDLLLFFARHPDQVFARMELLNQVWGYQHDGYEHTVNTHINRLRSKIEPDPANPRRLL
FT                   TVWGRGYKLVDPAGAAA"
FT   gene            550566..552035
FT                   /locus_tag="Smal_0471"
FT   CDS_pept        550566..552035
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0471"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase HAMP region domain protein; histidine
FT                   kinase A domain protein; KEGG: bac:BamMC406_5549 integral
FT                   membrane sensor signal transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50176"
FT                   /db_xref="GOA:B4SIH1"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B4SIH1"
FT                   /protein_id="ACF50176.1"
FT                   /translation="MIKPNLWQKLAAVIAALMLMCCMALLALQMRANTRHEQEVVQRLS
FT                   LGLAEHIAQRSELMDTSGMRDAAVRALFGQLMAVNPSVEVYLLDDQGRILGHDAPSGHL
FT                   VRNKVDVAPLRRLLSGAPLPILGDDPRSADGRKVFSAAPLIVQGRQAGYVYVVLVGEHR
FT                   QMLADDLAAGSQWNTTWWSVMLVGSLGLLAGLVAFYWVTRPLRRLTRRIQAFDIDAPTP
FT                   LPPPEPLRPGERDELVILEHAHAQMAQRLGEQWQQLRQQDLQRRELVANISHDLRTPLS
FT                   SLHGYLETLALKDVTLSPDERRRYLGIALAQSAKVGRLARALFELARLEHGEVRLEWEV
FT                   FALPELLQDVLQKFELAAQARNQRLHAEFPPGLPLVRADLGLVERVLTNLLDNALRHAP
FT                   EGGRIEVCLRATADSIEVSVADDGPGVAAALRAQLFQAPAALGARRGENGGLGLLIVQR
FT                   IVQLHGRRIELRDSERGALFVFALPRAEPAA"
FT   sig_peptide     550566..550649
FT                   /locus_tag="Smal_0471"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.707 at
FT                   residue 28"
FT   gene            complement(552032..553378)
FT                   /locus_tag="Smal_0472"
FT   CDS_pept        complement(552032..553378)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0472"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase HAMP region domain protein; histidine
FT                   kinase A domain protein; KEGG: cvi:CV_0760 probable
FT                   two-component sensor protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50177"
FT                   /db_xref="GOA:B4SIH2"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B4SIH2"
FT                   /protein_id="ACF50177.1"
FT                   /translation="MKRTPSAMRGHAFHFLRYGIGFLVAHLLLIVLGLWAWDALLEDRT
FT                   EASLLAEMRGTHALLQQRFAETPRDQWPALARGLDADFAYALRMVPLAEAEKALSASQR
FT                   PPFNNGRVQIDLEHMRSLQRIGDSGYAVMLGPLDEALPEEGWQDSEVSGVAILLLILMV
FT                   AVALPMYVMVYRLWRDVSQLAQAARQMRDGQLDTRAPRAGTALVRPLANAFNHMAEQLQ
FT                   QLLESQRVLAQAVAHEVRTPLARMRFGLADLEDTALDEIQRDALGGLRTDVDRLQHLTD
FT                   AGVEYAALGRCHQLTRQRLQLAALVRGVVAQFAPLPMPVQQVLSPTGLVNVNRHMLELA
FT                   LRNLLGNALRYARRQIRIASTVNDGWLCLQVEDDGPGIAPELRGQVLQPYVRLDPGSPG
FT                   FGLGLALVQVVADKHGGHVEVTDSELGGACIRLHLPLESGGAVESEAAC"
FT   gene            complement(553375..554064)
FT                   /locus_tag="Smal_0473"
FT   CDS_pept        complement(553375..554064)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0473"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein; KEGG: cvi:CV_0761 probable
FT                   two-component response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50178"
FT                   /db_xref="GOA:B4SIH3"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:B4SIH3"
FT                   /protein_id="ACF50178.1"
FT                   /translation="MLDIVLVEDDARLGTMVSDYLQRHGYQVAHERSGERAVARILAEK
FT                   PALVLLDVGLPDQDGFEVCRQIRPHYDGIICVLTARTDNIDQVLGLELGADDYIGKPIE
FT                   PRVLLARLRAHLRRHRRVEPRDGSLRFGELNIDPSTRNVHLQGSLLELTTAEFDLLFLL
FT                   ASNAGQILDRDALLRGLRGIAFDGLDRSIDARISRLRRKLGDNPEQPERIKTVRGRGYL
FT                   FSRSAWG"
FT   gene            554414..556315
FT                   /locus_tag="Smal_0474"
FT   CDS_pept        554414..556315
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0474"
FT                   /product="Asparagine synthase (glutamine-hydrolyzing)"
FT                   /EC_number="6.3.5.4"
FT                   /note="PFAM: glutamine amidotransferase class-II;
FT                   asparagine synthase; KEGG: xcb:XC_2806 asparagine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50179"
FT                   /db_xref="GOA:B4SIH4"
FT                   /db_xref="InterPro:IPR001962"
FT                   /db_xref="InterPro:IPR006426"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR033738"
FT                   /db_xref="UniProtKB/TrEMBL:B4SIH4"
FT                   /protein_id="ACF50179.1"
FT                   /translation="MSGVVGAWLPPAEDEHLLQQLAPMLRALQQRGRGRIGYWTDAEAG
FT                   LALGHCRAPTDTPLQPLSSDCGRYVLCLDGRLYNRADLQSQLRDLPRSCSDARLLLQAI
FT                   VEWGVERTLSRIEGAFGFSVWDRESRALWLARDPVGERPLYYGWYQGQFLFASELKALQ
FT                   AFAGFAPSIDQDALSLLLRHDYVPAPHTIYRGIHKLVAGAMLRIDLNDHAAGGSSQAAQ
FT                   GGSRYWCAREAMHSALQEPLQPAPSLEQATDQLEAVLQKAIAARMHSPLACGAFLSGGT
FT                   DSSLVTAMMQAQSTLPIEAWTVGFDDPGHDESDWATQVARHLGVQHHLHRMDARQGLDL
FT                   LQRLPQVWCEPFADASQLPTLLASELLGARKPVALTGDGGDELFFGHPSYGRALRNARL
FT                   CGGLPDWVRDLARRSGNRMNVERGRLGGWRALVAEVAANDVEGHYLQRVTRWRQPAQVV
FT                   LGAREPMTIFQQQDTALPAEARIQLLDFRMDLAEGILAKVDRAGMAAGVETRAPLLDMD
FT                   VVRLAWRLPQHLKYHDGEHKRILKHLLARYLPEPLVYRPKRGFGPPMARWLAGPLRDWA
FT                   EALLDPQLLRNQGCFDAVRVRGIWEAFLRGERKWHTHLWNVLMFQAWHQHWHGGRGR"
FT   gene            complement(556763..557110)
FT                   /locus_tag="Smal_0475"
FT   CDS_pept        complement(556763..557110)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0475"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xac:XAC3615 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50180"
FT                   /db_xref="InterPro:IPR018968"
FT                   /db_xref="UniProtKB/TrEMBL:B4SIH5"
FT                   /protein_id="ACF50180.1"
FT                   /translation="MAAAFSDRFSDATRQLAAAATRANRLALENAESMFGVQLKVMERN
FT                   LTATGGWLGELARGEDAAGTLSKGAQLWQDNLQRLGQAQQDVVGLGLQASKAWSELVQG
FT                   YNQSTADASNH"
FT   gene            complement(557227..557589)
FT                   /locus_tag="Smal_0476"
FT   CDS_pept        complement(557227..557589)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0476"
FT                   /product="queuosine biosynthesis protein QueD"
FT                   /note="TIGRFAM: queuosine biosynthesis protein QueD; PFAM:
FT                   6-pyruvoyl tetrahydropterin synthase and hypothetical
FT                   protein; KEGG: xom:XOO_0699 6-pyruvoyl tetrahydrobiopterin
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50181"
FT                   /db_xref="GOA:B4SIH6"
FT                   /db_xref="InterPro:IPR007115"
FT                   /db_xref="InterPro:IPR038418"
FT                   /db_xref="UniProtKB/TrEMBL:B4SIH6"
FT                   /protein_id="ACF50181.1"
FT                   /translation="MEIFKVFMLEAAHRLPNVPPGHKCARLHGHSFRVELKVEGEPGAQ
FT                   TGWIMDFGDVKAAFQPIYDRLDHHYLNDIPGLENPTSENLAVWIWNELKPSLPALSEIT
FT                   VHETCTSGCRYRGPAI"
FT   gene            557781..560420
FT                   /locus_tag="Smal_0477"
FT   CDS_pept        557781..560420
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0477"
FT                   /product="TonB-dependent receptor"
FT                   /note="PFAM: TonB-dependent receptor; TonB-dependent
FT                   receptor plug; KEGG: xac:XAC3613 TonB-dependent receptor"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50182"
FT                   /db_xref="GOA:B4SIH7"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="UniProtKB/TrEMBL:B4SIH7"
FT                   /protein_id="ACF50182.1"
FT                   /translation="MPKHTLLVAALAVALAAPLSAAAETSADASGEASTLAAVRVTGSN
FT                   IKRADTEASNPVQVIGRQQLEQTGKATVADVLRSISANTGNASNETTNNGWASGSAGIG
FT                   LRGLSQKNTLVLLNGRRLANYGFPAGGLSDTFVDLNALPLVAVERIEVLKDGASAVYGS
FT                   DAVAGVVNIITRQNFEGAEIGGSFGGADQGGLHEQNLKFVGGLGDLDTDGYNILFSLQG
FT                   YNRERLDQDERNLTKSGIYTDKPGGRWNGWSAKGARYLVNGVSVPMLDASGNCPAGTTR
FT                   VASAPIDGLAGDTCGFNQAPFTTLIPSTKRYQAYANGTFRLNDNVEAFGEVLYSQIKST
FT                   AWFGSSPFFTLESGRFALNADSGLAEPVTSLLPASNPYNPYGRAIPIEYTFFDLGGTLK
FT                   TNRSTAYRGVFGLRGTTAKWDWEVAAFGARSSERESVSGGFANRWALADALATGSYNLL
FT                   NPAATPQSVRDSINIATLRPAESKLQGIDAKISGSLGHTWAGEIGFAAGAEWRREKLDS
FT                   NNPWQIDAGLQVRPAIAEVHGKRQVSAAYAEVNVPLASTLELSAAARADHYDDFGDAFS
FT                   PKIGLRWQPLDFLLVRASASKGFRAPSLSENSNSTSIAYGSVVDPRDPDVPGSRQNPTF
FT                   FTVGNNELKPERTKSLNFGVVLSPWANTNLSVDYYRIQLDNLVGTNNTQTLVNDNVAGA
FT                   VQRDERGKLQAVYNRYQNLSELKTSGIDVELRQRIPTAAFGDFTVSSAYTHVRDYRRPT
FT                   VVGGPLVDYAGSNLGATLPKDKATTTLDWKYGDFNAAVTWYYTSSYRQEASTAAKAVQQ
FT                   QVGSYSQYDLYLAYTGIDKLTVYAKVQNLADKTPPYDASFPGIRAPYDFSQYDLRGRYF
FT                   TLGFDYRF"
FT   sig_peptide     557781..557852
FT                   /locus_tag="Smal_0477"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.725 at
FT                   residue 24"
FT   gene            560495..563086
FT                   /locus_tag="Smal_0478"
FT   CDS_pept        560495..563086
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0478"
FT                   /product="peptidase M14 carboxypeptidase A"
FT                   /note="SMART: peptidase M14 carboxypeptidase A; KEGG:
FT                   ilo:IL0695 secreted protein containing N-terminal
FT                   zinc-dependent carboxypeptidase related domain"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50183"
FT                   /db_xref="GOA:B4SIH8"
FT                   /db_xref="InterPro:IPR000834"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR033848"
FT                   /db_xref="UniProtKB/TrEMBL:B4SIH8"
FT                   /protein_id="ACF50183.1"
FT                   /translation="MSLHRRAVLPLLIAAAALFLPHPVQAQSAYFFPQIADPAAFDTAV
FT                   PTPEQFLGYPIGSRYTRHDQLVAYFQELAKRSDRISVREIGRSYEGRPLLIATVTAAGN
FT                   HARLEQIRQQHATLADPAQPRSAAGDSPVVVWLGYSVHGNETSSAEAAMLTAYYLVASR
FT                   SAETQQWLQQAVVLFDPAQNPDGRDRAANWHNAWASDPASADPADKEHVEPFPQGRTNH
FT                   YFTDLNRDWLALTQQDSRPKVEVFHQWYPNVQIDFHEMGKDSTYYFEPSPKSMHSPLIP
FT                   PASYEFNKTLAKYHAQALDALGSLYYTGENFDNFSPVYGSTYPDFHGAVGVTVEQASSR
FT                   GRVQESVNGLLTFPFTIRNQVATGLGTVRGAVSERSGLFDLQKQFFQSALKQAAQQPVK
FT                   SFVFGDAHDPALTRRLLELLLLHRIEVRALDRAVSVDGQHFEAGSAYVVPVQQAQFRLV
FT                   HSIFAETPPIKGDVFYGSTSYAIAPAYGVAFAGSRSRIEGGARVTAVPAAQGAVLGGQA
FT                   GFAYAIDWRDYNAGRALAALQDKGLSARAAFQPFTTATAQGEVNFAAGSLVIPVAGQPL
FT                   QGAALLEAVTAAARDAGVQVHSLASGRSREGIDLGSDGVKALRKPAVALVMGEGVAATE
FT                   IGSAWFLLDQQLHLPASKLDPQQLGKVPLDRYTTIVLSGGTYTGVDATAVAALKRWVQA
FT                   GGSLVTYGSASKWAIEQKLADGEKPGKDEDAADESRRAFGDQRDIAAIERVSGNILSAD
FT                   VDTSHPLAFGVPRRQLAINKENTVTLQPSANPFSTVVRIDATPRVNGYLSERNRARVAG
FT                   SAWLLVSAQGQGNVVLFADDPAHRKYWHGTDRLLINAIFFGNLVNPAKARG"
FT   sig_peptide     560495..560575
FT                   /locus_tag="Smal_0478"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 27"
FT   gene            complement(563262..564176)
FT                   /locus_tag="Smal_0479"
FT   CDS_pept        complement(563262..564176)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0479"
FT                   /product="transposase IS116/IS110/IS902 family protein"
FT                   /note="PFAM: transposase IS111A/IS1328/IS1533; transposase
FT                   IS116/IS110/IS902 family protein; KEGG: amr:AM1_6037
FT                   transposase, IS116/IS110/IS902 family"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50184"
FT                   /db_xref="GOA:B4SIH9"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:B4SIH9"
FT                   /protein_id="ACF50184.1"
FT                   /translation="MNGIGIDVSKRQLDIGTTDGETLQVSNNRSGFSELDVWLKKRPTS
FT                   QIVLEATGGYEQPVLDLLHKVGHPVARANALRARKLAQGLGQIAKTDRLDAYALAQMAA
FT                   LVKLPPYQPLQPWQQKMREFVRARRQAMDALTIARQQQEMVLDRELRRLLQGNITRLQT
FT                   MVERLGKQIAEQVGQQPQLKTLKSMKGVGPALQAVLASYLPELGRITGKRIASLVGVAP
FT                   MSHDSGTMRGKRSIHGGRAEIRQVLYMAAMSAMRHEPRLRDFYQSLRARGKEGKVAIVA
FT                   VMRKMLVILNARVRDAESGLVPA"
FT   gene            complement(564863..566278)
FT                   /locus_tag="Smal_0480"
FT   CDS_pept        complement(564863..566278)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0480"
FT                   /product="DEAD/DEAH box helicase domain protein"
FT                   /note="PFAM: helicase domain protein; DEAD/DEAH box
FT                   helicase domain protein; SMART: DEAD-like helicases; KEGG:
FT                   xcv:XCV3733 ATP-dependent RNA helicase"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50185"
FT                   /db_xref="GOA:B4SII0"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B4SII0"
FT                   /protein_id="ACF50185.1"
FT                   /translation="MSFESLGLAPFLLRALAEQGYETPTPIQQQAIPLVLAGRDLLAGA
FT                   QTGTGKTAAFGLPLLQHLGTASQEVRTGPRKPRALILAPTRELATQVHDSLRGYSKYLR
FT                   IPSACIYGGVGMGNQLDILRRGVDLLVACPGRLIDHLERRSIDLSGIELLVLDEADRML
FT                   DMGFLPSIKRILAKLPKQNRQTLLFSATFEDNIRQLALEFMRNPEQIQVTPKNTVAETI
FT                   THRVHPVDGGRKRDLLLHLLAQDSREQTLVFARTKHGSDKLAAFLEKSGIKTAAIHGNK
FT                   SQGQRLRALGDFKAGRVTVLVATDIAARGIDINELPKVINFDLPMVAEDYVHRIGRTGR
FT                   NGATGQAISLVAQDEVKLLRAITRLLGRDMDIRDVPGFELQVPIRWGNSAPGKAEHETG
FT                   ERAPRKNHARRPHGDAPRHAHAGPKKAGGGRREGGGNGQQRAGAGAGQGQRRGGAGNGG
FT                   GRGRGQGGGGRAS"
FT   gene            567174..568163
FT                   /locus_tag="Smal_0481"
FT   CDS_pept        567174..568163
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0481"
FT                   /product="fumarylacetoacetate (FAA) hydrolase"
FT                   /note="PFAM: fumarylacetoacetate (FAA) hydrolase; KEGG:
FT                   xac:XAC3609 fumarylacetoacetate hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50186"
FT                   /db_xref="GOA:B4SII1"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="InterPro:IPR041072"
FT                   /db_xref="UniProtKB/TrEMBL:B4SII1"
FT                   /protein_id="ACF50186.1"
FT                   /translation="MKLGSLKEGGRDGTLIVVSRDLRHGVRATGIAATLQQALEDWSHI
FT                   APRLNALYESLNAGDADGVFDLDPQALAAPMPRAYEFVDGSAYLPHVERVRRARGAEVP
FT                   ESFYTDPLMYQATSAGFHGPRDAVKVVSEDYGIDLEAEIVVITDDVPMAATPEQAAGHI
FT                   QLVGLVNDVSLRNLIPGELAKGFGFLQSKPRSALSPVFVTPDELGAAWQDSKVHLPLLT
FT                   HINGQWFGAPEAGVDMQFNFAQLVAHAAKTRPLSAGTIVGSGTIANEDTSKGASCFAEQ
FT                   RVVETLRDGKPSTPFMSFGDVVRIEMLDAAGNSIFGAIEQRIEQAAKP"
FT   gene            568178..568846
FT                   /locus_tag="Smal_0482"
FT   CDS_pept        568178..568846
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0482"
FT                   /product="maleylacetoacetate isomerase"
FT                   /note="TIGRFAM: maleylacetoacetate isomerase; PFAM:
FT                   Glutathione S-transferase domain; KEGG: xcv:XCV3731
FT                   maleylacetoacetate isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50187"
FT                   /db_xref="GOA:B4SII2"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR005955"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR034330"
FT                   /db_xref="InterPro:IPR034333"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="InterPro:IPR040079"
FT                   /db_xref="UniProtKB/TrEMBL:B4SII2"
FT                   /protein_id="ACF50187.1"
FT                   /translation="MEIPVDDGIALYTYWRSSAAYRVRIGLELKGLAWEARPVHLVREG
FT                   GEQHLDAYRALNPQQLVPTLLHEGQALTQSLAILEYLDERFPQVPLLPADAAGRARVRA
FT                   LAQLVACDIHPINNLRVMQYLERSLQVPADARTQWTLHWIAEGFTAMEAMLANSSATGT
FT                   FCHGDRPGLADICLLPQLYNAHRFGLDLTPYPTLRRIEAACQALDAFDRARPENQLDAA
FT                   "
FT   gene            complement(568924..570051)
FT                   /locus_tag="Smal_0483"
FT   CDS_pept        complement(568924..570051)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0483"
FT                   /product="twitching motility protein"
FT                   /note="TIGRFAM: twitching motility protein; PFAM: type II
FT                   secretion system protein E; KEGG: xcv:XCV3730 Tfp pilus
FT                   assembly protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50188"
FT                   /db_xref="GOA:B4SII3"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR006321"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B4SII3"
FT                   /protein_id="ACF50188.1"
FT                   /translation="MDIGYFLKLMTEKNASDMFLTTGAPVYIKIEGKLYPLGNTGLPPG
FT                   MVKKIAYSLMDEGQVPQFERELELNMAIALPDAGRFRVNVFKQRGEVGMVIRAIRSRIP
FT                   SIEELNLPQVLKDVIMTPRGLVLVVGSTGSGKSTSLASMIDHRNSTTTGHILTIEDPIE
FT                   YLHKHKMSIVNQREVGLDTHAFHNALKNAMREAPDVILIGEILDAETMEAAIAFAETGH
FT                   LCLATLHSNNADQTIERILNFFPESAHKNVLMNLALNLRAVVSQRLVKNKEGRRLPATE
FT                   VLINTPMIRDLLRRGQVHEIKAAMEGSLEEGMESFDQCLFRLAKAGTIEQEEALRAADS
FT                   RDGLALKFRLSEGSSGEHDPYADFSAGAPSITHGF"
FT   gene            570173..570538
FT                   /locus_tag="Smal_0484"
FT   CDS_pept        570173..570538
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0484"
FT                   /product="outer membran protein"
FT                   /note="KEGG: xac:XAC3606 outer membran protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50189"
FT                   /db_xref="InterPro:IPR025511"
FT                   /db_xref="UniProtKB/TrEMBL:B4SII4"
FT                   /protein_id="ACF50189.1"
FT                   /translation="MRHGLYVMAFAFALSAPVWAQDAALELAQARQAVDKATQADADQY
FT                   APDLIGLARQGLEQAQRAAGDRRERKNAPAMALRAAADADLARVRSEEATVTAQLQLRR
FT                   NEVNQLQRQLSTGEDRR"
FT   sig_peptide     570173..570235
FT                   /locus_tag="Smal_0484"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 21"
FT   gene            570535..571419
FT                   /locus_tag="Smal_0485"
FT   CDS_pept        570535..571419
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0485"
FT                   /product="OmpA/MotB domain protein"
FT                   /note="PFAM: OmpA/MotB domain protein; KEGG: xcb:XC_3638
FT                   outer membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50190"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="UniProtKB/TrEMBL:B4SII5"
FT                   /protein_id="ACF50190.1"
FT                   /translation="MKPMTAATLAALLALPTLAVAADNPMVAQLSQRLMSIQANPDTAE
FT                   LGAFERVQAQQAIATLDKAKRRDQELATYLAERRVEIAETAVRTALAAREVDRLERTRS
FT                   DLLIEASRRDAARARQEAEQLRMQAQMQAEEAERLRQAAEAETLARQDAENALTSVAGK
FT                   QQQRLSAAQQNAAKLAREEAELVSGQKLPGSKFDGRGEVFTFNGDAFAAGASSLSGGAR
FT                   NQAKALAEYLNIGKKGRLRIEAYDSANGVGQKRAEALRDALVAGGVASNRIQLSGKKAA
FT                   STRARSAEVIIAP"
FT   sig_peptide     570535..570600
FT                   /locus_tag="Smal_0485"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.980 at
FT                   residue 22"
FT   gene            571586..571750
FT                   /locus_tag="Smal_0486"
FT   CDS_pept        571586..571750
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0486"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50191"
FT                   /db_xref="UniProtKB/TrEMBL:B4SII6"
FT                   /protein_id="ACF50191.1"
FT                   /translation="MQAGREPQQIDVRRPVPQVVAGVQVAIDRRSSMNNAPCLEAGAFV
FT                   YLSKEVHHV"
FT   gene            571743..571979
FT                   /locus_tag="Smal_0487"
FT   CDS_pept        571743..571979
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0487"
FT                   /product="protein of unknown function DUF465"
FT                   /note="PFAM: protein of unknown function DUF465; KEGG:
FT                   xcb:XC_3637 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50192"
FT                   /db_xref="InterPro:IPR007420"
FT                   /db_xref="InterPro:IPR038444"
FT                   /db_xref="UniProtKB/TrEMBL:B4SII7"
FT                   /protein_id="ACF50192.1"
FT                   /translation="MFEDQPQSEIDARRARDPEFRALHDQHRKLNKKCMDAELGVLPID
FT                   DVTLGRMKREKLLAKQRLLRMYETPLPTTSPAH"
FT   gene            572346..573716
FT                   /locus_tag="Smal_0488"
FT   CDS_pept        572346..573716
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0488"
FT                   /product="Pyridoxal-5'-phosphate-dependent protein beta
FT                   subunit"
FT                   /note="PFAM: CBS domain containing protein;
FT                   Pyridoxal-5'-phosphate-dependent protein beta subunit;
FT                   KEGG: xcb:XC_3636 cystathionine beta-synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50193"
FT                   /db_xref="GOA:B4SII8"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR001216"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:B4SII8"
FT                   /protein_id="ACF50193.1"
FT                   /translation="MPIHSSVLELIGQTPIVKAQRLDTGACELYLKLESANPGGSIKDR
FT                   IGLSMIEAAEKRGDLKPGATLVEGTAGNTGLGLALVAQQKGYKLILVVPDKMSREKIFN
FT                   LKAMGAEVRLTRSDVAKGHPEYYQDLAKTIAEQTPGAYFINQFGNPDNPAAHEFGTGPE
FT                   ILEQMGGDLDAIVFGCGSSGTMTGLSRAFAKLSPKTELVLADPVGSILAEYINDGNLND
FT                   KSGSWLVEGIGEDFLPSISDFSRVKKAYAISDAESFHTARELLGKEGILGGSSTGTLLA
FT                   AALKYCKEQTTPKKVLVLVPDTGNKYLSKMYNDYWMLDNGFLQRPQHGDLRDLILRPYG
FT                   QRDTVVIGPNDLLTTAYQRMKLYDVSQLPVLDGDQLVGIVDESDVLLHVYGDEARFRDP
FT                   VATAMVSKLDRLDVKSPIEALLPVFDRGQVAIVMDGNAFLGLITRIDLLNYLRRRVQ"
FT   gene            573840..575012
FT                   /locus_tag="Smal_0489"
FT   CDS_pept        573840..575012
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0489"
FT                   /product="Cystathionine gamma-lyase"
FT                   /EC_number="4.4.1.1"
FT                   /note="PFAM: Cys/Met metabolism
FT                   pyridoxal-phosphate-dependent protein; KEGG: xcb:XC_3635
FT                   cystathionine gamma-lyase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50194"
FT                   /db_xref="GOA:B4SII9"
FT                   /db_xref="InterPro:IPR000277"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:B4SII9"
FT                   /protein_id="ACF50194.1"
FT                   /translation="MSNATSQDRALALATLAIHGGQSPDPSTGAVMPPIYATSTYAQSS
FT                   PGEHQGFEYSRTHNPTRFAYERCVASLEGGTRGFAFASGMAASSTVIELLDAGSHVVAM
FT                   DDIYGGSFRLFERVRRRTAGLDFSFVDLTDLAAFEASITPKTKMVWIETPTNPMLKIVD
FT                   IAAVAAIAKRHGLIVVVDNTFASPMLQRPLELGADLVLHSATKYLNGHSDMVGGMVVVG
FT                   DNAELAEQMAFLQNSVGGVQGPFDSFLALRGLKTLPLRMKAHCANALALAQWLEKHPAV
FT                   EKVIYPGLASHPQHELAGKQMAGYGGIVSIVLKGGFDAAKRFCEKTELFTLAESLGGVE
FT                   SLVNHPAVMTHASIPVARREQLGISDALVRLSVGVEDLGDLQVDLGEALK"
FT   gene            575009..575869
FT                   /locus_tag="Smal_0490"
FT   CDS_pept        575009..575869
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0490"
FT                   /product="ABC-2 type transporter"
FT                   /note="PFAM: ABC-2 type transporter; KEGG: nha:Nham_2778
FT                   ABC-2"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50195"
FT                   /db_xref="GOA:B4SIJ0"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/TrEMBL:B4SIJ0"
FT                   /protein_id="ACF50195.1"
FT                   /translation="MNNETILKAEIARRRARISSHDTQMKALPAFIRDVSEGMAAWRAW
FT                   TSLALLDIKHKYRRSVLGPFWITISMFVLILGIGLLYSQLFRMNLREYLPYIALGDIVW
FT                   IYISTTVQEGCTTFTASENLIRSMRLPMTLHVMRLVTRTFIVFLHGAIAYLPFVIFLKI
FT                   EPELVWLLALPGVALIVLATIPVTAIFGLLSARFRDLHPAIANFMQLGFFMTPIIWKAD
FT                   MLGPHRWVADINPIYHFIQIVRMPLMGQVPEAHSYYFVLAFIAAAFVIALPFLAANRHK
FT                   ISLWV"
FT   gene            575874..576599
FT                   /locus_tag="Smal_0491"
FT   CDS_pept        575874..576599
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0491"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: tbd:Tbd_1877 ABC transporter ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50196"
FT                   /db_xref="GOA:B4SIJ1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B4SIJ1"
FT                   /protein_id="ACF50196.1"
FT                   /translation="MTFIEVVDCSVQLPIYGTNNRSMKGAIMSAVTGGRVAPTSRNVTV
FT                   VDSLQNVTFNLREGDKLGLVGHNGAGKTTLLKTLAGVYEPTSGYIRSQGRVANLLDVTM
FT                   GMDFEATGVENIRLKGLLHGLSRAEIQSKIPQICEFSGLGPYVNMPVRVYSSGMMVRLA
FT                   FSIATSFDAEILLMDEWLGVGDADFNARAQQRLAEIVQKASILVLASHNQDIIAANCNR
FT                   IMHLEHGRITSDQPIEARA"
FT   gene            576600..578840
FT                   /locus_tag="Smal_0492"
FT   CDS_pept        576600..578840
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0492"
FT                   /product="Methyltransferase type 12"
FT                   /note="PFAM: Methyltransferase type 11; Methyltransferase
FT                   type 12; KEGG: mxa:MXAN_4620 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50197"
FT                   /db_xref="GOA:B4SIJ2"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:B4SIJ2"
FT                   /protein_id="ACF50197.1"
FT                   /translation="MNTRNRDYWINRSGDLYADQQKVRREAGNSNYARQEAWLVGFLAE
FT                   RSEQLGRPVRVLDFGVGFGRLARLLPQHAFVDYFGFDISPAMVEPLLREPPAELAVDIG
FT                   RRIRVGSSLTEAMQGEQFDMIFTVSVLIHNNREQAADALAQMRALLAPEGRLCFIENRP
FT                   VSISLLANLWHAGCWSHDFAGTLAPDMNVDVEDGILSDHAIYILHEPAAGILRQLRVPG
FT                   AHGFEPITAGDYLLRTLEATTAVARGMEVESAALGDGIAQMRDAVELYRQAEEHARRNL
FT                   DIARQHLGDDVGLLDGVAHLTAAIDALPALAARIGVLGGETSAQHAQSSERIEALHARE
FT                   AALVESLTQQERELEQAQARLEAAQSANQHLQWQQGLREQVRQVLSSRTDEGAMPYLDA
FT                   PVGGSASVGQPAPSVYEFNARRDLRFAQTVVGHERVCHIMHQEWFGIRAACGSLPGHKL
FT                   AVTSTSAPGAGDVEEVARLLAANKVNRLVIHGFSDGMLQWVKGLAAAGFDRIYMVWHGA
FT                   PSMWIHAEERRLFALAYKAVRTGLIRRVSVMRAGSHAALADVAGWQRQLYNMPPAYTGK
FT                   RIPRRATGATVFIPSWNLIHKNIFTNAAAAAATGEVANIWLMADDFALPYRVDKNVKRL
FT                   PKLSQLQMMEAMSQADAVMNASIVDCHPMVELEALAAGTPALRGRLGMDALEDHPYVEI
FT                   TQVADPLSVADVRQTLRRMLAAPVVEMDDMMSSYSRQMVALSFERYSEFMEI"
FT   gene            578843..581014
FT                   /locus_tag="Smal_0493"
FT   CDS_pept        578843..581014
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0493"
FT                   /product="glycosyl transferase family 2"
FT                   /note="PFAM: glycosyl transferase family 2; KEGG:
FT                   mxa:MXAN_4619 glycosyl transferase, group 2 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50198"
FT                   /db_xref="GOA:B4SIJ3"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:B4SIJ3"
FT                   /protein_id="ACF50198.1"
FT                   /translation="MGLRVFVTRELFPFTAGGIGRVIANMLMTAPEEERAEMAVLYVGD
FT                   NVEADAFAVAHPVVTFLAWPHSRFQQVDERGEIFPPMPAFTHSMLHWESVHVLQGLLEL
FT                   ERLKGPLEYVEFVDWGAPAFAATQEKLLGSALTTATLAVRLHTTDSILADFEPRVQSVH
FT                   GLNLFDLERKALADCDLIVGQIAPVAEAFRVFYGFSEEEWTPRLRLHAPPVLLDTMQPV
FT                   AQTTVIDDTTSLLFTSKLQDIKRPDTFIRGCIQFLRDRPRYQGNIVFLAHSFDVSYQEY
FT                   VISLVPEDLRSRVVFARGVTGAAREKSISGAVCVFPSPWESFCLAAYEASLSGAACVLN
FT                   AQNPAFGPGSPWRDGCNCSTFDGSAEDLARALCGLFESTVGRLSPVEVPKDPLPWKGLD
FT                   PVAVPAAVPLDRQLTVVVVNRDSAGRVLNSLDSILASNLTLDKLIVIDDASRDPRDIAA
FT                   LDQLGNNDPRLSVHRLAVPVGDAVARNMGLALVETPFAGFVRGGDQLLPGFLNGAVSAL
FT                   ASQPDFDVVVGQVGVTVDPDDVIAGNVAPDGFRIFYGEGRLAGLYENRLAPESYVIRTE
FT                   VARRFAFDPVIPALEVWEMMLRACQSGARFMVTSAVNVLARHQGQPDERHLEQIQIAMR
FT                   RRLQRKRVRVGSLEVPAYFIFGAHVSPSGFMGDASNAEMAYRLQALMESESVRYTLALA
FT                   RLLQKRAPWVLRLGKWSVQRLAPIYRRLR"
FT   gene            581034..583058
FT                   /locus_tag="Smal_0494"
FT   CDS_pept        581034..583058
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0494"
FT                   /product="glycosyl transferase family 2"
FT                   /note="PFAM: glycosyl transferase family 2; KEGG:
FT                   mxa:MXAN_4619 glycosyl transferase, group 2 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50199"
FT                   /db_xref="GOA:B4SIJ4"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:B4SIJ4"
FT                   /protein_id="ACF50199.1"
FT                   /translation="MHVIVIQLACWRVGGEPAALARGRLRAIPAASVLIVGEGAPPADL
FT                   LEECAERRTLCVDSPLHAMQGRRLPDVRRSGDAEQLGWSLAVMAALRALQQDVHLDCVE
FT                   IPSCGALAYALLQERALSEVFDTTRVMLRFDGIQAIEVLRQGRNVEMAALMLMDMERMC
FT                   LEQCDQVLVDSQAIAESLQRFLPGSQRPLHLRATLPEPAGLMSEYHAVGSALACVATEA
FT                   PALRQCLRAISGYLQQSNDGLLQVSVVCQPALLSEVLYVVPAALRHRFQEAPADCLRAS
FT                   PMRVVMPDRWSAGSALARELLAHGHRLIVDVANPALAAAQGWEQERTHLGYTDARGLFE
FT                   ALRASQQWGPTRHLRMGPSPPLPKLDVGTPGPAKVSVVVPCYNMGRWLPQTLRNIQQFS
FT                   WSDLEVIVVDDGSTDPGTVQLIEELEASPNAGLRVVRLEFNQGLSAARNAGVAAAQGEF
FT                   TLCLDADDLVSPEFVSIAVRALQRHPAHDFVVPRCAYFFGDESALDVNELRLGQGLPMV
FT                   GAAFDSGTLGNRFSTATSLARTSVLRALGYDESLRSYEDWQLYRRALQQGSRFIVTNDV
FT                   HFFYRQRPDSMIHDPAMRARHSLLYAEMVGGATLIGQGPVVSPNLLGALAAPPRIDGSS
FT                   SGLLLGGVVEALDEMQALRRSRIVGLGYRLSALLRQLRR"
FT   gene            complement(583105..584115)
FT                   /locus_tag="Smal_0495"
FT   CDS_pept        complement(583105..584115)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0495"
FT                   /product="UDP-glucose 4-epimerase"
FT                   /note="TIGRFAM: UDP-glucose 4-epimerase; PFAM:
FT                   NAD-dependent epimerase/dehydratase; short-chain
FT                   dehydrogenase/reductase SDR; 3-beta hydroxysteroid
FT                   dehydrogenase/isomerase; polysaccharide biosynthesis
FT                   protein CapD; dTDP-4-dehydrorhamnose reductase; Male
FT                   sterility domain; KEGG: dac:Daci_5547 UDP-glucose
FT                   4-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50200"
FT                   /db_xref="GOA:B4SIJ5"
FT                   /db_xref="InterPro:IPR005886"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B4SIJ5"
FT                   /protein_id="ACF50200.1"
FT                   /translation="MRVLVTGGAGYLGSHVCAELLLGGHEVTVVDDFSNARPDVGERLN
FT                   MLTGRVLNIITGDIRDRAILDRAFLQQRPEAVMHFAALKAVGESAVVPLAYYDVNVAGT
FT                   INLLQCMQRNACHKLVFSSSATVYGNSSHCPINEGAPTSATSPYGRTKLFVEQIINDAK
FT                   LADPLLQAINLRYFNPVGAHESGLLGEEPSGTPNNLMPYIAQVAAGLRSHVSVFGADYA
FT                   TTDGTGIRDYIHVCDLATAHIRTLEALPNLSGLNALNLGTGIPYSVLDVIRAFSEASGR
FT                   PVPYEIVGRRPGDIGECWADPSLAECRLGWSAKLDLAKMCRDTWRWQQILMSRSQ"
FT   gene            584297..585895
FT                   /locus_tag="Smal_0496"
FT   CDS_pept        584297..585895
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0496"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mav:MAV_0212 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50201"
FT                   /db_xref="GOA:B4SIJ6"
FT                   /db_xref="UniProtKB/TrEMBL:B4SIJ6"
FT                   /protein_id="ACF50201.1"
FT                   /translation="MATPTAPLLRLTLLGVGLVLVLLPGVLLMRELLHVGMQEDAMIGL
FT                   RHLRNMLEGSGFVYNRGESALGATNPLFWIFSFLAIKPFYLASPSLDVLVAHYYFCGFA
FT                   LLAAAIAFAMATPSRTRTVSVAAMALLSVLFFWPLRFLYLGLEGPFMLVCVGVIGLLAV
FT                   RSVGTRDGLLATLVGFLSWNRPEIALILIPAVLFYALLMSDKSSRIRVSVGYLAGAVAF
FT                   PLMLKLVSGAYIVGTVQAKAYFGNPSPPYNLDFFVQRIIYLDSFIGLGGGVTVLLLVGI
FT                   FASAIIGILDFLQGDRKQMPWVRGVYPAFVAGYSCFVLFIPSLWEWYVTFWLSFALVQY
FT                   GVLISRGINCCFSALRGNVGAAVLGVTIVLLSTSWLMGHRLATQRTEIVGWITQDAGFR
FT                   GRLSKELNERWHARSVWMEAAGWQGYFNNARIFDEVGLVDDETQPLAQKYGCAYFVSAL
FT                   KELQPQFVIKRQFEMDRNVMLTPPRSCPNAPLFSNDADRLWFDSNYEAVEHYGTPAPGY
FT                   FGEYSFLVLYRSRNK"
FT   gene            complement(586256..586684)
FT                   /locus_tag="Smal_0497"
FT   CDS_pept        complement(586256..586684)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0497"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: maq:Maqu_1646 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50202"
FT                   /db_xref="GOA:B4SIJ7"
FT                   /db_xref="InterPro:IPR007267"
FT                   /db_xref="UniProtKB/TrEMBL:B4SIJ7"
FT                   /protein_id="ACF50202.1"
FT                   /translation="MSRSRLIFAYSSFAAASILVNIGTQALAVLLYQGPYSVPASVVLG
FT                   TATGLLCKYFLDKHFIFGHSSESASQEAKTFTLYVVMGLATTLIFWGTEAAFHFIFEED
FT                   AMRYVGGIIGLSIGYAVKYRLDSHFVFKKTAVPGRRHD"
FT   sig_peptide     complement(586598..586684)
FT                   /locus_tag="Smal_0497"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.987) with cleavage site probability 0.919 at
FT                   residue 29"
FT   gene            complement(586681..587412)
FT                   /locus_tag="Smal_0498"
FT   CDS_pept        complement(586681..587412)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0498"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR
FT                   domain protein; KEGG: xac:XAC3591 short chain
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50203"
FT                   /db_xref="GOA:B4SJ35"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B4SJ35"
FT                   /protein_id="ACF50203.1"
FT                   /translation="MQKILIIGATSAIAEAVARQYAGRAAALYLVGRSAGKLDAIAADL
FT                   RVRGAQRVETGVLDVNHVAAHGGLLDNAWAAFGGIDTVLIAHGTLPDQAACDASVDLSL
FT                   HEFATNATATIALAAALAQRLQHGATLAVISSVAGDRGRASNYLYGSAKAAVTTYLSGL
FT                   GQRLHASGVNVLAIKPGFVDTPMTAAFKKGALWATPEQVANGILKAIGKRKSVAYLPGF
FT                   WWAVMMIIKNIPEFIFRRIKL"
FT   gene            complement(587415..588728)
FT                   /locus_tag="Smal_0499"
FT   CDS_pept        complement(587415..588728)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0499"
FT                   /product="FAD linked oxidase domain protein"
FT                   /note="PFAM: FAD linked oxidase domain protein; KEGG:
FT                   xac:XAC3590 oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50204"
FT                   /db_xref="GOA:B4SJ36"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:B4SJ36"
FT                   /protein_id="ACF50204.1"
FT                   /translation="MSAPAGQSWGRYPRVNQRIVPVFDRDVPLPLPVDGGSVLPHGNGR
FT                   SYGDSCLNPDATLLTSHGLDRFIDFDPATGIVRCESGVTLASILDIALPRGWFLPVTPG
FT                   TRYATVGGAIGNDVHGKNHHRAGTFCHHVLRLELLRSDGSRQQLTAADSSGLFAATAGG
FT                   LGLTGFITWAELQLRRVPGPWIETESIRFGNLDEFFELSRDSAAGYEYTVAWIDCLAKG
FT                   RNLGRGHFLRGDHAPGDAQAATPSSAPRRSMPLVPPVSLVNGLTLRPFNTLYYWRQPAH
FT                   RARHVSHYQSYFYPLDGINHWNRMYGPRGFLQHQCVLPPAHARDATAALLAEIARSGRG
FT                   SFLAVLKEFGDIPSPGMLSFPRPGTTLALDFPNDGPGLLTMLERLDRIVSDAGGAVYPA
FT                   KDARMSGALFRQAYPAWEQFSHFIDPRFSSGFWRRVME"
FT   gene            complement(588725..590143)
FT                   /locus_tag="Smal_0500"
FT   CDS_pept        complement(588725..590143)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0500"
FT                   /product="UbiA prenyltransferase"
FT                   /note="PFAM: UbiA prenyltransferase; KEGG: xac:XAC3589
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50205"
FT                   /db_xref="GOA:B4SJ37"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR039653"
FT                   /db_xref="UniProtKB/TrEMBL:B4SJ37"
FT                   /protein_id="ACF50205.1"
FT                   /translation="MTASNRPLCVDLDGTLLRSDILYESLLALLAHNPLYVFLVPFWLL
FT                   KGKAYVKRQLASRVQLPAAILPYDERVLEILRTTTQRPRVLCTASDRLLVQPIADHLDL
FT                   FEEVMASDGYTNLSGTNKGQALAERFGERGFDYMGNGQVDLKVWAHAGGAIVVNNGNGL
FT                   VRAASTRTEVLAHLPSQSGGLLTWIKALRVYQWLKNLLVLVPLLTAHRFFDIGSVVDAG
FT                   VAFLAFGLCASGVYLLNDLLDLTPDRMHPRKRRRPFAAGTLPLLHGLLAAPLITLAGFA
FT                   LALACSPAFAGVLLCYYVMTLSYSLKLKRIVMIDVVMLAALYTVRIIGGAVAISSELSF
FT                   WLLAFSMFVFLSLAMLKRYTELASALASGKEVAIGRGYSVADLPLVQSLGAAAGYIGVL
FT                   VFALYINSPESLELYTSPKLLWLLCPILLYWISRMWIVSHRGDMHDDPIVFAATDRSSQ
FT                   IVIGLCLLIVLIAI"
FT   gene            complement(590536..591474)
FT                   /locus_tag="Smal_0501"
FT   CDS_pept        complement(590536..591474)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0501"
FT                   /product="Electron transfer flavoprotein alpha subunit"
FT                   /note="PFAM: Electron transfer flavoprotein
FT                   alpha/beta-subunit ; Electron transfer flavoprotein alpha
FT                   subunit; KEGG: xcb:XC_3615 electron transfer flavoprotein
FT                   alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50206"
FT                   /db_xref="GOA:B4SJ38"
FT                   /db_xref="InterPro:IPR001308"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014730"
FT                   /db_xref="InterPro:IPR014731"
FT                   /db_xref="InterPro:IPR018206"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR033947"
FT                   /db_xref="UniProtKB/TrEMBL:B4SJ38"
FT                   /protein_id="ACF50206.1"
FT                   /translation="MSRILVIAEHHDGKLNAATAKTVSAATAIAGASIDVLVLAADPAA
FT                   VAAEAAKIAGVAKVLTVANAANAQAIAQVLAPQIAQLAKGYTHLFGPSTTFGKDLMPCV
FT                   AALLGVNQVSDLMSVEGSHTFKRPIYAGNAIITVEAPADQIVVATVRAASWPEAAQGGS
FT                   AAIEAANVDAALPTHTRFVGLAAGASDRPDLQSAKRVVSGGRGVGSEENFKVIFQLADK
FT                   LGAAVGASRAAVDAGYVPSDLQVGQTGKIIAPELYVAVGISGAIQHLTGIKDAGTIVAI
FT                   NKDGDAPIFEIADIGLAGDLFAILPELEKAL"
FT   gene            complement(591474..592220)
FT                   /locus_tag="Smal_0502"
FT   CDS_pept        complement(591474..592220)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0502"
FT                   /product="Electron transfer flavoprotein
FT                   alpha/beta-subunit"
FT                   /note="PFAM: Electron transfer flavoprotein
FT                   alpha/beta-subunit; KEGG: xac:XAC3586 electron transfer
FT                   flavoprotein beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50207"
FT                   /db_xref="GOA:B4SJ39"
FT                   /db_xref="InterPro:IPR012255"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014730"
FT                   /db_xref="InterPro:IPR033948"
FT                   /db_xref="UniProtKB/TrEMBL:B4SJ39"
FT                   /protein_id="ACF50207.1"
FT                   /translation="MKILVAYKRVVDYNVRIQVKPDGSGVVTDGVKLSPNPFDEIALEE
FT                   ALRLRDKGIASEVVVATIAPADAQAHLRNGLAMGANRAIHVVTDQAIQPLTASRTLLKL
FT                   IEKEQPDLVILGKQAIDDDANQTGQMLATLWGRPQATFASKLEIADGKATVTREVDAGL
FT                   ETLEVDLPAVVTTDLRLNEPRFIKLPDIMKAKAKPLETLQLADLGVEAADTFKTTQYAA
FT                   PSKRSKGVMVKDAAELVAALKQKGLL"
FT   gene            592506..593561
FT                   /locus_tag="Smal_0503"
FT   CDS_pept        592506..593561
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0503"
FT                   /product="dTDP-glucose 4,6-dehydratase"
FT                   /note="TIGRFAM: dTDP-glucose 4,6-dehydratase; PFAM:
FT                   NAD-dependent epimerase/dehydratase; short-chain
FT                   dehydrogenase/reductase SDR; 3-beta hydroxysteroid
FT                   dehydrogenase/isomerase; polysaccharide biosynthesis
FT                   protein CapD; dTDP-4-dehydrorhamnose reductase; Male
FT                   sterility domain; KEGG: xcv:XCV3709 dTDP-glucose
FT                   4,6-dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50208"
FT                   /db_xref="GOA:B4SJ40"
FT                   /db_xref="InterPro:IPR005888"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B4SJ40"
FT                   /protein_id="ACF50208.1"
FT                   /translation="MPTWLVTGGAGFIGGNFVLEAVARGVKVINLDVLTYAGNLKTLSS
FT                   LDGNPNHLFVQGDIGDRELVTRLLAEHRPDAVLNFAAESHVDRSIDVPGAFIQTNVVGT
FT                   LGLLEAVRDYWKALPAEQGADFRFLHVSTDEVYGTLGETGKFSETTPYAPNSPYSASKA
FT                   ASDHLVRAFHHTYGLPVLTTNCSNNYGPYHFPEKLIPLVIAKALAGEPLPVYGDGKQVR
FT                   DWLFVSDHCEAIRTVLAKGQVGETYNVGGNSEKQNIEVVQAICALLDARRPREDGQPRS
FT                   SQITYVADRPGHDRRYAIDASKLKNDLGWEPAYTFEQGITFTVDWYLDNQEWVNGVLDG
FT                   SYRLQRIGTAG"
FT   gene            593576..594463
FT                   /locus_tag="Smal_0504"
FT   CDS_pept        593576..594463
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0504"
FT                   /product="glucose-1-phosphate thymidylyltransferase"
FT                   /note="TIGRFAM: glucose-1-phosphate thymidylyltransferase;
FT                   PFAM: Nucleotidyl transferase; KEGG: xom:XOO_0721
FT                   glucose-1-phosphate thymidylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50209"
FT                   /db_xref="GOA:B4SJ41"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR005907"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:B4SJ41"
FT                   /protein_id="ACF50209.1"
FT                   /translation="MTQRKGIILAGGSGTRLYPITKGVSKQLLPVYDKPMIYYPLSVLM
FT                   LAGIREVLIINTPHEQVLFQQLLGDGSQWGMDIQYAVQPSPDGLAQAYLIGRDFVAGKP
FT                   SCLVLGDNIFHGHGLREMLRRADARDQGATVFGYWVNDPERYGVAEFDKSGKVIDLVEK
FT                   PENPRSNYAVTGLYFYDGNASNYAVDLKPSPRGELEITDLNKRYLQEGNLHLEALGRGY
FT                   AWLDTGTHQSLLEASNFIETIQTRQGLQVCCPEEIAFGQGWITAEQLEALAAPLIKNGY
FT                   GRYLHKLALRGVVP"
FT   gene            594460..595017
FT                   /locus_tag="Smal_0505"
FT   CDS_pept        594460..595017
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0505"
FT                   /product="dTDP-4-dehydrorhamnose 3,5-epimerase"
FT                   /EC_number="5.1.3.13"
FT                   /note="KEGG: xac:XAC3583 dTDP-4-dehydrorhamnose
FT                   3,5-epimerase; TIGRFAM: dTDP-4-dehydrorhamnose
FT                   3,5-epimerase; PFAM: dTDP-4-dehydrorhamnose 35-epimerase
FT                   related"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50210"
FT                   /db_xref="GOA:B4SJ42"
FT                   /db_xref="InterPro:IPR000888"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:B4SJ42"
FT                   /protein_id="ACF50210.1"
FT                   /translation="MKVIETRLPGCVVIEPAVFGDARGYFFETWNAERFAALGLPHRFA
FT                   QSNVSTSAQGVLRGLHYQWPRPQGKLVSVLEGEVYDVAVDIRRGSPTFGQWEAVVLSAE
FT                   NKKQFWIPDGFAHGFAVLSERAVFSYLCTEVYLKDFDAGVRWNDADIAVDWPISAPTLS
FT                   AKDESAPFLKDIAEDRLPVYVP"
FT   gene            595014..595952
FT                   /locus_tag="Smal_0506"
FT   CDS_pept        595014..595952
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0506"
FT                   /product="dTDP-4-dehydrorhamnose reductase"
FT                   /EC_number="1.1.1.133"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase; 3-beta
FT                   hydroxysteroid dehydrogenase/isomerase;
FT                   dTDP-4-dehydrorhamnose reductase; Male sterility domain;
FT                   KEGG: xac:XAC3582 dTDP-4-keto-L-rhamnose reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50211"
FT                   /db_xref="GOA:B4SJ43"
FT                   /db_xref="InterPro:IPR005913"
FT                   /db_xref="InterPro:IPR029903"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B4SJ43"
FT                   /protein_id="ACF50211.1"
FT                   /translation="MTVLVLGGNGQVGQELLRALVPLGKVVTTTRSGILPDGSVCETAD
FT                   FDQPDSLPALLDRLQPSVVVNAAAYTAVDRAEREVDAAFAVNAEAPGVIARWCAAHDVP
FT                   FVHYSTDYVFDGQGTAPYREDEPTAPLGVYGISKRDGEDAVRAAGGRHLIFRTAWVYAS
FT                   HGANFLRTMLRVGAERDALRVVADQIGTPTPAALIADVTAQALQHPGQLSGTWHLTASG
FT                   QTSWYGFAEAIFAEALATGVLAKVPAVEAIPSSEYPTPAKRPAWSVLDNRKLQQDLGTA
FT                   LPDWHEGLAIVMNEIKRLRDESAGGRASWTN"
FT   gene            596071..597909
FT                   /locus_tag="Smal_0507"
FT   CDS_pept        596071..597909
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0507"
FT                   /product="glucosamine/fructose-6-phosphate
FT                   aminotransferase, isomerizing"
FT                   /note="TIGRFAM: glucosamine/fructose-6-phosphate
FT                   aminotransferase, isomerizing; PFAM: glutamine
FT                   amidotransferase class-II; sugar isomerase (SIS); KEGG:
FT                   xcv:XCV3754 D-fructose-6-phosphate amidotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50212"
FT                   /db_xref="GOA:B4SJ44"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR005855"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR035466"
FT                   /db_xref="InterPro:IPR035490"
FT                   /db_xref="UniProtKB/TrEMBL:B4SJ44"
FT                   /protein_id="ACF50212.1"
FT                   /translation="MCGIVGAIADRDVVPVLIEGLKRLEYRGYDSSGIAVIDQGERRDV
FT                   RRVRRTGRVSEMATAAEAEGFNAVLGIGHTRWATHGGVTEANAHPHISHGVALVHNGII
FT                   ENHEEQREKLRAQGYSFESQTDTEVIAHLIHHHLKDGDDLLVALQRTVKELTGAYALAV
FT                   VSRAEPERFVCARMGCPLLIGLGEGENFVASDVSAVLSATRKVIFLEEGDTAEIRRDGV
FT                   RIFDEHDQPVERDVHLSDVSLASLELGPYRHFMQKEIHEQPRALGDTIEAAIDAGGFPA
FT                   ELFGKNAEAVLSGIEGVQIIACGTSYYSGLTARYWIEAIAGLPCSVEIASEYRYRAAYA
FT                   NPKHLIVTISQSGETLDTMEALKYAKSLGHKHTLSICNVPESAIPRASELVCYTRAGAE
FT                   IGVASTKAFTTQLAALFQLTVVLGKLHGRIDAAQEADYLEQLRFLPGSVQHALNMEPQI
FT                   AAWAERFARKSSALFLGRGLHYPIALEGALKLKEISYIHAEAYPAGELKHGPLALVDED
FT                   MPVVVIAPNDSLLEKVKSNMQEVRARGGELFVFADQDSNFNESEGVHVIRTPRHAGVLS
FT                   PIVHTIPVQLLAYHTALARGTDVDKPRNLAKSVTVE"
FT   gene            complement(598002..599405)
FT                   /locus_tag="Smal_0508"
FT   CDS_pept        complement(598002..599405)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0508"
FT                   /product="mannose-1-phosphate
FT                   guanylyltransferase/mannose-6-phosphate isomerase"
FT                   /EC_number="2.7.7.22"
FT                   /note="KEGG: xcb:XC_3609 phosphomannose
FT                   isomerase/GDP-mannose pyrophosphorylase; TIGRFAM:
FT                   mannose-1-phosphate guanylyltransferase/mannose-6-phosphate
FT                   isomerase; PFAM: mannose-6-phosphate isomerase type II;
FT                   Nucleotidyl transferase; Cupin 2 conserved barrel domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50213"
FT                   /db_xref="GOA:B4SJ45"
FT                   /db_xref="InterPro:IPR001538"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR006375"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:B4SJ45"
FT                   /protein_id="ACF50213.1"
FT                   /translation="MSSIQPVILSGGSGTRLWPLSREAYPKQFLPLAGELTMLQATWQR
FT                   VAPLAAHGPLVIANEEHRFVAAEQLQQVGAEPAAIILEPVGRNTAPAIAVAALEATRDG
FT                   ADALLLVLPSDHVITNEAAFRSAVQAAASAADAGKLVTFGIVPTGPETGYGYIKAADGQ
FT                   GVRAVERFVEKPDLETATGYVSSGQYYWNSGMFLFKASRYLQELERFQPEMLASSRQAW
FT                   QQARRDADFTRLDKDAFTAVPSDSIDYAVMEKTADAVVIPLDAGWNDVGSWTALRDVSQ
FT                   QDGDGNAHQGDVIAIDCRNTYAYAQRLVALVGLDDVIVVETDDAVLVGKADRMQEVKTV
FT                   VAKLKAEGRSEATWHRKVYRPWGAYDSIDNGERFQVKRITVKPGGTLSLQMHHHRAEHW
FT                   IVVSGTAEVTRGSEVILLSENQSTYIPLGVTHRLRNPGKLPLELIEVQSGSYLGEDDIV
FT                   RFEDTYGRS"
FT   gene            complement(599417..600763)
FT                   /locus_tag="Smal_0509"
FT   CDS_pept        complement(599417..600763)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0509"
FT                   /product="Phosphomannomutase"
FT                   /EC_number="5.4.2.8"
FT                   /note="PFAM: phosphoglucomutase/phosphomannomutase ;
FT                   phosphoglucomutase/phosphomannomutase alpha/beta/alpha
FT                   domain I; phosphoglucomutase/phosphomannomutase
FT                   alpha/beta/alpha domain II;
FT                   phosphoglucomutase/phosphomannomutase alpha/beta/alpha
FT                   domain III; KEGG: xcb:XC_3608 phosphoglucomutase;
FT                   phosphomannomutase"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50214"
FT                   /db_xref="GOA:B4SJ46"
FT                   /db_xref="InterPro:IPR005841"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR016066"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="UniProtKB/TrEMBL:B4SJ46"
FT                   /protein_id="ACF50214.1"
FT                   /translation="MPLPAFKAYDIRGRVPEELNEDLARRIGVALAAQLAPGPVVLGHD
FT                   VRLTSAGLQDALAAGLRGTGREVIDIGLCGTEEVYFQTDHLGAAGGVMVTASHNPMDYN
FT                   GMKLVKENARPISSDTGLFAISDAVAGDTSEAQPPRAGQVAQHDKSAYIQHLLSYVDTS
FT                   RLKPLKLVVNAGNGGAGAIVDLLAPHLPFEFIRICHEPDGSFPNGIPNPLLPENRAATA
FT                   DAVREHGADFGIAWDGDFDRCFFFDHSGRFIEGYYLVGLLAKAILARNPGGKIVHDPRL
FT                   VWNTVDMVEQAGGVPVQCKSGHAFIKEKMRAEDAVYGGEMSAHHYFREFAYADSGMIPW
FT                   LLIAQLVSESGRSLADWVEDRMAAYPCSGEINFKVDDAKAAVARVMEHFAAQSPALDHT
FT                   DGISADFGDWRFNLRSSNTEPLLRLNVEARGDAALMQARTDEISRLIQQ"
FT   gene            600995..601951
FT                   /locus_tag="Smal_0510"
FT   CDS_pept        600995..601951
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0510"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase; 3-beta
FT                   hydroxysteroid dehydrogenase/isomerase;
FT                   dTDP-4-dehydrorhamnose reductase; Male sterility domain;
FT                   KEGG: xfa:XF0611 dTDP-glucose 4-6-dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50215"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B4SJ47"
FT                   /protein_id="ACF50215.1"
FT                   /translation="MKFTHDQKRVLVTGGAGFLGSHLCDRLIAAGHDVLCVDNFYTGSK
FT                   ANVDGLLGHPRFELMRHDVTFPLYVEVDRIFNLACPASPIHYQQDPVQTTKTSVHGAIN
FT                   MLGLAKRLRARILQASTSEVYGDPEIHPQVEGYWGRVNPIGIRSCYDEGKRCAETLFFD
FT                   YWRQHQLEIKVMRIFNTYGPRMHPNDGRVVSNFIVQALKGDPITIYGDGSQTRSFCYVD
FT                   DLIEGMLRLMDSPADLTGPINIGNPAEYTMLELAETVLRLVGGSSKIEYRPLPSDDPRQ
FT                   RQPDISLARADLGWEPRVGLEDGLKETIAYFRHRLQA"
FT   gene            601962..602906
FT                   /locus_tag="Smal_0511"
FT   CDS_pept        601962..602906
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0511"
FT                   /product="glycosyl transferase family 2"
FT                   /note="PFAM: glycosyl transferase family 2; KEGG:
FT                   xfa:XF0612 dolichol-phosphate mannosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50216"
FT                   /db_xref="GOA:B4SJ48"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:B4SJ48"
FT                   /protein_id="ACF50216.1"
FT                   /translation="MRKIVVMPVYEDLEASSKLFIELARTQGPDTYVVAVDDGSVRQPL
FT                   PISAIEASGLEGVVIRLRRNVGHQRAIAIGLSYVAEHFDGDNIVVAMDSDGEDTPESIT
FT                   ALVAGLDSADVDVVVASRRSRVESLRFKAFYVVYKLLFSLLSGRQISFGNFMAAKMPAV
FT                   RRLASMQELWIHVAACVLGSKLRVQTCALDRGPRYAGRSKMNFVGLALHGFRALMVFAE
FT                   DVLVRVGIACTVVAALSITGGVVATVLKMLGFASQGWFSLAFGILVLVFLQTAALTLII
FT                   LMLSGMMRSGGVLGVGSYREFVDEVLHATRRSA"
FT   gene            602884..603288
FT                   /locus_tag="Smal_0512"
FT   CDS_pept        602884..603288
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0512"
FT                   /product="GtrA family protein"
FT                   /note="PFAM: GtrA family protein; KEGG: xfn:XfasM23_1626
FT                   GtrA family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50217"
FT                   /db_xref="GOA:B4SJ49"
FT                   /db_xref="InterPro:IPR007267"
FT                   /db_xref="UniProtKB/TrEMBL:B4SJ49"
FT                   /protein_id="ACF50217.1"
FT                   /translation="MPPVVARKDALAGQFIRYVINGLAATAVHYGVLRFNIEVLHIPLA
FT                   AAANALAAVFGIIASFLGSRYFVFRGRQGNVARQGSLFLLVYAGIALLHGLVMYVWADR
FT                   LQLDYRIGFVLATGMQMTISFAANKFLVFK"
FT   gene            603285..603884
FT                   /locus_tag="Smal_0513"
FT   CDS_pept        603285..603884
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0513"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xfm:Xfasm12_1695 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50218"
FT                   /db_xref="GOA:B4SJ50"
FT                   /db_xref="UniProtKB/TrEMBL:B4SJ50"
FT                   /protein_id="ACF50218.1"
FT                   /translation="MNRYLRAVLATVIFVVALLLVYYVHMRHFRVNVVLYASILDAVIA
FT                   LVVVFAGLYLLKWFRDFSRLELIQLAAIWLLGGYVFAISVPTVIDRSLSFYILEKLQQR
FT                   GGGIREDAFHEVFTEEYVREHHLVEVRLTEQLQSGTVQIDGGCVRLTARGERLASFSRF
FT                   YRKNLLPTHRLLMGQYTDALTDPFRDSRMPTDYRCQ"
FT   gene            603934..604359
FT                   /locus_tag="Smal_0514"
FT   CDS_pept        603934..604359
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0514"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50219"
FT                   /db_xref="UniProtKB/TrEMBL:B4SJ51"
FT                   /protein_id="ACF50219.1"
FT                   /translation="MEDMSNLSVRRRPSPWQWAVAALLGVLLVLALASVARRSHFETPL
FT                   LRQALAEDAGFAASVPREVVDARELMRAQREDLSPLSLGQGLKDDPLLQQRMWEALYPA
FT                   RFSDADTPHRLLKADDPLAATCQVLDRRGNVVLANCR"
FT   sig_peptide     603934..604044
FT                   /locus_tag="Smal_0514"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.911) with cleavage site probability 0.453 at
FT                   residue 37"
FT   gene            604334..605536
FT                   /locus_tag="Smal_0515"
FT   CDS_pept        604334..605536
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0515"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sus:Acid_7379 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50220"
FT                   /db_xref="GOA:B4SJ52"
FT                   /db_xref="UniProtKB/TrEMBL:B4SJ52"
FT                   /protein_id="ACF50220.1"
FT                   /translation="MSFLPTAVELGRRAALAMLASLLLCYALAATGLMGWPVLVAFAIF
FT                   LVSALLALPAVRDLRVSPLVLVACALVLIALGSPSDGWDPRSIWLFHAKRIFLEGSLYA
FT                   QLDDYAPWSHNDYPALVPLLMASAAGLLGHWNELLPKAVAPLLLLPALLLIAPSLRSRW
FT                   LVALFALLLLSTGREMLLNGYMDALVAVYAVAVVATAVRARTTGGRPRAGELIAFVLLV
FT                   AVLSMLKNEGAVLAAVLTASVLVDGLLRERRLAWHIVLAVLVALLPLLAWKLSVDGAGV
FT                   GNDLAGSDMKGQLLARLGSDGGSQLILKRLLLDAWVLVPLLLLAVFWRRTLRTPVAMTS
FT                   LLAALAYAAVLFLVYLGTPHDLDWHLRTSADRVRLPVLLLLAFAMLSVLGPRATPVARA
FT                   E"
FT   sig_peptide     604334..604423
FT                   /locus_tag="Smal_0515"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.957 at
FT                   residue 30"
FT   gene            complement(605567..608881)
FT                   /locus_tag="Smal_0516"
FT   CDS_pept        complement(605567..608881)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0516"
FT                   /product="Non-specific serine/threonine protein kinase"
FT                   /EC_number="2.7.11.1"
FT                   /note="KEGG: bxe:Bxe_B1664 putative helicase; PFAM:
FT                   SNF2-related protein; helicase domain protein; zinc finger
FT                   SWIM domain protein; SMART: DEAD-like helicases"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50221"
FT                   /db_xref="GOA:B4SJ53"
FT                   /db_xref="InterPro:IPR000330"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR007527"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038718"
FT                   /db_xref="UniProtKB/TrEMBL:B4SJ53"
FT                   /protein_id="ACF50221.1"
FT                   /translation="MTPTFTDEDLFRWIDEWTLQKSEQCLGGVRNRQLRDGLLTAEVQG
FT                   SARHPYYVEIDLTASTRTARSRLQSACSCPVGRTCKHVAAVLVSYMLDSLAMDDESPLT
FT                   EQNLTQPPRPELLAELSRWQSARIQPAQPRRNGVIFELSTYNHHPAVLVRRVKYGTDGA
FT                   ISTGKWMDITADLLLDPPAYLTPTDLAVMIQLRTQRQPATKDEWIDFAATLQLIVSSGH
FT                   GWVSCGTHGDVPARSGAPRRGELGWTVGMTQGATLLEPALSVEGGARGVVLGRSACYLD
FT                   PVTGEVGPLLLDVRAEDADAFLSLPNLLPNEEAVVAQMLQQIDPALPRPGASDTLPTLQ
FT                   ISAMIPVLRLHTIEFRPAWLGRRDPSQWADIATVAFEYDEHVRFLDDPSLFAHDTEGRL
FT                   ALLPRDLAEEARREGELRSVKLHRDPQPRAVLDGAGPQFQLRTHDWTGFLLGDVPRLEA
FT                   LGWKVETDDDFRHRITRVDEIDLDIQADPEDAGWFNLGLEIQVDGRKVSMVPLLQQVLH
FT                   ADPRWSRGQLDAIGDDENILLTASGNTRLALQASRLKPIMALLADLFTQRGAPLRLSAH
FT                   DRGRLQALQDDAHLQFRGHKDTQALVQRLLQAPAPEDVAPPAGLQATLRSYQREGLSWL
FT                   QYLRQQGLGGVLADDMGLGKTLQTLAHLLVEKESGRLDRPALLVVPTSLLHNWQSEAAR
FT                   FTPGLRVLTLHGPAREALFEAIPEHDLVLTTYPLLWRDEQALQSHSYHLLILDEAQQVK
FT                   NPKSRAAVTLRTLQARHRLCLTGTPLENHLGELWTQFDFLLPGLLGSEKLFNQHWRHPI
FT                   ERGSDQRRAQLLAQRLRPFILRRRKDQVAAELPPKTLITRAVTMEGGQRDLYETVRAAM
FT                   EKQVREAISDSGLARSHIRVLDALLKLRQVCCDPRLLPGETPARNAGSAKLELLREMLP
FT                   SMVEEGRRILLFSQFTGMLALIAQALDGLGLAYVTLTGDTQDRVTPVQRFMQGEVPLFL
FT                   ISLKAGGVGLNLTAADTVIHFDPWWNPAAENQASDRAHRIGQQQPVFVYRLIAAGSIEE
FT                   RIAELQERKAMLAESILEGGGSAGPRFSEEDVQALLAPLPGALPARRKAGRQSKVR"
FT   gene            609042..609773
FT                   /locus_tag="Smal_0517"
FT   CDS_pept        609042..609773
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0517"
FT                   /product="3-oxoacid CoA-transferase, A subunit"
FT                   /EC_number="2.8.3.5"
FT                   /note="KEGG: xom:XOO_0726 IpsJ protein; TIGRFAM: 3-oxoacid
FT                   CoA-transferase, A subunit; PFAM: coenzyme A transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50222"
FT                   /db_xref="GOA:B4SJ54"
FT                   /db_xref="InterPro:IPR004163"
FT                   /db_xref="InterPro:IPR004165"
FT                   /db_xref="InterPro:IPR012792"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:B4SJ54"
FT                   /protein_id="ACF50222.1"
FT                   /translation="MQQSTSTGKRGKRFASAAEALQGVVADGQTLAVGGFGLCGIPEAL
FT                   IAALRDSGAKGLTVISNNAGVDGFGLGQLLETRQIKKMISSYVGENKEFERQFLAGELE
FT                   LEFNPQGTLAERLRAGGAGIPAFFTATGYGTVVAEGKETREFDGKHYVMETALRADVAL
FT                   VKAWKADEAGNLVFRKTARNFNPACAMAGKVCIVEVEEVVPVGAIDPDQVHLPGIYVHR
FT                   IVHNPHPEKRIEQRTIRAEGN"
FT   gene            609775..610407
FT                   /locus_tag="Smal_0518"
FT   CDS_pept        609775..610407
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0518"
FT                   /product="3-oxoacid CoA-transferase, B subunit"
FT                   /EC_number="2.8.3.5"
FT                   /note="KEGG: xcb:XC_3606 IpsJ protein; TIGRFAM: 3-oxoacid
FT                   CoA-transferase, B subunit; PFAM: coenzyme A transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50223"
FT                   /db_xref="GOA:B4SJ55"
FT                   /db_xref="InterPro:IPR004164"
FT                   /db_xref="InterPro:IPR004165"
FT                   /db_xref="InterPro:IPR012791"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:B4SJ55"
FT                   /protein_id="ACF50223.1"
FT                   /translation="MAWTRDEMAARAARELTDGAYVNLGIGLPTLVANHIPEGVDVWLQ
FT                   SENGLLGIGPFPTDAEVDADLINAGKQTVTARAGASYFGSHDSFAMIRGGHVNLAILGA
FT                   MQVTHKGDLANWMVPGKMVKGMGGAMDLVAGVQRVVVLMEHTAKNGEHKILAECTLPLT
FT                   GVGVVDRIITDLAVFDVTDKGLLLVEAAPGVSDDELKEKTGVAFVRA"
FT   gene            complement(610418..612478)
FT                   /locus_tag="Smal_0519"
FT   CDS_pept        complement(610418..612478)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0519"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xom:XOO_0728 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50224"
FT                   /db_xref="InterPro:IPR007739"
FT                   /db_xref="InterPro:IPR032719"
FT                   /db_xref="UniProtKB/TrEMBL:B4SJ56"
FT                   /protein_id="ACF50224.1"
FT                   /translation="MSGAASGIRQLSFSVLRALFRALPMPAALRDRLRNQGLDRIGSWS
FT                   PPPPRGRVGAAADGARALLRADERAIGYAAAEDAPLPAAPPATLVAFYLPQFHPFEEND
FT                   AWWGKGFTEWRNVSRALPQFEGHVQPRLPGDLGFYDLRVGETLRAQAKLATDHGIGAFC
FT                   FYFYWFSGHTLMEQPLRQWLADSTIELPFCLCWANENWTRRWDGRNQDVLIGQQHSEQD
FT                   DLAFIAHIAEYLRDRRALKVDGHPVLLLYRPQLLPDPKATAARWRGWCRDNGIGEIHLA
FT                   YVQSFERPDPRDIGFDAAVEFPPNIAAPRQLNTSQFLLNPGYEGDVRDWRELAAQMRTA
FT                   PLPDYPLYPGVNPGWDNEARRPGRGRVLLHASPRGYADWLHDTVHGRLRDVPPARRMVF
FT                   INAWNEWAESAVLEPDARLGHAWLQATRRAMTPSQPAPSRPCVVIHAWHLDALPELLSA
FT                   VKDSGLPARLVITTTSDRQAQVQSITESHGLPAEIWAYDNHGRDILPFLHAADRLLQQN
FT                   ESLVLKLHTKRSTHRDNGDQWRREMVDALLGPAQAAANLAHLQADPRLGLMAPAGHLLN
FT                   VADYIGGNAQRMERLWAQLGLDGAPGDGQFASGSMFWVRLQALRPLLDAHLLPSMFEVE
FT                   AGQIDGTLAHAIERATGAVATCAGFSVGDTSQVHGAPPQPASAGYPYARGG"
FT   gene            612595..613182
FT                   /locus_tag="Smal_0520"
FT   CDS_pept        612595..613182
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0520"
FT                   /product="2OG-Fe(II) oxygenase"
FT                   /note="PFAM: 2OG-Fe(II) oxygenase; KEGG: xac:XAC3574 DNA
FT                   repair system specific for alkylated DNA"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50225"
FT                   /db_xref="GOA:B4SJ57"
FT                   /db_xref="InterPro:IPR005123"
FT                   /db_xref="InterPro:IPR027450"
FT                   /db_xref="InterPro:IPR037151"
FT                   /db_xref="UniProtKB/TrEMBL:B4SJ57"
FT                   /protein_id="ACF50225.1"
FT                   /translation="MLFPHDLPDAEVQHLPGWLPAGEADALLLALRAEVPWEVHRIRMF
FT                   GNWVDSPRLSCWIGDPQARYRYSGAEFVPHPWPLSLQGVREHLETEGLGRFNSVLLNRY
FT                   RGGGNYMGWHSDDEPELGPSPVIASLSLGAARRFLLRRRDDPARKAEFLLGHGDLLVMA
FT                   GQTQRFYQHALPKMARVQGERINLTFRWITPR"
FT   gene            complement(613254..613895)
FT                   /locus_tag="Smal_0521"
FT   CDS_pept        complement(613254..613895)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0521"
FT                   /product="protein of unknown function DUF330"
FT                   /note="PFAM: protein of unknown function DUF330; KEGG:
FT                   xcb:XC_3602 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50226"
FT                   /db_xref="InterPro:IPR005586"
FT                   /db_xref="UniProtKB/TrEMBL:B4SJ58"
FT                   /protein_id="ACF50226.1"
FT                   /translation="MSPTTLPRLLLATSMLALLGGCSILGSSEKTAVTLYSPSVQVKAD
FT                   PAWPQASWQLVLAKPSAARMVDSPRINVRPTPSQLEIYKGASWAQPATDMIEDTLLRGF
FT                   EDSGRIRGVARSTAGIRADYKLSTDVRRFESDYQGQATPTVVIEVNAKLIHVADQRVVA
FT                   DRTFRQSQPVGSTDVPAVTAAFERGLQQLAQDVVGWTLQSGQADQPTVTR"
FT   sig_peptide     complement(613812..613895)
FT                   /locus_tag="Smal_0521"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.996) with cleavage site probability 0.685 at
FT                   residue 28"
FT   gene            complement(613892..614818)
FT                   /locus_tag="Smal_0522"
FT   CDS_pept        complement(613892..614818)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0522"
FT                   /product="Mammalian cell entry related domain protein"
FT                   /note="PFAM: Mammalian cell entry related domain protein;
FT                   KEGG: xac:XAC3572 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50227"
FT                   /db_xref="GOA:B4SJ59"
FT                   /db_xref="InterPro:IPR003399"
FT                   /db_xref="UniProtKB/TrEMBL:B4SJ59"
FT                   /protein_id="ACF50227.1"
FT                   /translation="METKANYVLIGAFTLITGLALLAFGLWAAKYSSDRTWQEYRVVFR
FT                   EAVTGLSVGSPVQYNGIAVGSIIELNLVPDDPRQVVARIRLNSTTPVKTDTRAKLAITS
FT                   LTGPSIIQLSGGTPQSPALTTVNKDPAPIIPTTPSALQNITDVANRIVERMDQILSDRN
FT                   VASINATLANLETISGGLADRDQGTQALLLSARDAARSLDTTLKTTNGTIERLDKNLVQ
FT                   QLPGIIDKLDGTLVKLDSAAGNADSILGENRAAINSFANDGLGQLGPTLTELRGLIRDL
FT                   RRVSDRLENNPARYLLGRDAPKEFEPQ"
FT   sig_peptide     complement(614732..614818)
FT                   /locus_tag="Smal_0522"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.994) with cleavage site probability 0.944 at
FT                   residue 29"
FT   gene            complement(614822..615649)
FT                   /locus_tag="Smal_0523"
FT   CDS_pept        complement(614822..615649)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0523"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: xac:XAC3571 ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50228"
FT                   /db_xref="GOA:B4SJ60"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B4SJ60"
FT                   /protein_id="ACF50228.1"
FT                   /translation="MSTHPTPEEVPMRDDDGHDLAIRVRGLVNRFGSQTVHEDLDLDVR
FT                   RGEILGVVGGSGTGKSVLMRSILGLRVPDAGQIEVLGRDARADDAESRLHIERNTGVLF
FT                   QDGALFSSLTVGENVQVPLKEHHRELPERWHYELALLKVKLAGLPADAINKLPSQLSGG
FT                   MRKRAGLARALALDPPLLFLDEPTAGLDPIGAAAFDRLIKTLQEALGLTVFLITHDLDT
FT                   LYAICDRVAVIADRKVVANAPLPEIEKLDHPWIQEYFHGPRARAARGEQIESA"
FT   gene            complement(615651..616772)
FT                   /locus_tag="Smal_0524"
FT   CDS_pept        complement(615651..616772)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0524"
FT                   /product="protein of unknown function DUF140"
FT                   /note="PFAM: protein of unknown function DUF140; KEGG:
FT                   xac:XAC3570 ABC transporter permease"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0524"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50229"
FT                   /db_xref="GOA:B4SJ61"
FT                   /db_xref="InterPro:IPR003453"
FT                   /db_xref="InterPro:IPR030802"
FT                   /db_xref="UniProtKB/TrEMBL:B4SJ61"
FT                   /protein_id="ACF50229.1"
FT                   /translation="MAQVTPNHAPQLEQDAHDPGLIRLSGTWTLKTALAAAEVLRDVPD
FT                   TLTGIDATGIEKMDSAGVLQVLRVAHRADLGEDALQFRPDHQALVCTIEEVADDRPKPK
FT                   RDFGVLAALERLGVSVHATGHNIKALCSFLGENLVKAARLVKEPRRFRLTATVHQMEQV
FT                   GLDAVPLVALLSYLVGAVIAFLGSTILRDFGAEIYVVELVNIAFLREFAVLLTAIVLAG
FT                   RTASAFTAQIGAMKAREEIDAMRTLGLDPIDLLVLPRLFALLVTLPLLTFIAMVAGLAG
FT                   GITVGAFDLDIPPQMYIARMHDTMEVRHMLVGLSKAPVFALVIGLIGCLEGLKVEGTAQ
FT                   SVGERTTSSVVQTISLVIIIDAFAALWFMHMDW"
FT   gene            616865..618124
FT                   /locus_tag="Smal_0525"
FT   CDS_pept        616865..618124
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0525"
FT                   /product="protein of unknown function DUF1212"
FT                   /note="PFAM: protein of unknown function DUF1212; KEGG:
FT                   xcb:XC_3598 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50230"
FT                   /db_xref="GOA:B4SJ62"
FT                   /db_xref="InterPro:IPR010619"
FT                   /db_xref="InterPro:IPR024528"
FT                   /db_xref="UniProtKB/TrEMBL:B4SJ62"
FT                   /protein_id="ACF50230.1"
FT                   /translation="MSADAHTIPTPQATYAQRVAFVSEIAGRLHSYGTTAQRLETAVVA
FT                   LARQLDLDCEPWSNPTGIILSFSDPAQAIGSSDITRVIRLAPGENDLHKLSVADHIAEE
FT                   VANGRMSIAQGHTALRQLDKDPGRRGKLRTILSFTLGAAGVAGMWKLPWLDIATAGVIG
FT                   LMIGLLGMVTDRRPATREAAEALAALLAGLVATLVASFVGALNLNTVIIASLVVLLPGM
FT                   SLTNAVNELASQHWVSGTARFAGALTTIMKLSVGAMIAVTLADVLGLDPVIRATRPQGP
FT                   WVEWGSLLTAAFAFAMLFKANRRDYPWVIAASVAGYAISKFGGHAWGAPAGIFLSAMLL
FT                   TAGGNLFGRLVGRPGAIIRLPGIIMMVPGSTSLRGVLTLVQQQDVGAGQSVFLTVLNVV
FT                   MALVAGLLFGNLLMPARKTL"
FT   gene            complement(618255..618638)
FT                   /locus_tag="Smal_0526"
FT   CDS_pept        complement(618255..618638)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0526"
FT                   /product="histone family protein nucleoid-structuring
FT                   protein H-NS"
FT                   /note="PFAM: histone family protein nucleoid-structuring
FT                   protein H-NS; KEGG: xcb:XC_3597 DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50231"
FT                   /db_xref="GOA:B4SJ63"
FT                   /db_xref="InterPro:IPR001801"
FT                   /db_xref="InterPro:IPR027444"
FT                   /db_xref="InterPro:IPR037150"
FT                   /db_xref="UniProtKB/TrEMBL:B4SJ63"
FT                   /protein_id="ACF50231.1"
FT                   /translation="MSIDLTGLSARELGALIRTAKKQQTIVAKRRPITKVRAQLIKLAK
FT                   TEGYTIEELFGDAPAPRARKVAKAAKAPSKTAGRKLGKVAPKYRNPANPKETWTGRGKQ
FT                   PRWMAELTAKGNKKPEDFLIKKA"
FT   gene            complement(618861..620564)
FT                   /locus_tag="Smal_0527"
FT   CDS_pept        complement(618861..620564)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0527"
FT                   /product="prolyl-tRNA synthetase"
FT                   /EC_number="6.1.1.15"
FT                   /note="KEGG: xac:XAC3567 prolyl-tRNA synthetase; TIGRFAM:
FT                   prolyl-tRNA synthetase; PFAM: tRNA synthetase class II (G H
FT                   P and S); Anticodon-binding domain protein;
FT                   YbaK/prolyl-tRNA synthetase associated region"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50232"
FT                   /db_xref="GOA:B4SJ64"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002316"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR004500"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR007214"
FT                   /db_xref="InterPro:IPR023717"
FT                   /db_xref="InterPro:IPR033730"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="InterPro:IPR036754"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4SJ64"
FT                   /protein_id="ACF50232.1"
FT                   /translation="MRLSQFHLHTTKETPSDAELTSHRLMLRAGMIRKLASGLYTWSPL
FT                   GLRVLRKVERIVREEMDRAGAVEFQIPTIQPKELWEQTGRWQKFGPQLLKIKDRKDQTF
FT                   CYSPTAEEAACDFARSELSSYKQLPVNFYQIQTKFRDEIRPRFGVMRSREFLMKDAYSF
FT                   HLHDECLVREYENMKSAYSRIFTRLGLDFRMVQADSGAIGGDASQEFHVIADSGEDALV
FT                   FSTGSDYAANMEAAIAADPAPRAAASEAMRKVDTPTQKTCEDVAALLGINLQRTVKSVA
FT                   LIAGEGEAQQFVLVLVRGDHEVNEIKLAKVAGLDEQRFASEAEIAEHLGSVPGFLGPIA
FT                   PAKAIRVVADREVAAMSDFVVGANEAGFHLAGVNWGRDLAEPEVADIRNVRAGDRALDG
FT                   GELKIARGIEVGHVFQLGRTYARALDATVLDENGKAAVMAMGCYGIGISRVVAAAIEQN
FT                   HDDAGIIWPDAMAPWQVVVCVINPKGDAAVADAATNLLQELRDAGLDAALDDRGLRPGA
FT                   MFADMELIGIPHRVVVSERGLAAGTYEYRSRRASEAESLDKATLLQRLQG"
FT   gene            complement(621158..621532)
FT                   /locus_tag="Smal_0528"
FT   CDS_pept        complement(621158..621532)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0528"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xfn:XfasM23_1728 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50233"
FT                   /db_xref="InterPro:IPR025392"
FT                   /db_xref="UniProtKB/TrEMBL:B4SJ65"
FT                   /protein_id="ACF50233.1"
FT                   /translation="MRALSCLGCLLLLASANAVAGPVYKWKDANGVTQYSETPPAGKKF
FT                   ETREQARSPQAAASAETPAAPVPEQCSTARANLALLDSTGTVMQDTNGDGKADTALTQE
FT                   QRSAQKGLAEAAIKAYCPAE"
FT   sig_peptide     complement(621470..621532)
FT                   /locus_tag="Smal_0528"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.980 at
FT                   residue 21"
FT   gene            621613..622389
FT                   /locus_tag="Smal_0529"
FT   CDS_pept        621613..622389
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0529"
FT                   /product="CDP-diacylglycerol/serine
FT                   O-phosphatidyltransferase"
FT                   /note="TIGRFAM: CDP-diacylglycerol/serine
FT                   O-phosphatidyltransferase; PFAM: CDP-alcohol
FT                   phosphatidyltransferase; KEGG: xac:XAC3565
FT                   phosphatidylserine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50234"
FT                   /db_xref="GOA:B4SJ66"
FT                   /db_xref="InterPro:IPR000462"
FT                   /db_xref="InterPro:IPR004533"
FT                   /db_xref="UniProtKB/TrEMBL:B4SJ66"
FT                   /protein_id="ACF50234.1"
FT                   /translation="MDPITPPPRSRTIYLLPNLFTTAGLFAGFYAIIAAANGDFVNASI
FT                   AVFVAAVMDGLDGRVARLTGTSSEFGVQYDSLADLVSFGMAPALVMYHWSLSWLKFDDP
FT                   LLGRVGWAVAFLYAACAALRLARFNTQVAVVDKRWFVGLASPAAAGLMMSFVWAFADGN
FT                   LGWDGNQLRYVALAVTIVSALLMVSRIRFWSFKGGAAKGGRSDRVPFLVLALVPVAIAI
FT                   AVIDLPRVLFAVGILYALSGPVMWAVQRLRKKPEAA"
FT   gene            622386..622889
FT                   /locus_tag="Smal_0530"
FT   CDS_pept        622386..622889
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0530"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xom:XOO_0740 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50235"
FT                   /db_xref="UniProtKB/TrEMBL:B4SJ67"
FT                   /protein_id="ACF50235.1"
FT                   /translation="MSQDLPVLWSSAQQAWLQAMGYTVYHDGQLAAELDAALQLSVAEA
FT                   EAAQPAEPARASSPIAREHPAEAVPAPRAERPAPPRRETPVSAPDTAPAPARPLPSGNA
FT                   RQPVVRLPDRLQIALLRASGCNPNDPATQTLMESWPLDQLRHDPAAKRALWPQLRALRK
FT                   RGMP"
FT   gene            622886..623383
FT                   /locus_tag="Smal_0531"
FT   CDS_pept        622886..623383
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0531"
FT                   /product="ribosomal-protein-alanine acetyltransferase"
FT                   /note="TIGRFAM: ribosomal-protein-alanine
FT                   acetyltransferase; PFAM: GCN5-related N-acetyltransferase;
FT                   KEGG: xcv:XCV3688 putative acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50236"
FT                   /db_xref="GOA:B4SJ68"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR006464"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:B4SJ68"
FT                   /protein_id="ACF50236.1"
FT                   /translation="MSAVRQPGPVSLRALRESDLTVVMAIEVRGYPFPWTRGIFVDCLR
FT                   AGYPGLAMERDGELIGYGMLSIAADEAHVLNICIDPLTQSRGLGRQLLRALVQLAGDRG
FT                   AQRVFLEVRPSNTPALALYHSEGFNEIGRRPRYYPAAQGREDAVVMAIELVHGDLQAMP
FT                   PL"
FT   gene            complement(623451..624272)
FT                   /locus_tag="Smal_0532"
FT   CDS_pept        complement(623451..624272)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0532"
FT                   /product="protein of unknown function DUF6 transmembrane"
FT                   /note="PFAM: protein of unknown function DUF6
FT                   transmembrane; KEGG: cti:RALTA_B0369 putative transmembrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50237"
FT                   /db_xref="GOA:B4SJ69"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:B4SJ69"
FT                   /protein_id="ACF50237.1"
FT                   /translation="MPLSIFLLVLAAAALHASWNAIVKRGPDKFLGTVLVTGSAALLSA
FT                   AALPFLPFPAAHSWPWLAASVLLQVTYYGLVARCYQQVDMSLAYPLMRGSAPILVALAG
FT                   TLLGEQLSPAAWLGVVLVSTGILCMALGARGGQLRLPLLTAAMIATYTLVDAQGARQSG
FT                   SALSYTLWLFLLSGIPLPLWALYTRGGAVLDYARQHWPLGLAGGAGTTASYAMALWAMT
FT                   QAPVAMVSALRESSILFALLISVFLLRERIPRARWLAAALIVGGVLALRLA"
FT   sig_peptide     complement(624219..624272)
FT                   /locus_tag="Smal_0532"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.996) with cleavage site probability 0.802 at
FT                   residue 18"
FT   gene            complement(624366..627194)
FT                   /locus_tag="Smal_0533"
FT   CDS_pept        complement(624366..627194)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0533"
FT                   /product="valyl-tRNA synthetase"
FT                   /note="TIGRFAM: valyl-tRNA synthetase; KEGG: xcb:XC_3588
FT                   valyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50238"
FT                   /db_xref="GOA:B4SJ70"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002303"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR019499"
FT                   /db_xref="InterPro:IPR033705"
FT                   /db_xref="InterPro:IPR037118"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4SJ70"
FT                   /protein_id="ACF50238.1"
FT                   /translation="MTQLASSYDPKSFETDLYEAWEKAGHFKPSGTGEPYTILLPPPNV
FT                   TGTLHMGHAFQQTLMDALVRYHRMRGYDTLWQVGTDHAGIATEMVVSRNLALEGKGETR
FT                   DSLGREGFIGKVWEWKQQSGDIIERQMRRLGTSADWSRSTFTMDPQPSAAVNEAFVRWY
FT                   EQGLIYRGQRLVNWDPVLKTAISDLEVESAEEDGFLWSIAYTLDDGLSYEHVERDADGV
FT                   ETLRETRDYLVVATTRPETLLGDTAVMVHPEDARYAHLIGKSVVLPLTGRRVPVIADDY
FT                   VDRAFGTGVVKVTPAHDFNDYEVGVRHSLPMINLFTPVAALNENAPERFQGLDRYAARK
FT                   AVLAELEDLGILVETKAHKLQVPRGDRTGQVIEPYLTDQWFVKMDDLAKRGLELVEDGS
FT                   ISFVPPNWINTYRHWMNNIQDWCISRQLWWGHRIPAWFDEATGSCYVGRSEEEVRAKHS
FT                   LGSDVVLNQESDVLETWFSSQLWPFSTLGWPNEQAMAERGFDRYLPSSVLITGFDIIFF
FT                   WVARMIMATDNLVGKIPFKDVYFTGLIRDGQGQKMSKSKGNVLDPLDIIDGISIDDLVA
FT                   KRTGGLMQPKMVEKIEKATRKEFPDGIAAHGADALRFTIAALATHGRDIKFDMNRAEGY
FT                   KNFCNKLWNASRFTLMNTEGAAFTGMPTPRTDAERWILSRLAAVSSEAQGHYANYRFDL
FT                   LAQCLYEFAWNEFCDWFLELSKPALNGADAADAESTRHTLLYVLEALLRLLHPLTPFIT
FT                   EQLWQQLAPRLGLAETTLSLRPYPTAAEFEGDFAQAEADVEWLKAVISAVRRVRSELNV
FT                   APSKQVPLRLQAGLEQDRVRIERFSASLSFLLKLDSIQWLAEGESAPPAAAAIVGELKL
FT                   LVPLEGLVDLDAERVRLDKEIARVEVEKEKSETKLAKFTDKVPPAVVEQERVRLVDWNT
FT                   QLAGLREQRAKL"
FT   gene            complement(627228..627419)
FT                   /locus_tag="Smal_0534"
FT   CDS_pept        complement(627228..627419)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0534"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bmn:BMA10247_A2104 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50239"
FT                   /db_xref="GOA:B4SJ71"
FT                   /db_xref="InterPro:IPR000612"
FT                   /db_xref="UniProtKB/TrEMBL:B4SJ71"
FT                   /protein_id="ACF50239.1"
FT                   /translation="MRLLIALILPWLSFFTIGRPFAGIVCLILQITLIGWLPAAIWAAY
FT                   AVSQYHTDQKIRRALGPR"
FT   sig_peptide     complement(627351..627419)
FT                   /locus_tag="Smal_0534"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.655) with cleavage site probability 0.549 at
FT                   residue 23"
FT   gene            complement(627439..627864)
FT                   /locus_tag="Smal_0535"
FT   CDS_pept        complement(627439..627864)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0535"
FT                   /product="DNA polymerase III chi subunit HolC"
FT                   /note="PFAM: DNA polymerase III chi subunit HolC; KEGG:
FT                   xcb:XC_3586 DNA polymerase III subunit chi"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50240"
FT                   /db_xref="GOA:B4SJ72"
FT                   /db_xref="InterPro:IPR007459"
FT                   /db_xref="InterPro:IPR036768"
FT                   /db_xref="UniProtKB/TrEMBL:B4SJ72"
FT                   /protein_id="ACF50240.1"
FT                   /translation="MPRADFYLIAKPRFLTEPLRLVCELARKANDAGLFTLVLARDQAQ
FT                   AEELDELLWAFDNDAYIPHQIAGEDMDEEEALVLIAVPGTEAPARPLVINLRDEPWLGQ
FT                   CERVLEVVPADPEAREPLRERWRQYKAAGYDLNKHDM"
FT   gene            complement(627947..629425)
FT                   /locus_tag="Smal_0536"
FT   CDS_pept        complement(627947..629425)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0536"
FT                   /product="Leucyl aminopeptidase"
FT                   /EC_number="3.4.11.1"
FT                   /note="PFAM: peptidase M17 leucyl aminopeptidase domain
FT                   protein; KEGG: xcv:XCV3681 leucyl aminopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50241"
FT                   /db_xref="GOA:B4SJ73"
FT                   /db_xref="InterPro:IPR000819"
FT                   /db_xref="InterPro:IPR008283"
FT                   /db_xref="InterPro:IPR011356"
FT                   /db_xref="InterPro:IPR023042"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4SJ73"
FT                   /protein_id="ACF50241.1"
FT                   /translation="MALEFTLNHLAAASAAVDCLVVGAYADHTLTAAAQALDAASGGRL
FT                   AALAQRGDLSGKTGATTLLHDLPGVTAPRVLVVGLGEAARFGVPQYLKAVGDAVRALKA
FT                   GAVRSALFTLSEVAVKDRDAAWAIRQAVIAADHAAYRYTATLGKKKADDAGLAQLAIAG
FT                   DDAQALAQGQAIAAGVEFARELGNLPPNYCTPAYLAEVGVKFAGEHDGAEAEILDEHQM
FT                   EALGMGSLLAVARGSANRPRLVVLKWNNGGDAKPYVLVGKGITFDTGGVNLKTQGGIEE
FT                   MKYDMCGGANVIGTFVAAVKAKLPLNLVVVVPAVENAIDGNAYRPSDVITSMSGKTIEV
FT                   GNTDAEGRLILCDALTYAQRFEPAALVDVATLTGACMVALGHQTAGLMSKHDDLANELL
FT                   AAGEQVFDRAWRLPLWDEYQPMLDSTFADVYNIGGRWAGAITAGCFLSRFAEGQRWAHL
FT                   DIAGVASDEGKRGMATGRPVGLLSQWLLDQAARA"
FT   gene            629530..630612
FT                   /locus_tag="Smal_0537"
FT   CDS_pept        629530..630612
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0537"
FT                   /product="permease YjgP/YjgQ family protein"
FT                   /note="PFAM: permease YjgP/YjgQ family protein; KEGG:
FT                   xcb:XC_3584 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50242"
FT                   /db_xref="GOA:B4SJ74"
FT                   /db_xref="InterPro:IPR005495"
FT                   /db_xref="InterPro:IPR030922"
FT                   /db_xref="UniProtKB/TrEMBL:B4SJ74"
FT                   /protein_id="ACF50242.1"
FT                   /translation="MLKLDRYLLGDFVQSFLATLIVLLVVSVGGVLVDILGNIADGRLP
FT                   AKLLFSQLGLQFIAYLPLILPLALMLGLLLAVARLYRDSEMAVITAIGVGPKRLLRPLL
FT                   MLVLPVVALVGACSLWLGPWAGRVAEQMIIEANRSVLMAGLEPGRFTPLPNGGVVYLSS
FT                   ISPDGTRLGRVFLQRQKDDRLEVVSAAGGRMFFEGARQRFLELDDGHQVEGPVAGGLDY
FT                   RLATFARNDVALPDGAQTRTENDPELMPTTKLFGDARPEAQAQLHRRLAPPLIALAFAL
FT                   LTVPLGRSSPRQQRYGRMMLALLAYMVGTNLMFIGSGWIATGKIPAALGLWWLTLPLLG
FT                   LAIWMYARDGRLGRPKGAHA"
FT   gene            630609..631715
FT                   /locus_tag="Smal_0538"
FT   CDS_pept        630609..631715
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0538"
FT                   /product="permease YjgP/YjgQ family protein"
FT                   /note="PFAM: permease YjgP/YjgQ family protein; KEGG:
FT                   xcb:XC_3583 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50243"
FT                   /db_xref="GOA:B4SJ75"
FT                   /db_xref="InterPro:IPR005495"
FT                   /db_xref="InterPro:IPR030923"
FT                   /db_xref="UniProtKB/TrEMBL:B4SJ75"
FT                   /protein_id="ACF50243.1"
FT                   /translation="MRLRPMRFDLYLGQSVFTTVLLTWTVLVGLDVVMAFSGEFKDIGK
FT                   NGYSLGHAAAWVLYTVPRRAYTFFPTAAVIGALMGLGQLAATSELTALRALGLSRKRLS
FT                   VSVAIALSLLTAVMVLSAETLGPWGQDRADALKSSAKWGQDISTARYSGLWAREGDTFL
FT                   SAAGGEEQLVGDKGTRLILRDVRLYRIAEDGQIASLTHAATAEHDNDGWVLTGVRRDTF
FT                   GERSATREEVAREPWNSKLDAGALATGIAKPRNLSVAELRTSIEYRERNGLDARDYEDV
FT                   YWSRWFYPVNVLALCLAAVPFAFGSLRSGGMGKRLFLGILFALGFWLLQLFFGRMAGAL
FT                   KFDYRIAYALPPIVMLAISGLLFRRKSG"
FT   gene            complement(631798..632289)
FT                   /locus_tag="Smal_0539"
FT   CDS_pept        complement(631798..632289)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0539"
FT                   /product="RDD domain containing protein"
FT                   /note="PFAM: RDD domain containing protein; KEGG:
FT                   xom:XOO_0763 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50244"
FT                   /db_xref="GOA:B4SJ76"
FT                   /db_xref="InterPro:IPR010432"
FT                   /db_xref="UniProtKB/TrEMBL:B4SJ76"
FT                   /protein_id="ACF50244.1"
FT                   /translation="MSRPATDTATAATTEMPRPRALLLWRTLAMVYDTLPVLALWMLAG
FT                   TLFTIAYTLDGHTQRENIAPFSAWQWLLWAVCWAITGWYATASWRRGGQTLGMRPWRLK
FT                   LESSDGTPLRRRQLWLRFAVGTLSLLLGGIGFWWALIDRQRLTWHDRASGTRLVRMPKR
FT                   "
FT   gene            632346..633323
FT                   /locus_tag="Smal_0540"
FT   CDS_pept        632346..633323
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0540"
FT                   /product="tyrosine recombinase XerD"
FT                   /note="TIGRFAM: tyrosine recombinase XerD; PFAM: integrase
FT                   family protein; integrase domain protein SAM domain
FT                   protein; KEGG: xcb:XC_3580 site-specific tyrosine
FT                   recombinase XerD"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50245"
FT                   /db_xref="GOA:B4SJ77"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR011932"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR023009"
FT                   /db_xref="UniProtKB/TrEMBL:B4SJ77"
FT                   /protein_id="ACF50245.1"
FT                   /translation="MAPVSTPAERRQLVQQLPELRADDSLRIQRFLDAIWAENGLARAT
FT                   LDSYRRDLEGLARWTDGREGGLAGIERPGLFDYLAWRTRHGWSPRSNARLLSALRAFFA
FT                   DGVRRGDRSEDPSALLDPPKLPRLLPKALAESQIDALLAAPDIDSPLGLRDRAMLELMY
FT                   AAGLRVSELVLLPATAVNLRQGVLRVTGKGSKERLVPLGEESQHWLERYLQQSRPQLVG
FT                   KGKVQALADGQTPLFIEPTLHALTRQAFWHLVKRHAQVAGIDPARISPHALRHSFATHL
FT                   LNRGADLRALQMLLGHSSLSTTQIYTLVAREHLQKLHARHHPRG"
FT   gene            633424..634215
FT                   /locus_tag="Smal_0541"
FT   CDS_pept        633424..634215
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0541"
FT                   /product="protein disulfide isomerase precursor"
FT                   /note="KEGG: xcv:XCV3675 protein disulfide isomerase
FT                   precursor"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50246"
FT                   /db_xref="GOA:B4SJ78"
FT                   /db_xref="InterPro:IPR009094"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR018950"
FT                   /db_xref="InterPro:IPR033954"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B4SJ78"
FT                   /protein_id="ACF50246.1"
FT                   /translation="MLRFAIAAVFGALSLTACAQPAPPAAKAPATAAAAKAASPAANGS
FT                   ADQAVRAALTALNPGFEVDYIGAAPFPGFREVVVSGQLLYVSDDGRYLFQSQPYDTRAK
FT                   GPANSEGLLGYRRDLLAKANHGDRIVFAAPNAKYTISVFTDIECGYCRKLHQDIAELNR
FT                   NGISVEYLAFPRMGLGSKDYTDMISVWCAADRRQALTSAKRGGSVPAKSCTNPVAMQYA
FT                   LGQQLGVNGTPAIFAPDGTQLGGYLPPAQLRAALEKLSAKR"
FT   sig_peptide     633424..633483
FT                   /locus_tag="Smal_0541"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.990 at
FT                   residue 20"
FT   gene            complement(634337..636448)
FT                   /locus_tag="Smal_0542"
FT   CDS_pept        complement(634337..636448)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0542"
FT                   /product="glycoside hydrolase family 18"
FT                   /note="PFAM: glycoside hydrolase family 18;
FT                   Carbohydrate-binding family V/XII; Fibronectin type III
FT                   domain protein; SMART: chitinase II; KEGG: cvi:CV_4240
FT                   probable chitinase"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50247"
FT                   /db_xref="GOA:B4SJ79"
FT                   /db_xref="InterPro:IPR001223"
FT                   /db_xref="InterPro:IPR001579"
FT                   /db_xref="InterPro:IPR003610"
FT                   /db_xref="InterPro:IPR003961"
FT                   /db_xref="InterPro:IPR011583"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR029070"
FT                   /db_xref="InterPro:IPR036116"
FT                   /db_xref="UniProtKB/TrEMBL:B4SJ79"
FT                   /protein_id="ACF50247.1"
FT                   /translation="MYDPLVLSADVRSAERSLHRCRPRRLAWLLALAGAVALPGLAQAA
FT                   SCAGVAQWDQAKIYRAGDTLQKGGVLYRANQDIWNAPPDHPAGAPYYTNLGACDGSGSN
FT                   QPPVVSLTSPANGATFSAGSTVNVTANASDADGSVAKVEFFRDGSSLGVATNAPYAASW
FT                   ANASAGSHTLRAVATDNNNATASTATISITVNAAGGDTTAPSVPGGLAVGTRTANSIAL
FT                   SWSPSTDNTGGSGLAGYDVYRNGSLVGSPSSASYVDGGLTASTTYRYRVRARDNAGNAS
FT                   AQGTEISATTLAGNGGGTGKRVIGYFTQWGIYGRNYRVKNIDSSGSAARLTHINYAFGN
FT                   VRNNRCEVGITQPSDPNSGAGGDAFADYTKAFGAGESVSGSADTWDQPLRGNWNQLKQL
FT                   KAKHPGLKVLISLGGWTWSRGFSSAARPENRQAFVASCIDAYIKGNLPVTDGAGGAGAA
FT                   LGVFDGIDIDWEYPVACGIECGKPEDNANFTALMAEFRRQLDAVRPGLLLTVAVGAGID
FT                   KIRVTDPAAYHPYLDYINVMTYDFHGAWDAKTNHQSALFDSPNDPSTGDQKLYNSNDAI
FT                   EAFISRGVPAAKLNLGIGYYGRGWTGVANANNGLYQTATGAAPGTYEAGIEDWKVLKNL
FT                   AWPGYTDNTAGATWIYNGSTLWSFDTPANITRKMGYVKTQGLGGAFVWEFSGDDAQGTL
FT                   TKAVSDGLQ"
FT   sig_peptide     complement(636314..636448)
FT                   /locus_tag="Smal_0542"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.956) with cleavage site probability 0.911 at
FT                   residue 45"
FT   gene            637280..641164
FT                   /locus_tag="Smal_0543"
FT   CDS_pept        637280..641164
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0543"
FT                   /product="phosphoribosylformylglycinamidine synthase"
FT                   /EC_number="6.3.5.3"
FT                   /note="KEGG: xcb:XC_3578 phosphoribosylformylglycinamidine
FT                   synthase; TIGRFAM: phosphoribosylformylglycinamidine
FT                   synthase; PFAM: AIR synthase related protein; AIR synthase
FT                   related protein domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50248"
FT                   /db_xref="GOA:B4SJ80"
FT                   /db_xref="InterPro:IPR010073"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR036604"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="InterPro:IPR040707"
FT                   /db_xref="InterPro:IPR041609"
FT                   /db_xref="UniProtKB/TrEMBL:B4SJ80"
FT                   /protein_id="ACF50248.1"
FT                   /translation="MMVLEGAPALSPFRRERLESRLQSIAPSLRISGAWHVYFVQPEGS
FT                   AVPDLTTLCRILEAAPQAEAVAEGAVSRIVVPRLGTLSPWSSKATELVRGAGQPVSRVE
FT                   RGLRIDVQGWPADAAAQQALIKALHDPMTQSVLENVEQGQALFSTPARGELERVPVDQL
FT                   EAANQRLGLAMAQDEIDYLRERFSALGRSPSDVELMMFAQANSEHCRHKIFNASWTIDG
FT                   QEQDRSLFRMIKNTHQQTPQHTLSAYSDNAAVIEGHPASRYRPDPASGEYRSEPSVPSA
FT                   FQIKVETHNHPTAIAPFPGASTGAGGEIRDEGATGRGGKPKAGLSGFSVSHLRIPELPQ
FT                   PWEAPRALNPRMAPALEIMTDGPLGGAAFNNEFGRPALLGYFRSFELPEGADLVRAYDK
FT                   PIMLAGGLGAIDRVQVDKILLQDGDAVIVLGGPAMLIGLGGGAASSVASGESAEDLDFA
FT                   SVQRDNPEMERRCQEVIDRCVAMGADNPIKFFHDVGAGGLSNAIPELLHDSKVGGIIDL
FT                   GKVPTDDPSLSPMQLWCNESQERYVLGVAQERLAEFAALCARERCPFAAVGVATAEEHL
FT                   VVAYGAVPGNIPADAPIDLPMDVLFGKPPKMHRDTAHPPAPRWPALKTGGLDLQEAGLR
FT                   VLAHPTVASKNFLVTIGDRSVGGLTAREQMVGPWQLPVADVAITLADFNGVAGEAMALG
FT                   ERTPLALLDAAASARMAVGEALTNLCAAPVDALDEIKLSANWMAAAGHPGEDALLYDAV
FT                   KAVGMELCPQLDISIPVGKDSLSMQAQWHDQGEAHKSVSPVSLVITAFAPVADVRQQLT
FT                   PLLDREVESELWLIGLGAGKQRLGGSILAQVHADHGDLPAFAGAAPDLDDPQRLRGFFE
FT                   LIRDARQSGLLLAYHDRSDGGAFAALCEMAFTSRLGLDITLDAWGDDPFRSLFNEELGA
FT                   VVQIAREDRAAFADLVERHALTECAQRIAKPTTAPVVRVSLGGENLAEWRWDALFDAWW
FT                   SVTHAMQKRRDNPANADAEREIARAFTAPGLKPKLSFDLNEDVAAPFISTGARPRVAVL
FT                   REQGVNGQIEMANIFERAGFRAFDVHMSDLIEGRVALQDFTGLVACGGFSYGDVLGAGR
FT                   GWATSILERSALRDAFAAFFAREDSFALGVCNGCQMMSQLKGIIPGAEHWPQFRRNASE
FT                   QFEARTALLEVVESPSILLRGMAGSRLQVAVAHGEGQAVFDNAVDQAAARVSLRYIDGN
FT                   GNVASQYPLNPNGSPDGITGLTSTDGRVTIMMPHPERTPRALNMSWAPAEWQGDSPWMR
FT                   MFRNARVWCG"
FT   gene            641603..648781
FT                   /locus_tag="Smal_0544"
FT   CDS_pept        641603..648781
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0544"
FT                   /product="YadA domain protein"
FT                   /note="PFAM: YadA domain protein; Haemagluttinin domain
FT                   protein; Hep_Hag repeat-containing protein; KEGG:
FT                   xac:XAC3546 outer membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50249"
FT                   /db_xref="GOA:B4SJ81"
FT                   /db_xref="InterPro:IPR008635"
FT                   /db_xref="InterPro:IPR008640"
FT                   /db_xref="InterPro:IPR011049"
FT                   /db_xref="InterPro:IPR024973"
FT                   /db_xref="UniProtKB/TrEMBL:B4SJ81"
FT                   /protein_id="ACF50249.1"
FT                   /translation="MNRIYRKVWNKALGQLVVASELASSGSSGGVVDQRRDATQAAPAR
FT                   LAMALGLVLGLGMSGIAAAQSVQIGGSATCVAFSGKLLEKCLIEGTATAKGSNAVAIGS
FT                   NSSASAANSVALGAGSKATRANTVSVGDTGKERQITNVAAGSQATDAVNKAQLDAQARA
FT                   TQAALADVAADGNRYFKADGAGDDSDAAKIEGQGAVAAGAGAQSLANATTAIGTQAIAA
FT                   GIGASAFGQGALALGDASVVVGQSAAAFGLGDTAVGASATASSENGAATALGALSEATA
FT                   DGATAVGGGAVAMGPGSTALGRGATAANEASIAVGAFSTAVGEYSTALGSNSAAVATGS
FT                   VALGAGSLADRVDTVSVGAAEYGLTRQITSVAAGTEDNDAVNVGQLKGVAAVADATAKR
FT                   FQATGSSNSDAGALAEGDDALAAGEAANAIGNGATAVGAGAGAVAQNATAVGNNALASG
FT                   QNSAAFGNNAQANGPGSVAVGGAAVDANGNPLITSGGVPVETGATSAGVGGTAVGASAE
FT                   ASGFAASSYGVGAYAAGAQASAFGAVANAIGDYSTALGTQSNATGTSSVAIGGPADLIP
FT                   GLGFFVQTQASGEAATAVGAGAIASGDRAVANGSLSEASGAEATAVGYFAYAPGENASA
FT                   LGAQTWASGAQSTAVGYYATARGANSVALGANSEAVRANSVAVGSAGNERQITSVAAGS
FT                   EATDAVNKAQLDAVANTADTTARFFQAQPEAGSDAGALADGEGAIAAGSSSNAIGAGAI
FT                   AHGAAASAIGDDSVAVGRNSAATGNGGVAIGGLGQAYDEFNQPIIGADGKAQQVGTTAV
FT                   ADATAVGSGAQATGATSTAFGNAAKASGDNSFAAGGKSRATGSYAVAVGDSAFASSDDS
FT                   TAVGGYSWATASGAAAFGSGAWATATNASAFGNAAWASGSGATSIGYNSWANGASSTAV
FT                   GRGAFGYGDNSVALGFQALGNSINSIAIGTNTVAGGESAIALGAGSNASASNTVALGAG
FT                   SVANRARTVSVGSAGNERQVTNVAAGTQATDAVNKAQLDAVAATATTTSRFFQASGNGD
FT                   DVAGALVDGDNALAAGDAANAIGNGATALGSGANALASNAQAVGFNALASAANASAVGA
FT                   NAQATGEYATAHGAESEASGEQSAAFGAASIASGAGSTATGVLSEASGEEAVAVGYFSN
FT                   ASGDAATAVGSESVASGTASAAFGIGAEASGGYSTAIGGYAQASAFNATAFGNFANASG
FT                   SNSVAVGGDSEASGAYSTATGQGSLATGTNSVAVGGSLFGVLATEASGNYSTAVGGGAW
FT                   SGGINSTALGNAAESRGANSVALGADSIADRDNTVSVGGGGNTRQITNVADGTQGNDAV
FT                   NKNQLDAVAAAAEKTSKQFQASGNADGETGALVEGDNALAAGDAANAIGNGATALGSGA
FT                   NALAANATAVGIDALATGSNAAALGSTAQATGEDSLALGTGASASELGASAVGARAQAS
FT                   GAYSMATGTEANASGTQALASGFRSAASADGTTAVGGYAEASGRLGTALGYGSAASGAN
FT                   TTAVGFGAAAAGTGAVAVGQSSEASGEESVAIGGSTFFGLIPSRASGTGAAAFGAGAWA
FT                   TEDYATAIGWNSWAAGGSATALGANATANGSNSVALGAGSKADRDNTVAVGKAGGERQV
FT                   THVAAGSEATDAVNKGQLDAVASVADKTSRQFQASGNADGEAGALVDGDNALAAGNAAN
FT                   AIGNGATALGSGANAMAANATAVGFDALATGNNAAALGNTAQASGVDSVALGSGASASE
FT                   LGASATGAGAQAKGAYSTASGAQATASGTQSQANGFRASASADGASAIGSYADASGRLG
FT                   TAVGYGSKATGANATAVGVSANASAAGSVALGAGSVADRANTVSVGSASSDRQITRVAA
FT                   GTERTDAVNRGQLDAVAATADGTARYVKATGSGTASASGTDAAAIGSAASASGARSNAL
FT                   GANALAIGNGALALGTSAGATGANSVALGAGSRALDANVVSVGGGNGTDGPATRRIVNV
FT                   ADGRIAAGSTDAITGSQLNVTNQRVGAVETRVGDFDSRITTVETTAASAVGYDDASRDR
FT                   LTLSGFQGTTIDNVGAGSIAAGSRQAINGGQLFQSLSDAASFLGGGASVGMQGVFVAPN
FT                   YVIQGATYSNVGDALGALDRKVSEIDRRSAGGTRAGASSLRAMSASLDDTSLASTADAP
FT                   VAADAAAASTARVQGTPTAAAAGAGIPVGTPGSGANSVTVGDGAVASGASSTAIGQGAT
FT                   ATATNAIALGQGSLADRANTISVGSEGNERQVTNVAAGTTATDAVNKGQLDRGMATANS
FT                   YTDSRVQAVTDSFDVFKGEIDGRLRHMDRRIDRQGAMSAAMLNMATSAAGIRTQNRVGV
FT                   GIGFQGGESALSLGYQRAISDRATVTFGGAFSSDDSSVGVGAGFGW"
FT   gene            648940..650793
FT                   /locus_tag="Smal_0545"
FT   CDS_pept        648940..650793
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0545"
FT                   /product="peptidase S8 and S53 subtilisin kexin sedolisin"
FT                   /note="PFAM: peptidase S8 and S53 subtilisin kexin
FT                   sedolisin; peptidase domain protein; KEGG: xcv:XCV3669
FT                   extracellular serine protease"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50250"
FT                   /db_xref="GOA:B4SJ82"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR007280"
FT                   /db_xref="InterPro:IPR015500"
FT                   /db_xref="InterPro:IPR023827"
FT                   /db_xref="InterPro:IPR023828"
FT                   /db_xref="InterPro:IPR034176"
FT                   /db_xref="InterPro:IPR036852"
FT                   /db_xref="UniProtKB/TrEMBL:B4SJ82"
FT                   /protein_id="ACF50250.1"
FT                   /translation="MIKKQNLRINVLAAAVLSMTAVGAVHAAGLPTREPVRQASTAQPG
FT                   AERIIVKYRAGAAAATDRSAKLSSVQSALTRASLSGGTSRASTLGPQVVRKLATGADLI
FT                   RVQGRLAPAELQRVLKELQADPSVQYAEADVKLRRTELRAGDVQPALVPNDPFYQQNQW
FT                   HLHNAVGGINAPAAWDVSQGEGIVVAVIDTGILPQHPDLVGNLLEGYDFISDAETSRRP
FT                   TNDRVPGALDQGDWVENDNECYDGSLAEDSSWHGTHVAGTVAEQTNNGVGMAGVAYKAK
FT                   VLPVRVLGKCGGYLSDIADAVVWASGGTVTGIPANTNPAEIINMSLGGSGACGSTYQDA
FT                   INGAISRGTTVVVAAGNETDNASKYRPASCEGVVTVGATRITGGITYYSNYGTRVDLSG
FT                   PGGGGSVDGNPGGYIWQTGSNAATTPDSGTPGYMGMGGTSMASPHVAAVAALVQSALIA
FT                   KGKDPLTPAAMRTLLKETARPFPVAIPAATPIGTGILDAKAALAKALEEPCTENCGPVA
FT                   TPLTNKAAIGGLSGAAGSSKLYSFEAAAGKQFSVITYGGTGNVSVYVAEGREPSASDND
FT                   AKSTRPGTSETVRVTKPVAATYYIKVVGEAAYNGVSILATQ"
FT   sig_peptide     648940..649023
FT                   /locus_tag="Smal_0545"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 28"
FT   gene            650930..652651
FT                   /locus_tag="Smal_0546"
FT   CDS_pept        650930..652651
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0546"
FT                   /product="general secretory pathway protein E"
FT                   /note="KEGG: xom:XOO_0771 general secretion pathway protein
FT                   E; TIGRFAM: general secretory pathway protein E; PFAM: type
FT                   II secretion system protein E; General secretory system II
FT                   protein E domain protein; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50251"
FT                   /db_xref="GOA:B4SJ83"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR007831"
FT                   /db_xref="InterPro:IPR013369"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037257"
FT                   /db_xref="InterPro:IPR042181"
FT                   /db_xref="UniProtKB/TrEMBL:B4SJ83"
FT                   /protein_id="ACF50251.1"
FT                   /translation="MNALAATAADTAEGRILDALLARGRLKEGDLARARPLHAEAGGSL
FT                   LGLLVRLGLVSERDQAQASAEVLGLPLLEGKQLPEAPPQGLAEGLPLSVRFLKQFHVCP
FT                   LALDEQGVRLWLADAHDPYPQQAVQLALGVPVTPVLGMRAEIDDLVERWFGQGRSAMGA
FT                   IVETADGEGGAVDDIEHLRDLASEAPVIRLVNLVIQRAVELRASDIHVEPFESRLKVRY
FT                   RIDGVLVEGESPPANLTAAVISRIKIMARLNIAERRLPQDGRIMLRVQGKELDLRVSTV
FT                   PTAHGESVVMRLLDRETVVFDFHRLGFTDVFLPQFRKVLEQPHGILLVTGPTGSGKTTT
FT                   LYTALSQLNTADVKIITVEDPVEYQIEGINQIQAKPQIGLDFANALRSIVRQDPDIIMI
FT                   GEMRDLETARIAIQSALTGHLVLSTLHTNNAAGGITRLLDMGVEDYLLTSTINGILAQR
FT                   LVRRLEPTHAERYEASPEEVERFELRRLQPQGPIHLYRPKPSALAPTGYLGRTTIMEFL
FT                   VMNDALRRAVMRRDGMGEIERIAREAGMRTMYEDGLSKALSGQTTIEEVLRVTEES"
FT   gene            652676..653896
FT                   /locus_tag="Smal_0547"
FT   CDS_pept        652676..653896
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0547"
FT                   /product="type II secretion system protein"
FT                   /note="PFAM: type II secretion system protein; KEGG:
FT                   xcb:XC_3572 general secretion pathway protein F"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50252"
FT                   /db_xref="GOA:B4SJ84"
FT                   /db_xref="InterPro:IPR001992"
FT                   /db_xref="InterPro:IPR003004"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="InterPro:IPR042094"
FT                   /db_xref="UniProtKB/TrEMBL:B4SJ84"
FT                   /protein_id="ACF50252.1"
FT                   /translation="MPNYRYKALNTHGEIFDGQMEAASEAELVARLQDQGHLPMETQLA
FT                   DGGAIGGSTWRNLFRQRPLQGAALLQFTQQLATLLGAGQPLDRALSILLGLPEDERSRR
FT                   AITDIRDVVRGGAPLSTALERQHGLFSRLYVNMVRAGEAGGSLHDTLQRLADYLERSRA
FT                   LQGKVINALVYPAILLVVVGGALLFLLGYVVPQFAQMYESLDVALPWFTNAVLQLGLFV
FT                   RDWWVLLLVVPAVLALFFERKARQPVFRLALDGWLLQRRGIGRLLGELETARLARTLGT
FT                   LLRNGVPLLGALGIARNVLGNRALAADVEAAADEVKNGTGLSLALSRGKRFPRLALQMI
FT                   QVGEESGALDTMLLKAADTFEQDSARRIDRLLAAMVPAITLVLASVVGAVIVAVLVPLY
FT                   DLTNAIG"
FT   gene            653946..654389
FT                   /locus_tag="Smal_0548"
FT   CDS_pept        653946..654389
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0548"
FT                   /product="general secretion pathway protein G"
FT                   /note="TIGRFAM: general secretion pathway protein G; PFAM:
FT                   type II secretion system protein G; KEGG: xcv:XCV3666 type
FT                   II secretory pathway pseudopilin"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0548"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50253"
FT                   /db_xref="GOA:B4SJ85"
FT                   /db_xref="InterPro:IPR000983"
FT                   /db_xref="InterPro:IPR010054"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="InterPro:IPR013545"
FT                   /db_xref="UniProtKB/TrEMBL:B4SJ85"
FT                   /protein_id="ACF50253.1"
FT                   /translation="MIASRRPIRLSFTAARNQSGMSLLEIIIVIVLIGAVLTLVASRVL
FT                   GGADRGKANIAKAQVQTVASKVDNYQIDTGKLPGSLNDLVTAPAGVGGWLGPYAKPADL
FT                   NDPWGHALEYRAPGEGQPYELISLGKDGKAGGSSVDADIRYQP"
FT   gene            654396..654890
FT                   /locus_tag="Smal_0549"
FT   CDS_pept        654396..654890
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0549"
FT                   /product="general secretion pathway protein H"
FT                   /note="TIGRFAM: general secretion pathway protein H; KEGG:
FT                   xac:XAC3541 general secretion pathway protein H"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50254"
FT                   /db_xref="GOA:B4SJ86"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="InterPro:IPR022346"
FT                   /db_xref="UniProtKB/TrEMBL:B4SJ86"
FT                   /protein_id="ACF50254.1"
FT                   /translation="MTYFLPRRLPRPRLHGRRAAGLSLLEMLLVIALIAAIGLITAAGL
FT                   SRGFAGMQLRSAGKDIANQLRVVRAQAIARGEPQRFVIEPARRHWEGANQRHGDVPAQL
FT                   QVQFEGAAQLATAPGQGVIEFHPDGGSSGGRIRLQRDGAEWRIDVGWLTGEVRSGPWRA
FT                   Q"
FT   sig_peptide     654396..654524
FT                   /locus_tag="Smal_0549"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.671) with cleavage site probability 0.421 at
FT                   residue 43"
FT   gene            654887..655306
FT                   /locus_tag="Smal_0550"
FT   CDS_pept        654887..655306
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0550"
FT                   /product="type II secretory pathway pseudopilin"
FT                   /note="KEGG: xcv:XCV3664 type II secretory pathway
FT                   pseudopilin"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50255"
FT                   /db_xref="GOA:B4SJ87"
FT                   /db_xref="InterPro:IPR010052"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:B4SJ87"
FT                   /protein_id="ACF50255.1"
FT                   /translation="MKRRARGFTLLEVIIAFALLGLALTLLLGSLSGGAKQVREAGLRT
FT                   RAVLHAQSLLAEAGVAAPLQVGRQQGDWEQGRYHWELQVQPWVEPRAGSVVQSQSPGAP
FT                   WLAELQLQVRWGDSEREQLRWRSLRLLPPDLESAR"
FT   sig_peptide     654887..654994
FT                   /locus_tag="Smal_0550"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.811 at
FT                   residue 36"
FT   gene            655303..655935
FT                   /locus_tag="Smal_0551"
FT   CDS_pept        655303..655935
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0551"
FT                   /product="general secretion pathway protein J"
FT                   /note="KEGG: xcv:XCV3663 general secretion pathway protein
FT                   J"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50256"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:B4SJ88"
FT                   /protein_id="ACF50256.1"
FT                   /translation="MKRRAAGFTLIEVMLATVLLAGGLALAFASVRSAMAVSQRGEQIA
FT                   AESERMRAVQALLRRQLAGALRTPLEVPDPTREPMFFQGEEQRMLFAADLPGYLGRGGP
FT                   YLHALQVDGRSGQQRLLLDLVLLQEGERIAETPPRPPEVLVDGLKSVQLRYRGIDASTG
FT                   QVTDWLPRWDDTRRLPMLVEVQIVPAKGAPWPVLVVAPRAGGSGGAR"
FT   sig_peptide     655303..655413
FT                   /locus_tag="Smal_0551"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.931 at
FT                   residue 37"
FT   gene            655932..656795
FT                   /locus_tag="Smal_0552"
FT   CDS_pept        655932..656795
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0552"
FT                   /product="General secretion pathway protein K"
FT                   /note="PFAM: General secretion pathway protein K; KEGG:
FT                   xom:XOO_0777 general secretion pathway protein K"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50257"
FT                   /db_xref="GOA:B4SJ89"
FT                   /db_xref="InterPro:IPR005628"
FT                   /db_xref="InterPro:IPR038072"
FT                   /db_xref="UniProtKB/TrEMBL:B4SJ89"
FT                   /protein_id="ACF50257.1"
FT                   /translation="MNRQGGAALVLVLWLIALMTALVGAFALSARVEHLQQRVLDDDAR
FT                   GQERARAGLEYALMRLSADPQRAPWRADGRTYRWTFDDASIEIKVLDENGKINLNLADV
FT                   ALLTAFLKALGEDEGAARQLAGAIVDWRDEDSLLQPGGGAEAPDYAAAGLPYGPRNKRF
FT                   ETLGELQRVLGMPGPLYQKMLPHLTLYSRQARPDPQFASAPVLTALGLDADTVLAQRAQ
FT                   QERDADTAAGATTLASSSGTYSIESRVIDGSGRRSVLQAVVRNGSGGVPGRSYTVLRWE
FT                   QGMTAR"
FT   sig_peptide     655932..656024
FT                   /locus_tag="Smal_0552"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.348 at
FT                   residue 31"
FT   gene            656792..657931
FT                   /locus_tag="Smal_0553"
FT   CDS_pept        656792..657931
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0553"
FT                   /product="Fimbrial assembly family protein"
FT                   /note="PFAM: Fimbrial assembly family protein; KEGG:
FT                   xcb:XC_3566 general secretion pathway protein L"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50258"
FT                   /db_xref="GOA:B4SJ90"
FT                   /db_xref="InterPro:IPR007813"
FT                   /db_xref="UniProtKB/TrEMBL:B4SJ90"
FT                   /protein_id="ACF50258.1"
FT                   /translation="MTAWQDSLRQVQGRIGPGAGRFLRWWRQSLLAWVPARWQWALGWA
FT                   QARLLLQREGDQLQVRREAGERREAVATLPWPLSPAELDRVLEPRLRSLPRVWLLPANE
FT                   VLRRHLRLPAAAADRLRAVVGFEIDRQTPFESSQVSYDVRELGSAGEGLLQVELIAWPL
FT                   RQLDAWRGSVGEWADTLAAVDAIDAQGDPLHVNLLPPAQRQLRPDPMRRWNLLLALAAL
FT                   VMLVLAAVQLLDNRRAAADELRAQVERSARSARGVASERAQLQGLIDGAAFLEKQRSQR
FT                   AGTVEIWNELTRRLPEGTYLEKLAIENNNLQLIGLSREASQLVQLLQDAPQWRKVNLTG
FT                   VLQADGAASGRDRFTMTAELQPMAAANGEAADADAKRAP"
FT   gene            657906..658613
FT                   /locus_tag="Smal_0554"
FT   CDS_pept        657906..658613
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0554"
FT                   /product="general secretion pathway protein M"
FT                   /note="KEGG: xac:XAC3536 general secretion pathway protein
FT                   M"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50259"
FT                   /db_xref="InterPro:IPR034756"
FT                   /db_xref="UniProtKB/TrEMBL:B4SJ91"
FT                   /protein_id="ACF50259.1"
FT                   /translation="MPMPSARRDRWLALALLLAVLGLAYLLLVHPWFTQPLREINADVA
FT                   ALREREQRVQAQLQQQPQIEQRLRATREALQQRPGFLREATAEAAAAALGGKLQDAVAM
FT                   ASPGNRSCTISNRTPLTDNRRDAEFVRVAMQVRLRCGVAELATVLHSLETGSPRLFVDN
FT                   LNLIAQRFQQSPNESGLGLDVSFELAGYLLPGAAAEGATPTPATGPAATPQPPAAAPVP
FT                   DAPAEGQEVADET"
FT   sig_peptide     657906..657980
FT                   /locus_tag="Smal_0554"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.776) with cleavage site probability 0.337 at
FT                   residue 25"
FT   gene            658603..659394
FT                   /locus_tag="Smal_0555"
FT   CDS_pept        658603..659394
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0555"
FT                   /product="general secretion pathway protein N"
FT                   /note="KEGG: xac:XAC3535 general secretion pathway protein
FT                   N"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0555"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50260"
FT                   /db_xref="UniProtKB/TrEMBL:B4SJ92"
FT                   /protein_id="ACF50260.1"
FT                   /translation="MKLEQISLRTGFLLALAGWAAAVWLATGFGLGSQLPGADGNADAA
FT                   PSLPGLPSLAAERMASADSYSAIGERPLFAEDRKPKPYLLGGSEPAASAALRLTGVLLT
FT                   GDFGMATFTTEQNRSLRLRLNGEAVDGWQLVALAPRQATVIGPGGNQVLELAVFNGQGG
FT                   EPPTVLRGANGAPPAGGIIVPPPAGAPPPPPAAAATAQQAPGGSAAPAATPAAATPPAN
FT                   TNGPSEAQMQAIRERIQARRRQLQQQQQQQPSPPPGDGTNR"
FT   sig_peptide     658603..658680
FT                   /locus_tag="Smal_0555"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.982) with cleavage site probability 0.500 at
FT                   residue 26"
FT   gene            659404..661605
FT                   /locus_tag="Smal_0556"
FT   CDS_pept        659404..661605
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0556"
FT                   /product="general secretion pathway protein D"
FT                   /note="TIGRFAM: general secretion pathway protein D; PFAM:
FT                   type II and III secretion system protein; NolW domain
FT                   protein; KEGG: xom:XOO_0781 general secretion pathway
FT                   protein D"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0556"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50261"
FT                   /db_xref="GOA:B4SJ93"
FT                   /db_xref="InterPro:IPR001775"
FT                   /db_xref="InterPro:IPR004845"
FT                   /db_xref="InterPro:IPR004846"
FT                   /db_xref="InterPro:IPR005644"
FT                   /db_xref="InterPro:IPR013356"
FT                   /db_xref="InterPro:IPR038591"
FT                   /db_xref="UniProtKB/TrEMBL:B4SJ93"
FT                   /protein_id="ACF50261.1"
FT                   /translation="MNLRFLPWSFALALLVGCSTVSAPHVQRKGNLTSTTDAGQAAEVA
FT                   ADAARDSQGAPQAVIRRGTGTMINREAARAPAPALHGASTGEATFNFEGESVHAVVKAI
FT                   LGDMLGQNYVIAPGVQGTVTLATPKPVSPAQALNLLEMVLGWNNARMVYSGGRYNIVAA
FT                   DQALAGTVAPSTAPAASARGFEVRVIPLQFISATEMKKVLEPYARPNAIVNVDSGRNVI
FT                   TLGGTRAELENYMRTVEIFDVDWLSGMSVGVFPIQSGKAEQVAADLEKVFGEESKTPSA
FT                   GMFRFLPLENANAVLVITPQVRYLDQIQQWLDRIDTAGGSARLFSYELRYIKARDLAER
FT                   LSEAFASSGNRGGSSPGSLAPGAIPSQLGSDGDRGMDSNNSSNFGSTSGGSSSGGGSGS
FT                   MNLPQRQSGNVSVSLEVEGDRVGVSAVEETNTLLVRSTPQAWRSIREVIEKLDVMPLQV
FT                   HIEAQVAEVALEGDLKYGVNWFFDNAVAGRALTGALAGVTLPAAAGGSWSSLAGAATGG
FT                   EGLGWAFTGHNGAAVVSALDKVTDVRLLQTPSVFVRNNAEATLNVGDKVPINTTTVNTG
FT                   IGTSSYSSVQYIDTGVILKVRPRVTRDGTVFLDIVQEVSSASNVPENCNPQERNCNPRI
FT                   STKKLSTEAAVQSGDTIMLAGLITDTGTDGSSGIPGLSRIPVVGALFGQKSRTSRRSEV
FT                   IVLLTPSIVRNSQEARNLTDEYSQRFRAMEPLNQPRAKK"
FT   sig_peptide     659404..659484
FT                   /locus_tag="Smal_0556"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.937) with cleavage site probability 0.400 at
FT                   residue 27"
FT   gene            662294..663148
FT                   /locus_tag="Smal_0557"
FT   CDS_pept        662294..663148
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0557"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xcb:XC_3562 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0557"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50262"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:B4SJ94"
FT                   /protein_id="ACF50262.1"
FT                   /translation="MGAIVLLPLCVDDAALDRCLAALDAGTAPGTAVWLADDAQTGPRA
FT                   QAVVEHWLAHTPLQAEYTRRARPLGEVAHLDEMLRACEGLDVAVLAPDSVPAPGWLQQL
FT                   QDAFARDAAIATATPWCNAGETAAWPRLGEINPEPEDPALLAHTCATLPVLHPELPSAV
FT                   THAVLVRGNARRRAGGLDVESYAGWNAALVDLSLRMAGLGWRNVLCETAFVGRAGEAVS
FT                   RDGDLEALAARWPAWVPRLADFLMHDPLHGLRADLQQRMRQAIMPAEQGDLFVSSSAPE
FT                   PPA"
FT   gene            663145..663984
FT                   /locus_tag="Smal_0558"
FT   CDS_pept        663145..663984
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0558"
FT                   /product="glycosyl transferase family 2"
FT                   /note="PFAM: glycosyl transferase family 2; KEGG:
FT                   xcb:XC_3557 glycosyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0558"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50263"
FT                   /db_xref="GOA:B4SJ95"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:B4SJ95"
FT                   /protein_id="ACF50263.1"
FT                   /translation="MNVAIAAIVVTYQSGSTIDACLSRLRQAQDVAEIRVIDNGSMDGT
FT                   LDIVQRHASHDPRVRFVGNPDNPGFAAANNQGVADSSSPWLAFINPDLMVEPDTLAGLR
FT                   SRADALGDCLLGVEQLDEHGQADEAVRRRDPDFLLMLRSPGKGSKLAVPRDPQQALQRV
FT                   PALSGALLMMSRALFDRIGGWDAGYRLHAEDLDLCRRAREAGAVVAIANDLQVTHVRGV
FT                   SSRSRPFFVEWHKHKGLWRYFQKFEARQRSLPVRVAVWGAIWAHALMLVPKLLRKAL"
FT   gene            664093..665274
FT                   /locus_tag="Smal_0559"
FT   CDS_pept        664093..665274
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0559"
FT                   /product="nicotinate phosphoribosyltransferase"
FT                   /EC_number="6.3.4.21"
FT                   /note="KEGG: xfm:Xfasm12_0442 nicotinate
FT                   phosphoribosyltransferase; TIGRFAM: nicotinate
FT                   phosphoribosyltransferase; PFAM: Nicotinate
FT                   phosphoribosyltransferase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0559"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50264"
FT                   /db_xref="GOA:B4SJ96"
FT                   /db_xref="InterPro:IPR006406"
FT                   /db_xref="InterPro:IPR007229"
FT                   /db_xref="InterPro:IPR036068"
FT                   /db_xref="InterPro:IPR040727"
FT                   /db_xref="InterPro:IPR041525"
FT                   /db_xref="UniProtKB/TrEMBL:B4SJ96"
FT                   /protein_id="ACF50264.1"
FT                   /translation="MPIIQSLLDTDLYKFTMMQAVLHQHPGAQVQYRFKCRTPGIDLAH
FT                   YIDQIDEEIDHLCSLRFSDAELDYMRGLRFVKPDFADFLGLFHLDRKYIQLRASKTVPG
FT                   EIELDITGPWLHTILFEVPLLAIINEVWFRNTTTADFAEGERRLQAKAALLRDTPGFEQ
FT                   CRIADYGSRRRYSRDWHARLLPLLRDALGPQLVGTSNVHFARLYGMTPHGTMAHEYLQA
FT                   FQALGPRLRDSQVAALESWAREYRGDLGIALSDVVGLDAFLRDFDMYFCKLFDGVRHDS
FT                   GDPFDWGDRMLAHFQQRRVDPRSKVLVFSDGLDIVKVMRLYDYFRGRCQVAFGVGTHLT
FT                   NDLGPTPLNIVIKMVRCNGQPVAKLSDSPGKSMCDDPGYLTYLRQVFELPQPE"
FT   gene            complement(665294..665659)
FT                   /locus_tag="Smal_0560"
FT   CDS_pept        complement(665294..665659)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0560"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pap:PSPA7_5934 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0560"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50265"
FT                   /db_xref="UniProtKB/TrEMBL:B4SJ97"
FT                   /protein_id="ACF50265.1"
FT                   /translation="MRNSILLCVALMSVSALAQASSGSIRFSGHIAEPGCTTNLSQGEL
FT                   SLAACPPSAKGSTVAVTALADGQAATLRDGKRQGQKLSVSASAMRAGDIAFSERYSVQA
FT                   SKQQPLQGAYLVVVDYL"
FT   sig_peptide     complement(665597..665659)
FT                   /locus_tag="Smal_0560"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.541 at
FT                   residue 21"
FT   gene            666100..666639
FT                   /locus_tag="Smal_0561"
FT   CDS_pept        666100..666639
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0561"
FT                   /product="Fimbrial protein"
FT                   /note="PFAM: Fimbrial protein; KEGG: aby:ABAYE1856 putative
FT                   fimbrial protein precursor (pilin)"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0561"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50266"
FT                   /db_xref="GOA:B4SJ98"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="InterPro:IPR036937"
FT                   /db_xref="InterPro:IPR039458"
FT                   /db_xref="UniProtKB/TrEMBL:B4SJ98"
FT                   /protein_id="ACF50266.1"
FT                   /translation="MHKINLIAAVMLAAAPLAANAADGTITFNGKVTDKTCTISTPGGK
FT                   DFAVNLPTVSKNTLANAGAVAGRTPFAINLTKCSAGNVATYFEPGSTVDFNTGRLLNQA
FT                   SANAATNVQLQLLGSNNQVLPIKAAGAGLAQTNSQWVTVGTDGSADLSYYAEYYATAAA
FT                   TPGDVTSSVKYTIIYN"
FT   sig_peptide     666100..666165
FT                   /locus_tag="Smal_0561"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 22"
FT   gene            666725..667456
FT                   /locus_tag="Smal_0562"
FT   CDS_pept        666725..667456
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0562"
FT                   /product="Pili assembly chaperone, N-terminal"
FT                   /note="PFAM: Pili assembly chaperone, N-terminal; Pili
FT                   assembly chaperone, C-terminal; KEGG: xfn:XfasM23_0053 pili
FT                   assembly chaperone, N-terminal"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50267"
FT                   /db_xref="GOA:B4SJ99"
FT                   /db_xref="InterPro:IPR001829"
FT                   /db_xref="InterPro:IPR008962"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR016147"
FT                   /db_xref="InterPro:IPR016148"
FT                   /db_xref="InterPro:IPR018046"
FT                   /db_xref="InterPro:IPR036316"
FT                   /db_xref="UniProtKB/TrEMBL:B4SJ99"
FT                   /protein_id="ACF50267.1"
FT                   /translation="MKAIFPRALLLAAFTLPFCQNALAGVVVNGTRVIYPAQAREVTVQ
FT                   VDNVGDSPALVQAWIDSGDANQTADTSDAPFVLTPPIARVEPGRSQALRLIFSGAQLPT
FT                   DRESVFWLNVLDVPPSPDNADNSGEQNYLQVAFRSRLKLFYRPQGLKGVANDAPAALRW
FT                   TRNGDRLRVENPSPFHVTLAEVHAVTGSSEKAVEDKGAMVAPKQSLEFAAPAGTNQVRF
FT                   ITINDYGGRVEHTIRLGSTGG"
FT   sig_peptide     666725..666799
FT                   /locus_tag="Smal_0562"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.997 at
FT                   residue 25"
FT   gene            667528..670113
FT                   /locus_tag="Smal_0563"
FT   CDS_pept        667528..670113
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0563"
FT                   /product="fimbrial biogenesis outer membrane usher protein"
FT                   /note="PFAM: fimbrial biogenesis outer membrane usher
FT                   protein; KEGG: xfm:Xfasm12_0063 outer membrane usher
FT                   protein precursor"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0563"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50268"
FT                   /db_xref="GOA:B4SJA0"
FT                   /db_xref="InterPro:IPR000015"
FT                   /db_xref="InterPro:IPR025885"
FT                   /db_xref="InterPro:IPR025949"
FT                   /db_xref="InterPro:IPR037224"
FT                   /db_xref="InterPro:IPR042186"
FT                   /db_xref="UniProtKB/TrEMBL:B4SJA0"
FT                   /protein_id="ACF50268.1"
FT                   /translation="MIGNRLTLSIHQALCLLVAGVACPGWALAAPANLGEQALMAQSGA
FT                   ANARAPESAQFNSSFLSGQAKQVDLAAFSNGNPMVAGTYRVDVYVNGAWQGRRDLQFKA
FT                   DAQGRVDACLPLPMLEEMGVDSEAVLLQQDPSVPADKTSCVPVQQRMSNAYGIYDSGNL
FT                   RYDLSIPQVFLRREARGYVNPALWDRGINAGFVGYSFNAINSDSRVEGGQRNRSAYLGL
FT                   NAGLNLGGWQFRHDSNLTWSEGDGRHWQSIATYAQRGIPQVRGMLTIGEAYTTGELFDS
FT                   IGYRGASLASDDRMLPDSLRGYAPVVRGIAETNARVEVRQNQQLIYSSTVSPGSFVIDD
FT                   LYPTGYGGDLEVSVIEADGRRREFKVPFGSVPQMLREGVSRYSLTAGQVRNKLLADEPW
FT                   LVQGTYQRGIGNQLTLYGGSALSDGYLSLLYGVGLSTPVGAFAADVTHARTTFDHYGNH
FT                   TGASVRLSYSNMIGETGTNLTLAAYRYSTEGFYSLQDALYGRDSDKRGIDPTTRGRQRS
FT                   QFQVTLNQPLGRRGGALYVTGSVRDFYDRPGTSKQYQVGYNNAWRSVNYGFSALRTEEG
FT                   LLGRSDTQYLLSMSVPLGRGTHPVSFSADVGVRDRGGYDNSRVGITGSAGVDNNFSYGA
FT                   ALSDSREGGTTAVGNAEYRSRYTALNATYSHSRDFRQASVGANGSVVVHPGGFTFTPQR
FT                   GDTMVLVEAPGARDAIVSNAPGLRVDGRGYAVVPYVSPYRLNTVTLDPQGMAHDVELES
FT                   TSQSVAPFAGAISYLRFDTRKGNALLIQVRNTDGRTLPFGAQVKDEQGQPVGMVSQGGR
FT                   LYVRSEKNQGQLQVEWGAGADQRCTIDYQVPAGADASKTGFIPLEAACR"
FT   sig_peptide     667528..667617
FT                   /locus_tag="Smal_0563"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.929 at
FT                   residue 30"
FT   gene            670104..671141
FT                   /locus_tag="Smal_0564"
FT   CDS_pept        670104..671141
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0564"
FT                   /product="Fimbrial protein"
FT                   /note="PFAM: Fimbrial protein; KEGG: xfa:XF0077 fimbrial
FT                   adhesin precursor"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0564"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50269"
FT                   /db_xref="GOA:B4SJA1"
FT                   /db_xref="InterPro:IPR000259"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="InterPro:IPR036937"
FT                   /db_xref="UniProtKB/TrEMBL:B4SJA1"
FT                   /protein_id="ACF50269.1"
FT                   /translation="MPMISSRGRKALAALALLGGVLLAQQASAACRIQVNGFVAQDVQM
FT                   DMGQIVILPSTPVGGVIKEISVPINQQNSVARCDYWYSGYSTGEYVNAPQKRPVAGFAN
FT                   VYETGVAGVGIRLFRDSGAIQAYYPHTINFAANSTISLIGGQFRIQLIKTAAQTGSGVI
FT                   APNGRFTTYYFDGDGPSRPVLTSTFRGSGTTVVSPTCEVQAGSRNIAVDFGSVPNTTFT
FT                   GVGSRAVDRDFEIRLNCQGSNVAAYQSKIGIRLDADQDSSNMPGVLKLSAATNSATRIG
FT                   IQMVQRDGSTEREVRFGQTVNVGTTVPGTSVMALPLRARYVQTQAGTVGAGVANGQATF
FT                   TIQYE"
FT   sig_peptide     670104..670193
FT                   /locus_tag="Smal_0564"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.747 at
FT                   residue 30"
FT   gene            671409..672593
FT                   /locus_tag="Smal_0565"
FT   CDS_pept        671409..672593
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0565"
FT                   /product="UDP-N-acetylglucosamine 2-epimerase"
FT                   /EC_number="5.1.3.14"
FT                   /note="PFAM: UDP-N-acetylglucosamine 2-epimerase; KEGG:
FT                   mms:mma_2625 UDP-N-acetylglucosamine 2-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0565"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50270"
FT                   /db_xref="GOA:B4SJA2"
FT                   /db_xref="InterPro:IPR003331"
FT                   /db_xref="InterPro:IPR029767"
FT                   /db_xref="UniProtKB/TrEMBL:B4SJA2"
FT                   /protein_id="ACF50270.1"
FT                   /translation="MKVLSVFGTRPEAIKMGPLVRALAESADIESVVCITGQHRAMLDQ
FT                   VMSLFEITADHDLDVMVPNQTLNGLCARLFERLDALYTQVRPDRVLVHGDTTTAMTAAL
FT                   AAFHHRIPIGHVEAGLRTGDINRPWPEEMNRRVIDVVGHQLYAPTASSRANLAREHLGG
FT                   QILVTGNTVIDALQQTVQRLDADPALRAQADAPFHMLDPRRRLLLVTGHRRESFGQGFE
FT                   DICRALAELARRTDLQVLYPVHLNPNVQGPVNAHLGHLDNVHLVPPQDYLRFVRLMQRA
FT                   DVILTDSGGVQEEAPALAKPVLVMRDVTERPEAVEAGVVTLVGTTPSRIVEAVNAALAQ
FT                   PPQPTHFDPDASPYGDGRASVRIVAALRGQPLPEFSPVVHGGAANHPHPHEVMP"
FT   gene            672590..674791
FT                   /locus_tag="Smal_0566"
FT   CDS_pept        672590..674791
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0566"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mms:mma_2624 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0566"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50271"
FT                   /db_xref="GOA:B4SJA3"
FT                   /db_xref="InterPro:IPR018513"
FT                   /db_xref="UniProtKB/TrEMBL:B4SJA3"
FT                   /protein_id="ACF50271.1"
FT                   /translation="MTQTGRSPLFASAAAFVLSGVVASAHAADSVAGQFAEWSGDSTVN
FT                   RQMSLRELGFRQPLVLSGQESQREIYLPVPAGVATRDAQLQLDGRYVRGHAGRTSGLWS
FT                   VDGDPIAARSITDAQGDASQLLAIDGEPRQNGFVRVGVGWWSIVSDYQCADQSAPANVL
FT                   RLSPDSRFSYRFDGRAVDTVAKAWGALPPRVRLLVDGRALQAPVYDAAWRIGTALQAGG
FT                   KQVQVVALPKVGDSVDLTGISIPASLQGVPAYAALASGERAYVLKDLAEVGVLLSLRDS
FT                   GPLAADAMIGSDALRAGVRAALDALAAQVGATGADAGTAFAAWRGTGMGGLEKPADNGS
FT                   VSVVAVAGRPTLVVDPAAAGKVAGLFADQWRSYALGRSLQVTAAGMPKLDGDQVLLSRL
FT                   GNIAGTMDVVTRADRSATFDLGALSADGRLPEQVVIDVSAAPNAAGQGAVATIYFNDYL
FT                   LGGKVLAANGQPQRLVAKVPAYALSARNEIRVSFLRQPARPYCHDPATGYPVSILPSSH
FT                   LTLAKRSLGSDFVGASSQLSRGSQVFVPGTWLQDAPTSLAKVIAIASAVGASPEASELK
FT                   VVDAGAAVSPGAPWLAFGVAPAGVDVAGLKDGHLLIGGTPQPLLDVSGLDRAAVVQVGT
FT                   SGGQLGVLYSDLGAQAPSFGAPFRLLRGDLAVLDGSDAVREFDRQDPYGSRVAEDGNPQ
FT                   SKWERHMVWLLLLVGVIVFALLAARVTQVRRRKSANTGH"
FT   sig_peptide     672590..672673
FT                   /locus_tag="Smal_0566"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.989 at
FT                   residue 28"
FT   gene            674798..676945
FT                   /locus_tag="Smal_0567"
FT   CDS_pept        674798..676945
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0567"
FT                   /product="General secretory system II protein E domain
FT                   protein"
FT                   /note="PFAM: General secretory system II protein E domain
FT                   protein; KEGG: mms:mma_2623 bacteriophage N4 adsorption
FT                   protein B"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0567"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50272"
FT                   /db_xref="GOA:B4SJA4"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR007831"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR037257"
FT                   /db_xref="UniProtKB/TrEMBL:B4SJA4"
FT                   /protein_id="ACF50272.1"
FT                   /translation="MDGLFWNIQLANYYAALEATAAAVAVLILISSLDDLFIDVWYWVR
FT                   ESWRALTIKRRDAYKPLTQEDLLQRPEQPLAIMVPAWMEYDVIAQMVENMINVLDYREY
FT                   VVFVGTYPNDQQTIDEVERMRRRYKRLRRVEVPHDGPTSKADCLNWLILAIFEYEKRHD
FT                   IEFAGVILHDSEDVLHPMELRFYNYLLPRKDMIQLPVTSLDREWYELVAGVYMDEFAEW
FT                   HAKDLVVRESVSGMVPSAGVGTCFSRRALLALSAQTDNQPFNTDSLTEDYDVGARLAAM
FT                   GMQSIFARFPVQFRVRRPSWFGWGPVRERTQQMALCVREYFPDNFRASYRQKARWVLGI
FT                   GLQSWESLGWRGSLATKYLLARDRKGIITSFVSIIAYVIFLQLLLFWLLKMTGVWTMQF
FT                   PSVFQPGTWQMNVALLTTAALATRVVQRFYFVNRLYGWEHALMSIPRMVVGNMINFMAT
FT                   ARAWKVFLAYLLFGKRMVWDKTMHDFPDAAQLVQTRKQLGELLGTWQAVEPERLQQALD
FT                   QQHAGRQQPLGRILLTQGWLDDETLAEAIAFQGDLPRAVIDVDYLRACQFPVSADACVQ
FT                   WRMLPLPPRQEGTLRLAVASPLPEEALALLKQETRSEHIEQSIARESEINAGLRLIGGD
FT                   RQWHLDNVPLLGDLLVEMRLIDHARFEIALDDYKPQRDGRIGDYLVKQGITTEEAVAQA
FT                   MQEQRRRAATLQSPPPGALPA"
FT   gene            676942..679764
FT                   /locus_tag="Smal_0568"
FT   CDS_pept        676942..679764
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0568"
FT                   /product="TPR repeat-containing protein"
FT                   /note="KEGG: dac:Daci_2942 TPR repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0568"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50273"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR025137"
FT                   /db_xref="UniProtKB/TrEMBL:B4SJA5"
FT                   /protein_id="ACF50273.1"
FT                   /translation="MKTTLLSTVIAIALATATAPVLAQADAPLPLSGAAYRIAEQAFAA
FT                   YERGDYPAAYQQSSEAIRLRPDVVRLRLLQIYALQKLGRGAEAQQRARRALDAGMKDPA
FT                   LPALAAAVPKTTTGAARSAALPRASATAADRNSRQAYLLATEAYAAYDAGQMGIAASKA
FT                   EQAFRQQPKQGAWALLWVAALEAQQQPEQADVAISTALQLGAPNVEELRARRVVLTRQR
FT                   ALLLAQQAYRSLSAGDDAAAIGHARDAVKLAPEVASYRLLLITAQLQGDQLADAEHSAD
FT                   QALQVDANDLNARVMRGYLRQRQGSTLRANEDFDAALATPGSTAQQRNVRLLAVDAALA
FT                   AGDRVRAAALLAPLQAPVPADEKDARAQLLLQQGIEQRAKAISSSRALPRISAEAYPAP
FT                   VQHCQSGDSSNVCELMPADLQGDGGAAQRAYAAYARRDYADAIGEARQAVQLAPEDVNL
FT                   QGLLTTALAAGNRVQQDEARQRLDAALAQHPDDAGALMQRGYLNQKAREPARALADFHA
FT                   AEATGKAPKSVVLDQAYASAANGDHPQAVTLLRSAIDRADAGELPLDEHQRYNVRNAIA
FT                   NYSREWGVIASAGFRGARQAATNVGGAAISTPGDSVFSTLEAFWRPPAFNDQHGTLELY
FT                   ARLLNTLYDEGGTYESIRAVDPCTGESTPDARARAERLSHSRSTTGWPSTIASFGMRYA
FT                   FGQTGLSAGIERRQFLGSATRQGEVYPASAAVQCRLQLALNPPLEASTLARYRLASGSG
FT                   GWMSYLTYGYYHGTDLRTDVNQWWMVSGYAQGGYTWDDNGASFTLDALDANGTPVRRVG
FT                   EANGRLHREQWFAAGELRAGRSFRFGSGQTHWVVTPYVVIGADWLDQRSRVRDLRYPLL
FT                   PSQSFALNDSQRSWSLGAGPGVGVRYWFREDHYNTPRSYLDLTVQYRFAIGGGDTQRAK
FT                   GLFATAILYY"
FT   sig_peptide     676942..677013
FT                   /locus_tag="Smal_0568"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.621 at
FT                   residue 24"
FT   gene            complement(679758..680762)
FT                   /locus_tag="Smal_0569"
FT   CDS_pept        complement(679758..680762)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0569"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: dac:Daci_2934 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0569"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50274"
FT                   /db_xref="InterPro:IPR027849"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:B4SJA6"
FT                   /protein_id="ACF50274.1"
FT                   /translation="MPPPVLPADPSSPLRRRLLRAAVLAPLAGTLATLPGCSLPVQVDG
FT                   SFLQPWRSHLQWGLADWQRSLKLARTLGCRQLVLQWTGIVGGSDGDWSLPDGSLQQLFT
FT                   AASENDIRIRVGLPFQQRWWQAIGADDATLQAFLAESLGHARSWLAQAPWAQQPAFGGW
FT                   YLPYELEQYHWADPARQHWLAQWLHGLVQAASARGGDCAMSCYFSRLQTDGNLVTLWQA
FT                   VLAQAAVRPMVQDGVGVAGAGNVQQLQPLLDHFHAHGIGFDAIVELFRELPGGPADGSG
FT                   FKGETADAARIQRQLAWARDSGAQHVLVYALEPWLTQDTPQAAALRRRWGLPQ"
FT   gene            complement(680845..682161)
FT                   /locus_tag="Smal_0570"
FT   CDS_pept        complement(680845..682161)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0570"
FT                   /product="Xanthine/uracil/vitamin C permease"
FT                   /note="PFAM: Xanthine/uracil/vitamin C permease; sulphate
FT                   transporter; KEGG: xcv:XCV0318 major facilitator
FT                   superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0570"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50275"
FT                   /db_xref="GOA:B4SJA7"
FT                   /db_xref="InterPro:IPR006043"
FT                   /db_xref="InterPro:IPR026033"
FT                   /db_xref="UniProtKB/TrEMBL:B4SJA7"
FT                   /protein_id="ACF50275.1"
FT                   /translation="MSLLERLFQLQQHGTTVRTELLAGVTTFLTMSYIVFVNPEILGTT
FT                   GMDAGAVFVATCLAAALGSAVMALAANFPVGMAPGMGLNAFFAFTVVGAAGLPWQQALG
FT                   AVFISGLVFLVLSLTGVRAWLVSGIPSSLRSAIVAGIGLFLAIIALQKSGVIVGNEDTL
FT                   VALGPLNTAPPLLALAGFLLIAVLEARRIRGAILIGILAVTGAGWALGDVQYQGLVSLP
FT                   PSLAPTFLQLDLPGLLHHDGGAPIAVLLQVVLVFVLVEVFDATGTLYGVVGRAGLLKLP
FT                   GAQKRFGRALLADSTAIVAGSMLGTSSTTAFAESASGVQVGGRTGLTALVVSALFLAAL
FT                   LFSPLAAMVPSYATAPALLFVAGLMLRELVEVDWSDLTESVPAALCALAMPFTYSIANG
FT                   LAFGFIAYAALKAGTGRWREVHPAVWLVAVLFTLRYALE"
FT   gene            complement(682345..684009)
FT                   /locus_tag="Smal_0571"
FT   CDS_pept        complement(682345..684009)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0571"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: xom:XOO_3642 putative ABC transporter ATP-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0571"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50276"
FT                   /db_xref="GOA:B4SJA8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR022374"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032781"
FT                   /db_xref="UniProtKB/TrEMBL:B4SJA8"
FT                   /protein_id="ACF50276.1"
FT                   /translation="MSSQYIYTMNRVSKVVPPKRQIIKDISLSFFPGAKIGLLGLNGAG
FT                   KSTVLKIMAGVDTDFEGEARPQAGIKVGYLAQEPELDPTKTVREAVEEGVGEVLQAQAA
FT                   LEAVYAAYAEEGADFDALAKEQERLEAILAAGDAHTLENQLDVAADALRLPPWEAIVGK
FT                   LSGGEKRRVALCRLLLQKPDMLLLDEPTNHLDAESVEWLEQFLARYTGTVVAVTHDRYF
FT                   LDNAAEWILELDRGRGIPWKGNYTDWLTQKDERLKQEDNQEKARQKAIQKELEWSRQNA
FT                   KGGRTKGKARLARLEELQSVDYQKRNETNEIFIPPGERLGNAVMEFKNVSKKFGDRLLF
FT                   DNLSFLVPGGAIVGIIGPNGAGKSTLFKMITGQEKPDTGEIVVGPTVQLSYVDQSRDAL
FT                   EGNHSVFQEIAGGLDILNINGIEIQSRAYIGRFNFKGQDQQKMVGSLSGGERGRLHMAK
FT                   TLLQGGNVLLLDEPSNDLDIETLRALEDALLEFPGNTFVISHDRWFLDRIATHILAFEG
FT                   DSHVEFFQGNYREYEEDKRRRMGDDAAPKRLRFKALK"
FT   gene            684265..684738
FT                   /locus_tag="Smal_0572"
FT   CDS_pept        684265..684738
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0572"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xcv:XCV0793 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0572"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50277"
FT                   /db_xref="InterPro:IPR024572"
FT                   /db_xref="UniProtKB/TrEMBL:B4SJA9"
FT                   /protein_id="ACF50277.1"
FT                   /translation="MRINRVMAGAVASVLALGAVAPAFADNDHRHDHDRREWREDRREW
FT                   RQDRREWERDRREARRDYRQDRREWHRDHDRYYRPAPPRVVYRPAYGPGYGWKVGHRYR
FT                   DYYRGPVYVVNDYPRYQLRRPPYGHQWIRDDRGNMLLVAIATGVIAQYVLSSR"
FT   sig_peptide     684265..684342
FT                   /locus_tag="Smal_0572"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 26"
FT   gene            684926..686179
FT                   /locus_tag="Smal_0573"
FT   CDS_pept        684926..686179
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0573"
FT                   /product="Glycine hydroxymethyltransferase"
FT                   /EC_number="2.1.2.1"
FT                   /note="PFAM: glycine hydroxymethyltransferase; aromatic
FT                   amino acid beta-eliminating lyase/threonine aldolase; KEGG:
FT                   xcb:XC_3544 serine hydroxymethyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0573"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50278"
FT                   /db_xref="GOA:B4SJB0"
FT                   /db_xref="InterPro:IPR001085"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR019798"
FT                   /db_xref="InterPro:IPR039429"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4SJB0"
FT                   /protein_id="ACF50278.1"
FT                   /translation="MFPRDVRIESYDPELAKAIAAETQRQEDHVELIASENYTSPAVME
FT                   AQGSQLTNKYAEGYPGKRYYGGCEYVDIAEQLAIDRLKQLFGADYANVQPHSGSQANQA
FT                   VYFALLQPGDTILGMSLAHGGHLTHGAKVNASGKLFNAV