(data stored in ACNUC7421 zone)

EMBL: CP001117

ID   CP001117; SV 1; circular; genomic DNA; STD; PRO; 396459 BP.
XX
AC   CP001117;
XX
PR   Project:PRJNA16691;
XX
DT   03-APR-2009 (Rel. 100, Created)
DT   10-MAY-2014 (Rel. 120, Last updated, Version 6)
XX
DE   Deinococcus deserti VCD115 plasmid 3, complete sequence.
XX
KW   .
XX
OS   Deinococcus deserti VCD115
OC   Bacteria; Deinococcus-Thermus; Deinococci; Deinococcales; Deinococcaceae;
OC   Deinococcus.
OG   Plasmid 3
XX
RN   [1]
RP   1-396459
RX   DOI; 10.1371/journal.pgen.1000434.
RX   PUBMED; 19370165.
RA   de Groot A., Dulermo R., Ortet P., Blanchard L., Guerin P., Fernandez B.,
RA   Vacherie B., Dossat C., Jolivet E., Siguier P., Chandler M., Barakat M.,
RA   Dedieu A., Barbe V., Heulin T., Sommer S., Achouak W., Armengaud J.;
RT   "Alliance of proteomics and genomics to unravel the specificities of Sahara
RT   bacterium Deinococcus deserti";
RL   PloS Genet. 5(3):E1000434-E1000434(2009).
XX
RN   [2]
RP   1-396459
RX   DOI; 10.1074/mcp.M900359-MCP200.
RX   PUBMED; 19875382.
RA   Baudet M., Ortet P., Gaillard J.C., Fernandez B., Guerin P., Enjalbal C.,
RA   Subra G., de Groot A., Barakat M., Dedieu A., Armengaud J.;
RT   "Proteomics-based refinement of Deinococcus deserti genome annotation
RT   reveals an unwonted use of non-canonical translation initiation codons";
RL   Mol. Cell Proteomics 9(2):415-426(2010).
XX
RN   [3]
RP   1-396459
RX   DOI; 10.1093/gbe/evu069.
RX   PUBMED; 24723731.
RA   de Groot A., Roche D., Fernandez B., Ludanyi M., Cruveiller S., Pignol D.,
RA   Vallenet D., Armengaud J., Blanchard L.;
RT   "RNA Sequencing and Proteogenomics Reveal the Importance of Leaderless
RT   mRNAs in the Radiation-Tolerant Bacterium Deinococcus deserti";
RL   Genome Biol Evol 6(4):932-948(2014).
XX
RN   [4]
RP   1-396459
RA   De Groot A., Dulermo R., Ortet P., Blanchard L., Guerin P., Fernandez B.,
RA   Vacherie B., Dossat C., Jolivet E., Siguier P., Chandler M., Barakat M.,
RA   Dedieu A., Barbe V., Heulin T., Sommer S., Achouak W., Jean A.;
RT   ;
RL   Submitted (09-JUL-2008) to the INSDC.
RL   DSV, EBEB, SBVME, LEMIRE, CEA, CEA Cadarache, Saint Paul Lez Durnance
RL   13108, France
XX
RN   [5]
RC   Protein update by submitter
RP   1-396459
RA   De Groot A., Dulermo R., Ortet P., Blanchard L., Guerin P., Fernandez B.,
RA   Vacherie B., Dossat C., Jolivet E., Siguier P., Chandler M., Barakat M.,
RA   Dedieu A., Barbe V., Heulin T., Sommer S., Achouak W., Jean A.;
RT   ;
RL   Submitted (20-DEC-2010) to the INSDC.
RL   DSV, EBEB, SBVME, LEMIRE, CEA, CEA Cadarache, Saint Paul Lez Durnance
RL   13108, France
XX
RN   [6]
RC   Protein update by submitter
RP   1-396459
RA   de Groot A., Roche D., Fernandez B., Ludanyi M., Cruveiller S., Pignol D.,
RA   Vallenet D., Armengaud J., Blanchard L.;
RT   ;
RL   Submitted (18-APR-2014) to the INSDC.
RL   DSV, EBEB, SBVME, LEMIRE, CEA, CEA Cadarache, Saint Paul Lez Durnance
RL   13108, France
XX
DR   MD5; c740b7cfe2cea38bc22dadfdacf05bc8.
DR   BioSample; SAMN02603250.
DR   EuropePMC; PMC2669436; 19370165.
DR   EuropePMC; PMC2830850; 19875382.
DR   EuropePMC; PMC4007540; 24723731.
DR   StrainInfo; 662049; 1.
XX
CC   Genome sequencing was performed by Genoscope, www.genoscope.cns.fr.
CC   Source DNA is available from de Groot at nicolaas.degroot@cea.fr.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..396459
FT                   /organism="Deinococcus deserti VCD115"
FT                   /plasmid="3"
FT                   /strain="VCD115"
FT                   /mol_type="genomic DNA"
FT                   /note="type strain of Deinococcus deserti VCD115"
FT                   /db_xref="taxon:546414"
FT   gene            160..945
FT                   /locus_tag="Deide_3p00001"
FT   CDS_pept        160..945
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p00001"
FT                   /product="putative ATPase involved in plasmid/chromosome
FT                   partitioning, ParA/Soj-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p00001"
FT                   /db_xref="EnsemblGenomes-Tr:ACO47902"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C1D421"
FT                   /protein_id="ACO47902.1"
FT                   /translation="MTKVITFFSNAGGVGKTSATRDFGYELSQQGYRVLLIDLDSQANL
FT                   TDWLGATVDESLDLEQEKNFTMFNAIINGAPLPVPVTRHGMDIIPSGISITEIEGILPN
FT                   KPLGGENLLRKALAPVKQEKQYDFILIDSPPTLGKIVNLCLMASDEIVVPVSSRNKGYK
FT                   AVAMVHKKIADFRENNPSLNVATHLITQLNNTSHSKITDEVARQTLKNVSGPLRHRPAV
FT                   YDNCQLAMMPVGAYEPNGEARKEVMAAVQQMLTYIGVSA"
FT   gene            942..1832
FT                   /locus_tag="Deide_3p00010"
FT   CDS_pept        942..1832
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p00010"
FT                   /product="putative ParB-like partition protein"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p00010"
FT                   /db_xref="EnsemblGenomes-Tr:ACO47903"
FT                   /db_xref="GOA:C1D422"
FT                   /db_xref="InterPro:IPR003115"
FT                   /db_xref="InterPro:IPR004437"
FT                   /db_xref="InterPro:IPR036086"
FT                   /db_xref="UniProtKB/TrEMBL:C1D422"
FT                   /protein_id="ACO47903.1"
FT                   /translation="MSPKPDIRASLLNSKTSKEAVYNQRSKTILEVPLDQVVPFSGQAR
FT                   RYFDHDSIKALADSIEKHGQLSPLLVWRNNDEQYEIIAGERRWKALRMLKRRVALADVI
FT                   MDVTRDQAFEIALVDNLQRENLNRYEEVRAKLDLIARRLMMTPDDARAELLRLRNGTSS
FT                   NTQHLVIVEEVLKMAGNESLQSFVANGFPVLDLPQVLRQAVEDGSLHPSKATVIKGAPE
FT                   EHHAVLIQQTVEEKLTRQQVLDRVRALAAPKGITYRSNADAVRKLLTPSRLKTLDTARR
FT                   NELETLLAKVKSLLQ"
FT   gene            2633..4579
FT                   /locus_tag="Deide_3p00030"
FT   CDS_pept        2633..4579
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p00030"
FT                   /product="putative histidine kinase, classic"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p00030"
FT                   /db_xref="EnsemblGenomes-Tr:ACO47904"
FT                   /db_xref="GOA:C1D423"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C1D423"
FT                   /protein_id="ACO47904.1"
FT                   /translation="MTANETPQLQDLELVQLINGIVWEADPVTRVNTFVSDRITSLLGY
FT                   TPEQWRSPGFWEAHIHPDDQARIVAEGEALMGRGQPYQLEYRMTRADGQTMWLRDLITP
FT                   VFRGGVMVKLGGVMLDITAEKNAQAELLAARARFSRIIESSPVGMVLSDIKTSRVLETN
FT                   DAFLRIINCPRAIFMGEEDDFNPWVSADDRAELVRRLKEDRTVRDFETLHKRRLTGEQR
FT                   NVLISAEYLEMDGQETLLVMAQDITDRKASEMALEESRRTFEALFEHSPDAIKLIDFDT
FT                   EEMPILQCNKVAARMSGYTREEIIGKSAYATLPDDQRAAILASGDAEFRASLESELEMR
FT                   FESVQQRKDGSLYPVDINLALLTVGDKRVVLSIERDMTARKKAEAELKSSQERLLLSEK
FT                   LASLGRLTAGLAHEINTPLAAAMNYLHEAERLAREYQASIGEASVTDDDHREIAGELIS
FT                   TLGEGAKTATRIGEFIRRMREHTRDTVTGVLDFDAGRGAEATLTMLTHQARAANVELIF
FT                   EAPEQLVVLRGEPGRFTQVVTNLVVNAIHACEGTSQQAGTVTVRLFEQLGHPVLQVQDT
FT                   GTGISPEVLPKIFDPMFTTKDVGKGTGLGLSIIHDIVTGHFGGEISVQTSIGEGSTFSV
FT                   SFPRRTRSEALAG"
FT   gene            complement(4869..5081)
FT                   /locus_tag="Deide_3p00039"
FT                   /note="nonfunctional hypothetical protein"
FT   gene            complement(5103..5357)
FT                   /locus_tag="Deide_3p00040"
FT                   /note="nonfunctional integrase"
FT   gene            complement(5710..7107)
FT                   /locus_tag="Deide_3p00050"
FT   CDS_pept        complement(5710..7107)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p00050"
FT                   /product="putative beta-lactamase"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p00050"
FT                   /db_xref="EnsemblGenomes-Tr:ACO47906"
FT                   /db_xref="InterPro:IPR001466"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:C1D425"
FT                   /protein_id="ACO47906.2"
FT                   /translation="MPLFDTVQALAPYLQSWLEYQRDLARVPGVQVAVRVNGELAASFA
FT                   LGVANEATGQPLTPRHLFRIASHSKTFTATAVFQLVETGALRLDDLAGLWLPELAGSPA
FT                   AGLTVRALLGHQSGINRDGADSDYWQQLCDFPNRDALITLCRADAVFAPDQFFKYSNMG
FT                   YSLLGLIIEAVSGQTYEEYIAAHITGPLTLTNLGPELPLERESELAAGHSGRLAGNDAR
FT                   RVLPSTDTRAMAAATGFYGTAEDVTAYLAAHAMGLDELLTDASKRLMQRKESEIRRPVK
FT                   RWYGLGFIVEEIGDRLVVGHSGGFPGHITQSWLDPESGLTVSVLTNCLGGPATEWATNL
FT                   IKLIDLAMNLSEKKTSDGSVFNLDSYTGRFATDWGVFDLVDLGGRLVSLAPQGDPALSV
FT                   TELTVVDANTVTPKPEAGFGSVGEPFQFQRTAAGDIEWVRQGGGRAWPIAAYRQRVGLA
FT                   PLASTVR"
FT   gene            complement(7271..8299)
FT                   /locus_tag="Deide_3p00052"
FT   CDS_pept        complement(7271..8299)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p00052"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p00052"
FT                   /db_xref="EnsemblGenomes-Tr:ACO47907"
FT                   /db_xref="InterPro:IPR019646"
FT                   /db_xref="UniProtKB/TrEMBL:C1D426"
FT                   /protein_id="ACO47907.1"
FT                   /translation="MPDLHLALIDLCGAIGNYHDRSRTDGVFHLQIGGPGSVPALKALD
FT                   MPELHVDLLPGPITSTQVDVLRSLGYVPAGLHWQHPGGWRLVLPDEASGWRAGQQALRA
FT                   LLLDSPEAAAAYVQVFGSHGRDTADLAFQERASAHYACTVGFHPACFVARMFAGLDLPW
FT                   MFAGGVALDLYMGRVTRPHDDLDVIVPYDQQAELHDHLQQSGWRLDASVNRTYQPWVPP
FT                   LEPPSFQVHARHPDLPDVVMLDLMLTDLSGGRWRYRRDPNITLPLERARLQGPHGLPYL
FT                   TPEAALLFKAGRGEGGMRLKDARDFARLRPSLTAGQQRWLHSQLKSSQPDHPWLPQLNG
FT                   SI"
FT   gene            8604..8969
FT                   /locus_tag="Deide_3p00060"
FT   CDS_pept        8604..8969
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p00060"
FT                   /product="putative DNA-binding protein HU (Histone-like
FT                   protein)"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p00060"
FT                   /db_xref="EnsemblGenomes-Tr:ACO47908"
FT                   /db_xref="GOA:C1D427"
FT                   /db_xref="InterPro:IPR000119"
FT                   /db_xref="InterPro:IPR010992"
FT                   /db_xref="UniProtKB/TrEMBL:C1D427"
FT                   /protein_id="ACO47908.1"
FT                   /translation="MTKKNTKAPAKKPAATKSAASAAPKKAAAAEKIGKTQMVDMIADR
FT                   AGLTKKQSEEVVSVMLESIVEAVRSGKSVGLPGLGTLSVRETAARTGVRPGTSEKIQIA
FT                   AGKKLAFKAATTLKGTL"
FT   gene            9798..10262
FT                   /locus_tag="Deide_3p00061"
FT   CDS_pept        9798..10262
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p00061"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p00061"
FT                   /db_xref="EnsemblGenomes-Tr:ACO47909"
FT                   /db_xref="InterPro:IPR009783"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:C1D428"
FT                   /protein_id="ACO47909.2"
FT                   /translation="MTRPPLPPFTIHTARDKVRLAEDAWNSRDPARVAQAYTEDSVWRN
FT                   RDEFFSGRPAIEAFLTHKWEREHDYRLIKELWTFHENRISVRFQYEFHDHSGQWYRAHG
FT                   NEQWEFDDRGLMRRREASINDVPIREEERLFRWPAGRRPDDHPGLTELGR"
FT   gene            complement(10837..11568)
FT                   /locus_tag="Deide_3p00080"
FT   CDS_pept        complement(10837..11568)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p00080"
FT                   /product="putative transcriptional regulator, GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p00080"
FT                   /db_xref="EnsemblGenomes-Tr:ACO47910"
FT                   /db_xref="GOA:C1D429"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C1D429"
FT                   /protein_id="ACO47910.1"
FT                   /translation="MTTKSLSRRHLVQSELTRRIVSGHVSPLSRLPKETELAEEFDVSR
FT                   VVIREAMKVLAEKGLIEIQQGRGTTVNPAHRWNPMDPQVLMHLGKGSSFYTVQSELLEA
FT                   RLVFEVKLAGLAATRMTDRDLGHMESLLRTMDQFLDDPDRFSELDAEFHVALIQGGKNA
FT                   ILAKLLEPVHELLKVGFRQTILKPGAAQQAQVFHWAIYDGLKRRDPVATQDAVQRHLIR
FT                   AQENLQALGDWLNPVPDEVKS"
FT   gene            11832..13115
FT                   /locus_tag="Deide_3p00090"
FT   CDS_pept        11832..13115
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p00090"
FT                   /product="putative sugar ABC transporter, periplasmic
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p00090"
FT                   /db_xref="EnsemblGenomes-Tr:ACO47911"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:C1D430"
FT                   /protein_id="ACO47911.1"
FT                   /translation="MSRTSLPVTLALTLCALSVASNAQAQTFNWKAQRGKTISVSVVKS
FT                   PWSDILQDRLGEFEKLSGINVNLSVLPEQQARQKLAIDFASGGRTVDVFDSSLTVEKTR
FT                   FAQAGWYEPLNKYMVAGKLDPTYRFDDFFTSARTAVKTSDGRIIGLPWKADVQVLYYRK
FT                   DLFAQAGLKVPTTLDELENAAEKLHVPGKMYGYAARGLKNANVYTFAFPLQAFGGKWID
FT                   GKGNSTVNSAQAVKALNWYSSMLKKYAPPSVISYNWSEVLGLFQQEQLAMFNDGIGFAV
FT                   QLEDKSKSKVAGKVGYAVLPGRLAPATYNALAMSSRSGNKDAAFIFMQWATNRAFDKHL
FT                   VENGVTSPRQSSWTTATNKPLETIPWAKTYFDALKVAKPAFPEVPPVQEMRDTVGIAIV
FT                   QSIQGSASKPALDQASRDFQTALNSAKQ"
FT   gene            13117..14028
FT                   /locus_tag="Deide_3p00100"
FT   CDS_pept        13117..14028
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p00100"
FT                   /product="putative sugar ABC transporter, permease
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p00100"
FT                   /db_xref="EnsemblGenomes-Tr:ACO47912"
FT                   /db_xref="GOA:C1D431"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C1D431"
FT                   /protein_id="ACO47912.1"
FT                   /translation="MTTSPLPGTAVRRAKRRPAAPILFVLPALLLTVIVIAFPLGYTLY
FT                   QSMTNWVITSPNPPKFIGLANYAELLRDQRAMQSLVRTLLITVCSVSLQMVLGVAMALV
FT                   MNKHFFGRGLFRTLALFPVVATPVAISLIFVTMMNPQTGVLNHFLTSLGLSAQQWIYAE
FT                   KSVLPALILVDTWQWTPFVMLIALAGLATLPSEPYEAAKIDGATAWQTFWGITLPMLMP
FT                   SLFVALLFRAIDTLKLFDTIYAMTQGGPGTASETINLYLYTLSFNYFRMGYASSMVIAL
FT                   LVLVLGITLLLIRARKLAEDRS"
FT   gene            14094..14897
FT                   /locus_tag="Deide_3p00110"
FT   CDS_pept        14094..14897
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p00110"
FT                   /product="putative sugar ABC transporter, permease
FT                   component, putative maltose ABC transporter malG"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p00110"
FT                   /db_xref="EnsemblGenomes-Tr:ACO47913"
FT                   /db_xref="GOA:C1D432"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C1D432"
FT                   /protein_id="ACO47913.1"
FT                   /translation="MTHLLPLLISAFFIVPIVFVFYWMVSMSFQTQVEISASPPTFWSA
FT                   NPTTEWYSQLMRRMPFLQYTWNSMVVGVSATAIGLAIGLPAAYAIARWKLTSLSTLFLI
FT                   TRITPAISFLIPWYIIAKRLGLGDSLVIITLLHITITLPLIIWIMIGFFEALPTDLEQA
FT                   ATVDGCNAWQSFALIAVPLVKPGIVAAIILAFIQSWNNFLFAAVLGGPGSQTLPVTVYG
FT                   MLSFEQANWGPLAAAATLVCLPVIVGTIFFQRQLVEGLTAGAMKG"
FT   gene            15017..15982
FT                   /gene="dapA"
FT                   /locus_tag="Deide_3p00120"
FT   CDS_pept        15017..15982
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dapA"
FT                   /locus_tag="Deide_3p00120"
FT                   /product="putative dihydrodipicolinate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p00120"
FT                   /db_xref="EnsemblGenomes-Tr:ACO47914"
FT                   /db_xref="GOA:C1D433"
FT                   /db_xref="InterPro:IPR002220"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR020624"
FT                   /db_xref="UniProtKB/TrEMBL:C1D433"
FT                   /protein_id="ACO47914.1"
FT                   /translation="MTHAHSSAFHVRGLVVPIVTPYTPHGAVDLKQAEALARFYALQGV
FT                   PALFPGGTTGEFALLTLDEREALLEAVVRGVRSSGTAETQIIAHTGAATLDEVLRLSRH
FT                   AQAQGVPAVAVVTPFYYEYEDAAVLAFYQTVCRTLPDLGVYAYTIPQRAGNSMTASSVA
FT                   ELCREPNFAGIKDSSGDMHRLLTLIEVPGLSVLAGADDLCFPFMISGGHGLVSGPAGVV
FT                   PELFQAFFAALNTQQVERAMALARHIRVFSRIIRGGGRIDYLKAGLDWRGLTNGPSRQP
FT                   LPNMGAEERRALTQQLVTFAQALAGDGVTLTSAAVRDAVV"
FT   gene            16053..16946
FT                   /gene="rbsK"
FT                   /locus_tag="Deide_3p00130"
FT   CDS_pept        16053..16946
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rbsK"
FT                   /locus_tag="Deide_3p00130"
FT                   /product="putative ribokinase"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p00130"
FT                   /db_xref="EnsemblGenomes-Tr:ACO47915"
FT                   /db_xref="GOA:C1D434"
FT                   /db_xref="InterPro:IPR002139"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR011877"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:C1D434"
FT                   /protein_id="ACO47915.2"
FT                   /translation="MILVAGSINIDFAVQVQALPAPGETVMGSAYLVSPGGKGANQAVA
FT                   CARAGAPVQFVGCAGSDAYGDQLREALQSDGIDTTSLRRVDGQTGAAFVTVGSDGENTI
FT                   AVASGVNQALREADLPELNGVTHLILQLEIPLETVRAFAQAARRAGVHVTLNAAPAHPL
FT                   DDELLGLVDLLIVNAGELEALCGAQAGAGLEYQLEVLSGRGPKAIVVTLGADGAAFWTN
FT                   GRCHRSAAFAVQAVDTTGAGDTFVGVLVAALRHMDLTAAVQRASAAAALACTQRGAQIS
FT                   MPRLSAIERLLASTVR"
FT   gene            17005..18615
FT                   /locus_tag="Deide_3p00140"
FT   CDS_pept        17005..18615
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p00140"
FT                   /product="putative L-fucose isomerase and L-arabinose
FT                   isomerase family"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p00140"
FT                   /db_xref="EnsemblGenomes-Tr:ACO47916"
FT                   /db_xref="GOA:C1D435"
FT                   /db_xref="InterPro:IPR009015"
FT                   /db_xref="UniProtKB/TrEMBL:C1D435"
FT                   /protein_id="ACO47916.1"
FT                   /translation="MTISSLPLTEAYLVASGDMRLAANQQCWPAQAHMEAQLTQALSAL
FT                   GVKLTRAHDVDPQERHGFISSQRMGMDVFRRIPKDAPVIVAEAVWQYSHHVLAGLRAHR
FT                   GPILTVANWSGQWPGLVGLLNLNGSLTKMNIDYSSLWSEDFQDEFFVSRLAEWVRTGRV
FT                   THDRTHVRSFDAQRVPEAHRTLGTQLAQSMLEQQAILGTFDEGCMGMYNAVIDDELLNP
FT                   LGIYKERLSQSALYAGMQQVTDSEAEAALDWLLERGMQFAWGADPATELTRAQTLDQLK
FT                   MYVAAMRIAAQFGCDAIGIQYQQGLKDLAPASDLAEGLLNNPERPPVHDARTGEELYAG
FT                   QALPHFNEVDEGAAVDGLVTHHVWTALGLNPANTLHDLRWGEDHDGQFVWVLMISGAAP
FT                   AAHFAGGYQGASSERQPPMYFAQGGGTLKGESRPGDLVWSRVYIQGGRLHVDLGLGRAV
FT                   ALPEAEVQRRWSLTTPQWPIMNAVLEGVSRDQMMAQHQANHIQVAYAPSRDAALEALNV
FT                   KATLFDALGVDVHLCGFQA"
FT   gene            18612..20123
FT                   /gene="xylB"
FT                   /locus_tag="Deide_3p00150"
FT   CDS_pept        18612..20123
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="xylB"
FT                   /locus_tag="Deide_3p00150"
FT                   /product="putative xylulokinase"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p00150"
FT                   /db_xref="EnsemblGenomes-Tr:ACO47917"
FT                   /db_xref="GOA:C1D436"
FT                   /db_xref="InterPro:IPR000577"
FT                   /db_xref="InterPro:IPR018483"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniProtKB/TrEMBL:C1D436"
FT                   /protein_id="ACO47917.2"
FT                   /translation="MTAGSPVLLGLDIGTYSSKGVLVGVDGRIVAQHVIAHQISMPAPG
FT                   HVEQDADAVWWGDAQTLIRTLLQGVDPARVVGVACSAIGPTLLPLDERGAPLRPGILYG
FT                   VDTRAGAQIDAMNHDLGEDQVFLHSNMALTSQAIGPKIRWLREHEPALWARTRTLTTAS
FT                   SYLVYRLTGRHVMDHHTGAHFMPLYDPRTRQWSETFRAAVLADRGLDLLPDLAWSDERA
FT                   GVVTAEAGALTGLRPGTPVAVGTVDALAEAISVGATQPGDLMVMYGSTTFFVLVQTAPT
FT                   PDPRVWSVGGAFPGQVNLAAGMGTTGSLTRWMADEFARELPTDQAYDALFAEAARIDPG
FT                   ADGLLMLPYLSGERTPINDPRARGVIAGLTLTHTRGHLFRAALEGVGFGIRHNLEAFSD
FT                   LGADIRRVIAVGGGTKGRVWLQIVSDITGVSQEMAQISLGASYGDAFLAGRAAGVLAPE
FT                   ELQRWIQPAEPVVPNMAAKRTYDRLYPLYRDLYTTTASTVHALSQ"
FT   gene            complement(20383..21147)
FT                   /locus_tag="Deide_3p00160"
FT   CDS_pept        complement(20383..21147)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p00160"
FT                   /product="putative amino acid ABC transporter, periplasmic
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p00160"
FT                   /db_xref="EnsemblGenomes-Tr:ACO47918"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:C1D437"
FT                   /protein_id="ACO47918.1"
FT                   /translation="MRLKISLLAGLALMVGSAAQARTLSDIKASGVLKVATSADFEPFN
FT                   YMKGGVAKGFEVDLAEQVARQMGLRIEWVVRPFDGLLKEVNDRPKEIDVVIASHAINST
FT                   RAKTVEFASPHYCTGGVILTRKGGPLTTKALAGKKLGAEAGSTYFSFLRKLPFDKSVQV
FT                   YNSSLAVTTAVATGQVAAIVTDRFAAIEAQKTFPKAGLVLGETLWKEQIAMAFAKGNTE
FT                   LKTAVNAALHQVETNGGSAQLSRKYFGQNIGC"
FT   gene            21551..22390
FT                   /locus_tag="Deide_3p00161"
FT   CDS_pept        21551..22390
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p00161"
FT                   /product="putative SAM dependent methyltransferase,
FT                   putative ubiquinone/menaquinone biosynthesis
FT                   methyltransferase ubiE"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p00161"
FT                   /db_xref="EnsemblGenomes-Tr:ACO47919"
FT                   /db_xref="GOA:C1D438"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C1D438"
FT                   /protein_id="ACO47919.1"
FT                   /translation="MHPSETGPVFAGSIPSVYAQYLVPLIFESYAADLASRVAGHQPAR
FT                   VLEIAAGTGVVTRQLAHALPPGTSIVASDLSQPMLDQAALAGTERPVEWKQADAQHLPF
FT                   PDASFDVVVCQFGVMFFPEKARAFAEVRRVLRPHGEFVFNVWDRIEENEFPQTIVQAIS
FT                   TLLPEDLLPFITRIPYGYHDPVVIARDLAAGGFTETPAITFLTALSRAGSPDIPAVAFC
FT                   QGTPMRDELEERGPTTLAQATDLATAAIAARFGPGDVTGKLRALVVSVKRDAPAVHR"
FT   gene            23102..25003
FT                   /locus_tag="Deide_3p00170"
FT   CDS_pept        23102..25003
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p00170"
FT                   /product="putative diguanylate cyclase"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p00170"
FT                   /db_xref="EnsemblGenomes-Tr:ACO47920"
FT                   /db_xref="GOA:C1D439"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:C1D439"
FT                   /protein_id="ACO47920.1"
FT                   /translation="MDFRDDPPQPASLIQAGAGLTGAIATALLQTSLDCMIVIDQNNLV
FT                   VEWNPAAEQVFSYSRQDTLGRNLSTLIIPPAFREGHERGMRRYLTTRIPRIANRVKVFA
FT                   QRRNGDTFPCEIAFHPLEFSGSTFFAAVLRDISEQIRTEEVLRESEERYRTIFDQAALG
FT                   IAHVSVKGHWERVNQTLCHILGYTHEDLLALTYPDVTHQDDLEQVKEHAELLLSDGVHT
FT                   SCIQHRFVRRDQSVVWVKVTSSVMRKASGEAQSFIAMVEDITEIQRAEEELRLAAEDLE
FT                   RRVEARTADLTNLSAQLQTQVLELEQRNRETRLLGEMSDMLQACLTISEVEQVVAQHAS
FT                   ELFPGVGGALYAFESSRTVLQETISWNGGSSSSSVFVPVECWGLRRGRPFSALGEEGLH
FT                   CRHSSASHSTLCVPMLAQGETVGLLHLEAGSAAPLTRRQERLAQTVAETAALAIVNLRL
FT                   RESLRQQSIRDPLTGLYNRRYLEESFERELHRAQRSDDPIAVIMLDIDHFKHFNDSHGH
FT                   EAGDELLRALGQLLSGCIRAEDVACRYGGEEFAMVFPGMTLDQATRWADQLRHTVESTQ
FT                   FASRGEALEQVSVSLGVAAFPQHGRHLADLIRAADAALYRAKREGRNRVITADGASR"
FT   gene            25354..26103
FT                   /locus_tag="Deide_3p00171"
FT   CDS_pept        25354..26103
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p00171"
FT                   /product="putative transcriptional regulator, GntR"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p00171"
FT                   /db_xref="EnsemblGenomes-Tr:ACO47921"
FT                   /db_xref="GOA:C1D440"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR011663"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C1D440"
FT                   /protein_id="ACO47921.1"
FT                   /translation="MTDDGTPRRYLQVQQRLQEMLDGGDYQPGDKVPSERELAQTLGVS
FT                   RMTVRRAVDNLVKLGLLERDSTTGTRVSTPRVRRLLNHAHLHSITQMVAATGGRAGGKL
FT                   LEFLVTPASVGVAEKLLVPAGSPVVTIRRLRLVDDMPFCLETSYLPARRVPGLAAEDLL
FT                   EGGSLYELLEARYGIAAAVGESLISVSFATVSEAQALKLPVNHAVLLYRSVVQDTQGQP
FT                   FEYLKSVNHPGLVVFNIGEGRPGPQEG"
FT   gene            26176..27216
FT                   /locus_tag="Deide_3p00180"
FT   CDS_pept        26176..27216
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p00180"
FT                   /product="putative phosphosugar isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p00180"
FT                   /db_xref="EnsemblGenomes-Tr:ACO47922"
FT                   /db_xref="GOA:C1D441"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR024713"
FT                   /db_xref="InterPro:IPR035490"
FT                   /db_xref="UniProtKB/TrEMBL:C1D441"
FT                   /protein_id="ACO47922.1"
FT                   /translation="MTISDAGPAVVASPINRELIINSLQGALQAKNAAATLGRDLAHQI
FT                   DRIYFVACGAPNRVMLSLEYWLDHARTDLQVKRYFPAEFLAMQPHLDERTLVILASKSG
FT                   TTQETVQAAQFLRSQPCRTLVVTTTADKPLAQGAQHLFLMGETEQAHTGIYIVLQGLMA
FT                   GLLDARHGYPLYDQVMRSLDALPAVLVESAEVSDARGRADAHTYRDDHTLYHLASGPVF
FT                   TTAYVFGVCMLMEMQWLHSVPFEAAEWFHGPFEILDAQTPVMVLLGEDPSRPLAERALT
FT                   FCRKYTNRVMKYDSRDLPMTGVDPEVRALFAPYALQAALNRFAEHLAAERNHSLDTRRY
FT                   MWVTDY"
FT   gene            27218..28048
FT                   /locus_tag="Deide_3p00190"
FT   CDS_pept        27218..28048
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p00190"
FT                   /product="putative fructoselysine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p00190"
FT                   /db_xref="EnsemblGenomes-Tr:ACO47923"
FT                   /db_xref="GOA:C1D442"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:C1D442"
FT                   /protein_id="ACO47923.1"
FT                   /translation="MPRLLGIGDNTVDLYLSDGTMYPGGNAVNVAVLSARLGHSASYVG
FT                   CVGTDAAGELILSALRAEGVDLSHCRQMEGMTSWSGIEHRDGDRYFVGSAPGVQGEWTL
FT                   TEADLTFTAAHDLVHTSIYSRLDDALPRIRQAAALLSYDFSSEWTTDLLARVAPQLDVA
FT                   FLSAGEDPLPEATALAEEVAGYGAGVVVVTRGARGALALTDTVLYTQNPVPAAVVDTLG
FT                   AGDAFITAFLHCWATHHDVPAALTAGAHEAARNCAVHGAFGYGTPIPAHHLARP"
FT   gene            28073..28852
FT                   /locus_tag="Deide_3p00200"
FT   CDS_pept        28073..28852
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p00200"
FT                   /product="putative amino acid ABC transporter, periplasmic
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p00200"
FT                   /db_xref="EnsemblGenomes-Tr:ACO47924"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR018313"
FT                   /db_xref="UniProtKB/TrEMBL:C1D443"
FT                   /protein_id="ACO47924.1"
FT                   /translation="MCHTRMSALLVLVPALCAAAPAHAATLAQVKASGVLRLATEGNYP
FT                   PFNHYKNKALTGFEVELGNAIAKQLGVKPQWTTVVFESLLLGLDRNRYDLVIASHGITP
FT                   ERLKAVTFSTPHYCSGGVLVARPGGPRTLEDLKGKVVTMGVNTSYLGYVQKLPGIGGVK
FT                   TFPTTNDQLNAVLNNRADAMVLDRFNAIDASKVLPGKLQIGDVVFPERIGMAMRRNNAE
FT                   LEQAVNRALATLMANGTYTKLSQAYFGQDVRCPVTPG"
FT   gene            complement(29253..30287)
FT                   /gene="recA"
FT                   /locus_tag="Deide_3p00210"
FT   CDS_pept        complement(29253..30287)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recA"
FT                   /locus_tag="Deide_3p00210"
FT                   /product="putative recombinase A"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p00210"
FT                   /db_xref="EnsemblGenomes-Tr:ACO47925"
FT                   /db_xref="GOA:C1D2C5"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013765"
FT                   /db_xref="InterPro:IPR020584"
FT                   /db_xref="InterPro:IPR020587"
FT                   /db_xref="InterPro:IPR020588"
FT                   /db_xref="InterPro:IPR023400"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C1D2C5"
FT                   /protein_id="ACO47925.1"
FT                   /translation="MDTDQHKALQTAMSQIEKQFGKGSIMKLGADSKLDVQAISTGSLS
FT                   LDVALGVGGIPKGRVTEIYGPESGGKTTLALSIIAQSQKAGGTCAFIDAEHALDPVYAR
FT                   ALGVNTDDLLVSQPDNGEQALEIMELLIRSGAIDVVVVDSVAALTPRAEIEGEMGDSLP
FT                   GLQARLMSQALRKLTSIVSKTGTAAIFINQVREKIGVMYGNPETTTGGKALKFYASVRL
FT                   DVRKMGGKSTMVDNVAVSHSVKVKTVKNKVAPPFKEVELTLRYGHGFDAMDDLVTLATT
FT                   FEVIKKAGSFYSYGDERIGQGKEKAIAFLSERPDLLADIRERVLAQMRGTPVAPLPEPA
FT                   LSAD"
FT   gene            30608..32110
FT                   /locus_tag="Deide_3p00220"
FT   CDS_pept        30608..32110
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p00220"
FT                   /product="putative sulfatase"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p00220"
FT                   /db_xref="EnsemblGenomes-Tr:ACO47926"
FT                   /db_xref="GOA:C1D445"
FT                   /db_xref="InterPro:IPR000917"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:C1D445"
FT                   /protein_id="ACO47926.1"
FT                   /translation="MPRNVILIQIDSLNRHFLRAYGNDWVQAPNLEGFAQRAVIFDRHF
FT                   TGSLPCMPARREIWAGVEEFWWRGWGPLEPWDEPIAYHANRAGITTQLITDHYHFFEWG
FT                   AHSYHHDFAGYEFIRGHEHDNHITAPLRGEPSWARRMVAEHGESARIYLRNVASFAHEK
FT                   DFFAPRVMDAAARWIDLNHTQERFFLHVDCFDVHEPFHIPEPYRSLYTDEAPDDFNPWP
FT                   RYGRSDEGELALTEQELQWIRAQFAGKLTMVDTWLGRVFDALSRHDLWPDTAVIITTDH
FT                   GHYLGEHGRIGKPASPLWNTLTHVPLMVWCPGQPARREGAITQPVDLHATVLDLLNLPG
FT                   TGPHSRSFLPVLLGQRTDHRDLAVYGYANARVGVTNGEWTLLRDHDPRLGPAHWYSLQV
FT                   GHLDARSYPARHTRPTVFPDLVAGQFIPGVQTAHWRMPAQSDDLRHLTLPREDLLYHAA
FT                   DLGQQQNLRVEHPREMRRLEEQLRAHMTQLGVPQEQFARLRL"
FT   gene            32805..33002
FT                   /locus_tag="Deide_3p00225"
FT   CDS_pept        32805..33002
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p00225"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p00225"
FT                   /db_xref="EnsemblGenomes-Tr:AHX26567"
FT                   /db_xref="UniProtKB/TrEMBL:X5HN99"
FT                   /protein_id="AHX26567.1"
FT                   /translation="MIEVKCTWIPGTLDMLQLRAGNRHGRLSVHELRRRFGMGAMNSMY
FT                   LIGRFQTLAEPGALTGLALS"
FT   gene            complement(33343..34485)
FT                   /locus_tag="Deide_3p00230"
FT   CDS_pept        complement(33343..34485)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p00230"
FT                   /product="putative Carbonate dehydratase, precursor"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p00230"
FT                   /db_xref="EnsemblGenomes-Tr:ACO47927"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="UniProtKB/TrEMBL:C1D446"
FT                   /protein_id="ACO47927.1"
FT                   /translation="MRKQSWKWVLGLGGCTLLTAALAGGSEGVKGALARFTSTPPTVIN
FT                   RSFLSPLSEYFGTISVGQHSFVAANTVVRADPGQSICIGSDTNLQDNILLLALRNQPLP
FT                   AGGCAPRATTVRDRVSIAHQAVIKNSVIGNFTFVGFRSRIENSVLEDGVFVLHGAVVRN
FT                   VRIPRDRLVPTGAAITTQAQANALPLKAAANSEFQEEVLEVNEEFAEHYVELYLEGGFD
FT                   AVSGVSANPKTSFNPRAIRPTLSANVRLEEFARLVGDVRLGANSVVGRRTSIRADEGAP
FT                   IIIGERAEIEDRVTFHALKGTSIQIGRNLDTDDNIVFHGPLTVGDNLTIGDDAVLFRSK
FT                   VGTGVTIGSGALVIDVTLRDGVTVPENAKILKQADADALR"
FT   gene            34755..35126
FT                   /locus_tag="Deide_3p00231"
FT   CDS_pept        34755..35126
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p00231"
FT                   /product="Hypothetical protein, precursor"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p00231"
FT                   /db_xref="EnsemblGenomes-Tr:ACO47928"
FT                   /db_xref="UniProtKB/TrEMBL:C1D447"
FT                   /protein_id="ACO47928.1"
FT                   /translation="MSVHPSRRKQWIFLPILWLSSFALAEVQLVPVPASDVTRLLVKIY
FT                   SARKVPADMTFVALLLRQQPSLAQRINSMEIDVESRTIRIGVSEPLLLKNDPVLDSLRE
FT                   YAHALNISMDVTAVRYFRF"
FT   gene            complement(35539..37188)
FT                   /locus_tag="Deide_3p00232"
FT   CDS_pept        complement(35539..37188)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p00232"
FT                   /product="putative N-acyl-D-amino-acid deacylase"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p00232"
FT                   /db_xref="EnsemblGenomes-Tr:ACO47929"
FT                   /db_xref="GOA:C1D448"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR013108"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:C1D448"
FT                   /protein_id="ACO47929.2"
FT                   /translation="MCAFVIKGGVLIDGTGASRFPADLRMDDHRITQIALPGAADETAA
FT                   EVIQADGLVVAPGFIDVMSHSVSTLLEDGRSVSKITQGITTEIMGEGWTPAPVWGANTE
FT                   PFRLHGCPGGEKSWENRARNWTRFGDWMSAQEGVGASVNFGSFLGGTTVRLCVRGHAAG
FT                   PSTPEELDSMRRIVRESMEDGAFGLATALEYPPGSFADTDELTVLCGEVARYGGIYSTH
FT                   LRAEDDSILEALDEALEICHRSGARLHLYHLKAAGRSSWPKMAQLLQRINGIRTLGTEV
FT                   YADMYLYTSAGTGLSSVLPPWASTDDRLKDRLADPRERAQIYQAVQTPDGTWEPLGSLN
FT                   GPASVTPLGLRLPNHLQFNGQSLVKISEALGLDWIDTAIELILKEPGRIFTAFDLMSED
FT                   NIERQLLEPWVMPGSDAQGFDPSRSSRDALGLHPRACGNFARFLGYYVRDRGLMSLEEG
FT                   VRRMTSLPARHLRLAGRGELRTGAFADVVVFDPHEIRDRATFLEPGHLSEGVHHVWVNG
FT                   QPVVRAGLTTGARPGRRLHGGSKVRKPSADRI"
FT   gene            complement(37420..38166)
FT                   /locus_tag="Deide_3p00233"
FT   CDS_pept        complement(37420..38166)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p00233"
FT                   /product="putative hydrolase, precursor"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p00233"
FT                   /db_xref="EnsemblGenomes-Tr:ACO47930"
FT                   /db_xref="GOA:C1D449"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C1D449"
FT                   /protein_id="ACO47930.1"
FT                   /translation="MRMSALLHLLIISVALAAPVQLRAPDGLTLHAEHTAVTHPRGAVL
FT                   LLHAPGQNRHEFRGIVGRLAREGYASLALDQRSGGRYDGHNNPTVAGLGTRILTERSAL
FT                   SDLDVAWRWLKRTYPNASVFALGSGASGTLLIPFAAQRPELAGVLAFSPYRGDLFETDA
FT                   LAAARRMHVPLFVTSSDDPFEVQAARELLNATASACKRQYVPPGFGLRGAVNLDPAKTT
FT                   EPVVTERYWTAVLSFMEAAKSRKRRC"
FT   gene            complement(38545..38901)
FT                   /locus_tag="Deide_3p00234"
FT   CDS_pept        complement(38545..38901)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p00234"
FT                   /product="putative antibiotic biosynthesis monooxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p00234"
FT                   /db_xref="EnsemblGenomes-Tr:ACO47931"
FT                   /db_xref="GOA:C1D450"
FT                   /db_xref="InterPro:IPR007138"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:C1D450"
FT                   /protein_id="ACO47931.1"
FT                   /translation="MYGLIGKIQVLPGQRDALASILLEGTTGMPGCLSYVVAQDPDDDK
FT                   ALWVTEVWDSEASHQASLALPSVRQAIQQGRPLITGFGERFVTRPLGGHGLVYQESHSP
FT                   TQRTAAPTMTEGTS"
FT   gene            complement(39414..43694)
FT                   /locus_tag="Deide_3p00240"
FT   CDS_pept        complement(39414..43694)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p00240"
FT                   /product="putative metal dependent phosphohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p00240"
FT                   /db_xref="EnsemblGenomes-Tr:ACO47932"
FT                   /db_xref="GOA:C1D451"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR037522"
FT                   /db_xref="UniProtKB/TrEMBL:C1D451"
FT                   /protein_id="ACO47932.1"
FT                   /translation="MTQAAGKSGEAVTDHNRQPWQLSPMPDLCEPEHPPGLDRITWLAA
FT                   RLLGASVAFISRLSDQQIMAAFSLKGDVSRHLLETAQSLIIPGQRAADINNLTLDPHTR
FT                   DHPLATGPDAMRSYAAVAVTTPDGTHTGSLILLHQQTRPPLSPFDQDTLRGLADLAGEA
FT                   INLHNGRLDLTLQQHRLQRTLALTQTISWVFHPSSQRFSLGGSAEDLGLTHIGMPDTIE
FT                   DWARLIHPEDRERTVRQLHEAIDSRRAYAEDYRVVSATGEVTWLRAQGQPQLDAAGQVL
FT                   CFVGCVQNITRQKRDEAALLESETRLRTVLETISEPIYLKDLNGRYRMFNPAALSFVKQ
FT                   DADQAYGAVDADLFPGQAERIHAMDQQVMLTRQPVTYEVPFPDRTTVMQTTKHPYIVNG
FT                   ELAGVLGISRDISAHRNLEEQLVRQARRTSSILESLPSAFIALDPAWRFVYINAVAARM
FT                   FGRAPDEVLGQPVWPFLHRLTGLHLKDRLQAVPGTSTLQFEVHTPETGAWFEISAASHE
FT                   DGMAISFVDITARKQLEDSLRNANEDLERRVTERTAELRTKAYQDVLTSLPSRRAFEEA
FT                   FERATEQPQGFQLLLLDVDDLKTVNDLAGHAQGDHLLQCFASALQEVFGPHGQAYRQGG
FT                   DEFAVLLQTGHFGPARLREMMHRVHRQVGLQGYPSLRASMGAVTFPQDASAPNDLLRLA
FT                   DRRMLRDKAAHRAVRTFQGPHQSETDTHLSAEMMWQALRATSALISTDGLIDRAGWQAF
FT                   LQAAVTALPSAEAGSMYVREGSLFVMRAQVGYSEALIGVGHPAEGMGLWYGTEKNWALG
FT                   EARVLRGSPAIRAAAHPIPQWPAGNADIALFDDLGGLDHIQASLCVPVMVSGQVVATIN
FT                   LDNLRSEQAFEPYELNIAEEFARQAAAIVASHDRRAREVNRTQELEVLAQANAALGLVQ
FT                   EPEELERILVQETKELLRTAHVAFARYDHRDMVLRLVSPSGVYEHFPYQVIPEGQGISW
FT                   HAIHSGKVLHVERLDQDPRVHTPGALPDGTLLAAPLIRTADVPIGVILAVRPASQSFSP
FT                   LDGRLLGALASAGVTAFERLRVTVEEQRRTEELRMLAELARHVGLADDVGTIARECLSV
FT                   CKTFLEADLALFTCPERGLEITVGEGAEDFLKAAARLLDGSAGMPPFTGEQGRATSCYP
FT                   ELPGALPEMVSAGVHGVVEVPVMERGRRIGKVFLVWLRPLEALPRTAEALMNRSAELIG
FT                   QVLNREAHLADIEATREGALMALGLSLELRDFETAGHTERVVVLAVQVGQALGLTAEQL
FT                   DDLRVGAYLHDIGKLAIPDDILLKPGKLNAAQRQLMQRHTVVGDELMSRIPTVLPGARA
FT                   VIRHHHERWDGTGYPDQLAGDMIPLAARIFTVVDVFDALTRSRPYKHAWTVDAAIEELR
FT                   LQAGRRFDPHVVEAALLVLAQQRS"
FT   gene            complement(44155..44625)
FT                   /locus_tag="Deide_3p00250"
FT   CDS_pept        complement(44155..44625)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p00250"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p00250"
FT                   /db_xref="EnsemblGenomes-Tr:ACO47933"
FT                   /db_xref="UniProtKB/TrEMBL:C1D452"
FT                   /protein_id="ACO47933.2"
FT                   /translation="MNGYEPLEVVKAVKRALWDVSNQRTPITQVDLTLKTLQEQGAGFS
FT                   LKVPWLSDIEVSAGAKESMTQTINLSLTLPDELLDAASTELQQAVVAMVGTFNAMLDVA
FT                   TDGEHGKPLLFRDGTAAVEFVFDQQGQIKLIFNAGLRANYANTVKVKFGART"
FT   gene            complement(44813..45037)
FT                   /locus_tag="Deide_3p00260"
FT   CDS_pept        complement(44813..45037)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p00260"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p00260"
FT                   /db_xref="EnsemblGenomes-Tr:ACO47934"
FT                   /db_xref="UniProtKB/TrEMBL:C1D453"
FT                   /protein_id="ACO47934.1"
FT                   /translation="MLVHITLNLNEAEVDAQADSVLEELHRAGVREVDTRYLKSYSLVS
FT                   GHVDQAHVGSVEALPVVMAVEPISTVNAI"
FT   gene            complement(45096..46274)
FT                   /locus_tag="Deide_3p00270"
FT   CDS_pept        complement(45096..46274)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p00270"
FT                   /product="putative serine protease, subtilase family"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p00270"
FT                   /db_xref="EnsemblGenomes-Tr:ACO47935"
FT                   /db_xref="GOA:C1D454"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR015500"
FT                   /db_xref="InterPro:IPR022398"
FT                   /db_xref="InterPro:IPR023827"
FT                   /db_xref="InterPro:IPR023828"
FT                   /db_xref="InterPro:IPR036852"
FT                   /db_xref="UniProtKB/TrEMBL:C1D454"
FT                   /protein_id="ACO47935.1"
FT                   /translation="MDPQSLTLEQPAHIIVFRDVTPENADVLASILEAVPLPGADAGAQ
FT                   SINRTILSAANGTHARIYLQLGVAVATLTPHQIWQLRVLGNIITVAPNEERSIPERQVF
FT                   EGTDLPAEGTFHQIGLNPHTSELTGNGVRVAVLDTGVDLQHPDLNILPGNTISYVPGEP
FT                   DVQDQNGHGTHCAGIIAGSATPAGGIRYGVAPEATLLIAKVLNRKGTGTDAEIVDAINW
FT                   AANLGAEIISMSLGSPRTPGSSFSARYETIASRLLDRGILLVAAAGNDSARPHYVRPVR
FT                   NPAACPSIMGVAAVDHHDRIAAFSNPTMDAIGVVDIAAPGVGVLSAWPGATVQRSSGTS
FT                   MATPHVAGVAALYVEQNPANTGRTLWKLLTERARTVAALSADDVGTGIVQAP"
FT   gene            46926..47396
FT                   /locus_tag="Deide_3p00271"
FT   CDS_pept        46926..47396
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p00271"
FT                   /product="Hypothetical protein, precursor"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p00271"
FT                   /db_xref="EnsemblGenomes-Tr:ACO47936"
FT                   /db_xref="UniProtKB/TrEMBL:C1D455"
FT                   /protein_id="ACO47936.1"
FT                   /translation="MFRPLPLAVLALAGVACAAAPPVKFTLATPPGTKSLVMVTHPALA
FT                   LKYNVTAGPGSTDPKAEFTFEVNPDGCLGYEYFARPGFGSFYGRKDLCGFSPKTFKIKV
FT                   VNAAPKLGQWTVVAYLTNARGQSVPLQLLASVTPWSSAARPTVKQITPPLRP"
FT   gene            47264..47596
FT                   /locus_tag="Deide_3p00272"
FT   CDS_pept        47264..47596
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p00272"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p00272"
FT                   /db_xref="EnsemblGenomes-Tr:ACO47937"
FT                   /db_xref="UniProtKB/TrEMBL:C1D456"
FT                   /protein_id="ACO47937.1"
FT                   /translation="MDSRGVPHKRQRTVGAAATAGQCDPLVFCRATHRETNYPTPETLK
FT                   LFSCRQESASRRAGGSDRAMLPGARQVEQSPGVIHKQGPDPLQEDLGGLCNGYSRTRER
FT                   SNPQGA"
FT   gene            complement(47664..48569)
FT                   /locus_tag="Deide_3p00273"
FT   CDS_pept        complement(47664..48569)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p00273"
FT                   /product="putative universal stress family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p00273"
FT                   /db_xref="EnsemblGenomes-Tr:ACO47938"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:C1D457"
FT                   /protein_id="ACO47938.1"
FT                   /translation="MMIPRVLIPVETLDMASPALTTARRFFPTAPCHLLHVLPAAPQTV
FT                   SSLGGPVIMIGTGEPAHREAEQQLSALGNGEVVSGSDPASEIVRRTFTQEFDLVVMGTS
FT                   GRRGLARALLGSIAERVVRESALPVITVRHGEPEPTSRILVMTDFSSAANRAYGAVQQY
FT                   FPGAEVHLMHVVSPTALTAPVSLPPAGRAITASSLIARNREWIQEAREQLATLGGGEIV
FT                   EGDPAEVALERARSGMYGLIALGTAGRGGVERLMFGSVAQRIVRESPVPVLTARALDPD
FT                   SSMNGPSSFRLNDNGGSLGA"
FT   gene            complement(48936..49430)
FT                   /locus_tag="Deide_3p00280"
FT   CDS_pept        complement(48936..49430)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p00280"
FT                   /product="putative transcriptional regulator, MarR family"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p00280"
FT                   /db_xref="EnsemblGenomes-Tr:ACO47939"
FT                   /db_xref="GOA:C1D458"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR023187"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C1D458"
FT                   /protein_id="ACO47939.1"
FT                   /translation="MPSEEFMDTPALLNRIERDWRAARPDVDPEPMLTVIAVQRTSSLL
FT                   QAALEDFFAQHDLTPSAFDLLATLRRSAPPEGLTLGDLAGLMAITPPAITKRMDGLERR
FT                   GWVARQADTQDRRTVRAQLTAEGRQVVDSLLTAHVANEERLLGGLTPAERRILRALLGR
FT                   I"
FT   gene            complement(49433..49885)
FT                   /locus_tag="Deide_3p00290"
FT   CDS_pept        complement(49433..49885)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p00290"
FT                   /product="Conserved hypothetical protein; putative membrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p00290"
FT                   /db_xref="EnsemblGenomes-Tr:ACO47940"
FT                   /db_xref="GOA:C1D459"
FT                   /db_xref="InterPro:IPR000559"
FT                   /db_xref="InterPro:IPR006750"
FT                   /db_xref="UniProtKB/TrEMBL:C1D459"
FT                   /protein_id="ACO47940.1"
FT                   /translation="MTFAVLLGTLGAGIGLSAGLAFNLRLARALGSPLAATLVNFMVGA
FT                   ALLLGLWLLGVDGTRPSALPPLWMLCGGLLGATYVTLSLIGAARLGVGLSTVAVTLGQV
FT                   LGALLIGTVGWLGQPSQRPTLAALLSAALLLGAVALLARDREQAKG"
FT   gene            complement(49882..50346)
FT                   /locus_tag="Deide_3p00295"
FT   CDS_pept        complement(49882..50346)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p00295"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p00295"
FT                   /db_xref="EnsemblGenomes-Tr:ACO47941"
FT                   /db_xref="GOA:C1D460"
FT                   /db_xref="InterPro:IPR006750"
FT                   /db_xref="UniProtKB/TrEMBL:C1D460"
FT                   /protein_id="ACO47941.1"
FT                   /translation="MAIPSIPQQTFPLVLAVFAGSLLPAQFATNGALAGQWPLTLTAAT
FT                   SYLEGALFLFLLLKAQRLTPDWAAAHQAPRWAWLGGIVGSAYVVGSVLLTRMLGAALAT
FT                   TLVIAAQIVTAILLDHFGALGLQRRRINRTRLLAVLLALGALSLRLWGTG"
FT   gene            complement(50495..51055)
FT                   /locus_tag="Deide_3p00300"
FT   CDS_pept        complement(50495..51055)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p00300"
FT                   /product="putative phosphoglycerate mutase family,
FT                   precursor"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p00300"
FT                   /db_xref="EnsemblGenomes-Tr:ACO47942"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:C1D461"
FT                   /protein_id="ACO47942.1"
FT                   /translation="MTRKRETLTRWLITLGLCALSTAKAQSQWNALTDGAVVLFRHALA
FT                   PGTGDPPGFRLNDCRTQRNLNAEGRAQARRIGRAFRERRVTVTRVLSSRWCRARETASL
FT                   AFPGKVHNEAAFNSFFDNSAQEPAQTRAARGVLARWKGPGVLVVVTHQVNITALTGIVP
FT                   ASGEGIIVRFQDDRLKVLGRVTP"
FT   gene            complement(51159..51353)
FT                   /locus_tag="Deide_3p00305"
FT   CDS_pept        complement(51159..51353)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p00305"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p00305"
FT                   /db_xref="EnsemblGenomes-Tr:AHX26568"
FT                   /db_xref="UniProtKB/TrEMBL:X5H5W8"
FT                   /protein_id="AHX26568.1"
FT                   /translation="MKKSEARYVAKNVPGVGWRVWSTPVEQWWGNAFPVYPAALLDELN
FT                   GPKRTDRLLELNRPDDIRS"
FT   gene            51602..52078
FT                   /locus_tag="Deide_3p00310"
FT   CDS_pept        51602..52078
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p00310"
FT                   /product="putative adenylate cyclase"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p00310"
FT                   /db_xref="EnsemblGenomes-Tr:ACO47943"
FT                   /db_xref="InterPro:IPR012042"
FT                   /db_xref="InterPro:IPR023577"
FT                   /db_xref="InterPro:IPR033469"
FT                   /db_xref="UniProtKB/TrEMBL:C1D462"
FT                   /protein_id="ACO47943.1"
FT                   /translation="MPMEIERKFLVRADVWAATVKPEGSELRQGYLSTDPARTVRVRVA
FT                   NTQAWLTIKGKTQGVSRAEFEYALPVDDARQLLTLSVSQLHKTRYRMPVGVHTWDVDVF
FT                   HGPLSGLILAEVELRAEDEQFEPPLWVGVEVSADARYYNSALSGAQQVPDPPEL"
FT   gene            complement(52559..53518)
FT                   /locus_tag="Deide_3p00320"
FT   CDS_pept        complement(52559..53518)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p00320"
FT                   /product="putative cysteine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p00320"
FT                   /db_xref="EnsemblGenomes-Tr:ACO47944"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:C1D463"
FT                   /protein_id="ACO47944.2"
FT                   /translation="MTRSDLNLTPLRAGTLGGIGHTPLIELTNVVPRGSARLVAKFEPA
FT                   NPTGSMKDRMAQAAVSAAVQDGRLVPGGTVVEYTAGTTGISLAFVCAARGYRLHVVFSD
FT                   AFSQEKLRTMQAFGAEITLVPSDQGRITQQLIKEMIRVSHELGGQPGHWWCDQLNNHDA
FT                   IEGYHALGSELWEQTEGSLDAFVHAVGTAHSIHGVSRELRRRGADVTVVAVEPAESAVL
FT                   SGGTSGAHRIEGIGIGFLPPLWHPEEISEIQTVSTEEATHMARRLAREEGLFAGVSTGA
FT                   NVVAALRVAERLGEGATVATIVCDSGLRYLSTDVFRPQ"
FT   gene            complement(54506..54982)
FT                   /locus_tag="Deide_3p00330"
FT   CDS_pept        complement(54506..54982)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p00330"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p00330"
FT                   /db_xref="EnsemblGenomes-Tr:ACO47945"
FT                   /db_xref="UniProtKB/TrEMBL:C1D464"
FT                   /protein_id="ACO47945.1"
FT                   /translation="MTCPANLEWTDPDLRNFYSPGRNVPARDPLAELRAAGLVLPSLPS
FT                   PPGARVGSSGSSYGSEGPNGPFYITYATVRTPHSPDTVLTHYLAALQAQGWAQGAPQQT
FT                   PEGEWTVSLTARQGGQERRATFSLMPRPELGTTEGSTRLHRVDVQFALGQRPSY"
FT   gene            complement(55066..55494)
FT                   /locus_tag="Deide_3p00331"
FT   CDS_pept        complement(55066..55494)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p00331"
FT                   /product="Hypothetical protein, precursor"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p00331"
FT                   /db_xref="EnsemblGenomes-Tr:ACO47946"
FT                   /db_xref="UniProtKB/TrEMBL:C1D465"
FT                   /protein_id="ACO47946.1"
FT                   /translation="MKPFLRILALGLFGSAVALAQSASPDLLSKLTDSERVLLLTAAGV
FT                   GSSDAFRPGQLPPMLPYRLPLLPGQTLIGSVVQPWSTLVVVRTTATPEAVRVAATKALA
FT                   LEGWRDQYDTTATQDIFRSHTGDQTIVRTTRPASADLA"
FT   gene            56136..56534
FT                   /locus_tag="Deide_3p00340"
FT   CDS_pept        56136..56534
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p00340"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p00340"
FT                   /db_xref="EnsemblGenomes-Tr:ACO47947"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="UniProtKB/TrEMBL:C1D466"
FT                   /protein_id="ACO47947.1"
FT                   /translation="MPENDPTATVRRMFAAFASGDLDAVLETLHEDSHWIYIGANPDLT
FT                   KVEFRGKAGVRRFFEHILEKYEITAFTPDEWIEQGDAVVVFGSEEGRIRATGAPFRHEW
FT                   SQKYVVTHNLISRMTEYNIRVEPKGSAD"
FT   gene            complement(56679..57701)
FT                   /locus_tag="Deide_3p00350"
FT   CDS_pept        complement(56679..57701)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p00350"
FT                   /product="putative alkanesulfonate monooxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p00350"
FT                   /db_xref="EnsemblGenomes-Tr:ACO47948"
FT                   /db_xref="GOA:C1D467"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:C1D467"
FT                   /protein_id="ACO47948.1"
FT                   /translation="MRFGYWMPIFGGWLRNVEQEDMTTDWSYVRDVAVQSEQLGFDLSL
FT                   IAELNLNDIKGPQAPSLDAWTLAPAVAAVTQNLELMMAVRPNYHAPALTAKAISTLETI
FT                   APGRVSLNVVSSWWADEARQYGMPFDQHDDRYTRTEEWLSVVRRLLTEPVVDHAGALYQ
FT                   LSGTHLEPKPAQLPTVYMGGESPRAKQLISEKSDAYVMHGDPPEVIAAKIADLRARRET
FT                   SGGAPMQFGMAAYVICRDTEEEAQAELARITDVQQSPQAYASYQDFVRGSQLESQVSLE
FT                   EYSVSNRGLRPRLIGTPEQIAARIREYEAAGVDLLLLQFSPQLEEMRRFGQDVIPRFRA
FT                   "
FT   gene            complement(57826..59106)
FT                   /locus_tag="Deide_3p00360"
FT   CDS_pept        complement(57826..59106)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p00360"
FT                   /product="putative ATP-grasp enzyme-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p00360"
FT                   /db_xref="EnsemblGenomes-Tr:ACO47949"
FT                   /db_xref="GOA:C1D468"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:C1D468"
FT                   /protein_id="ACO47949.1"
FT                   /translation="MITERSDLLAAIDQLNGVGLPAAITFNTHITALAIARSLGRQGIP
FT                   VLGLDREGGGLGQRSRHLSALALCPDVADGGREFTDFLLDLGPHFAQKPVLFPTNDDWV
FT                   FATSRHKTELERFYHVPFSGQDVIDTALNKTSLYRAAEKLGIPIPQSWYLDGVPVADLA
FT                   AGPHEQVRQVAAQVPYPVILKPDESRAFYEAFRAKVFVVQTPSEFEARVQEAAQQGLRL
FT                   VAQRIVRTRPGGFYSVCSYLDAQSRPRGVFVGRKLEQYPPDFGTSCLADARFVPEIAER
FT                   GVRVLQALGFHGISEIEFVQDPDTGEHLLLDVNTRSWKWIGLPIASGIDLPSLAYRDAI
FT                   GEAFDAPQQRDGVRWTFLRDYVKLVRERAGVMPQEHVTKDEWLSLIRGEIPAGGTLVDG
FT                   ILDPDDPEPFYEVLKGELFGFRYTCAC"
FT   gene            complement(59103..59834)
FT                   /locus_tag="Deide_3p00370"
FT   CDS_pept        complement(59103..59834)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p00370"
FT                   /product="putative aspartate racemase"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p00370"
FT                   /db_xref="EnsemblGenomes-Tr:ACO47950"
FT                   /db_xref="GOA:C1D469"
FT                   /db_xref="InterPro:IPR001920"
FT                   /db_xref="InterPro:IPR004380"
FT                   /db_xref="InterPro:IPR015942"
FT                   /db_xref="InterPro:IPR018187"
FT                   /db_xref="InterPro:IPR033134"
FT                   /db_xref="UniProtKB/TrEMBL:C1D469"
FT                   /protein_id="ACO47950.1"
FT                   /translation="MNRAVGVLGGMGPEATLDFFAKVLRRAGARSDQDHLRLLIDNNPG
FT                   VPDRNAALSGRGESPGPVLAQMARGLQASGADFLVMVCNTAHAFEEDILNATTLPFVSL
FT                   IEETRDAALREQPGLQRVGLLATSTCLGAGLYQSAFAPYGVSTLALEGSALARFMDLLY
FT                   QIKAGDTGPRVRAEMRTLALELVDSGAEVLVAGCTEVPLVLDAQDVPVPLVNSTDVLVE
FT                   RTLQYARGLVPLPERSVKTPA"
FT   gene            complement(59831..60826)
FT                   /gene="dcyD"
FT                   /locus_tag="Deide_3p00380"
FT   CDS_pept        complement(59831..60826)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dcyD"
FT                   /locus_tag="Deide_3p00380"
FT                   /product="putative D-cysteine desulfhydrase"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p00380"
FT                   /db_xref="EnsemblGenomes-Tr:ACO47951"
FT                   /db_xref="GOA:C1D470"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR005966"
FT                   /db_xref="InterPro:IPR027278"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:C1D470"
FT                   /protein_id="ACO47951.1"
FT                   /translation="MHLARFPRRQYTADPTPIEKLERLSAFLGGPDIYIKRDDLTGLTG
FT                   GGNKTRKLEFLVADALARGADTLITVGAVQSNHCRLTLAAAVKEGLQCRLVLEERVAGS
FT                   YQENASGNNFLFRLLGAESLTVVEGGADLAGTMQSIADDLAREGRKGYVIPGGGSNALG
FT                   ALGYVACAEEILGQTYRMGLDLDHIVCASGSAGTHAGLLVGLTGNNAHLPLTGINVRRE
FT                   RETQEGNVHALAQQTAELLGVPEIPRETVRALDEWVGPGYSLPTTDMVEAVQLLARLEG
FT                   ILLDPVYTGKAMAGLIGLVRRGEFKPGQKVLFVHTGGAPALYAYQDVLLA"
FT   gene            61974..62246
FT                   /locus_tag="Deide_3p00385"
FT                   /note="nonfunctional transposase (degenerated IS - IS630
FT                   family)"
FT   gene            62114..62434
FT                   /locus_tag="Deide_3p00384"
FT                   /note="nonfunctional transposase (degenerated IS - IS630
FT                   family)"
FT   gene            62287..62727
FT                   /locus_tag="Deide_3p00383"
FT                   /note="nonfunctional transposase (degenerated IS - IS630
FT                   family)"
FT   gene            complement(62744..63229)
FT                   /locus_tag="Deide_3p00382"
FT   CDS_pept        complement(62744..63229)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p00382"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p00382"
FT                   /db_xref="EnsemblGenomes-Tr:ACO47954"
FT                   /db_xref="InterPro:IPR034660"
FT                   /db_xref="UniProtKB/TrEMBL:C1D473"
FT                   /protein_id="ACO47954.1"
FT                   /translation="MPTVDAPDYLSNLTDLLRETFEGTGGQGSHYIDGRGHGSVFETLD
FT                   DLDHELASTPLKPDGATIAAHTEHIRYYIHILRRFIAQEEDVRPDWPGSWETRTVTPEE
FT                   WSDLKRAIRDEYAAAMTHLHQIEVWDDEPIGGFLSILTHSAYHLGAIRLLAVTLRHY"
FT   gene            complement(63522..64169)
FT                   /locus_tag="Deide_3p00391"
FT   CDS_pept        complement(63522..64169)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p00391"
FT                   /product="putative phospholipase A2, precursor"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p00391"
FT                   /db_xref="EnsemblGenomes-Tr:ACO47955"
FT                   /db_xref="GOA:C1D474"
FT                   /db_xref="InterPro:IPR015141"
FT                   /db_xref="InterPro:IPR036444"
FT                   /db_xref="UniProtKB/TrEMBL:C1D474"
FT                   /protein_id="ACO47955.1"
FT                   /translation="MRQVLSAAVLVSLLASCGQTVPDVAVTLPGDSLVGAYAERPELQD
FT                   PESQAILSRYANDPGLVQALQEAYGERPTVLSFPETPTITGQDLAADRLAYIKRVGWRT
FT                   VTYYNGQYASYAGTTLPYSGLNWTRDGCSAPDGLGLGYREDFRPACNVHDFAYRNLKVY
FT                   QRTDANRKTSDDVFYSNMKVICAAKSWYAEPACYSAAYAYYQGVRVGGGGSF"
FT   gene            65182..65616
FT                   /locus_tag="Deide_3p00393"
FT   CDS_pept        65182..65616
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p00393"
FT                   /product="putative response regulator, CheY"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p00393"
FT                   /db_xref="EnsemblGenomes-Tr:ACO47956"
FT                   /db_xref="GOA:C1D475"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:C1D475"
FT                   /protein_id="ACO47956.1"
FT                   /translation="MSIAPRHYLLVDDNPTDRLLAQEAFAELQPDCTLTCVASGLEALD
FT                   FLQVAVPLPDVILLDINMPGMNGFQLLERLKNRPELKGIPVVMLSTSNAAEDIRQAYTL
FT                   HASSYVVKSPSFEAFMAQVEAFLGYWQATRVARPSTAEQP"
FT   gene            65648..65863
FT                   /pseudo
FT                   /locus_tag="Deide_3p00400"
FT                   /note="nonfunctional response regulator, CheY"
FT   gene            65867..66025
FT                   /pseudo
FT                   /locus_tag="Deide_3p00401"
FT                   /note="nonfunctional response regulator, CheY"
FT   gene            complement(66474..67490)
FT                   /locus_tag="Deide_3p00410"
FT   CDS_pept        complement(66474..67490)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p00410"
FT                   /product="putative homoserine O-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p00410"
FT                   /db_xref="EnsemblGenomes-Tr:ACO47959"
FT                   /db_xref="GOA:C1D478"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR008220"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C1D478"
FT                   /protein_id="ACO47959.1"
FT                   /translation="MTSWPVQEGVFELGDLNVERGGVIQGARLAWQTHGTLNSARDNVI
FT                   VYPCSYAATHDSQSWLIGPGGVLDPERWFIVIPDMFSNGLSSGAAETPDYPDLVTLRDN
FT                   VLAQSRLLREIFGVQRVAAVYGFSMGAMQAYHWAALFPGQVERAIVVCGSARTSLHNKV
FT                   FLSGLLRTLEAAPEHLGNGRFAAEPHEALKAFGHIYAGWGLSQDFYRAELFRTVLGFPD
FT                   LETYLRSDWEVRFAPYRAANLYAQALSWFHGDISGNDLYGGDLSQALASIQARVLLMPS
FT                   ETDLYFRVADNAAELPYLQAAELRSIPSLWGHRAGSPAGLPEELTFLSSAVQNWLAE"
FT   gene            complement(67846..70410)
FT                   /locus_tag="Deide_3p00420"
FT   CDS_pept        complement(67846..70410)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p00420"
FT                   /product="putative alpha-mannosidase"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p00420"
FT                   /db_xref="EnsemblGenomes-Tr:ACO47960"
FT                   /db_xref="GOA:C1D479"
FT                   /db_xref="InterPro:IPR000602"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="InterPro:IPR011682"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR015341"
FT                   /db_xref="InterPro:IPR027291"
FT                   /db_xref="InterPro:IPR028995"
FT                   /db_xref="InterPro:IPR037094"
FT                   /db_xref="InterPro:IPR041147"
FT                   /db_xref="UniProtKB/TrEMBL:C1D479"
FT                   /protein_id="ACO47960.1"
FT                   /translation="MADPRSKDLTFTLVGHAHLDPVWLWDRQEGLEAVKATFRSVLDRL
FT                   KENPDLMFGHTSAAQYAWMDVDPDLLAEIRAAVDRGQWELLGGQWVEPDVNIPSGESLA
FT                   RQALHGQRYFEHTFGQRSRVAFLPDTFGHPHTLPQMFKLSGLDHFVFWRPHPHEVDLPS
FT                   NLFWWQGPDGTRVLSARVESYNSNPRDVVDTLNASIDWRPADSPEWLVVYGVGNHGGGP
FT                   TKKAIANMRALMVDPDWPTLQMGTVAGFFARAAQRDVQAEFHAPLQYTFRGCYTSHSSV
FT                   KRFNRLGEHTLSAAEKWSTIATRYGRAYPGAALDRSWKHLLFNQFHDIICGTSIPRAYD
FT                   DARYEQGEAVGTAKRTLHEAVQVIARHIDTRSTDDVVVEETMRRVRTGAGNVVADMGDG
FT                   VPVVVFNPNPWPRQEVIDVELNDWHVLDMQVLDDRNEPVVHQFAMGEAGPPRKRAAFLA
FT                   DVPALGYRVYRIVDRPPHQPGADARPLSATDRVLENAWWRLELDPRTGALRSLRDKRLD
FT                   RELLAGAAAQVLVIEDPTNPWGKGDYFRHLAGVFGDPHIELLETGPVRATVRVTTRWGR
FT                   STARQDLSIYRDSPAIHGHLQLDWHEEYRMAKLAFPFALEDTTATFSVPFGYVTRPAGG
FT                   QEEPSQAWLAVSGVLASSGKPTEANFQQLGDQAGSMAQRHAGRAPYGVALLNDSKYGAD
FT                   VHGGEVRLSILRSPIYGGGDRPEQPRPVDQYLDQGLSETRWALMPHMGAWQDAGVVAAA
FT                   QDFNEPLTFVREFAHSGRLPRTLSFLTVEPPDAVLVTALKQAEEGEDWILRLYEPYGRP
FT                   AAVQVTVPLLNLSFEATVTPHQIKTFRLGQDGTQSEVNFLEQ"
FT   gene            complement(70524..71156)
FT                   /locus_tag="Deide_3p00430"
FT   CDS_pept        complement(70524..71156)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p00430"
FT                   /product="putative transcriptional regulator, LuxR family,
FT                   putative sensory transduction protein liaR"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p00430"
FT                   /db_xref="EnsemblGenomes-Tr:ACO47961"
FT                   /db_xref="GOA:C1D480"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:C1D480"
FT                   /protein_id="ACO47961.1"
FT                   /translation="MTASPIRVLLVEDHAFTRDGLRVAVNFEPDLRVVGEARSGEEALE
FT                   VLSRTAVDVAVVDIGLPGMDGIQTAGEVRRHYPQTRVVMLTAHNLRAEVLAALASGADA
FT                   YCLKSARPDLLLLAIRAAAVGSAFLDPQVAHHVLGAMRTPGVPVELSARELEVLRLIAD
FT                   GLGNREIGMQLEISVSSVKLHVQDLLEKLQASDRTQAAVKALRQGLL"
FT   gene            complement(71153..72652)
FT                   /locus_tag="Deide_3p00440"
FT   CDS_pept        complement(71153..72652)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p00440"
FT                   /product="putative histidine kinase, classic; putative
FT                   membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p00440"
FT                   /db_xref="EnsemblGenomes-Tr:ACO47962"
FT                   /db_xref="GOA:C1D481"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C1D481"
FT                   /protein_id="ACO47962.1"
FT                   /translation="MHFALPSSHSTSRRPFQGLEVVAVVLAALVFLADLATPPALVVGT
FT                   LLSAPVALAALASSWRFALGLLVFAVVANVGAGFHHWHDLPTSTFDVLNRAVSLGATLL
FT                   VGGLTWRARLASERAVQVEAEKRRAEQERNLRTLVEFVSGPYGLEAFVARAAEGLAAFT
FT                   GAQEVEIGRVDRTTMRTPHAIFPAGARHHLNQTLPLDVRVPPSSDGSVWTASQESDLLA
FT                   FLPGRDGDLLVRVHQPQVNAAQLVEAITTLRPLLERTTLLDDLAAQRAHLAEQGEVVRD
FT                   LIYAFSHDLRTPLMANALHMEQALKGAFGPLPEEYRRTLHNGLEANDSLLSLADQLLTV
FT                   ARYEGGEAQEEAQEVNLRSIVLGVVDQVQPRAQARRVGFDLRLDSVRVYGSKHDLRRAV
FT                   QNLVDNAVKFSPSEGTVTIELKLDLDDALIKVTDEGPGVPSSRTGNLFQRFRTGGAGGS
FT                   TGLGLYLTRRIAEAHGGTVSYRRTAQARTVFTLTVPKGETT"
FT   gene            72739..74688
FT                   /locus_tag="Deide_3p00450"
FT   CDS_pept        72739..74688
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p00450"
FT                   /product="Conserved hypothetical protein; putative membrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p00450"
FT                   /db_xref="EnsemblGenomes-Tr:ACO47963"
FT                   /db_xref="GOA:C1D482"
FT                   /db_xref="UniProtKB/TrEMBL:C1D482"
FT                   /protein_id="ACO47963.2"
FT                   /translation="MSTARTSGSFKQWFLEIEQSEPEGFYENESAVRVQHHQHPWWKVM
FT                   CLTGVDYFSTLGYQPGIAALAAGPLAPVATLVLVLVTLFGALPMYRRVAQESPHGDGSI
FT                   SMLERLLSYWPGKLLVLTLIGFVATGFIITITLSAADATAHLVENPFLKARLDGYQVPL
FT                   TLALIGLLGGVFLKGFKEAIGIAVAIVVLYIGLNLVVIGKGTLDVLAQPAVLTNWQTGL
FT                   AQAYQSPLAMTGAALLVFPRLALGLSGFETGVVVMPLVQGGPGDARKRLAGRIRNTKKL
FT                   LTTAALLMSALLLGSAMVTTLLIPPDAFRPGGEASGRALAYLAHERLGDAFGSLYDAAT
FT                   ILILWFAGASAMAGLLNIVPRYLPRYGMAPDWSRASRPLVVIFVALSALVTILFRANVE
FT                   TQAGAYATGVLALMTSAAVAVFLTEVRRKHARSAAVFAVISALFIYTSVVTVADRPEGL
FT                   FIALLFIAAILTVSVASRVSRSTELRVQHVTLDGPAQQLLRETVLRGLPVRFIANRLHA
FT                   GDSTEYHLKELEVRLDTHLPQGEPALFLEVAITDASNFTDTVQVQGVRIGRHAVLRAGG
FT                   SSVPNTIAAVLLHVRDVTGSPPHVYFEWSETGPAANALRFLLAGEGDIPPLTHEVLRVA
FT                   EPNQQRRPIVHVGG"
FT   gene            74694..76049
FT                   /locus_tag="Deide_3p00460"
FT   CDS_pept        74694..76049
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p00460"
FT                   /product="putative K+ uptake transporter (Trk family);
FT                   putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p00460"
FT                   /db_xref="EnsemblGenomes-Tr:ACO47964"
FT                   /db_xref="GOA:C1D483"
FT                   /db_xref="InterPro:IPR003445"
FT                   /db_xref="InterPro:IPR004772"
FT                   /db_xref="UniProtKB/TrEMBL:C1D483"
FT                   /protein_id="ACO47964.1"
FT                   /translation="MTSPNRRLLLNRLTPPQLIALSFAVAILVGTLLLYSPVTHAPGKN
FT                   VTLLQALFTATSATCVTGLNVLDPGSTFNRLGEVILMVLIQVGGLGIITFGTLFASLRG
FT                   QRVGVQERLRTAQQANLNEFGDVTRVIKGIFIYTLLTELIGALLLMVHFVPLEGWDRGI
FT                   HLSVFHSVSAFNNAGFGLYPDNMIRFAEDPLVLLTTSTLVILGGLGYLAVLGVALYLRD
FT                   PRRNRLSLNTIIILVTSAFLIVLGTVVVTVLEWNNPGTLGPLSTGGKLLSGYYQGVAPR
FT                   TAGFNSVDYGAMHGATLFITMLLMFVGGSPGSTAGGIKTTTFYVLVSSIVSHAKGEHEN
FT                   VSFHRRIETEDLLRASVVTALSLVVVTSGMFLLLATNPKLPFVNVAFEAFSAFATVGLS
FT                   MNTTPLFNAPGQLVLIGLMFLGRIGPLTFAIAFARQQRHRVRYPVDKSIVVG"
FT   gene            complement(76441..77649)
FT                   /locus_tag="Deide_3p00470"
FT   CDS_pept        complement(76441..77649)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p00470"
FT                   /product="putative major facilitator superfamily MFS_1;
FT                   putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p00470"
FT                   /db_xref="EnsemblGenomes-Tr:ACO47965"
FT                   /db_xref="GOA:C1D484"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C1D484"
FT                   /protein_id="ACO47965.1"
FT                   /translation="MASSIRGPAWAVLLADTLTWLATGVMFPFLMLYWQRVHQQSAAQA
FT                   GMLVALVSLAGVLATPLAGSLTDRLGSRATLLGGLGAALLGAMTMAVATTLPLVLSGAV
FT                   LVFAGQAVVGPAVLSALALLLPAHLHSNAFSLRATGLNAGIGVGALLGGVIVHADDLTS
FT                   FARLFWLQALLLLLAGGLASRLPRLFSPSGSGARGRGGWRTALRDPRLLLLCALMFAFV
FT                   FIGISQLNTGIALVAMDVRAVPTGVFGAAVACNAFVIVLGQVAVTRALRGRRRTSALRL
FT                   MFLVWVAAWLAVLFLGTASSGLVVPLLVLGMLLFGLGELLMPPSLTPLVAVVAPGELLG
FT                   RYNALVSLSGLLARTVAPLAPGVLLSHSSSLFAGVMVLACLACLTLPARLHPRLNDADN
FT                   LIQ"
FT   gene            complement(77845..78081)
FT                   /locus_tag="Deide_3p00474"
FT                   /note="nonfunctional hypothetical protein"
FT   gene            complement(78519..78845)
FT                   /locus_tag="Deide_3p00473"
FT   CDS_pept        complement(78519..78845)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p00473"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p00473"
FT                   /db_xref="EnsemblGenomes-Tr:ACO47969"
FT                   /db_xref="UniProtKB/TrEMBL:C1D488"
FT                   /protein_id="ACO47969.1"
FT                   /translation="MRKSHFLLRPESEGWWPYRTGVSVTAQVTMPDTTALQLLNAEVYF
FT                   PFRVMGAEAETVGAAVTPACIGRTARLSRRTSRSFSTRRELGSGILTRNGSFTVRLLEA
FT                   LLHV"
FT   gene            complement(78972..80594)
FT                   /locus_tag="Deide_3p00480"
FT   CDS_pept        complement(78972..80594)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p00480"
FT                   /product="putative 5-nucleotidase"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p00480"
FT                   /db_xref="EnsemblGenomes-Tr:ACO47970"
FT                   /db_xref="GOA:C1D489"
FT                   /db_xref="InterPro:IPR006179"
FT                   /db_xref="InterPro:IPR008334"
FT                   /db_xref="InterPro:IPR019079"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="InterPro:IPR036907"
FT                   /db_xref="UniProtKB/TrEMBL:C1D489"
FT                   /protein_id="ACO47970.1"
FT                   /translation="MSIRLLPLTALTVLLTACLSVAPPDPVTIQFLNVSDWHAQLDPLT
FT                   VGSGTTQRTVGGAATLSAYFKQDRAANPNTLTLTGGDAYGGSPPLSSFFNEVPAIEAMN
FT                   VMGFDADTFGNHNFDRGIQGLQPLIDRAKFQYVSANLENLEANLTKVKRYQIFTVGGVK
FT                   VAVIGITNPEAPTLVAPGALGTLRVTDPVAAATQARLMAQAEGARVFVVIAHLGVTGRD
FT                   PVTQAHTGPLIDFAKSVNGFDVIFGDHTNEQFSATINGALVIENLSKGATYSKVNVTVD
FT                   RSTGQVTERINTFIEPVTTGVTPDPAVEQVLSTYRTQLAQQLDRKIGVATEVFARGSNI
FT                   ERLREVALGNLITDALRARYGTQLAIQNGGSIRSALPSSYTPQDKSLRRPAPGYQPGPP
FT                   YDIVAGDVYSVLPFGNTAVTRTVTGSQLYAALENSVSALPGASGRFLQISGFSFTYDVS
FT                   RPVGSRIVSVTLDSGAPVLRDATTYTLALSDFTNAGGDEYTMFADGQGVSREPDAQVVL
FT                   EYIQQRGTITPATGTRIRAVGGS"
FT   gene            complement(81052..81999)
FT                   /locus_tag="Deide_3p00490"
FT   CDS_pept        complement(81052..81999)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p00490"
FT                   /product="putative Bug family protein, precursor"
FT                   /note="Bordetella uptake gene bug product"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p00490"
FT                   /db_xref="EnsemblGenomes-Tr:ACO47971"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:C1D490"
FT                   /protein_id="ACO47971.1"
FT                   /translation="MTRFSLLAAALLLLPLSASAQPLTGLRIMAPASPGGGWDQTSRAI
FT                   QSALHDTKLAQSVQVFNVSGAGGTIGLAQFNNAQGDNNLLMAMGLIMVGAIETNKSKAT
FT                   LETVTPIARLTGEYEVLVVPAASPYKNLRQFVAAWKANPRLAIAGGSAGGTDHMLTGLL
FT                   AEAAGIDPANMNYVAYSGGGESLTALLGNQVAAGVNGYNEMAEHINSGKLRLLGISSKR
FT                   RIPGIIAPTFREQGLNVEMLNWRGVVAAPGISPERRKQLIATFDKLHASKAWKDTLRQR
FT                   KWVDMYLSGEKFDTFLTAEQTRARKVLKSIGLVK"
FT   gene            complement(82063..83592)
FT                   /locus_tag="Deide_3p00500"
FT   CDS_pept        complement(82063..83592)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p00500"
FT                   /product="putative FAD binding protein, putative fumarate
FT                   reductase flavoprotein subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p00500"
FT                   /db_xref="EnsemblGenomes-Tr:ACO47972"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C1D491"
FT                   /protein_id="ACO47972.1"
FT                   /translation="MHLNSDSPSDQHTFDTVVVGAGNAALCAALSARERGMRVLVLERG
FT                   PHGKRGGNSYFTDGAIRFAYNDLNDIRDVIPRISDEEAEQIVMPSYSEADYLGDLMRVT
FT                   GNQSDPELARQIVTQSPSTIRWMRDHGVKFDLIYDNQSFLKDGKYHFWGGLPVKTDGKG
FT                   VGLIERLNVRAEELGIEVWYESRATRLLTDKGRVTGVLVQRGEQEITLQAGSVVLACGS
FT                   FEASRELRAEHIGQEWDAAIVRGTEFNTGDGISMALAVGAQRYGDWSGCHAIGTDAGAP
FT                   KVGDFGKPGDIYKKHSYPLGLLINKSGLRFVDEGADFRNYTYAKYGREILKQPGHVAYQ
FT                   IFDSQVRPMLRKEYNLEEATFYQADTLEELASLLDVDQKQFLETIGTYNAAVQDGDYNP
FT                   TVKDGKGTVGITPPKSNWALAVEQGPFYAFPVTCGITFAFGGVRVSPQGEVLNADQEAI
FT                   PGLFAAGEMVGGIFYQNYPGGSGLMSGAVFGKLAGESSAQYVQASSLALTS"
FT   gene            83743..84423
FT                   /locus_tag="Deide_3p00511"
FT   CDS_pept        83743..84423
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p00511"
FT                   /product="putative transcriptional regulator, GntR"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p00511"
FT                   /db_xref="EnsemblGenomes-Tr:ACO47973"
FT                   /db_xref="GOA:C1D492"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C1D492"
FT                   /protein_id="ACO47973.1"
FT                   /translation="MALPPFQIDTSISLAAGLYEALRGAILRGELKAGEKLTEVSLAEH
FT                   VQISRTPVREALRHLQLDGLLESAGRSLIVAPVNLDAMMEMCVVRETLEGLAARLAASY
FT                   RGEADLLALADLQETMCAASAVNDVAAVVRANHRFHATIWHASRNRYLARQLQDLRQAI
FT                   ERLQTSTLNSSQRRAEAEQEHEEILAALQAGDMEWAERATRQHFRNAELLRLRLLRLKA
FT                   DTSF"
FT   gene            84888..85121
FT                   /locus_tag="Deide_3p00513"
FT                   /note="nonfunctional transposase (degenerated ISDds3 - IS4
FT                   family)"
FT   gene            85325..88003
FT                   /locus_tag="Deide_3p00530"
FT   CDS_pept        85325..88003
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p00530"
FT                   /product="putative histidine kinase, classic"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p00530"
FT                   /db_xref="EnsemblGenomes-Tr:ACO47975"
FT                   /db_xref="GOA:C1D494"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C1D494"
FT                   /protein_id="ACO47975.2"
FT                   /translation="MPESFGASTAPSSLAERLQDVTEALAAATTPAAVFKIVLQPALVA
FT                   LDAVAGAVLLVSDAGDRLEIAATQGREDGAQTIWQDGPLDDTVPAGDALKQHTPLFFEH
FT                   QGELTAVYPDLEERAGTTAPVASAVLPMFLDGQPLGAIVLDFKEPHHFTPAERRFLRTL
FT                   AAQCAVALGRARLSGALHRQVEARTRELEESRARAEVLATLGDALQRAHSPEDVAVQAL
FT                   EPLGHTLGASSVMVVQLERGRLHVPTIWGETLPAMAALRTSGTPLKEAALLDRCARTKK
FT                   AGYYADYDAAGGVLTGLATLAFAVEPIHASGDDLVGFLCAWRLPRTEPWPAGDRDLLRR
FT                   SAGTLGVALERAVTTQALQERTEALDAFVAFTERVAGETDVRALIEHAADVLRATLGDL
FT                   GVGYYEPEDGRWKARAWSNGIPREFVARMQAGFEFSTPRFAHAIRDQQPHFMQEWNSAS
FT                   EDLPGARRTGAMATYPYFQHGRPTGVLSAGSMQTLGWSEREQAIIRAVGRSLGLAMEGT
FT                   RSAAELRRASRFNELVLNSLGEGVTTIDAQGRSTLANPAALKMLGYTAEDFMGRPQHAL
FT                   IHHSYPDGSPFPREACEIYAAFVDGQVHRANDEVFWRKDGSSFPVEYTSTPILNESGEI
FT                   EGSVLVFRDVTERQRAEATLRQANDELRRSNAELEQFAYVASHDLQEPLRTVTSFSQLL
FT                   AKKYAGQTDARGQMYVRLITEGTQRMTQLLQDLLAFSRVAKGAADPVRVNTGVILAQVS
FT                   QDLAAQIQHTGAQLHIGEVPDVLGDASQLRQLFQNLIGNALKFSHPERGPVVWVGAECD
FT                   GGLVRFRVQDNGVGIAPEYFERIFTIFQRLHTREQYEGSGIGLSIARKIVERHGGRIWL
FT                   ESTPALGTTFYFTLPAVEGGA"
FT   gene            88000..88374
FT                   /locus_tag="Deide_3p00540"
FT   CDS_pept        88000..88374
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p00540"
FT                   /product="putative response regulator, CheY"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p00540"
FT                   /db_xref="EnsemblGenomes-Tr:ACO47976"
FT                   /db_xref="GOA:C1D495"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:C1D495"
FT                   /protein_id="ACO47976.1"
FT                   /translation="MRSVTRVLVVEDHFPDAVLLEEWLELAEVQWEVVHVVTFAEATSR
FT                   WPDGRFDALLLDLDIPDGFGLDLVERGLALAGAVPVVVLSGRADEAVAAGAVGLGARAY
FT                   VVKGPASVHELRAALEGQRD"
FT   gene            complement(88407..88793)
FT                   /locus_tag="Deide_3p00545"
FT   CDS_pept        complement(88407..88793)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p00545"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p00545"
FT                   /db_xref="EnsemblGenomes-Tr:AHX26569"
FT                   /db_xref="GOA:X5GY98"
FT                   /db_xref="InterPro:IPR007367"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:X5GY98"
FT                   /protein_id="AHX26569.1"
FT                   /translation="MNDVTLAFSPRRARLPTLERTPRITSAPTLTPPLTLTLGRLLIHL
FT                   DLTPTLELMARIELRGSERRPRVRGKGVAVPDVLRIARRCRTLEELFELRPSLDELDVR
FT                   ACLAYAHQLQAQRESGPSGRFQPT"
FT   gene            88833..89288
FT                   /locus_tag="Deide_3p00551"
FT   CDS_pept        88833..89288
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p00551"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p00551"
FT                   /db_xref="EnsemblGenomes-Tr:ACO47978"
FT                   /db_xref="UniProtKB/TrEMBL:C1D497"
FT                   /protein_id="ACO47978.1"
FT                   /translation="MMRKLARKNADCPCGRVRAKCGTVAQEHLGSRTLMFRLCCYPRPG
FT                   QPAACLKLGPVGGGTRRMGLTPQDAALTEGLWQFVREASSLRLVGEILPLTVSALSVFL
FT                   PAYQLTQSTPAGQEPLYRGGPQPHTVFRPRTKVRRSVWRMSAAAPRS"
FT   gene            complement(89359..89691)
FT                   /locus_tag="Deide_3p00552"
FT   CDS_pept        complement(89359..89691)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p00552"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p00552"
FT                   /db_xref="EnsemblGenomes-Tr:ACO47980"
FT                   /db_xref="UniProtKB/TrEMBL:C1D499"
FT                   /protein_id="ACO47980.2"
FT                   /translation="MAAPRSSAALRARATPTHTDLAALPFDQACAEIAARHHLSEPHAF
FT                   QLAPGGATHLVRLSDGQALCGRGPQVYAEAPQVTGPLTCRACVQAVARRLKSSLGRRAA
FT                   RHTPTR"
FT   gene            complement(89883..90278)
FT                   /locus_tag="Deide_3p00553"
FT   CDS_pept        complement(89883..90278)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p00553"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p00553"
FT                   /db_xref="EnsemblGenomes-Tr:ACO47981"
FT                   /db_xref="GOA:C1D4A0"
FT                   /db_xref="UniProtKB/TrEMBL:C1D4A0"
FT                   /protein_id="ACO47981.1"
FT                   /translation="MRNRNYRLGVINGWFGSIGDTCLNSGIVLAPLASQLGASNTLVGL
FT                   IPALMSCGYSLPQLFVAGKVRERPLKLPIYKSSAWLRSSAFLLLVTASVLVTLWSSRYK
FT                   VGESLAPPRQGQRMTRELYCHHGWAPC"
FT   gene            90540..91235
FT                   /locus_tag="Deide_3p00555"
FT   CDS_pept        90540..91235
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p00555"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p00555"
FT                   /db_xref="EnsemblGenomes-Tr:ACO47982"
FT                   /db_xref="UniProtKB/TrEMBL:C1D4A1"
FT                   /protein_id="ACO47982.1"
FT                   /translation="MKRLLTTVILLAVTASAQEGPAVSSSLLRVPLSTGAVRVADAAAA
FT                   REFGQVLNGLARNQNSGCQTSEFLVWDDVDRAEEISTHLATQFNTAARLTVVDEIHPEG
FT                   PVSVRATSLPPSFQQVARQAVENAVYRVLGTEADGPCLACFQRTDRAKSQCWSTRVRKV
FT                   VHPTLIHAWPARTPGGAAARSGWQSPRRGRVGKPRRLPLPGPPPGWRTARSGSEPRNTG
FT                   RPYLLWAAG"
FT   gene            complement(91018..92292)
FT                   /locus_tag="Deide_3p00560"
FT   CDS_pept        complement(91018..92292)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p00560"
FT                   /product="putative major facilitator superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p00560"
FT                   /db_xref="EnsemblGenomes-Tr:ACO47983"
FT                   /db_xref="GOA:C1D4A2"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C1D4A2"
FT                   /protein_id="ACO47983.1"
FT                   /translation="MSPHELEYKSRGVQLRALAGLPRNARNAILMEPLWAIFGTVVIYY
FT                   APLYMRSVGLSSTEIGLLGSVTLALSFLFQAVAAPVTNRLGRKRTTLIGDLISWTIPMF
FT                   VWATANSFAAFAVAAALSAVGRIVALSWSLLLIEDVEERQRARVFGIINLIVTVCGLLT
FT                   PLVGLIIAQHGVTATMRAYYIAGGVGMTVMFLWRNAITQETQSGVAAMAQHRALGVGQS
FT                   ICHTMAMVAGMRGHPGLMGMTAFYLLTVFIEQLSLFQILFLQETLQFSAQTLSFVPFVG
FT                   AFVTVLLYWVGLPQLSRLPLGRTLVVTRVLGLLGAALLLFVPAGNVAVMLAVVGLLGGA
FT                   TFLTQTYRDAALFSRLPREGTADLYSAVQTLTLLCAIPAAALAGAIFEVSPHGLFVVIA
FT                   ILSGLLLLLAFWLARRESESDGPLF"
FT   gene            93069..93515
FT                   /locus_tag="Deide_3p00562"
FT   CDS_pept        93069..93515
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p00562"
FT                   /product="Conserved hypothetical protein; ISDds6 passenger
FT                   product"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p00562"
FT                   /db_xref="EnsemblGenomes-Tr:ACO47985"
FT                   /db_xref="InterPro:IPR018958"
FT                   /db_xref="InterPro:IPR037883"
FT                   /db_xref="UniProtKB/TrEMBL:C1D4A4"
FT                   /protein_id="ACO47985.1"
FT                   /translation="MGQEELFKRLRAGGVPAPLIPKLPDDREIDALEVLLETRLPPSYR
FT                   AYLLTLSDVLAGAYWPLVIHHELTGGRLLDQTRDLRAIGLPQFLVPFETSQDGDAFCFD
FT                   TRSAGPEYAVVRWVHDDGSFDTYRWPSFIAWVQDEWLPTVEDQK"
FT   gene            complement(93827..95203)
FT                   /locus_tag="Deide_3p00564"
FT   CDS_pept        complement(93827..95203)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p00564"
FT                   /product="putative transposase"
FT                   /note="ISDds6 - IS701 family member"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p00564"
FT                   /db_xref="EnsemblGenomes-Tr:ACO47986"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR038721"
FT                   /db_xref="InterPro:IPR039365"
FT                   /db_xref="UniProtKB/TrEMBL:C1D4A5"
FT                   /protein_id="ACO47986.1"
FT                   /translation="MTVPHNWQRAFRGFLSPYLETLDNAKQRVCLPRYVRGLLAPLERK
FT                   STQPIAEHVGMPYQRLHHFVNVSHWDAEQIEIRLKRQAQRLCGGKNAVLIIDDTALPKS
FT                   GDASVGVAYQYCGALGKIANCQSLVTLTLSDGSLFAPLSMRLFLPGSWAGNPERCQGAG
FT                   VPVVRQHYRSKGEIAMEELDRALDAGVTFRVVLADAGYGINKDFRQALSQRGLTWAVGI
FT                   VGIQKVFSLDVTLRDPPQKTGGRPGKHPIPSEIARPVKDVLHEIPPYRWHTVKGAKSSR
FT                   WLVVRGRIADGLPNKRGLHLPGEAVWVVGEKRRGGEIKYYVTNHAPSTSMAQVVRDIKA
FT                   RWACEVLHLQSKEELGLDHFEGRSLLGLEHHIVLVLLTMMFLQTLRQQQCSVAAEIPTL
FT                   PELRRTTSRALEQIWFGRCPHCGEVVQVGSTPLPGLKVRISNPYRRKKTLSLSDNFNTP
FT                   "
FT   gene            complement(95606..96424)
FT                   /locus_tag="Deide_3p00565"
FT   CDS_pept        complement(95606..96424)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p00565"
FT                   /product="putative short-chain dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p00565"
FT                   /db_xref="EnsemblGenomes-Tr:ACO47987"
FT                   /db_xref="GOA:C1D4A6"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C1D4A6"
FT                   /protein_id="ACO47987.2"
FT                   /translation="MKKPEHDRAVGRLSDRVLLVTGGSSGIGRAIALAAAAEGAQVVIA
FT                   DVHPEGAEQTLAAITAANGEATFFPCDVASDVQVRDLMEAAIHRFGQLDILVNNAGIGG
FT                   DNAPAHELDLETWDRIMAVNLRGPFLCARYALPHLMQSGSGVIVNVASTYGLIGAPNAP
FT                   AYCASKGGVVNLTRQLAVDYGQRGVRVNAVCPGYVDTDMGGRRASLPPEEAQAAHDRRE
FT                   ANAARQPLGRQAHADEISRAVIFLASGESSFMTGSIVTVDGGCTATFNHD"
FT   gene            96567..98138
FT                   /locus_tag="Deide_3p00570"
FT   CDS_pept        96567..98138
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p00570"
FT                   /product="putative dipeptide ABC transporter, periplasmic
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p00570"
FT                   /db_xref="EnsemblGenomes-Tr:ACO47988"
FT                   /db_xref="GOA:C1D4A7"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:C1D4A7"
FT                   /protein_id="ACO47988.1"
FT                   /translation="MNRFIRTTLALSSMLAFTQALGVTRGGELVYGRYADSLFLDPVLN
FT                   DANVDIWILTNLYDTLLQPTADGKGVQPGLASAYTVAPDGKSMRLTLRPGLRFADGSAL
FT                   TAQDVKWSLDRARKPDNGAWSGSLASISNIVASGNTVTLNLKQPDPTLPAALATFNAAI
FT                   MPQKLFNAARGSTEAAKAKAFAEKPIGSGPFVLSSWKKGSSMVLKRNPYYWKKGADGKA
FT                   LPYLNSIRFEIIPDDNTRILKLQAGELHGAEFIPLSRVAELKANPKINMQLFPSTKVNT
FT                   VLMNNRPKLKDGTANPLSDVRVRQALNYATNKEALVQIVTFGNGKPMRSFMSATTPLFA
FT                   PQASYTYDLAKAKQLLADAGYPNGFEVVTLATSGNADDLALLTTLQQMWGAAGVRLKIE
FT                   QLDNATKTARYRAADFQMRTAAWTNDINDPSQITSYFAIYDNIQSLYTGYKSAEIDRLF
FT                   AQSQQETNPARRASQYNQIQGIYMKAAPIVFLYETPYPVALSKNVKGFVQIPLGNNIFA
FT                   ATSLEK"
FT   gene            98205..99143
FT                   /gene="gsiC"
FT                   /locus_tag="Deide_3p00580"
FT   CDS_pept        98205..99143
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gsiC"
FT                   /locus_tag="Deide_3p00580"
FT                   /product="putative dipeptide/oligopeptide/nickel ABC
FT                   transporter, permease component"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p00580"
FT                   /db_xref="EnsemblGenomes-Tr:ACO47989"
FT                   /db_xref="GOA:C1D4A8"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C1D4A8"
FT                   /protein_id="ACO47989.1"
FT                   /translation="MRATYVIKRLLQIIPTFIAVLILVFLLVRLLPGDPASAILGDRAT
FT                   PEIVERTRRELGLDKPLPVQFGIFVQNLLRGDLGESSSLKVPVFRLIVERLPVTLFLSA
FT                   YAALIAVLLAVPLAVLAAVRRDTWVDSLIRGVFQVALSLPVFYVALQLLTLLGAKLGWF
FT                   PIGGYGDSLKDHLYHLFLPALTLGFNLAAILVRTLRNSILEVLTAEYVEFARSKGLQSR
FT                   VVMLRHVLRNALISTVTLLGLNIGALIGGAVITESVFAIPGVGRLMIDSIFGRDYPVIQ
FT                   GLTLVFAVLVSLVFLMTDLIHARLDPRVEHA"
FT   gene            99178..100035
FT                   /gene="gsiD"
FT                   /locus_tag="Deide_3p00590"
FT   CDS_pept        99178..100035
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gsiD"
FT                   /locus_tag="Deide_3p00590"
FT                   /product="putative dipeptide/oligopeptide/nickel ABC
FT                   transporter, permease component"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p00590"
FT                   /db_xref="EnsemblGenomes-Tr:ACO47990"
FT                   /db_xref="GOA:C1D4A9"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C1D4A9"
FT                   /protein_id="ACO47990.1"
FT                   /translation="MTTLTPATPAAAAPRRTRRRPKPTLVMGLLLLLPILAATFAPGLI
FT                   APYSPTEFDYSAILKPPSASHLFGTDNFGRDVFSRVVYGTRIDMQIALLTTLFPFVFGS
FT                   LLGAFTGFIGRWPDMLVGRIADLVVVFPFLVLVIAIVAVLGPGLTNMYIAVSAVGWVAY
FT                   WRLVRGEVLAQKEAEYAQAARVLGFSPSRVLLRHILPNAVTPAIVYLMTDMSLGILLGA
FT                   SLGYLGLGAQPPTPEWGVMVADGKNFMVTAWWISGFPGLALTLAGVTFSLIGDGLADAL
FT                   RPRS"
FT   gene            100032..101033
FT                   /locus_tag="Deide_3p00600"
FT   CDS_pept        100032..101033
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p00600"
FT                   /product="putative dipeptide/oligopeptide/nickel ABC
FT                   transporter, ATP-binding component"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p00600"
FT                   /db_xref="EnsemblGenomes-Tr:ACO47991"
FT                   /db_xref="GOA:C1D4B0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C1D4B0"
FT                   /protein_id="ACO47991.1"
FT                   /translation="MTGSPSPVLSVRNLNVHIPTPRGELHAVRGVDFDLQPGEVLGLVG
FT                   ESGSGKSVTLRALLQLHRKPIRVTGAVQYDRQDLIGLSESRLRTIRGAQIGMIFQEPMT
FT                   ALNPVLTIGEQIRENLHEHRGLRGRPAEDRAAELLDLVGIPSARTRLKDYPHQFSGGMR
FT                   QRAMIAIALAAEPRVLLADEPTTALDVTIQDQILRLLLRLRKQLGMSIILVTHDLGVVA
FT                   QTCDRVAVMYAGRLVETAGVTDLFRQPRHAYTLGLMRSLPDIGAHRRPLQPIPGSPPDL
FT                   RDIPQACAFSPRCAYSTQACLGAEPPLVPIDDGRASACVHHAELPGVAEVTA"
FT   gene            101030..102067
FT                   /locus_tag="Deide_3p00610"
FT   CDS_pept        101030..102067
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p00610"
FT                   /product="putative oligopeptide ABC transporter,
FT                   ATP-binding component"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p00610"
FT                   /db_xref="EnsemblGenomes-Tr:ACO47992"
FT                   /db_xref="GOA:C1D3B3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C1D3B3"
FT                   /protein_id="ACO47992.1"
FT                   /translation="MTHEPLNSEPLLNVEGLTKTFPVCQGLLERWQGKPAKAVRALTDV
FT                   NLSVQRGETLGLVGESGCGKSTLARCLVRLHQADKGSVRYAGQEVLLLQGDALRQYHRR
FT                   VQMIFQDPFSSLNPRMTVGQALREVLTVHQLRPKAQHNERVHELLNLVGLPAEAAGRLP
FT                   HEFSGGQRQRIGIARALALEPECIVADELVSALDVSVQAQVVNLLLELQEKLHLTVLFV
FT                   AHDLRLVRHLSHRVAVMYLGRVVEIAATQDLFEQPAHPYTQALLAAAPLLEPGQRAEVP
FT                   ALTGELPSPLNVPSGCPFRTRCPHAFDRCVTERPELSEIRPLQQVACHLYDPVDQEVRL
FT                   PVGVG"
FT   gene            102067..103077
FT                   /locus_tag="Deide_3p00611"
FT   CDS_pept        102067..103077
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p00611"
FT                   /product="putative transcriptional regulator, GntR familly"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p00611"
FT                   /db_xref="EnsemblGenomes-Tr:ACO47993"
FT                   /db_xref="GOA:C1D3B4"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C1D3B4"
FT                   /protein_id="ACO47993.2"
FT                   /translation="MPQEGEADTSPFVVDRTLSVPLSVQLRGQIEYGIACGELPPGARL
FT                   PSVRDLVAQTGVAHVTVAHVYRDLAARGLIVTVAGRGTFVADPSSSGPMQDVAALRGLL
FT                   NDVLFQAERDGIEPERVVALLQAMIARGHTARDVGVRIVLVGVLDVATRAYARELQALL
FT                   RPEDRVKACTFIQLAQPALIQEVRSADIVLTLGHRLAEARALLPGLDILPMRVTVSHET
FT                   REHLAALAPDTRLALIATFDDFLPTFLTGVHRYAPQVLDVRAAHLAEQNLPELLAWCDA
FT                   AVYASGADGIVTALNPGTFAFEYRHAVHRPDAERTLLPVIAQHRALVRERKHHEN"
FT   gene            103067..103795
FT                   /locus_tag="Deide_3p00630"
FT   CDS_pept        103067..103795
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p00630"
FT                   /product="putative creatinine amidohydrolase
FT                   (creatininase)"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p00630"
FT                   /db_xref="EnsemblGenomes-Tr:ACO47994"
FT                   /db_xref="GOA:C1D3B5"
FT                   /db_xref="InterPro:IPR003785"
FT                   /db_xref="InterPro:IPR024087"
FT                   /db_xref="UniProtKB/TrEMBL:C1D3B5"
FT                   /protein_id="ACO47994.1"
FT                   /translation="MKIEAMNWMQVEAYLREDDRCVLPLGSTEQHGFMSLAVDNILPER
FT                   LAQEVAAPLGVPVFPTLNYGITPYFRAYPGSVTLRVQTYLSVVRDVLDSLYEQGFRRIL
FT                   IVNGHGGNSPAQGFSGEWSADHPGTQVLFHNWWNAPRTWQEVQRIDPVASHASWMENFP
FT                   WTRLPGVTLPEIQKPMADLDRLRLLSPAQLRQTLGDGNYGGLYQRSDEDMLALWAVAVQ
FT                   ETSGLLQNGWVPASRSEQQT"
FT   gene            103792..104823
FT                   /locus_tag="Deide_3p00640"
FT   CDS_pept        103792..104823
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p00640"
FT                   /product="putative 2-dehydropantoate 2-reductase
FT                   (Ketopantoate reductase)"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p00640"
FT                   /db_xref="EnsemblGenomes-Tr:ACO47995"
FT                   /db_xref="GOA:C1D3B6"
FT                   /db_xref="InterPro:IPR003710"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR013332"
FT                   /db_xref="InterPro:IPR013752"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C1D3B6"
FT                   /protein_id="ACO47995.1"
FT                   /translation="MKLLIWGAGAIGGTIGAYLVRAGHDVTFVDCAADHVKSIREGGLH
FT                   IEGPIESFTVHAAAFTPGEVTGQWDHVLLCTKAQDTASAAGQLADHVTPAGCVVSVQNG
FT                   LNPLVLNATFGQDRVLGSFVNFGADYLSPGVVHYAGRGVVVIGEQDGQLSERARALHAA
FT                   LRDFDSNAVLSANMFGYLWSKLGYGALLFATAVTNDGIADALARPEDRTLYIALGREVM
FT                   RVALAHQITPEAFNGFNPAAFLPGASDDMAQASMDEMVAFNRRSAKTHSGIWRDLAVRK
FT                   RRTEVDAQLGWVVHFGQEHGLPTPITARLVDLIHELESGQRELSRENLAELHAVIPAVT
FT                   PAT"
FT   gene            104820..105449
FT                   /locus_tag="Deide_3p00641"
FT   CDS_pept        104820..105449
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p00641"
FT                   /product="putative demethylmenaquinone methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p00641"
FT                   /db_xref="EnsemblGenomes-Tr:ACO47996"
FT                   /db_xref="GOA:C1D3B7"
FT                   /db_xref="InterPro:IPR005493"
FT                   /db_xref="InterPro:IPR036704"
FT                   /db_xref="UniProtKB/TrEMBL:C1D3B7"
FT                   /protein_id="ACO47996.1"
FT                   /translation="MTAVIDGLRALLPSGDLTCVVSDALDRGWALSGAFRPVWSGACCA
FT                   GEAVTVRTFGTDLSAVFDAISVAEPGSVLVIDSHGITGAAFWGERTTRAALARRLAGAV
FT                   IDGGCRDVTAVRQLGFPVFSTAITPNAGLPGGRGAVNVPIQAGGIPVSPGDVVVADENG
FT                   VVIVPQHLAPGTLERVRVLLAAEQQVFAQADRGMAVPPESTEKGMV"
FT   gene            105451..106977
FT                   /locus_tag="Deide_3p00650"
FT   CDS_pept        105451..106977
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p00650"
FT                   /product="putative carboxypeptidase Taq (Thermostable
FT                   carboxypeptidase 1)"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p00650"
FT                   /db_xref="EnsemblGenomes-Tr:ACO47997"
FT                   /db_xref="GOA:C1D3B8"
FT                   /db_xref="InterPro:IPR001333"
FT                   /db_xref="UniProtKB/TrEMBL:C1D3B8"
FT                   /protein_id="ACO47997.1"
FT                   /translation="MNEFQQQSAEINDLLCILNLLTWDTRTQMPPGGSQSRAQQTATLS
FT                   GLAQQRLLDPAFEHAARAALSAAEPASVPARAAQQAISAVRALKRVPVELTRDLALTKS
FT                   AAQDAWADARAHSDFSRFAPHLTRMVDLQRRLADALGYDAHPYDALLNLYEPGLTAATL
FT                   QPLFSQLRTHHLSLLREVQAQPQPRLDFLERDYDVAAQQILALELAQAIGYDLTRGRLD
FT                   ASAHPFEISFTREDVRITTRYHPNFLPGALFGVLHEAGHAMYEQGVSSELSRSVLASDL
FT                   LGLYAVGGASYGTHESQSRLWENRVGRSRAFWDQHYPRAQALFSSQLADVTVVEFHRAV
FT                   NRVQPSLIRVEADELTYDLHIMLRVDIESALIAGDLKVQDLPEMWNARIESDLGLKVPD
FT                   DARGVLQDIHWSAGLFGSFPTYTVGNIMAAQFYEAAHAALPDLEASLARGEYGPLRIWL
FT                   TEQVYQHGRTFTPHELLERTTGRGLDAAPYLTYLSGKYRDLYGVTEKETA"
FT   gene            106974..107729
FT                   /locus_tag="Deide_3p00660"
FT   CDS_pept        106974..107729
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p00660"
FT                   /product="putative short chain dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p00660"
FT                   /db_xref="EnsemblGenomes-Tr:ACO47998"
FT                   /db_xref="GOA:C1D3B9"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C1D3B9"
FT                   /protein_id="ACO47998.1"
FT                   /translation="MTLRSDGLAGKVAVVTGASSGIGAATALALAAQGASVVLVARRED
FT                   RLQDLARQVQSSGGHAEVVVADLADEAQARLTVERAVSAFGRVDILVNNAGLMLLGPVT
FT                   GADTTDWRRMIDVNLLGLMYTTHAALPHMRTQGGGHIVNISSVSGRGASPTSAGYSASK
FT                   WGVGGFSEGLRQEVRLDRIRVTVIEPGVVATELTDHITHQDTKVAYEGRIQTMIPLEAE
FT                   DIAAAVVYAVTQPERVNVNEILIRPLDQG"
FT   gene            108006..109382
FT                   /locus_tag="Deide_3p00670"
FT   CDS_pept        108006..109382
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p00670"
FT                   /product="putative amidase"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p00670"
FT                   /db_xref="EnsemblGenomes-Tr:ACO47999"
FT                   /db_xref="GOA:C1D3C0"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="InterPro:IPR020556"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/TrEMBL:C1D3C0"
FT                   /protein_id="ACO47999.1"
FT                   /translation="MRNSEILFASIPQVAACYRSGSLSPVEVTRACLARIEELDPALNA
FT                   FISVTAELALAQAVQAETELRSGTDRGPLHGIPVALKDLTDTAGVRTTCGSRLLADHVP
FT                   GQDAVVTVRLREAGAVLLGKTNLLEFAYGSVHPDYGQTNNPWDVTRTSGGSSGGSAAAV
FT                   AAGLCFAAFGTDTGGSIRIPAAYCGVTGLKPTYGLVPLDGVFPLSWSLDHGGPIARSSG
FT                   DAALMLAALTGGPHDAAPRDLQGVRLGVLAEHARGPDMQQGVVEVFDQACDALRRAGAV
FT                   LVEVHIPQLDRMDTAMMHVLLPEASAVHAAWLQQSPGAYAPDTRMHLEQGFAVSGVEHV
FT                   RAQQYRRKLALDFLAALTDVDAILSPTVAWVAPHEDPVVSDNEGSTEARRTAPANLTGF
FT                   PALSLNAGFSEGLPVGLQITTRPGADALALSLGMSLEALLDGNRIPPLGGTPTTERRTP
FT                   "
FT   gene            109435..110199
FT                   /locus_tag="Deide_3p00680"
FT   CDS_pept        109435..110199
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p00680"
FT                   /product="putative short-chain dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p00680"
FT                   /db_xref="EnsemblGenomes-Tr:ACO48000"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C1D3C1"
FT                   /protein_id="ACO48000.1"
FT                   /translation="MIVRFDGQTVIVTGAAHGFGRAISLAFATRGANVWACDVNEAGLR
FT                   ETETLSAEQGTPLQVRSVDVADREAVRALVLEASGGERVDVLVNNAGGVLGQVGRPIEE
FT                   ISQDDWHAIFRVNLDGAFYFSQAVAPLMKARGAGRIINISSGAGLGVSLTGIQAYASAK
FT                   AAQIGLTRQLAHELGTWGITVNNVAPGFVLSNPTTERQWQSYGEDGQRRLIDNIALKRL
FT                   GSPDDIAHAVLFFASEYAGWVTGQILSVDGGK"
FT   gene            110196..111596
FT                   /locus_tag="Deide_3p00690"
FT   CDS_pept        110196..111596
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p00690"
FT                   /product="putative peptidase M20"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p00690"
FT                   /db_xref="EnsemblGenomes-Tr:ACO48001"
FT                   /db_xref="GOA:C1D3C2"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:C1D3C2"
FT                   /protein_id="ACO48001.1"
FT                   /translation="MMDDVLTYLEEHYERHLEDLRTFVRIPSVSTEGQHAPDVRRAAEW
FT                   VAARLSSAGLTDARVTDTPGHPVVTASWTNHPGAPTILVYGHYDVQPPDPLERWDSPPF
FT                   EATERDGNMYARGVSDDKAPMLIPIRVTEAFLQARGALPINVKFLFEGEEEIGSPNLGA
FT                   FVRDHAQQLQADFVLSADGGMWRADVPTLTVSARGLVALEFTVRGPGKDLHSGRHGGSL
FT                   HNPLHAISRMVASLHGPDGRVSVEGFYDDVVPVSPAIRADTAALPFNDEAYLREVGAPA
FT                   TFGEPGYSTLERQWYRPTLELNGLWGGYTGEGAKTVLPSEAHAKITCRLVPGQDPDRIR
FT                   ERIEAHLRQHAPPGVTVTFEESRHGAPAYRIPPEHVGLRVAREAIRSVYGQDPLMVGMG
FT                   GSIPICDTFRDALDMDTVFFSFAVGDENIHAPNEFFRLARFQEGARAWTAYFEALARSV
FT                   DAVVTATR"
FT   gene            111601..112542
FT                   /locus_tag="Deide_3p00700"
FT   CDS_pept        111601..112542
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p00700"
FT                   /product="putative succinylglutamate desuccinylase /
FT                   aspartoacylase family"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p00700"
FT                   /db_xref="EnsemblGenomes-Tr:ACO48002"
FT                   /db_xref="GOA:C1D3C3"
FT                   /db_xref="InterPro:IPR007036"
FT                   /db_xref="UniProtKB/TrEMBL:C1D3C3"
FT                   /protein_id="ACO48002.2"
FT                   /translation="MNTLIQSTPPGTVARGVLDAPLNTRTRVPYTVVRGAEDGPTLLVT
FT                   AGVHGAEYASIDAAYQLTQTSPSDLQGTLVVLPMVNPSAFWQRSIYVNPIDGRNLNRLF
FT                   PGRARGTYAEQLASWLHEEFLSQADALIDLHGGDLVEALKPFSVYVRDHEPSRQLALAF
FT                   GLPHLIASDSRGMTFEVTRTHGVPAIIAEAGGQGLRRAADVTLLVRGVRQGMRHLGMLS
FT                   CDLEQSSEVIEHDEFAWLSAPASGLWHPRVAAGDTVSKGQEIGTLRDINGNDLHTFGAP
FT                   ESGTVLFLVTSLAMNEGDPLLGIGVSSVPPVC"
FT   gene            complement(113050..114009)
FT                   /locus_tag="Deide_3p00720"
FT   CDS_pept        complement(113050..114009)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p00720"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p00720"
FT                   /db_xref="EnsemblGenomes-Tr:ACO48003"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="InterPro:IPR036770"
FT                   /db_xref="UniProtKB/TrEMBL:C1D3C4"
FT                   /protein_id="ACO48003.1"
FT                   /translation="MCIALMCSAALAEQNLAEMQLSNAANYCDTAQAIALIAQGVNINT
FT                   RNSGGYTPLMMAANSGCTDIARLLIARGADLSVKTSAGWDAAYLAKLNNHQAVLALLTT
FT                   PARPRSTAAEPATPRAPAVKTPSPTAVPSAPTSAPPKAHTAWPKLGKYKPGQSVLYSGT
FT                   AGKTWTRGVIRSIDPKYGYNLTGVTGSEDANFVVGVNREPFWTAWFVGDWRVNVPVAVN
FT                   TVVRGTDVYRVYSGGLRLPPLRINADGTYSWRVQSTGGEQLLRGRWVPNPDGPGVLLRA
FT                   GPQGADWLVYNNSRTGSALGDTIIISSACCSHYAGSRL"
FT   gene            114781..116265
FT                   /locus_tag="Deide_3p00722"
FT   CDS_pept        114781..116265
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p00722"
FT                   /product="putative dipeptide ABC transporter, periplasmic
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p00722"
FT                   /db_xref="EnsemblGenomes-Tr:ACO48005"
FT                   /db_xref="GOA:C1D3C6"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:C1D3C6"
FT                   /protein_id="ACO48005.1"
FT                   /translation="MLSTRLSSSLITLTMLAGSIAGAQTLTVGMDADVVRLDPVLSAAA
FT                   VDRHVLYQVFDRLVDVDENLKIVPSVARSWKISSNGLTYTLTLRSGIKFHDGTSLNAAA
FT                   VKYSLERSLNMDGSARKNELSAIKSITAVNPTTVRIDLHAPFGPLLAILSDRAGMIVSP
FT                   TAAAKSGADFGRAPVGSGPFSFVSRTQQDNITLNSYSEYWNGAPKIDKLVYRPFPDGDV
FT                   RYANLLSGGAQVIVVDAKDVEKLESNNKFNVISIPTLGFQGIWLNTTRAPFNNKLVRQA
FT                   VAATIDRNAVAQVVFRNTAKPAAGPFPPNTPAYSSSIKVPTPNIADARKKLKQAGVSNL
FT                   TFTMIAATGTTTALLTQVYQAMMAEAGINMKIELVDNGALSSRATSFNFDAALLNWSGR
FT                   IDPDGNIYDWVRTGGTYNYGRYSNKEVDALLAKARAQSSMSARKATYNVALGKVLSDTP
FT                   YIWVYHQSNMYGTTKAVSGLKSIPDGILRFKDVVLK"
FT   gene            116503..116919
FT                   /locus_tag="Deide_3p00725"
FT   CDS_pept        116503..116919
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p00725"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p00725"
FT                   /db_xref="EnsemblGenomes-Tr:AHX26570"
FT                   /db_xref="UniProtKB/TrEMBL:X5H5R5"
FT                   /protein_id="AHX26570.1"
FT                   /translation="MLEPVHDSILEQLKTEVSQYPRMDGYYQLEPVVIGALRQGWKGQS
FT                   DIFNALYESLGPHSALAAYQIAHPRIQPFSGEPPGDEDCEYTAEEALDALTYELKGGFE
FT                   IGHLAEYVPSAKAAVLATHFFAVFHEPRAFWGLG"
FT   gene            117160..117321
FT                   /locus_tag="Deide_3p00730"
FT                   /note="nonfunctional hypothetical protein"
FT   gene            117294..117434
FT                   /locus_tag="Deide_3p00731"
FT                   /note="nonfunctional hypothetical protein"
FT   gene            complement(117889..119391)
FT                   /locus_tag="Deide_3p00740"
FT   CDS_pept        complement(117889..119391)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p00740"
FT                   /product="putative penicillin binding protein
FT                   transpeptidase, putative peptidoglycan glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p00740"
FT                   /db_xref="EnsemblGenomes-Tr:ACO48008"
FT                   /db_xref="GOA:C1D3C9"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR036138"
FT                   /db_xref="UniProtKB/TrEMBL:C1D3C9"
FT                   /protein_id="ACO48008.2"
FT                   /translation="METKIKSRSIWMLLIGMFAFCFLAISYASVMAPLSPFETREGRKL
FT                   PTPSGRGRILSADGRVLAATLVKDAGTFAQKETRVYPNGDMAGQLLGVMGASEGLEGLE
FT                   HDYQDHLAAGQDLTLTIDTHLQAVTEAELQKKALEERAEYAAAIVMETRTGRLLAVASW
FT                   PPSNPGKWKETPMRNRRNRAFIDRFEPGSVIKSLTVAAALDDGIIKPDQVLDTPMARYV
FT                   GKRWGSTIRDSVAHGPRLTIQNVLRYSSNVGISHIVEPYTNEKFRARLSQFGIGTAPEL
FT                   PVVTASNGILRPIERWDTLVRTTNGFGQGMSTTLLQMAVAYNVLGNHGVYLPPRLNAAD
FT                   PVGTGRRVVRSETARTVREMLRMTIELGIPHRALLEGYDLGGKTGTAQFATAGGYSSEI
FT                   YESTYAGFYPSTNPEITIAIMAHGARGEYHGADLAAPVYREIVASYASSRGHRPDPGLE
FT                   AEQRVIQMDRNEGKYRDGTVDRAPMPSREELLKTTRAQGSAP"
FT   gene            complement(119634..120773)
FT                   /locus_tag="Deide_3p00750"
FT   CDS_pept        complement(119634..120773)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p00750"
FT                   /product="putative amidohydrolase 2"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p00750"
FT                   /db_xref="EnsemblGenomes-Tr:ACO48009"
FT                   /db_xref="GOA:C1D3D0"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:C1D3D0"
FT                   /protein_id="ACO48009.1"
FT                   /translation="MNLTDIPIYDHHAHALLHEPLWRAGPIEPYFTEATDPLILQHFAR
FT                   DTLFFRRSMRDLAAYYGCAPTMDAVLEARQNQDYGDLARHMFQDARIDTVLIDDGVWPD
FT                   RLWSVRQSADRLPCAVRRVLRLESEVALLAAEHDSAAGLLTALETHLRHLAPTLAGLKS
FT                   IAAYRTGLDISRPTAHSVEAAFTVLKRETSPGAVPRVNSKPLIDSVVWTGLRVAVDTGL
FT                   PVQFHTGYGDPDLDMRLASPLHLRGVLEAPELRGLKVVMLHCYPYVREAGYLASVYGGA
FT                   YLDLGLTIPYTSVTAMRTATLEALHLAPVTKVLFSTDAQRTPELYWLAARWGRTVLGDA
FT                   LDLTVRDGDLSPQEADWAARRILHDNARDLYPSIVVRAS"
FT   gene            complement(120775..122094)
FT                   /gene="glnA"
FT                   /locus_tag="Deide_3p00760"
FT   CDS_pept        complement(120775..122094)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glnA"
FT                   /locus_tag="Deide_3p00760"
FT                   /product="putative glutamate--ammonia ligase (glutamine
FT                   synthetase)"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p00760"
FT                   /db_xref="EnsemblGenomes-Tr:ACO48010"
FT                   /db_xref="GOA:C1D3D1"
FT                   /db_xref="InterPro:IPR008146"
FT                   /db_xref="InterPro:IPR008147"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR027303"
FT                   /db_xref="InterPro:IPR036651"
FT                   /db_xref="UniProtKB/TrEMBL:C1D3D1"
FT                   /protein_id="ACO48010.1"
FT                   /translation="MNIQQLREAGVQYVRILWTDHANLIRAKAAHLSLLDAGLPDGVGI
FT                   AAAQLALPVMADVVVPGAGLGPVGEVRLVPDWDTLTVLPYAPAQAQVLGDLRLGAGPWD
FT                   CCPRAFLREQIRAAAQFGLTVNAAFENEFFLLRRDNGSYTPADTTVFAHTSGFNRHARF
FT                   MLDLSAALEAQGLQPEFYYPEAGPGQQELSVRYSDALQAADQQITFRETARGVAEAHGL
FT                   VASFLPKPFEGVAGSGCHLNLSLWRDGANAMADPHHPTGISREGQHFLAGVLFHLPALC
FT                   ALSVPSHNSYHRLRPHFWAGAYTAWGYENREAALRVSRAGHACSRFELKTSDASANPYL
FT                   ALGALIAAGLDGIEQQRPLPAEAVGDPALMSEEARRASGIELLPQSLHEAVTALERNTV
FT                   LLDALGEARSRAYLAVRRAEWTALKDLNLPEELQLLAERY"
FT   gene            complement(122327..122794)
FT                   /locus_tag="Deide_3p00770"
FT   CDS_pept        complement(122327..122794)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p00770"
FT                   /product="putative transcriptional regulator, AsnC/Lrp
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p00770"
FT                   /db_xref="EnsemblGenomes-Tr:ACO48011"
FT                   /db_xref="GOA:C1D3D2"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR019885"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C1D3D2"
FT                   /protein_id="ACO48011.1"
FT                   /translation="MDDTDTHLLRLLQHNADTSHAELGRQVGLSATGVHKRLRRLREDG
FT                   VIKRTAIVLDRAKLGLDLMCFLKVNFKNNLASPNLDELHGAVSALPEVLECYTLTGTND
FT                   AIVKVAVRDHVALREFLQRFSEAQSIIERVETCIVLEEIREGNDYAVPKPQ"
FT   gene            123215..124723
FT                   /locus_tag="Deide_3p00780"
FT   CDS_pept        123215..124723
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p00780"
FT                   /product="putative dipeptide ABC transporter, periplasmic
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p00780"
FT                   /db_xref="EnsemblGenomes-Tr:ACO48012"
FT                   /db_xref="GOA:C1D3D3"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR023765"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:C1D3D3"
FT                   /protein_id="ACO48012.1"
FT                   /translation="MMRFTALFVTALLGTASVSQAQTGTLTVATAQDPQNWDPIDTFLI
FT                   AWGTVAHNIYDGLIIRTPDLKLQPGLATKWTYLNGGKTLRFTLRKGVKFHNGEPFNANA
FT                   VKFSFDRLLGAEGKKGPQQANYTSIKQVKVVDPYTVDFILAQSDPVLLTKLAGYGAMIV
FT                   PPRYIKEKGAAYFDTHPVGTGPFQFVSYKNGESIRLQAFPGYWGGKPKVANLTFRFIEE
FT                   PATRVAELQSGRVDIATAIPVAQAATVKGNSKLSLQAVPSPTVQALRFNVSHSLTKDVR
FT                   VRRALNHAVDRDAIIKSILQGYASPIASLQSSKSYGYDPNLKPYPYDPAKAKALLAEAG
FT                   VKPGTPIGIDFIGTDAVFREVAQAVAGFFQAAGLKPELKTYETNTFYSDIIPKNKTSNA
FT                   YQMGWGGWTFDFDNTAYLLYHSKQFWNPDYSNKTLDAMLDKQHTMSDQKQRLVILRDIA
FT                   RFTHEQAIDIPLYNQQDLWGVSKRVQGFQAPSDSLLHLRTVSVK"
FT   gene            124730..125653
FT                   /gene="gsiC"
FT                   /locus_tag="Deide_3p00790"
FT   CDS_pept        124730..125653
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gsiC"
FT                   /locus_tag="Deide_3p00790"
FT                   /product="putative dipeptide/oligopeptide/nickel ABC
FT                   transporter, permease component"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p00790"
FT                   /db_xref="EnsemblGenomes-Tr:ACO48013"
FT                   /db_xref="GOA:C1D3D4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C1D3D4"
FT                   /protein_id="ACO48013.1"
FT                   /translation="MARYLLSQLFQAALVVVFVTLVVAVMLRFSGDPAVAQFQGASAPT
FT                   EEQLREIRQAMGLDRPFLVQYWDFLSGVVTGDLGTSFRGETAVRSLIAQAMPPTMLLAL
FT                   CSLGLSVLLSLPLAIHAAVHKGSWADQAVRFFSLLGLSFPNFWLGIMLALIFGVTLRWL
FT                   PVSGYESAASLILPSVTLGLILTSTTVRLLRASLLDVLSSQYVTVARSKGLSERRVLYK
FT                   HALRNTAIPMITFVGLQFGGLIGGVVIVEQVFAWPGLGSLALHAISNRDYPVLQGTVTV
FT                   LAVLVVLVNLLVDLSYGLFDPRVRLE"
FT   gene            125655..126524
FT                   /gene="gsiD"
FT                   /locus_tag="Deide_3p00800"
FT   CDS_pept        125655..126524
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gsiD"
FT                   /locus_tag="Deide_3p00800"
FT                   /product="putative dipeptide/oligopeptide/nickel ABC
FT                   transporter, permease component"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p00800"
FT                   /db_xref="EnsemblGenomes-Tr:ACO48014"
FT                   /db_xref="GOA:C1D3D5"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C1D3D5"
FT                   /protein_id="ACO48014.1"
FT                   /translation="MTDLAPPSTRARARHALRRWTPDLVIGLLLTGGVLGVVLLANLLF
FT                   PAGTDTMDLTARLTPPALSSDHPLGTDPIGRDVLARVVYGGRISLLVGVVSVTLSALIG
FT                   ILLGLFAGFYGGKLDAFLMRLADIQLAFPFILLAMTVIAILGPGLWKLIAVMVASQWAQ
FT                   YTRLVRGQVLALRDREYVQAANALGASNSRMIFRHIVPNALGPVIVLATLNIANNILLE
FT                   SGLTFLGLGVDPQVPSWGGMLADGRTYLQSAWWVSVFPGVAITLTVLGFNLLGDWLRDH
FT                   LDPHGRHA"
FT   gene            126521..128452
FT                   /locus_tag="Deide_3p00810"
FT   CDS_pept        126521..128452
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p00810"
FT                   /product="putative zinc carboxypeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p00810"
FT                   /db_xref="EnsemblGenomes-Tr:ACO48016"
FT                   /db_xref="GOA:C1D3D7"
FT                   /db_xref="InterPro:IPR000834"
FT                   /db_xref="UniProtKB/TrEMBL:C1D3D7"
FT                   /protein_id="ACO48016.2"
FT                   /translation="MTSAPPGPLTPPQQDQHYEPSATRGQRRVWEQHFPWEGQRLMELL
FT                   SALRLAHQPHHVLAYVSESPQTRAALRTSIVRAAGPGCAARVRSAYKTAYFWITEEVQP
FT                   LWRRAQADRVTLTYPVLSEAPQGRFLQEAYPLAAVFEREGVEAEFVPGPVGRPYYQATL
FT                   WRGERELWHGTCFTPLFQRQAPDGRMVLGPTGWLTVQAEGADVLDQRLETDGEAFWDWY
FT                   VATVLPAVLELADRRDDGLVFRNLAVTLQLSEPDLALDVLDERISMTEALTEEVYFGTV
FT                   DALKRHTSTPPGARTLTPGRIVPVAHAVPGQDGWARVTLTEWASSPAELHRPGASHSVT
FT                   ADPESVLQDRPAPPGQIWANARAAADRHQLEWHVPAHSVDGRPVPAVLRSTPGAAGSVL
FT                   ITAGQHANETTGPVAALNLLSHLAGMPVNFALLPLENPDGAFLHRALTQLAPNHMHHAA
FT                   RYTSLGDDLEARLRQGDRRWEAGARAWAQEQVGANLHLNLHGYPAHEWVRPYSGYAPHG
FT                   FESWALPAGFITIVWYWPGHDKPARLLAEAIAQRLQQEPEVVQHAQAALRASTAHVLTP
FT                   HYELIGGLPFILTEQPSALCPLTVITEAPDETIYGARFRSCVQAHLSVCLAAIGHTLRG
FT                   DGQPESCT"
FT   gene            128570..129481
FT                   /gene="pip"
FT                   /locus_tag="Deide_3p00820"
FT   CDS_pept        128570..129481
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pip"
FT                   /locus_tag="Deide_3p00820"
FT                   /product="putative prolyl aminopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p00820"
FT                   /db_xref="EnsemblGenomes-Tr:ACO48017"
FT                   /db_xref="GOA:C1D3D8"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR002410"
FT                   /db_xref="InterPro:IPR005945"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C1D3D8"
FT                   /protein_id="ACO48017.1"
FT                   /translation="MQPHAHKMQTQEPWEGFCSVEHGQLWYRVHPGPANRPPVIVLHGG
FT                   PGCPSTYLHSLSALADFTTVVFYDQLGCGRSTSDVPMSALTLDSFTADLQVLLDTLRIK
FT                   SFVLLGHSFGGLLALHHQRCFPHTASALLLASPLVATSDWMADMAVLTGALPEPYADDL
FT                   NKPQEDPAYVAAEAQFYRTYFCHLQPWPPELQVAVEQLAASPAYHLMWGPTEFTQTGNL
FT                   EGADCSGVLRTLRCPVLFTCGSADEARPETLRRYADMCERGQLKVFEGGTHCVHLEQPD
FT                   EFLQVIREFFGHDSAIQWITSV"
FT   gene            complement(129886..130251)
FT                   /locus_tag="Deide_3p00821"
FT                   /note="nonfunctional transposase (degenerated IS - IS630
FT                   family)"
FT   gene            130503..132269
FT                   /locus_tag="Deide_3p00830"
FT   CDS_pept        130503..132269
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p00830"
FT                   /product="Hypothetical protein, precursor"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p00830"
FT                   /db_xref="EnsemblGenomes-Tr:ACO48019"
FT                   /db_xref="UniProtKB/TrEMBL:C1D3E0"
FT                   /protein_id="ACO48019.1"
FT                   /translation="MTPTSSSRPGRRALLILGAALASSAMAWKPSTHIYFAEQALTDAV
FT                   SDGRVTICRTNYEAGTIAGDCRDYAVDPEILAALRAAPAQYRAGVLGPDAYPDLLTGQQ
FT                   VIHPDESLPKRPDAPGGANSWLQYLWDSAAAEGGGNRLAIKAFVVGYLTHAAGDMYGHT
FT                   FVNAYTGGEFALGPNAVRHIVLEGYVAKRTPPPVDAAGRPVNENSVSIDGVSDFIYRRM
FT                   VDARPGSVLRDQLLTGSGAATSVPRVYSDLRAGLQRDVDEYYRRKADFDRRSADKLAAA
FT                   ARCKPLDFGCSATLLVTQAGVIQAEKAAYMAVNAAPITYKEYWIKDIDDGLRAWPGVSH
FT                   ELARALVYNTGGVDTARAQKVAEQYVYDHLLSMSGAPDAVGGSLGLINSVLSALFPAFI
FT                   REAVEQMKRDLLNSLLRQAFGLTVEELKAYVTSPEVHFDRVMATPGGQKTTLRQMNRGE
FT                   LRIADDGFANPSARFDYQVFPAGYNTVTISKLVLLPPAEINRLLRDLGATQVLSTPNVM
FT                   LGFIRSLDGHNEWLNNAPYQLAPAINCGAYIRLFMRQTGEAVRCGSIIQGEPVQKVVPR
FT                   PVPLVPITPPGR"
FT   gene            132429..132905
FT                   /locus_tag="Deide_3p00831"
FT                   /note="nonfunctional transposase (degenerated IS OrfB -
FT                   IS200/IS605 family)"
FT   gene            132844..133344
FT                   /locus_tag="Deide_3p00832"
FT   CDS_pept        132844..133344
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p00832"
FT                   /product="putative DNA-binding protein HU"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p00832"
FT                   /db_xref="EnsemblGenomes-Tr:ACO48021"
FT                   /db_xref="GOA:C1D3E2"
FT                   /db_xref="InterPro:IPR000119"
FT                   /db_xref="InterPro:IPR010992"
FT                   /db_xref="UniProtKB/TrEMBL:C1D3E2"
FT                   /protein_id="ACO48021.1"
FT                   /translation="MLKPAVCTRVQSQQAVDVFLESVLEAVRTGKSVGLAGLGTLSIRE
FT                   TAARTGVRPGTSERIQIPAGKKVAFKVATTLQGTLSATFCFIESEVLRNLHSQRIPGYH
FT                   AQHQRRPSGRLLLAVMNTPIIHEAIGIFRNSKDHYHLEGTLQVRTELGVPAETTWNDLV
FT                   PGR"
FT   gene            133355..133618
FT                   /locus_tag="Deide_3p00840"
FT   CDS_pept        133355..133618
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p00840"
FT                   /product="putative cold shock protein"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p00840"
FT                   /db_xref="EnsemblGenomes-Tr:ACO48022"
FT                   /db_xref="GOA:C1D3E3"
FT                   /db_xref="InterPro:IPR002059"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012156"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019844"
FT                   /db_xref="UniProtKB/TrEMBL:C1D3E3"
FT                   /protein_id="ACO48022.1"
FT                   /translation="MPAGKVKWFNAEKGFGFIETPGGPDVFAHFSAISGSGFKKLNEGD
FT                   EVEFELEEGQRGKGPQAKNIVVTKAAPAAAYGDRPQRRDDRW"
FT   gene            complement(133976..135691)
FT                   /locus_tag="Deide_3p00850"
FT   CDS_pept        complement(133976..135691)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p00850"
FT                   /product="putative Serine protease, subtilase family,
FT                   precursor"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p00850"
FT                   /db_xref="EnsemblGenomes-Tr:ACO48023"
FT                   /db_xref="GOA:C1D3E4"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR003137"
FT                   /db_xref="InterPro:IPR015500"
FT                   /db_xref="InterPro:IPR023828"
FT                   /db_xref="InterPro:IPR036852"
FT                   /db_xref="InterPro:IPR037045"
FT                   /db_xref="UniProtKB/TrEMBL:C1D3E4"
FT                   /protein_id="ACO48023.1"
FT                   /translation="MHVSRSVKFVGLALALAACAQQSNVPTSSVTPTVSSQAATTARTY
FT                   LVGFKAGQGTNTEAIRKVGGQLRRSFTRIEAASATLTAAQANKLAADPSVEYVELTVTR
FT                   RADNYITSDSNTLGKPGGQLGGLNVNWQPSGEFTYGDIALAVPSLRTQQHTGAGTAVCV
FT                   GDTGIDGNHPEFAGKLKGFKNFMGDGKDSATALNDVNQHGTHVAGTIFAQFGAGSNVGP
FT                   SGMDSNGVGGVAPGVNLYVARVLGDDGSGTSEGVVEGVNWCVSQLVTQGGKEQRMVVNL
FT                   SLGADEGSKTEKRAFQAAYDAGALVVAAAGNDGVKLPHYPSDYPSVIKVGAVNHLGNLA
FT                   DFSNHNSKQELVAPDVAVLSSVPVGTGLAASASAAGVATYQSVNPFEFAAAKTVSNLPI
FT                   VAAGGEGNRFCEPNAVNAALNGAIALISRGACPFADKVANAVANHAAAVIVYNNTTGPL
FT                   NSVTLGSPRSIPVVGITQADGLATLTKVQAGSVTGSVSIYASDYEYFNGTSMATPHVAG
FT                   AAAVVWAAKPGLSNAELRDLLSATATDLGPNGRDNFFGNGLVNPGAAIAAAGRR"
FT   gene            complement(136286..136513)
FT                   /locus_tag="Deide_3p00854"
FT   CDS_pept        complement(136286..136513)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p00854"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p00854"
FT                   /db_xref="EnsemblGenomes-Tr:AHX26571"
FT                   /db_xref="UniProtKB/TrEMBL:X5HLN0"
FT                   /protein_id="AHX26571.1"
FT                   /translation="MTKARTPKKTKSSRAGKPEEKATMTKHGLWTPESSKETAREIRKL
FT                   NKEEPATRTVTEAVDKTRLSLPQERGAPDL"
FT   gene            complement(136920..137864)
FT                   /locus_tag="Deide_3p00853"
FT   CDS_pept        complement(136920..137864)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p00853"
FT                   /product="putative homocysteine S-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p00853"
FT                   /db_xref="EnsemblGenomes-Tr:ACO48026"
FT                   /db_xref="GOA:C1D3E7"
FT                   /db_xref="InterPro:IPR003726"
FT                   /db_xref="InterPro:IPR036589"
FT                   /db_xref="UniProtKB/TrEMBL:C1D3E7"
FT                   /protein_id="ACO48026.1"
FT                   /translation="MKGPLPQLTRRVLTDGGLETDLLFNRGIDLPLFSSVVLLATLEGR
FT                   EALETYYRPYLELAHRHSAGFILESATWRASPDWAAPLGLHQCGLDQLNVAAVELLHRL
FT                   RSKSATDPLEIVVSGCVGPRGDGYDPGQIMNVAEAANYHGHQVRVLASAGVDMLSALTM
FT                   TNINEATGITLAAAEVGLPVSVSFTVETDGRLPTGDSLMDAVTAVDEATNDYAAYFMVN
FT                   CAHPDHFAAVLDEPAAWTRRIRGVRANASRCSHKELDAMTELDAGDPLELGQLYRKLLH
FT                   EHPQITVLGGCCGTDLRHVTAIAEACARLPMSS"
FT   gene            138489..139769
FT                   /locus_tag="Deide_3p00860"
FT   CDS_pept        138489..139769
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p00860"
FT                   /product="putative major facilitator superfamily protein;
FT                   putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p00860"
FT                   /db_xref="EnsemblGenomes-Tr:ACO48027"
FT                   /db_xref="GOA:C1D3E8"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C1D3E8"
FT                   /protein_id="ACO48027.1"
FT                   /translation="MFSLLRDRRILILWIGESINAFGNGLTFIALAWFLYRLYPNSPAL
FT                   SGTVIGAWTAAMLLGTVSLAGYTDVWDRRRILQVANGLSAIWISLIPLLHGLDLLSFPA
FT                   LVVIAALTGFTGSVIFPAQQASLPTFVSADRLQGIQALFNLTWTTSGLLAPISAGFLVA
FT                   SIGAPGVMWVNAASFVVALIAYSIVRFPTVTRAQDSGQGLAAWWARTRYGFAFVLARPP
FT                   LWATLLGLASVNFAMEPYVAIFLPRIADRLMVGVELPAALSWVRADSRGALGVGLLGSV
FT                   LALAELGMVIWMGRRTSRHPLNWIALGCVGPALCIVGVAYAPSLGMALVLALLMGLCFG
FT                   PLNVMVGTMFARLTPEEVRGRVYSARILVGQGLRPVGVSLAAVLMGAVGLAPAVAVLGV
FT                   FAALLTLVGYLRARGAGDDAQGAAAAD"
FT   gene            139985..140392
FT                   /locus_tag="Deide_3p00870"
FT   CDS_pept        139985..140392
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p00870"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p00870"
FT                   /db_xref="EnsemblGenomes-Tr:ACO48028"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:C1D3E9"
FT                   /protein_id="ACO48028.1"
FT                   /translation="MKIQRVGTQPSTTGPADWFTGAVRIDGLFPAHEPARAAGNAVTFE
FT                   PGARTAWHTHPLGQTLIVTAGVGRVQREGGPVEEIRPGDVVWCEPGEKHWHGAAPTTAM
FT                   THIALQEALDGKSVEWLEHVTDEQYQAGEAG"
FT   gene            141243..141593
FT                   /locus_tag="Deide_3p00880"
FT   CDS_pept        141243..141593
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p00880"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p00880"
FT                   /db_xref="EnsemblGenomes-Tr:ACO48029"
FT                   /db_xref="UniProtKB/TrEMBL:C1D3F0"
FT                   /protein_id="ACO48029.1"
FT                   /translation="MPPMNVSQAKRHVEEALNHTDLPAHAELHVQTSQNPGRLVLTMIV
FT                   RNPGVTTGGNFIVSEEAIQDYGAQAVEDAFQRVLTAITNGNLLVLVGDPADLAVLTSHG
FT                   WSDGHPAPYAAH"
FT   gene            complement(142683..142901)
FT                   /locus_tag="Deide_3p00888"
FT   CDS_pept        complement(142683..142901)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p00888"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p00888"
FT                   /db_xref="EnsemblGenomes-Tr:AHX26572"
FT                   /db_xref="UniProtKB/TrEMBL:X5HNA7"
FT                   /protein_id="AHX26572.1"
FT                   /translation="MSDLEAMRQAALRAVAEARVFALEAHRGDLLPEVDGLYAAYLDAP
FT                   REMSALKNVLDAALSFSQRLGPPLATA"
FT   gene            143939..144163
FT                   /locus_tag="Deide_3p00900"
FT                   /note="nonfunctional transposase (degenerated IS - IS982
FT                   family)"
FT   gene            complement(144202..144525)
FT                   /locus_tag="Deide_3p00903"
FT   CDS_pept        complement(144202..144525)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p00903"
FT                   /product="putative Barstar, RNAse (barnase) inhibitor"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p00903"
FT                   /db_xref="EnsemblGenomes-Tr:ACO48031"
FT                   /db_xref="InterPro:IPR000468"
FT                   /db_xref="InterPro:IPR035905"
FT                   /db_xref="UniProtKB/TrEMBL:C1D3F2"
FT                   /protein_id="ACO48031.2"
FT                   /translation="MAKGTLDTSRIRDWETFHDVSMQAFGFPDFYGRNMDAWIDCLTYL
FT                   DEADGMSSVVLGSDELLCIHVPGFSIFAASLPDVANAFLACSCFHQPAVYRTEGCFPTD
FT                   FDA"
FT   gene            complement(145055..145519)
FT                   /locus_tag="Deide_3p00901"
FT   CDS_pept        complement(145055..145519)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p00901"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p00901"
FT                   /db_xref="EnsemblGenomes-Tr:ACO48032"
FT                   /db_xref="UniProtKB/TrEMBL:C1D3F3"
FT                   /protein_id="ACO48032.2"
FT                   /translation="MDLVRRALETMAWCAPRVQTNDVASCLRSTELRPGRDIAFWYGDP
FT                   PLADELEFLSDPWQPLPDEPPVVRVPSELRGETIPRTYKVYLAETGGLVPWAEWNASAL
FT                   WPNMERALRNFRSAATVAHRRRTVEGMAIRRSQLLRERGWKPDDTLRNLP"
FT   gene            complement(145584..145943)
FT                   /locus_tag="Deide_3p00902"
FT   CDS_pept        complement(145584..145943)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p00902"
FT                   /product="Conserved hypothetical protein; putative membrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p00902"
FT                   /db_xref="EnsemblGenomes-Tr:ACO48033"
FT                   /db_xref="GOA:C1D3F4"
FT                   /db_xref="InterPro:IPR025597"
FT                   /db_xref="UniProtKB/TrEMBL:C1D3F4"
FT                   /protein_id="ACO48033.1"
FT                   /translation="MTLAALLAAIAGLITVGLGLFGLVRPHTAAAFVGILPNGLRGVSE
FT                   VRATYGGLFFVLGLASLIIASPQAWLMVGLAWGGAALARVVSVVIDRSFDSKNYGGIVL
FT                   EGLLCVLFLAHLVVR"
FT   gene            complement(146120..147238)
FT                   /locus_tag="Deide_3p00910"
FT   CDS_pept        complement(146120..147238)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p00910"
FT                   /product="putative filamentation induced by cAMP protein
FT                   Fic"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p00910"
FT                   /db_xref="EnsemblGenomes-Tr:ACO48034"
FT                   /db_xref="InterPro:IPR003812"
FT                   /db_xref="InterPro:IPR025230"
FT                   /db_xref="InterPro:IPR036597"
FT                   /db_xref="InterPro:IPR040198"
FT                   /db_xref="UniProtKB/TrEMBL:C1D3F5"
FT                   /protein_id="ACO48034.2"
FT                   /translation="MSTRLPVYAHQNSEWPHFRWDSSAFDVRLADIHFRRGALITAMAS
FT                   LGFDIRQETVLSVLVQDVTKSSEIEGEHLDAAQVRSSIAQRLGMDVAGLPPAARHVEGV
FT                   VEMLLDATGRFGAPLDAERLFGWHSALFPTGRSNLRRIIVGGWRDDREGPMMVLSGPLD
FT                   RQRVHFEAPAAERVPHEMDRFLTWFDTAQLDPVVRAAVAHLWFVTIHPFDDGNGRIARA
FT                   ITDLALARADGTSQRFYSMSAQIERERRAYYDALENTQRGGVDITGWIVWFLDQVFAAL
FT                   QSAEGVLDKVRSRQAFWDLYRDVLLNGRQIKVLGKMLEGLNSKLRSSKYAALAGCSQPT
FT                   AVRDLSDLVSKGILKVDPAAAGRSTSYILNFN"
FT   gene            complement(147264..147668)
FT                   /locus_tag="Deide_3p00912"
FT   CDS_pept        complement(147264..147668)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p00912"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p00912"
FT                   /db_xref="EnsemblGenomes-Tr:AHX26573"
FT                   /db_xref="UniProtKB/TrEMBL:X5H5X7"
FT                   /protein_id="AHX26573.1"
FT                   /translation="MAQRPILVNRNRLPNLWGNADAEEDKWLRVNLNNIQGFERFINES
FT                   VTPSFNALPFRQQRRLKETFRYALTQFDEAELSYAFDSCGRMYRMPALVPLRSAERVHI
FT                   SLRAIGAPLRLSLSDFSLHDSKNQTYSNQV"
FT   gene            complement(148202..150220)
FT                   /locus_tag="Deide_3p00930"
FT   CDS_pept        complement(148202..150220)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p00930"
FT                   /product="putative Von Willebrand factor type A domain
FT                   protein, precursor"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p00930"
FT                   /db_xref="EnsemblGenomes-Tr:ACO48035"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:C1D3F6"
FT                   /protein_id="ACO48035.2"
FT                   /translation="MWSLRRFARHHFLTRLSLALFLSASGAGQAQSGPTMIQLILDSSG
FT                   SMFSRLPGGDTRMATAQAVMTDFIGRLPNDPNLNVGLRLYGAAINAADPGACQDSKLVL
FT                   PMRGLDRSALLAAVRGARPKGATPIVYSLQQAAQDFPTTAGRRIVVLVTDGQESCQGDV
FT                   KGALEAFRSRGLEVDVRVIGIDLDARAQASFAGVGTFVNTRSAGELASALGQAVQAVAP
FT                   PAQVKVPVVVTLTSGGQPVTSGPVVRMTRTVGGAAAESLQTVGGEYRAELTPGTYSVQV
FT                   EATNGTQTYAGLTVTTDGPNRFSFNIAAVQAVQLQVAPAQPVAGGRVTVTYSGAPGGTN
FT                   NWVTLARREDPDTAYLDWSKVSGAAGQVDLAVQDEETVFEARYMLVNSDGSTRVVGRSA
FT                   PFTARRASVSLAGPGSAAAGSQIEVRWTGPNNPGDYVTIVPKGAPVGTYLNYFYTRNGN
FT                   PGRLITPLTPGDYEIRYNNDISGRMLASVPITLSAASYGLQAPTTAVAGSQIEVRWTGP
FT                   NNPGDYVTIVPKGAPVGSYLNYFYTRNGNPGRLITPLAPGDYEVRYSTEAQSPNPTLHS
FT                   VPVRLSAATYGLVAPREAKAGSTIQVRWTGPNNGGDYVTIVRKGAPVGAYLNYFYTSAG
FT                   NPGQLTLPSEPGEYELRYSTEAQSPNPTLFSVPFTVR"
FT   gene            150505..150954
FT                   /locus_tag="Deide_3p00935"
FT                   /note="nonfunctional cadherin domain/calx-beta domain
FT                   protein"
FT   gene            complement(151171..152097)
FT                   /locus_tag="Deide_3p00940"
FT   CDS_pept        complement(151171..152097)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p00940"
FT                   /product="putative sulfatase-modifying factor 1"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p00940"
FT                   /db_xref="EnsemblGenomes-Tr:ACO48036"
FT                   /db_xref="InterPro:IPR005532"
FT                   /db_xref="InterPro:IPR016187"
FT                   /db_xref="InterPro:IPR042095"
FT                   /db_xref="UniProtKB/TrEMBL:C1D3F7"
FT                   /protein_id="ACO48036.1"
FT                   /translation="MLLRPARENMLWIPGGDFQMGSDHHYPEERPAHHVHVEGFWMDPH
FT                   PVTNAEFRRFVEATGYVTLAERTPDPAQFPGVPLDVLVPGSVVFQQPAGPVPLYDHAGW
FT                   WAYVPGACWHQPEGPHSTLTGQDSHPAVHVAFEDALAYAAWAGKMLPGEAEWEYAARGG
FT                   LHGATFAWGDEERPQGRVMANTWHGRFPWENLDPHGFPRTSPVGTYPANGYGLHDMTGN
FT                   VWEWTLDPFQPQHVIRHVKSCCTPLNTRAGTGGTRERRVIKGGSHLCAPNYCFRYRPAS
FT                   RQGQEVDSSTSHLGFRCIVRGAGNAPI"
FT   gene            complement(152150..152884)
FT                   /locus_tag="Deide_3p00950"
FT   CDS_pept        complement(152150..152884)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p00950"
FT                   /product="Conserved hypothetical protein; putative membrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p00950"
FT                   /db_xref="EnsemblGenomes-Tr:ACO48037"
FT                   /db_xref="GOA:C1D3F8"
FT                   /db_xref="InterPro:IPR014470"
FT                   /db_xref="UniProtKB/TrEMBL:C1D3F8"
FT                   /protein_id="ACO48037.1"
FT                   /translation="MSLISMPPTMDEVLALPTVPLSRPHGGAATTSLAPITEASYSTNS
FT                   ANSLIHLYRAEVGKMTAYRARLDTSTNWAIVTTAGLSSFALGSSQNNHAVFLFAMFMNY
FT                   FFLHLEARRFRTFEITHHRVRIMERFFYPAMLGDKVDAGWHQLLIAELAKPRSPITRMD
FT                   ALGWRLRRNYLWIYAAVLMAWIAKLDLLRGPDGSPALTGLVPLAAIGSLPGQLVLLAVG
FT                   AFYVFLMHLAVRAVRQYPLEDG"
FT   gene            complement(152928..154322)
FT                   /locus_tag="Deide_3p00960"
FT   CDS_pept        complement(152928..154322)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p00960"
FT                   /product="putative sulfatase"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p00960"
FT                   /db_xref="EnsemblGenomes-Tr:ACO48038"
FT                   /db_xref="GOA:C1D3F9"
FT                   /db_xref="InterPro:IPR000917"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:C1D3F9"
FT                   /protein_id="ACO48038.1"
FT                   /translation="MNPRPNILLINCHDLGTFLGCYGIPTVHTPHIDGLASDGVKFDRM
FT                   FCVAPQCSPSRAALFTGRYPHNNGVMGLTHAHFAWDLHAGEQHLAQILRAAGYHTALVG
FT                   VHHELRHENMAQVATRCGFDEAVGEAANDDAPGDVMTERALDVLRRQAGAERPFYLQLG
FT                   YYEPHRLTPKVREERDYLGFIGDYIEPDDSLGLTIPAYLSDTPGARAETAELQGAVRYL
FT                   DACVGRVLQALRDLHLEQDTLVIFTTDHGLAFPRAKGSLYDPGLEIAFLVRYPARGWAG
FT                   GRVQQDLLSNVDVVPTLLELLDLPVSPDVQGQSFLNVLDGAGPSGRTEVFSEITFHDYY
FT                   DPRRAIRTEQYKLIVNFCAAPAFMNTSQSWRPRIDTENPVYPMLAYHPPTELYDLHNDP
FT                   LEYRNLADEPSYRRVHQALLARLHAWMHNTQDPLLQGAVTSPLHRRVVAALKEAETPVL
FT                   DPASHD"
FT   gene            complement(154347..155201)
FT                   /locus_tag="Deide_3p00970"
FT   CDS_pept        complement(154347..155201)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p00970"
FT                   /product="putative sugar ABC transporter, permease
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p00970"
FT                   /db_xref="EnsemblGenomes-Tr:ACO48039"
FT                   /db_xref="GOA:C1D3G0"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C1D3G0"
FT                   /protein_id="ACO48039.1"
FT                   /translation="MTRAAFSLSRFTPGRLVRSALLLLAVCITLGPLLYTLLTSLKYLR
FT                   DITAMNFVFTATPDNYAALFNPSQSNFLRLALNSLMVGVISTAIVTFVGVLGAYSLTRF
FT                   RWNPGVRTGITWWLLFLNLIPPVVFAGPFYVIARKFGLYDTILAVAIAHAVINLPLAVF
FT                   IMQSFFAEVPKELEEAAAIDGCSRMQTLVRIILPITRPGIAAASLLAFIFSWKDFLLAL
FT                   SLTSTPKSATIPIGIAAFAQEYSIRYGEMAAAATVATIPAVILVIFAQRHIVRGLTLGA
FT                   VKG"
FT   gene            complement(155198..156136)
FT                   /locus_tag="Deide_3p00980"
FT   CDS_pept        complement(155198..156136)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p00980"
FT                   /product="putative sugar ABC transporter, permease
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p00980"
FT                   /db_xref="EnsemblGenomes-Tr:ACO48040"
FT                   /db_xref="GOA:C1D3G1"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C1D3G1"
FT                   /protein_id="ACO48040.1"
FT                   /translation="MIGKQPWSSKPHVSKPLLATLLGSGDRYFQYWALLPVVLVLLALT
FT                   IYPLQQLIVMSVSDVRFEGNVAQWTNVGGRHYAELLQDPVVTTAFRNTLLFVVVTVIVE
FT                   VILGLILALAVAESRRLSWLYRPVLVLPILIPGIAIGTMWRLMYDVNYGVINQLLAKVG
FT                   ILGPTWTADPSLALFSVMIVDVWHWTSFLFLILLAGVESIPDELKEAARVDGATEAQVL
FT                   RRVTLPLMTATIIMATLLRAVAAFKVFDEVYLLTGGGPGTSSQVVGLYIEQLIFQQGRV
FT                   GYGSALAVIAALVAIVFIVMQTRLTSRKDAS"
FT   gene            complement(156194..157507)
FT                   /locus_tag="Deide_3p00990"
FT   CDS_pept        complement(156194..157507)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p00990"
FT                   /product="putative sugar ABC transporter, periplasmic
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p00990"
FT                   /db_xref="EnsemblGenomes-Tr:ACO48041"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:C1D3G2"
FT                   /protein_id="ACO48041.1"
FT                   /translation="MNSTRTRVTLTALLTGLTLSLSNSTAQGNTQAISILINDSPWFPG
FT                   FKALVEQYQKETGRRVNLNVTPFAGMLQKTQNAVTAKESEFDLVNLNEQWYMRFYADGQ
FT                   ITPLKKIDPAFKLDPQIIEYDYATRWDARLKNSNKKGEVLGLPINGNIQLLYYRKDLFD
FT                   KAGLAAPKTWADVEKAAKVLHDAPNMYGFAARTSPPDYDYQGILNSYMGSVLKYDTSSK
FT                   QWEVNLSQDVASRALDTWVRLGKTYGPRNYANLGQADMAALMSSGRLAMGVMVSALAPS
FT                   FEDPKVSSVVGKVAATVVPGATATRRATMSGIWVMGIPQNLPTARKKAALDFLEWATSK
FT                   KAQMNYARAGAIPVRQDVFEELGDEKQFAWMKAMAQSTPFIKAQPRVRESAQIIEVLNR
FT                   RLPQVISGGAKSDATLDAAAREIHKILTDAGYKVKPLR"
FT   gene            complement(157541..158746)
FT                   /locus_tag="Deide_3p01000"
FT   CDS_pept        complement(157541..158746)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p01000"
FT                   /product="putative transcriptional regulator, ROK family"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p01000"
FT                   /db_xref="EnsemblGenomes-Tr:ACO48042"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR041614"
FT                   /db_xref="UniProtKB/TrEMBL:C1D3G3"
FT                   /protein_id="ACO48042.1"
FT                   /translation="MAQHDRPSRSSAASRNAVLNVLKNTKEVTTDELVRRTGISQPTIL
FT                   KVLSALQHEGLIERYRHGEPTGGRPPILYRYSAQAGTILGIEAELPVIRAALMDLAGNT
FT                   LTTKQWTVDLTLETPQLIDALLSSIQHFADTAIPADTHLQTCGLAVTGFIDQTRGLWIG
FT                   SARIDILQDIPIQQQLAAVLQRPVHLIHQIDALTLAEPAQHTVFHNQPFLYFDVAEGIG
FT                   LRLANAGTPVTGMFGNAGLIGHTTVVPDGRRCVCGNHGCLEEYASARAFRRLLRELHDE
FT                   HPHSALNQLGHPAVLSDAVQLMHLGDEHAKRIVDELVRFLAIGIANAVNVFEVTNVVLG
FT                   GYIIEGGESLNRQLLHQTRTHLQPILGRNLNLVFSTASRDIAAPLGAAHHALQLATLPT
FT                   PA"
FT   gene            159335..159427
FT                   /locus_tag="Deide_3p01005"
FT   CDS_pept        159335..159427
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p01005"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p01005"
FT                   /db_xref="EnsemblGenomes-Tr:AHX26574"
FT                   /db_xref="UniProtKB/TrEMBL:X5GYA7"
FT                   /protein_id="AHX26574.1"
FT                   /translation="MLIVKSTTVFLKRFYDLNGEQIGTLTIAPG"
FT   gene            complement(160361..160645)
FT                   /locus_tag="Deide_3p01020"
FT   CDS_pept        complement(160361..160645)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p01020"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p01020"
FT                   /db_xref="EnsemblGenomes-Tr:ACO48043"
FT                   /db_xref="InterPro:IPR025336"
FT                   /db_xref="UniProtKB/TrEMBL:C1D3G4"
FT                   /protein_id="ACO48043.1"
FT                   /translation="MPKYLIERKMPGAGQLSGDDLRSASQNSNGVLARMQQNGTNVQWV
FT                   ESYVTDDAIHCIYLAPNEEAVHEHARTAGLPADSVRQVRATISPMTAEP"
FT   gene            complement(161005..161709)
FT                   /locus_tag="Deide_3p01030"
FT   CDS_pept        complement(161005..161709)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p01030"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p01030"
FT                   /db_xref="EnsemblGenomes-Tr:ACO48044"
FT                   /db_xref="GOA:C1D3G5"
FT                   /db_xref="InterPro:IPR005146"
FT                   /db_xref="UniProtKB/TrEMBL:C1D3G5"
FT                   /protein_id="ACO48044.1"
FT                   /translation="MTNPLQISPLVAERFPTYHGLVLLASGLTNGPSNERSIALLREAE
FT                   SHARQMFMTSPVAAHPHVAAWQDAFRAFGMKPKKTMNSAEALITRVVKGGELPAINRLT
FT                   DAYNAVSVRFVVPCGGEDLDHVVGPVTLKVADGKEPFETNKDGAAFVDHPVPGEVVWAD
FT                   EAGVTCRAWNWRQGTRTRLTDDTTRAYFLFDALAPMTPEDLTTAGDALEALLTELSPGC
FT                   EIRRVYLGSANE"
FT   gene            complement(161741..162310)
FT                   /locus_tag="Deide_3p01040"
FT   CDS_pept        complement(161741..162310)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p01040"
FT                   /product="putative pyridoxamine 5-phosphate oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p01040"
FT                   /db_xref="EnsemblGenomes-Tr:ACO48045"
FT                   /db_xref="GOA:C1D3G6"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="InterPro:IPR024747"
FT                   /db_xref="UniProtKB/TrEMBL:C1D3G6"
FT                   /protein_id="ACO48045.1"
FT                   /translation="MTDTTPRGQLKRQDKAMTREEAEAFLSSAFCGRTGTLGPDGYPYV
FT                   VPNLFTWQGGQVYLHTARYEGQFLTNVRFHEQVSFEVDEPGEIFPYGHVECDTSVSYRS
FT                   VIVFGRIRIVEDMDEKVRFYRAFMTKYAPEDSWGREKDSLPRVNGTIVYAITPESITGK
FT                   QGHLPGLSDRWPAKNDTASPGWQKRK"
FT   gene            complement(162327..162833)
FT                   /locus_tag="Deide_3p01050"
FT   CDS_pept        complement(162327..162833)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p01050"
FT                   /product="putative diamine acetyltransferase 2
FT                   (Spermidine/spermine N(1)-acetyltransferase 2)"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p01050"
FT                   /db_xref="EnsemblGenomes-Tr:ACO48046"
FT                   /db_xref="GOA:C1D3G7"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:C1D3G7"
FT                   /protein_id="ACO48046.1"
FT                   /translation="MPTIIRPATEQDIPQLLELMRALAEFEQYIDVFAVTEEILLHQGF
FT                   QQDPPDFHALVADADGTLTGMLVYYIVPFTATASPTLYMKELYVTEGARGQRVGEGLMH
FT                   AAAQEATARGCGSIRWTVANWNEAGQRFYERLGAQANPVWVDYSLSGPALSALAASTNA
FT                   AQPPA"
FT   gene            complement(162914..164398)
FT                   /locus_tag="Deide_3p01060"
FT   CDS_pept        complement(162914..164398)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p01060"
FT                   /product="putative transcriptional regulator, GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p01060"
FT                   /db_xref="EnsemblGenomes-Tr:ACO48047"
FT                   /db_xref="GOA:C1D3G8"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C1D3G8"
FT                   /protein_id="ACO48047.1"
FT                   /translation="MPLHLDRDGAVPVARQLQAQLRDAILQGQLRPGERLPSTRTLARV
FT                   LGTSRGAVMAAYDDLLTEGYLVGQVGSGTYVSVDLPAAPVAPAPHTPVAGTPHWLRASP
FT                   VTPDVAPATKDPHAIDFRVGQPAVAPLSDEAWKRAWRRVSEESLPGAYAQAAGDPELRA
FT                   EIAAYLHRSRGVPCGPDDVVITSGAIQGLHLVARAVLAPGDVAAFEEPGYRLARQVLRE
FT                   RGARILPVPVDGDGLRVSELPVGAEAPTLVYTTPSHQFPLGSRLSLPRRRALLDWAQAH
FT                   DSLIVEDDYDGEFRYDTAPLPALAALDPSRVVYLGTFSKVLSPALRVGYVVAPPVLRER
FT                   LEALKTIADYHTSWPVQRALAIFLRAGDLERHLARMRRVYARKRAALVRELEGARDVAR
FT                   VGGLEAGFHVHLDLDARLNAEEVARQSAARGVNVSLLAPFYVAQNAPGGLLLGYGGLEI
FT                   EQIRQGARVLVEVMNHQAATSPGRLRQRHARQSDHR"
FT   gene            complement(164699..165745)
FT                   /locus_tag="Deide_3p01062"
FT   CDS_pept        complement(164699..165745)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p01062"
FT                   /product="putative Glutamine--fructose-6-phosphate
FT                   transaminase"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p01062"
FT                   /db_xref="EnsemblGenomes-Tr:ACO48048"
FT                   /db_xref="GOA:C1D3G9"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR035466"
FT                   /db_xref="InterPro:IPR035490"
FT                   /db_xref="UniProtKB/TrEMBL:C1D3G9"
FT                   /protein_id="ACO48048.1"
FT                   /translation="MTQTQRHPSSPLMLQETREAPEVIRRQIVQNMSRVQEIVCAIRER
FT                   PPKMAVTIARGSSDHACSFLKYGLETQLSLPVASIGPSVHTLYGAQLDLQGALVLAVSQ
FT                   SGASPDVVETLRMARQRGGLTVALVNVEDSALAHAAEFVLPLQCGEERAVAATKSYLAS
FT                   LTAFLPVVAQLSGDLDLDLALAGLPEVLKEILALEERARDLAERYRFIQQLVVLARGMH
FT                   FGVAQEAALKLVETCGIQASAFSAAEFSHGPKRLLVEGVPVLAFTSLDAAANSSAEAYQ
FT                   GLHTTRSDLRTIGPASESTLRTMSTGHALTDPVGSAVAFYLFAAHLAVRRGLDPDHPPL
FT                   LSKVTQTR"
FT   gene            complement(165742..166893)
FT                   /gene="nagA"
FT                   /locus_tag="Deide_3p01070"
FT   CDS_pept        complement(165742..166893)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nagA"
FT                   /locus_tag="Deide_3p01070"
FT                   /product="putative N-acetylglucosamine-6-phosphate
FT                   deacetylase"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p01070"
FT                   /db_xref="EnsemblGenomes-Tr:ACO48049"
FT                   /db_xref="GOA:C1D3H0"
FT                   /db_xref="InterPro:IPR003764"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:C1D3H0"
FT                   /protein_id="ACO48049.1"
FT                   /translation="MTGSLSARQARLPVRQVTGRVFNGAAFHPATVVFTQTVQQVSPSP
FT                   DAPDDVLILPGFIDTHVHGGGGGDTMDGVKGIREMARTHARFGTTTLLPTTMTAPWPEV
FT                   VGALRAVKAVMEEGVDGGADIPGAHLEGPFISPMRLGAQPPFAIEPTADLLAEVLELDV
FT                   VRAVTLAPELPGVWHAALQLTAAGIRIGIGHTRADAQTVKALLDALQAGGARTAGTHLF
FT                   NAMGGIEGRLPGVPGALLTNPETFVEIILDNAHVHPTAFLLAHAAARNRVLLVTDAIRA
FT                   TGLGDGESELGGQRVLVKNGQARLTDGTLAGSVLTMHTALRNAVRAGVSLAEASRMLSA
FT                   TPAASVGLTDRGQISEGLRADLVVLNRELAIKAVYIGGQEISL"
FT   gene            complement(166890..167063)
FT                   /locus_tag="Deide_3p01072"
FT                   /note="nonfunctional hypothetical protein"
FT   gene            complement(167161..168006)
FT                   /gene="nanK"
FT                   /locus_tag="Deide_3p01080"
FT   CDS_pept        complement(167161..168006)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nanK"
FT                   /locus_tag="Deide_3p01080"
FT                   /product="putative N-acylmannosamine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p01080"
FT                   /db_xref="EnsemblGenomes-Tr:ACO48050"
FT                   /db_xref="GOA:C1D3H1"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="UniProtKB/TrEMBL:C1D3H1"
FT                   /protein_id="ACO48050.2"
FT                   /translation="MTAAEGTCLAVDIGGTTTRVAVVQGSAVTHRHEAATPASQGPQAV
FT                   LDQVLSLLNQCHAPPYVPLAVACTGRVHQGCVTAINQATMPGWTAVPVEGLLSRATGRP
FT                   VTVLNDAKAATLAEWQASGKPDHFMFLTISTGIGSGLVLRGRLVQAPEGLDIGLGFARG
FT                   PEGQALEVTSSGRGLEQAAGPLGSVRALFDAAEQGDVHAQTLLTAPFQILADRIHDAHC
FT                   LLGLNLVSLGGSLGLRDWTHFVLNAALPDLRLTRAAHGADAGLLGVALHARTIRQEMTA
FT                   "
FT   gene            complement(167993..168667)
FT                   /gene="nanE"
FT                   /locus_tag="Deide_3p01090"
FT   CDS_pept        complement(167993..168667)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nanE"
FT                   /locus_tag="Deide_3p01090"
FT                   /product="putative N-acetylmannosamine-6-phosphate
FT                   2-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p01090"
FT                   /db_xref="EnsemblGenomes-Tr:ACO48051"
FT                   /db_xref="GOA:C1D3H2"
FT                   /db_xref="InterPro:IPR007260"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:C1D3H2"
FT                   /protein_id="ACO48051.1"
FT                   /translation="MSAVLDRLRGRLIVSCQANPGSPLRDPHIISRLALAAQQGGAAGL
FT                   RIQGFEDVLAVRAVTDLPIIGLTKTDRPDTPVYITPTSAEAARLAELGSDIVAFDATLR
FT                   PRPESVVHLVQTIHAAGALAMADISTLPEAQAAYEAGADIVGTTLAGYTPHSRALTTAD
FT                   WLLMDELREGGLTFIAEGRLNSPQDAARAMRHGAHAVVVGSAITRPDVITTWFAGALRD
FT                   GS"
FT   gene            complement(168664..169596)
FT                   /locus_tag="Deide_3p01100"
FT   CDS_pept        complement(168664..169596)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p01100"
FT                   /product="putative dihydrodipicolinate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p01100"
FT                   /db_xref="EnsemblGenomes-Tr:ACO48052"
FT                   /db_xref="GOA:C1D3H3"
FT                   /db_xref="InterPro:IPR002220"
FT                   /db_xref="InterPro:IPR005264"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR020625"
FT                   /db_xref="UniProtKB/TrEMBL:C1D3H3"
FT                   /protein_id="ACO48052.1"
FT                   /translation="MTTIRAAQAFHGIIPPVVTPLTPDYQVDETALRQVIRHLLLGGVH
FT                   GLFLLGSTSEVVFMDAPARREVLRIAVDETQGRVPLLAGVIDPTTDRVIAHARDAQAAG
FT                   VDGLVVTAPFYARTSQTEIIEHFRAIRQAVPLPIMAYDIPVCVHVKLERATLRTLRAEG
FT                   LIEGLKDSSGDDTNFRLLALECQNDPDFRLFTGSELMVDTAFQVGAHGCVPGLGNVDPA
FT                   AYVALYDTARTGDWVKARQIQERLIRLFSIALQGAPRTSGGASGVGGFKTALKLMGLIP
FT                   YHHMNRPNLPLNDQETERVGAILREGGLL"
FT   gene            complement(169647..170522)
FT                   /gene="gsiD"
FT                   /locus_tag="Deide_3p01110"
FT   CDS_pept        complement(169647..170522)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gsiD"
FT                   /locus_tag="Deide_3p01110"
FT                   /product="putative dipeptide/oligopeptide/nickel ABC
FT                   transporter, permease component"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p01110"
FT                   /db_xref="EnsemblGenomes-Tr:ACO48053"
FT                   /db_xref="GOA:C1D3H4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR025966"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C1D3H4"
FT                   /protein_id="ACO48053.1"
FT                   /translation="MTALTAPGIRRNPTTLAFKRFLRHRLAVLGLLLLSLIVLAVVVGP
FT                   VVSPFKPDDIDLMSRNQPPSSRHWLGTDPTGRDVFARTFSAGRVSLMVGLFSTLISVVV
FT                   GTILGALAGYFGGWVDNVIMRFVDIVMTFPSIIVLLTLAAIIGPGIDKTIVIIGLLGWP
FT                   LAARLVRAKLLSVRELEFIAAANALGATDRRILLKHALPNAVDVLVVFVSLGVASAILT
FT                   EAGLSFLGLGVQPPQASWGNLLSTAREITVLEAYPWQWMPAGALIVLTVLATNFLGDGL
FT                   RDALDPKARQ"
FT   gene            complement(170537..171490)
FT                   /locus_tag="Deide_3p01120"
FT   CDS_pept        complement(170537..171490)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p01120"
FT                   /product="putative dipeptide/oligopeptide/nickel ABC
FT                   transporter, permease component"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p01120"
FT                   /db_xref="EnsemblGenomes-Tr:ACO48054"
FT                   /db_xref="GOA:C1D3H5"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C1D3H5"
FT                   /protein_id="ACO48054.1"
FT                   /translation="MGTYVVRRLLTTIPLLLVITAIIFTMLQFTPGDPMDAYIPPDQVI
FT                   SVQQREIIRTELGLDQPKPVQYLRWLGKAAQGDLGYRIKNGEPVTSEIARRLPPTLMLM
FT                   GLGMTLGVALGVFFGVLAAVKRYTALDNGLTFLAFLGISTPAFLAGLIGMYVFALKLQW
FT                   FPAGGYQTPGDGSVLDTLSHLILPASILSVTYIAVLMRYTRSSVLDVVFQDYVRTASAK
FT                   GVPHTRVISKHVLRNALIPVVTVIGANVANLIGGAVFLESIFSWPGTGQLYLDAIDSRD
FT                   YPMIMGTTLVLATVILLANLITDVLYGAIDPRIRYS"
FT   gene            complement(171578..173110)
FT                   /locus_tag="Deide_3p01130"
FT   CDS_pept        complement(171578..173110)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p01130"
FT                   /product="putative dipeptide ABC transporter, periplasmic
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p01130"
FT                   /db_xref="EnsemblGenomes-Tr:ACO48055"
FT                   /db_xref="GOA:C1D3H6"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:C1D3H6"
FT                   /protein_id="ACO48055.1"
FT                   /translation="MIKRSVLALTLALTTLGTASADKVITGAFDQGPGGAPQQFNPLTN
FT                   TAGFTWLNKYYSTLVLYDAGFKKISGDLASSWVVGDGGKKYTFILQSGVKWHDGKPFTS
FT                   KDVKFSLELANNPDSGSAFAAKFGNIRSIQTPNTRTVVVTLSKPNAALLDALTSFMILP
FT                   QHELSKIPARELRTSTWWRTEPVGTGPFMWSRHVPDQYVELKANPNYYKGKPKVDRLVN
FT                   RYFKEQAAAVLALKSGNIDFTYLTLDDTKTFSGSSVSILSGPSQVANYLGFNNASDQFK
FT                   DIRVRQAMLHAIDRNTIIKQLYGGGAELAYCPVTNSRYVPKSVNKYAYDPAKARQLLQA
FT                   AGWNSSQNIEVITYYTDQLSKDVLVTLQQMFAQVGLKITPRFLDTPTYNQVTNGTAFQM
FT                   VYAGIGNGPDPDTLYPSLHSDFMPPNGTNRMRVNLPAVNKLFEQGQETAAVAARTKAYQ
FT                   NVCSLVNEQLPWATLWTAKRFGGATKDLVNFVWTPAPGGGRYDDQAHLWDIK"
FT   gene            complement(173135..173857)
FT                   /locus_tag="Deide_3p01140"
FT   CDS_pept        complement(173135..173857)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p01140"
FT                   /product="putative transcriptional regulator, GntR family,
FT                   putative transcriptional regulator nanR"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p01140"
FT                   /db_xref="EnsemblGenomes-Tr:ACO48056"
FT                   /db_xref="GOA:C1D3H7"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C1D3H7"
FT                   /protein_id="ACO48056.1"
FT                   /translation="MTTKVPAYRQAQIAIKRYIEEHHLRPGDLLPSESQLAKDMGMSRL
FT                   SLREGVKTLEAVGILEARQGEGLYVKAFTFDSIFENLPYSFASDGKSLRDLLQVRTALE
FT                   EGLVGMVVSHTTPQQIDQLHRLAQQMIDKAKRGETFEDEDREFHLVLYRPLHNLFLNRL
FT                   VELFWEVFRRLHGSAGATHWNLEQTAQDHMAIVDALRQRKPAKVTQAMHAHFQQINERL
FT                   APSTDTTLVTDVRSTPAS"
FT   gene            174171..175298
FT                   /locus_tag="Deide_3p01141"
FT   CDS_pept        174171..175298
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p01141"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p01141"
FT                   /db_xref="EnsemblGenomes-Tr:ACO48057"
FT                   /db_xref="InterPro:IPR006652"
FT                   /db_xref="InterPro:IPR015915"
FT                   /db_xref="InterPro:IPR019936"
FT                   /db_xref="UniProtKB/TrEMBL:C1D3H8"
FT                   /protein_id="ACO48057.1"
FT                   /translation="MSSMFRSAAQGGDSGGEHGGTYPDLPLPLTHGVGGIIGTTVYAGL
FT                   GTAGQKFFALDLTQPNRVWTEVAAFPDPARDQAAAAVANGKLYVFGGIGKSTPEATTAV
FT                   FHQVHVYDPGANTWAMLNTRVPREIAGGSAVTQGDRILLFGGVNRTIFDRYFEDMAAAG
FT                   TDKDRRDTVTLAYFNQRPQDYRFSRDLQAYSPATNTWESLGVVPFAGRTGAALHLEGNI
FT                   LTVMNGELKPGLRTPAVHQGVVSPAGVTWRALPDLPPPAAGQVQEGLAGAYTGCSGGAL
FT                   LLAGGTNFPGSSAQFARGTLYAHQGLKKTWHTTVYALRGGRWSIAGQLPQAQGHGLSIQ
FT                   FGDEVLLIGGELPGGTASAKVISVQVKDGQLLTAR"
FT   gene            complement(175696..176463)
FT                   /locus_tag="Deide_3p01142"
FT   CDS_pept        complement(175696..176463)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p01142"
FT                   /product="putative phage integrase"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p01142"
FT                   /db_xref="EnsemblGenomes-Tr:ACO48058"
FT                   /db_xref="GOA:C1D3H9"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:C1D3H9"
FT                   /protein_id="ACO48058.1"
FT                   /translation="MPCRKPILMQPRDRTDAITRRPPHRETVVHRALAAAEREQRTDLR
FT                   VLILLTAHAGLRIEEALTLTWTQVDLASRRLTVQGKGRKRRIVGISGSLLDALQAHAGQ
FT                   GKGDRLFTYAHRSGATYHLRRLMEQEGLPWAGFHAFRKYNGTLLYRRTRDFVRVAHHLG
FT                   HANVNTHGRTLMCRQMTWLVNSPISEESATVRSAYPGLSEFSPENRNAYVAHTWILGYT
FT                   VSHQRRPLGRLFHHQPVADLKRTDQTVTSGCMG"
FT   gene            176408..176695
FT                   /locus_tag="Deide_3p01160"
FT   CDS_pept        176408..176695
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p01160"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p01160"
FT                   /db_xref="EnsemblGenomes-Tr:ACO48059"
FT                   /db_xref="GOA:C1D3I0"
FT                   /db_xref="InterPro:IPR003735"
FT                   /db_xref="InterPro:IPR038390"
FT                   /db_xref="UniProtKB/TrEMBL:C1D3I0"
FT                   /protein_id="ACO48059.1"
FT                   /translation="MIASVRSRGCIRIGFLHGIQVLNRLRRLEDQVRGLHKMVDEERPC
FT                   QEILTLLSGVRSALDATGETIFEQYLLSCAAEEGEPLPTKEIVKTARLLR"
FT   gene            complement(176780..177826)
FT                   /locus_tag="Deide_3p01170"
FT   CDS_pept        complement(176780..177826)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p01170"
FT                   /product="putative luciferase-like monooxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p01170"
FT                   /db_xref="EnsemblGenomes-Tr:ACO48060"
FT                   /db_xref="GOA:C1D3I1"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR022290"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:C1D3I1"
FT                   /protein_id="ACO48060.1"
FT                   /translation="MEIGIDSFAATVTDPDTNLTLSGADRLNHLIEEIERADAVGLDSF
FT                   GVGEHHRREYLDAAPAIILAAAASRTQGIRLNSAVTVLSADDPVRVFQQFSTLDLLSRG
FT                   RAEIVVGRGSFVEAYPLFGLDLHDYDALFAEKLELLLKLRDDPQVHWQGRFRAPLTGQG
FT                   VYPRPQQESLPIWLGVGGTPESFVRAGTLGLPLMVAIIGGSFRRFRPLVDLYRQAGLAA
FT                   GHPAESLRVGVHAFGFVAPTSQEARDAFYPGYARMIETIGRERGWPAPSRARFDAECGP
FT                   AGAYLIGGVQEVVDKVLHVNEVLGGVSRLTFQMTNVVMTHERMLRAIELLGQEVAPLVR
FT                   ERLLEHTR"
FT   gene            complement(177810..179111)
FT                   /locus_tag="Deide_3p01180"
FT   CDS_pept        complement(177810..179111)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p01180"
FT                   /product="putative Flavin-binding monooxygenase-like
FT                   protein; putative pyridine nucleotide-disulfide
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p01180"
FT                   /db_xref="EnsemblGenomes-Tr:ACO48061"
FT                   /db_xref="GOA:C1D3I2"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C1D3I2"
FT                   /protein_id="ACO48061.1"
FT                   /translation="MAPASTDDDPDMTPGPAGRLAPPGAALKTDIVVIGGGQAGLSAAY
FT                   HLKQAGLVPRKKFVILDAAAAPGGAWQFRWPSLTLSTVNRIHDLPGLPFSDMASGETHV
FT                   QARVAVPRYFAAYEQAFGLRVLRPVKVILVSRRGDRFRVETDRGEFSARGLINATGTWD
FT                   APYIPEYPGAERFQGQHLHTRDYRTPQAFAGQHVVIVGAGISALQLLGEISKVTTTTWV
FT                   TRQPPVFREGPFDDQAARAAVALVEDRVRAGLSPQSVVSVTGLPVTPAVEEMRARGVLS
FT                   RHPMFTEITEDGVRWANGSEVHADVILWCTGFRSSLDHLAPLMLRRPDAEDGIVMTGRL
FT                   ATQVASEPRIHLVGYGPSTSTIGANRAGRAAASELLTSLAAARPHMTCGGRGKRGRSET
FT                   TSKQRNRNDRRVSALPFTHTAKATSKETHHGNRH"
FT   gene            complement(179294..179980)
FT                   /gene="wrbA"
FT                   /locus_tag="Deide_3p01190"
FT   CDS_pept        complement(179294..179980)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="wrbA"
FT                   /locus_tag="Deide_3p01190"
FT                   /product="putative flavoprotein wrbA (Trp repressor-binding
FT                   protein)"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p01190"
FT                   /db_xref="EnsemblGenomes-Tr:ACO48062"
FT                   /db_xref="GOA:C1D3I3"
FT                   /db_xref="InterPro:IPR005025"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR010089"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:C1D3I3"
FT                   /protein_id="ACO48062.1"
FT                   /translation="MTFLDRLLKALYPRTQAQDAPQESPVTTPSPVRMTIVYYSTYGTN
FT                   HQMAEVAAEAARESGAEVRLVKARETAPQEVVNGQDAWRAQQERTAHVPEATPADLENV
FT                   DAILFSSPTRFGGATSQIRAYIDTLGGLWGTGALANKTFSAMTSAQNPHGGQETTLQTL
FT                   YITAMHWGAILTPPGYTDPVLFASGGNPYGASVTANGEPLSEADKASIRHQVRRQIEIT
FT                   QKLKAQ"
FT   gene            complement(180139..180579)
FT                   /locus_tag="Deide_3p01200"
FT   CDS_pept        complement(180139..180579)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p01200"
FT                   /product="putative transcriptional regulator, MarR family"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p01200"
FT                   /db_xref="EnsemblGenomes-Tr:ACO48063"
FT                   /db_xref="GOA:C1D3I4"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C1D3I4"
FT                   /protein_id="ACO48063.2"
FT                   /translation="MTEMPASLDVDEALRQPSIRLWRRLIRLTQGKIRDVESALSPLGL
FT                   TPTEFDLLAVVRAHPGATQQELAQHMLFTEGNMTYHAQRLLSRGLIRREVAGRTKRLSL
FT                   TPEGSALMNQALPVVVDIHEAQFAGLTTDQLQQLEGLLRLLQ"
FT   gene            181067..181483
FT                   /locus_tag="Deide_3p01210"
FT   CDS_pept        181067..181483
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p01210"
FT                   /product="putative transcriptional regulator,Rrf2 family"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p01210"
FT                   /db_xref="EnsemblGenomes-Tr:ACO48064"
FT                   /db_xref="InterPro:IPR000944"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C1D3I5"
FT                   /protein_id="ACO48064.1"
FT                   /translation="MNSHYAMAVHVLALINMYPDSARTSEDIAASIGTNPVVVRNVIGH
FT                   LRRAGLLDTRQGVAGAHLTRAPRDITLLDVYRAVNAPASVFKLHEQPNPRCPVGSRIQG
FT                   SLTQVFGEAQGALEAHLASLTLEDVTGDLARRVS"
FT   gene            181540..182169
FT                   /locus_tag="Deide_3p01220"
FT   CDS_pept        181540..182169
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p01220"
FT                   /product="putative NAD dependent epimerase/dehydratase
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p01220"
FT                   /db_xref="EnsemblGenomes-Tr:ACO48065"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C1D3I6"
FT                   /protein_id="ACO48065.1"
FT                   /translation="MNILLIGATGFLGTRILHEALNRGHTVTALVRREHALTPAPNLHI
FT                   EVADASLPSDVARLATGTDAIIASVSARKPGDTPIPTTIQAIADGARQAGTPRLFVVGG
FT                   AGSLEVAPGVALMDAPGFPDAYRTEAEQHGQALAFLRGSDLNWTYLSPAAEIAPGERTG
FT                   TFRLGGNQFFTDAEGRSFITAEDYAVAVLNELEHPQHERQRFSIAY"
FT   gene            182187..182822
FT                   /locus_tag="Deide_3p01230"
FT   CDS_pept        182187..182822
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p01230"
FT                   /product="putative DsbA FrnE like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p01230"
FT                   /db_xref="EnsemblGenomes-Tr:ACO48066"
FT                   /db_xref="GOA:C1D3I7"
FT                   /db_xref="InterPro:IPR001853"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:C1D3I7"
FT                   /protein_id="ACO48066.1"
FT                   /translation="MSDLHLLYVTDAYCGWCWGFAPTLSAFHARHPHLPLRLISGGLFT
FT                   GEKIAPIAAYPHIPGANDRITHLTGVTFGDAYQARLQEGILVLNSDDAAAGLAALRALA
FT                   PDRALEAFHAIQHAFYMEGQSLSDPRTYRAVAQTLNLDPDAAEAAFHGPQARTEAAQDY
FT                   QLARTLGVDSYPTLLAQQDGQRTVLARGAATVEQVETRLQRALNPATP"
FT   gene            complement(182982..183878)
FT                   /locus_tag="Deide_3p01240"
FT   CDS_pept        complement(182982..183878)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p01240"
FT                   /product="putative transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p01240"
FT                   /db_xref="EnsemblGenomes-Tr:ACO48067"
FT                   /db_xref="GOA:C1D3I8"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C1D3I8"
FT                   /protein_id="ACO48067.1"
FT                   /translation="MRLDPDYLVTFSVVAEYGNISRAAEALRLSQPAVSGQLKALQDVV
FT                   GERLYTRTAYGITLTEAGQDLLGYARVIATTLSGAAEHLRTRQARTRPLRLGLSWTLSG
FT                   QAVSLVSGAHEAGHEVRVTSGHSTSLMEAVASGASDAALIVQPPGPLPAGLEGHRFSAE
FT                   DLCLLVPAGHPLEDRGSTPLLAAAQEVFLWPMVGSTVARHAERLLNEATVLPAVQFELG
FT                   SLTAVREAVGRGLGVTILPPSVARLEIEAGQVSPVLIEALNVTVSYVVVVPSDVVVRPE
FT                   ARRLLDLVLRSRRSTRL"
FT   gene            184014..184895
FT                   /gene="sseA"
FT                   /locus_tag="Deide_3p01250"
FT   CDS_pept        184014..184895
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sseA"
FT                   /locus_tag="Deide_3p01250"
FT                   /product="putative thiosulfate sulfurtransferase
FT                   (Rhodanese)"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p01250"
FT                   /db_xref="EnsemblGenomes-Tr:ACO48068"
FT                   /db_xref="GOA:C1D3I9"
FT                   /db_xref="InterPro:IPR001307"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:C1D3I9"
FT                   /protein_id="ACO48068.1"
FT                   /translation="MTNSTAPTPYARDVLVSTAWVAQHLGDPTVRLIEVNEDILLYDTG
FT                   HLPGALKIDWQIDFWHPVMRDFITPKEVSALLGRLGIREYDQIILYGDKSNWWAAYAFW
FT                   FLSYSGVQNLKLMDGGRQKWMAEGREVTTDVPEVRPTVYPALQCDESIRAYREDVLAHL
FT                   DGVQAGRGALLDIRSPDEFSGKVTHMANYPQEGVLRGGHIPGARNVPWAKAANEDGTFK
FT                   SVEELRALYEGEGVTPDKDVIAYCRIAERSSHSWFALTQLLGYPRVRNYDGSWTEWGNA
FT                   VGLPIEKTYVPE"
FT   gene            184990..185643
FT                   /locus_tag="Deide_3p01260"
FT   CDS_pept        184990..185643
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p01260"
FT                   /product="putative electron transport protein SCO1/SenC,
FT                   precursor"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p01260"
FT                   /db_xref="EnsemblGenomes-Tr:ACO48069"
FT                   /db_xref="GOA:C1D3J0"
FT                   /db_xref="InterPro:IPR003782"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:C1D3J0"
FT                   /protein_id="ACO48069.1"
FT                   /translation="MTVPSPSPAARPWTTSALLALLAVLLLLGSAWAYARIRSPFPYYG
FT                   TAYTPPVAAQPFQGTDHTGQPYTFTPGSTGRTTAVFFGFTHCPNICPLSLAYLEKARQA
FT                   LTPQERQQLDIVLVSVDPARDTPERLGAYVEFFGTATGVHIPEPALARTAQAYGVAYQQ
FT                   VKLDGGAGYQVNHTPATYLVDGSGTLRVLWDYTQLTQVDRVVRDLRHVLENPLP"
FT   gene            185640..186464
FT                   /locus_tag="Deide_3p01270"
FT   CDS_pept        185640..186464
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p01270"
FT                   /product="Conserved hypothetical protein; putative membrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p01270"
FT                   /db_xref="EnsemblGenomes-Tr:ACO48070"
FT                   /db_xref="GOA:C1D3J1"
FT                   /db_xref="InterPro:IPR019108"
FT                   /db_xref="UniProtKB/TrEMBL:C1D3J1"
FT                   /protein_id="ACO48070.1"
FT                   /translation="MTAAPANLNPTLLDLLSLRFDPGVWLPILAITGVYLWHAQRARRS
FT                   WVGRAGWPAWRTGLFLLGMLLLLVATQSAAATVTQSSMAVYMARLMVLAEVVPPLLVLG
FT                   LPRTLRPHPDRPLGRALSVLLDPWVALAVWTAVITYWNVPAGFNASVVSNTAEALLPTL
FT                   YLLSSLMVWAVVLRPLPTVQPANIGSRGWFGLLAALPMMAVAGVWLNAPDVLYAPYVAA
FT                   LCLWDLTPLQNQQLSGWIMMMAGIPAMCVALMQLMAWLIQLADGDATPKARG"
FT   gene            186947..187399
FT                   /locus_tag="Deide_3p01280"
FT   CDS_pept        186947..187399
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p01280"
FT                   /product="Conserved hypothetical protein, precursor"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p01280"
FT                   /db_xref="EnsemblGenomes-Tr:ACO48071"
FT                   /db_xref="InterPro:IPR012533"
FT                   /db_xref="InterPro:IPR038507"
FT                   /db_xref="UniProtKB/TrEMBL:C1D3J2"
FT                   /protein_id="ACO48071.1"
FT                   /translation="MSIVLRAASLLAALLLSAAGAHATIRTEGGLTESKAGASETYRLN
FT                   VPTEKAISTTQVRLIVPAGVTLSRFQVTPGFTRTVTTNAAGLVTEVIWKGRIGPMEYAR
FT                   FFFQAVNPEQPGSITWKVYQTYSDGSVVAWDDSDPSQAPASRTTVK"
FT   gene            187449..187862
FT                   /locus_tag="Deide_3p01290"
FT   CDS_pept        187449..187862
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p01290"
FT                   /product="putative copper resistance protein CopC,
FT                   precursor"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p01290"
FT                   /db_xref="EnsemblGenomes-Tr:ACO48072"
FT                   /db_xref="GOA:C1D3J3"
FT                   /db_xref="InterPro:IPR007348"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR032694"
FT                   /db_xref="UniProtKB/TrEMBL:C1D3J3"
FT                   /protein_id="ACO48072.1"
FT                   /translation="MIRFSLLALLLAMPGASAHTAVTSVTPAANTTVAAPGAVRISFSE
FT                   PVNLRFSTFKVYPLKATGTTLTQAAKRLAPVALAARDDASVRADTAPILTGRAARVTLP
FT                   LKPNLPAGPYLIVWRVLSEDGHPVTGHHHFHVK"
FT   gene            187859..188671
FT                   /locus_tag="Deide_3p01300"
FT   CDS_pept        187859..188671
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p01300"
FT                   /product="putative copper resistance protein CopD; putative
FT                   membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p01300"
FT                   /db_xref="EnsemblGenomes-Tr:ACO48073"
FT                   /db_xref="GOA:C1D3J4"
FT                   /db_xref="InterPro:IPR008457"
FT                   /db_xref="InterPro:IPR032694"
FT                   /db_xref="UniProtKB/TrEMBL:C1D3J4"
FT                   /protein_id="ACO48073.1"
FT                   /translation="MTAGFAHFLMFLAVAVLLAASLVWRRLAPHGLTLPRHPFAWLGAG
FT                   FWLMLTGLALNVAATLSALGFTTPGDVIDYLLTTGPGRAALVTLLGTTLLLVAEVGEWS
FT                   APVARSGAAAGVTVMLWGLAGLGHGADHESVLVRAAHALHSGAMGGWVGGMLMLVVGRP
FT                   THWTRMARAFSPLALTCVVVLGVSGVLMGVSHAGPPGQWTASPYGRTLLLKLLAVLGVL
FT                   TAAWRVRRHRSDRPADVPFLALRVELGLLLVVLVLTAVLVISASPTHG"
FT   gene            189185..189922
FT                   /locus_tag="Deide_3p01310"
FT   CDS_pept        189185..189922
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p01310"
FT                   /product="putative thiosulfate sulfurtransferase
FT                   (Rhodanese)"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p01310"
FT                   /db_xref="EnsemblGenomes-Tr:ACO48074"
FT                   /db_xref="GOA:C1D3J5"
FT                   /db_xref="InterPro:IPR001307"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:C1D3J5"
FT                   /protein_id="ACO48074.1"
FT                   /translation="MPGAVQLDCRADLWDPVIRDFVSPEAFAALMGRLGITPDTTVVLY
FT                   GDKSNWWATYAFWVLRYCGHERVRLVNGGRQKLMTDGFDLTDEIPDVQPCTYPVQERNE
FT                   QLRIYRDEVQHHIHAVRAGRGALVDVRSPDEYAGHVTHMPEYPQEGVLRGGHIPGAVNL
FT                   PWAMAVKHDGTFKAADQLRRMYEKADVTPDRMVVTYCRIAERSSHTWFVLTQLLGYPDV
FT                   RNYDGSWTEWGNAVGVPIETAPR"
FT   gene            190013..190216
FT                   /locus_tag="Deide_3p01320"
FT   CDS_pept        190013..190216
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p01320"
FT                   /product="Conserved hypothetical protein; putative membrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p01320"
FT                   /db_xref="EnsemblGenomes-Tr:ACO48075"
FT                   /db_xref="GOA:C1D3J6"
FT                   /db_xref="UniProtKB/TrEMBL:C1D3J6"
FT                   /protein_id="ACO48075.1"
FT                   /translation="MDLESWTPKDKARRLAVLVALYLSTMLMVVSVLALKWPWFVAPLV
FT                   GAVGYAVAFYVAYAILRNTFRR"
FT   gene            complement(190692..191591)
FT                   /locus_tag="Deide_3p01330"
FT   CDS_pept        complement(190692..191591)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p01330"
FT                   /product="putative SnoaL-like polyketide cyclase"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p01330"
FT                   /db_xref="EnsemblGenomes-Tr:ACO48076"
FT                   /db_xref="GOA:C1D3J7"
FT                   /db_xref="InterPro:IPR009959"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="UniProtKB/TrEMBL:C1D3J7"
FT                   /protein_id="ACO48076.1"
FT                   /translation="MNKTRFLAITALLLNATATAAVLGGGGPASTKPAALKSPANRSAT
FT                   MSTPKQQVIDVLKAIETGASAPFAVINPQNYTHHILGAADGLTGYRALLQALPAGSARV
FT                   NTVRVFQDGNHVFTHTDYNFFGPKIGIDVFRFENGRIVEHWNNVQQTPTGPNPSGHTMI
FT                   DGPTTATDLQHTQRNKQLVARFVDDILVHGRMDKLTAYFDGDRYIQHHPQIADGLSGLG
FT                   AALDAMAKVGVTMRYTKVHKVLGEGNFVLVMSEGTLGGKPTSFYDLFRVENGKIAEHWD
FT                   TVETIPARSEWKNGNGKF"
FT   gene            complement(191644..192060)
FT                   /locus_tag="Deide_3p01340"
FT   CDS_pept        complement(191644..192060)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p01340"
FT                   /product="putative transcriptional regulator, Rrf2 family"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p01340"
FT                   /db_xref="EnsemblGenomes-Tr:ACO48077"
FT                   /db_xref="InterPro:IPR000944"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C1D3J8"
FT                   /protein_id="ACO48077.1"
FT                   /translation="MNSQYAIAVHILTLISLYPHNARTSDEIAASVGVNPVVVRNVMSL
FT                   LRKAGLLDTRQGSPGARLIRPPEAITLLDVYHAVNAPELVFKLHDQPHPQCPVGGNIQA
FT                   ALTTVLGNAQQAMEDHLATVTLADIMADLVQLAL"
FT   gene            193012..193854
FT                   /locus_tag="Deide_3p01360"
FT   CDS_pept        193012..193854
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p01360"
FT                   /product="putative transcriptional regulator, IclR family"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p01360"
FT                   /db_xref="EnsemblGenomes-Tr:ACO48078"
FT                   /db_xref="GOA:C1D3J9"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C1D3J9"
FT                   /protein_id="ACO48078.1"
FT                   /translation="MVEKDPAVGSIRSVERAFTLLDALARSDRPLTLTELSNRTDMSKA
FT                   TVLRFLATLEQWALTQKVNNGYQLNVGTLPLAYAFLMNDSLNRAALPVLQRVALATQET
FT                   VTMYVRAGMERVVVQRVEGRTPFAHTLPVGQRLPLLLGAPGLVLAAAMKAADRYALLEH
FT                   HPEVVLASGERFDRPAMEARLDQVHQQGYAISRSERLSQIFAVAAPVKTADQTVKAAVG
FT                   ITAHEKRITDEQVEVLIEEVMFASRAIGEASGSWSTGHQASSPQTEVTSARSTRRRPR"
FT   gene            193864..194397
FT                   /locus_tag="Deide_3p01370"
FT   CDS_pept        193864..194397
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p01370"
FT                   /product="Hypothetical protein; putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p01370"
FT                   /db_xref="EnsemblGenomes-Tr:ACO48079"
FT                   /db_xref="GOA:C1D3K0"
FT                   /db_xref="InterPro:IPR009936"
FT                   /db_xref="UniProtKB/TrEMBL:C1D3K0"
FT                   /protein_id="ACO48079.1"
FT                   /translation="MEHTMQRYQQAAAVLFLFFAVFIVWQGLKLQYYTPLGPGSGFFAV
FT                   WLGALLGLLALMQLVQTIRPARPATPPVMDADLNAPAEVEPEQVLPDRSGVIRIAAVIG
FT                   ALILTALLLPLLGFQITAFILLIFLLLGLERVRPVTAVIIALVFSVGLFQLLTRFLSVE
FT                   LPHSSLAVLKQLGL"
FT   gene            194409..195902
FT                   /locus_tag="Deide_3p01380"
FT   CDS_pept        194409..195902
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p01380"
FT                   /product="Conserved hypothetical protein; putative membrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p01380"
FT                   /db_xref="EnsemblGenomes-Tr:ACO48080"
FT                   /db_xref="GOA:C1D3K1"
FT                   /db_xref="InterPro:IPR002823"
FT                   /db_xref="UniProtKB/TrEMBL:C1D3K1"
FT                   /protein_id="ACO48080.1"
FT                   /translation="MESFTDLLLGFSVALRWENLLYALVGSILGTLIGVLPGIGPVAGT
FT                   ALLIPLTFDMPAVGAIIMLTSLFYGTAYGGTITSVLLNVPGEAASAVTAIDGHQMAKKG
FT                   RAGAALAIAAIGSFVGGTVATIALVFAAGSLARLALNFGPVEFAALTVLGLSLLMGLAG
FT                   KSLVKGLMMGLFGLLLALVGLDPVQGLPRFTFGHLELLDGLSFVAVVMGLFGLSEIMLL
FT                   IENRLRPVVAHAMSSMMLSRQDVRDSTAPILRGSVIGTALGLVPGMTGSVSSLLSYVVE
FT                   RKSSKHPERFGTGAIEGVAGPETANNAHANGALIPLFTLGIPASPTVAVLMGAFLMKGL
FT                   VPGPLLFTEQPELVWGVIASFYVGNIILLILNLPLIGIWVRVLLIPQAILIAIILALLV
FT                   VGAYTINNSVFDIYVMLIFGVIGYLLRKLDYPIAPIILALVLGPLMERSLRQSLELSQG
FT                   SAQIFLQSPIALTFLIAAALVLLSPTFRPLLTRWQRRRA"
FT   gene            196072..197067
FT                   /locus_tag="Deide_3p01390"
FT   CDS_pept        196072..197067
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p01390"
FT                   /product="putative Bug family protein, precursor"
FT                   /note="Bordetella uptake gene bug product"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p01390"
FT                   /db_xref="EnsemblGenomes-Tr:ACO48081"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:C1D3K2"
FT                   /protein_id="ACO48081.1"
FT                   /translation="MKITPKQGLMTATALLVSLSLLSSTASSQSRKVTFPEKGKTIQII
FT                   VGFAAGGSTDVGARLLAKGLEKELGVPVVIVNRPGAGGQLGYVALTQAKPDGYTIGNTN
FT                   FPSAVVTYLDPARQATYKRNDFIPLALHVVDPGLFAVRKDSPYKSLKDVIAAAKANPGK
FT                   ITISTTGLQTDEHFAILQLEKMAGVKFAPVHFSQGIASATTALLGGKIDVFAGNVGDLL
FT                   GQYKAGEVRILGVMDDRRSPFYPNVPTFAAYGYKLENSASRGFAAPAGTPTEVVNVLSK
FT                   AIQKVASSEAHKQEMKNLGLTLRYMTPAKYRAYWSTYETDIQDLLPLSRQ"
FT   gene            197099..198094
FT                   /locus_tag="Deide_3p01400"
FT   CDS_pept        197099..198094
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p01400"
FT                   /product="putative D-isomer specific 2-hydroxyacid
FT                   dehydrogenase family, putative phosphoglycerate
FT                   dehydrogenase (D-3-phosphoglycerate dehydrogenase)"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p01400"
FT                   /db_xref="EnsemblGenomes-Tr:ACO48082"
FT                   /db_xref="GOA:C1D3K3"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR029753"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C1D3K3"
FT                   /protein_id="ACO48082.1"
FT                   /translation="MTQKVLVTSIFLHAGGEVDHLLRAEGFEPTYAPALTKRTEDELIG
FT                   LLDGVSGAIIANEPFTDRVLAAAPDLKVISRTGVGFDSIDVAAATQRGVVVCNTPNVNR
FT                   YAVAEWTLAMMLGCARHAVKNWTEMNAGGFKRFEGTELYGKTLGLAGLGGIGKEVARRA
FT                   HAFGMTLLAVEEYQDQAFAAQYGVTYVDLETALEQSDFLSLHLPLNAQTRHLINAERLA
FT                   RMKPSACLINTARGGVVDTVALAQALREGTIAAAALDVFEEEPLPADSHLHALENLLMS
FT                   PHVGGVTTEARQMSGVRAAENLILALKGQAPASPVNPEVIPTARYAVSAT"
FT   gene            198214..198909
FT                   /locus_tag="Deide_3p01410"
FT   CDS_pept        198214..198909
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p01410"
FT                   /product="putative demethylmenaquinone methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p01410"
FT                   /db_xref="EnsemblGenomes-Tr:ACO48083"
FT                   /db_xref="GOA:C1D3K4"
FT                   /db_xref="InterPro:IPR005493"
FT                   /db_xref="InterPro:IPR036704"
FT                   /db_xref="UniProtKB/TrEMBL:C1D3K4"
FT                   /protein_id="ACO48083.1"
FT                   /translation="MLIPDSPYFQNHVERTSPELVTRASGFAASILADVAGRRGTMHGR
FT                   VRALAPSMRVAGPAITVEVRPGDNLMIHAAMAIAQPGDVLVIDGKGDQTCALMGEIMIS
FT                   QCMALGLAGVIIDAAVRDSAEIQALGFPVFSVGTNPNGPTKFVPGRVNHTISAGGVTVR
FT                   PGDLVVADADGVFVAEREQVEALLPLAQKKVDSESARLQDIRSGRNLTPGWLAAALAAA
FT                   GVLEETATA"
FT   gene            199048..199605
FT                   /locus_tag="Deide_3p01420"
FT   CDS_pept        199048..199605
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p01420"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p01420"
FT                   /db_xref="EnsemblGenomes-Tr:ACO48084"
FT                   /db_xref="UniProtKB/TrEMBL:C1D3K5"
FT                   /protein_id="ACO48084.1"
FT                   /translation="MSPEAPQGHGPNEVQLLLCQRLRAEELLEVNTVAVRLGLLPVEVQ
FT                   ERIHLGKLPAVRMGGKLYVQQDDLTFYVDQLEHPPGLMAAWTWATATVHLAGTLDDLQE
FT                   RLPERLRCLRKELLGPLQPFAERVKEYLKGGRYGAVALHVRGAERMVLAFERAHGPLSV
FT                   EMRHTVAPRSVTSHPCEDDQPG"
FT   gene            complement(199741..200478)
FT                   /locus_tag="Deide_3p01430"
FT   CDS_pept        complement(199741..200478)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p01430"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p01430"
FT                   /db_xref="EnsemblGenomes-Tr:ACO48085"
FT                   /db_xref="UniProtKB/TrEMBL:C1D3K6"
FT                   /protein_id="ACO48085.1"
FT                   /translation="MDLRLLLNANTTLIHQELARVGAPLPAPAPRLVDTPGWAHTTCDE
FT                   QATIVTTFATHSERLCARCGYCAFYTADGQWLGHHGGNGLIILRRPDYARDIVLSDFAD
FT                   EQMHLHTLRHLATERNLPYSLIVMSQRQVEPNVFRRETLGGALTDLDDTPLRQYLMTFR
FT                   GRVEQAWAEWRHEVFGRLSLPVPLHPGEVVVSDWSGEEEGALDDGRLYTLYASVENDPH
FT                   HPWLALSLSGDQREWRPRQRTSG"
FT   gene            complement(200984..201406)
FT                   /locus_tag="Deide_3p01440"
FT   CDS_pept        complement(200984..201406)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p01440"
FT                   /product="putative PaaI thioesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p01440"
FT                   /db_xref="EnsemblGenomes-Tr:ACO48086"
FT                   /db_xref="InterPro:IPR003736"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:C1D3K7"
FT                   /protein_id="ACO48086.1"
FT                   /translation="MTLSLAEFTEQARGALPDHLGIEFLEASGERVVARMPVERRVHQP
FT                   FGVLHGGASVALAETVASLGAHLSVAERGMTAVGMEINANHLRAVRSGVVTATATPVHQ
FT                   GRTTQVWQIEIVDEQDRGVCVSRCTLAVIPVPPQGS"
FT   gene            complement(201403..201978)
FT                   /locus_tag="Deide_3p01450"
FT   CDS_pept        complement(201403..201978)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p01450"
FT                   /product="putative PaaI thioesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p01450"
FT                   /db_xref="EnsemblGenomes-Tr:ACO48087"
FT                   /db_xref="InterPro:IPR003736"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:C1D3K8"
FT                   /protein_id="ACO48087.1"
FT                   /translation="MTHPTTPDPVSPPTPLHNGPLQGDRVRTYTWEDPLVGAEAARHIS
FT                   GLDYLRAMVRGEFPGPPIAASLDFSLALEDDIEDGRVTFRMTPQEFHYNPIGSVHGGVY
FT                   ATLLDSALGCAIHTRLPAGVGYTTLELKVNYLRPLLVGMGEVRAVGEVLSVSRQVATAH
FT                   AKLLDANDRLCAHATTTCLILRPQRSAP"
FT   gene            202277..202885
FT                   /locus_tag="Deide_3p01460"
FT   CDS_pept        202277..202885
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p01460"
FT                   /product="putative transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p01460"
FT                   /db_xref="EnsemblGenomes-Tr:ACO48088"
FT                   /db_xref="GOA:C1D3K9"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:C1D3K9"
FT                   /protein_id="ACO48088.1"
FT                   /translation="MARYRSDHAQETREKILNAATLAFKADGLNTVGIGRLMGKAGLTH
FT                   GGFYAHFPSKDALVQETLARSLQKTARNLLQAATDTPPYGLGGVIRSYVSRQHRDRPAA
FT                   EGSCVLPALAAEVARQSPDVRQAVTETIAVLIDELSALSQAGDPAAQRAEVLPILSGMV
FT                   GAILLSRAVSDPDLSDAILKTTRDHLMGQLLPGNAHDRG"
FT   gene            202872..204311
FT                   /locus_tag="Deide_3p01470"
FT   CDS_pept        202872..204311
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p01470"
FT                   /product="putative major facilitator superfamily; putative
FT                   membrane family"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p01470"
FT                   /db_xref="EnsemblGenomes-Tr:ACO48089"
FT                   /db_xref="GOA:C1D3L0"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C1D3L0"
FT                   /protein_id="ACO48089.1"
FT                   /translation="MTAGNRLIQRSTLIASSLAVVVVMLNVAAVNPALPSLQQAFQTST
FT                   TDLQWVVNVYNIVFAALLLVGGLLGARLGFRRVLLGGLALGAFGAVLTALAPSYAVVLL
FT                   GRGITGVGASLVQPATLVLLTLAFSDPAARARAIGLWAGVSGLGIAVGPVLGGVLVDAF
FT                   GWTAVFWTLVLAGAVTWAASLWGTRESPRFAARRVDLPGLLLVVLTLGSLIYGLTQGNG
FT                   LGWGSPLVLGCLLGAGVLFALFLWVEGREQHPLVDLGLFRNLTFTASNLGGLLIFFGPF
FT                   SLLVFFTLLLQGVMRYSATRAGLIIVFFPLGAALGSVLGGHLTARRGTRLTATLGLGLI
FT                   GLATLVLVRVSLRTTGWDLWWNFAVMGLGVGLSLGALTTAAMASAPRDQMSQASSLLSA
FT                   LRQVGAALGIALLGAVIALHPGEDEAAFLGGLRDALWLAGGVLLLSAPAVWWAMGRPEG
FT                   EGRPAGGTLTAPVQDAASQEG"
FT   gene            complement(204859..205860)
FT                   /locus_tag="Deide_3p01480"
FT   CDS_pept        complement(204859..205860)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p01480"
FT                   /product="putative sugar ABC transporter, periplasmic
FT                   component, putative rhamnose-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p01480"
FT                   /db_xref="EnsemblGenomes-Tr:ACO48090"
FT                   /db_xref="GOA:C1D3L1"
FT                   /db_xref="InterPro:IPR013459"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="InterPro:IPR030159"
FT                   /db_xref="UniProtKB/TrEMBL:C1D3L1"
FT                   /protein_id="ACO48090.1"
FT                   /translation="MKHRTVLLAALTLTLGAAAVATAQGTLKKGITIAFLPKQVNNPYF
FT                   TTAWKGGQAAIKEIAGVGKQVGPSDAGASSQVSYINTLLAQRQNAIVVSASDTNALVPY
FT                   LKRAMQQGVKVVTYDSDVAVGGRHVFVSQASADTIARDQVKILAKQIGSKGEIAILSAT
FT                   PNATNQNAWIKVMQEELQKPQYKDMKLVKIAYGNDDDQKSFTEMQGMMQAYPNLKGVIS
FT                   PTTVGISAAARYLSGSPYKGKVALTGLGTPNQMRAFVKNGTVQGFALWNPEELGYLASY
FT                   AAAALVSGQITGKEGEKFSAGKLGQRTIGKDGVVILGPLTVFDKANIDKFNF"
FT   gene            complement(205933..206937)
FT                   /locus_tag="Deide_3p01490"
FT   CDS_pept        complement(205933..206937)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p01490"
FT                   /product="putative ribose/xylose/arabinose/galactoside ABC
FT                   transporter, permease component"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p01490"
FT                   /db_xref="EnsemblGenomes-Tr:ACO48091"
FT                   /db_xref="GOA:C1D3L2"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:C1D3L2"
FT                   /protein_id="ACO48091.1"
FT                   /translation="MSVPNRPRRSLLGWESTILALVVVALLMGSALHDAFLTGPNLSNL
FT                   TSNLVEIALIALTMTLVVIAAEIDLSVASIVGMCSALLGVLWAAQVPMPLAILATLTLG
FT                   ALAGFLNGWLVTRLGLPSLAVTIGTLALYRGLAYALLGDRAVADFPPFWTNLGFGLVPG
FT                   TQIPIPAVAFVLLAIITAVVLHATPFGRSLYAIGANEVAARFAGLRVERTKLLLFILSG
FT                   LMSAFAAVIYTFRFSSARADNAAGLELAVIAAVLLGGVSIFGGRGSVIGVIAAVFLIGI
FT                   IQNALTLADVPNEILTIVTGLLLILSVLGPNLAARFKTARQQRLNTQPQGGTL"
FT   gene            complement(206934..207959)
FT                   /locus_tag="Deide_3p01500"
FT   CDS_pept        complement(206934..207959)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p01500"
FT                   /product="putative ribose/xylose/arabinose/galactoside ABC
FT                   transporter, permease component"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p01500"
FT                   /db_xref="EnsemblGenomes-Tr:ACO48092"
FT                   /db_xref="GOA:C1D3L3"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:C1D3L3"
FT                   /protein_id="ACO48092.2"
FT                   /translation="MTGLSTPGTASTPPPNLLSRLFRAREASLILILLALVAMTTAINP
FT                   RFLTPQSMRDLALNVAIIGLVVVGQTLVLLMKHVDLSVSSTLGLTAFLTGSLFVANPSM
FT                   PIGLAFVAGVGIGALLGAVNGLLVAYGKVPALVATLGTLYVFRGVDYAVVQGGQITASN
FT                   LPAAFSSFASSSVLGVPSLVLLVLVVMALFSIYLRSYRAGREYYAVGSNVEAASLAGIN
FT                   VSRRVMTGFILSGAIAGLAGVLYLARYGTVDAAAGTGLELQVIAAAVVGGVAITGGVGT
FT                   IAGAGIGALLLGVIGSALVALRAPAFWQQAIQGALLLLAISIDIVVARRAARVMQERSH
FT                   R"
FT   gene            complement(207959..208996)
FT                   /locus_tag="Deide_3p01501"
FT   CDS_pept        complement(207959..208996)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p01501"
FT                   /product="putative sugar ABC transporter, ATP-binding
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p01501"
FT                   /db_xref="EnsemblGenomes-Tr:ACO48093"
FT                   /db_xref="GOA:C1D3L4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C1D3L4"
FT                   /protein_id="ACO48093.1"
FT                   /translation="MDEPTAALTGQETERLFRVVRALRARGAAVLFITHRLEEAFAECQ
FT                   RFTIMRDGRWVSSGPALEYTIDSVVRGMVGRDVSELYPKIPVTPGDIALDVRGLTRRGV
FT                   FRDVSFQVRRGEIVGLAGLVGAGRSEVARVIFGIDPRDAGEVRVQGHPVPAGSTGAAMQ
FT                   AGIGLVPEDRRQQGLVMDMSIERNATLAILGRLRRGPLMDRAREYQTASDWTSKLQLKA
FT                   HRLTDAVSTLSGGNQQKVVLAKWLATGPAVLIVDEPTRGVDVGAKAEVHRTLAQLAAEG
FT                   LAVVMISSDLPEVLGMADRILVMREGELVGELPRQDASEEAVMYLATGQGTPTPARQTA
FT                   VGGVA"
FT   gene            complement(208842..209495)
FT                   /locus_tag="Deide_3p01510"
FT   CDS_pept        complement(208842..209495)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p01510"
FT                   /product="putative sugar ABC transporter, ATP-binding
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p01510"
FT                   /db_xref="EnsemblGenomes-Tr:ACO48094"
FT                   /db_xref="GOA:C1D3L5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C1D3L5"
FT                   /protein_id="ACO48094.1"
FT                   /translation="MTDQPILALHHASKSFGPVQALVDVSLELYGGEAHALLGENGAGK
FT                   STLVKILAGVHRADGGELLLEGQPRTFYNTAEARDAGIAIIYQEPTLFADLTVAENVLM
FT                   GRQPLKSGGRIDRRAMLSTVGEILRDLGVPLDPARPVRGLSIADQQIVEIAKAPVLPGA
FT                   RADHGRTDRSPDRSGNRTALPRCPRPARPWGSRSVHHSPAGGSLCGMPALHNHA"
FT   gene            complement(209488..209829)
FT                   /locus_tag="Deide_3p01520"
FT   CDS_pept        complement(209488..209829)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p01520"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p01520"
FT                   /db_xref="EnsemblGenomes-Tr:ACO48095"
FT                   /db_xref="GOA:C1D3L6"
FT                   /db_xref="InterPro:IPR008000"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:C1D3L6"
FT                   /protein_id="ACO48095.1"
FT                   /translation="MPTPAPPLHRVCFLLQVRPDRLTEYKTHHQAVWPDMLQALRETGW
FT                   HNYSLFLRGDGLLVGYFETPDLAAAQQGMAGREVNARWQATMAPYFEALNGKNPDEGFL
FT                   QLEEVFHLD"
FT   gene            209951..210736
FT                   /locus_tag="Deide_3p01530"
FT   CDS_pept        209951..210736
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p01530"
FT                   /product="putative transcriptional regulator, DeoR family"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p01530"
FT                   /db_xref="EnsemblGenomes-Tr:ACO48096"
FT                   /db_xref="GOA:C1D3L7"
FT                   /db_xref="InterPro:IPR001034"
FT                   /db_xref="InterPro:IPR014036"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:C1D3L7"
FT                   /protein_id="ACO48096.1"
FT                   /translation="MTTDTPKVSSERQHQILRRALADRVVKIKDLSAELGVHEMTVRRD
FT                   IDQLAEQGLLERIHGGARIVEKTSEEVAHQLRATKNTEAKEAIARAALNLIEDGDVVAL
FT                   DASTTALALARLLHARNVSAIVSGLDAANVLAANGVPFLMVGGNFHAPARSFVGAFFMD
FT                   TMTRLHPDKVFFSAKAFSPDTGFTDPHLPEVGAKQTLIRSAGTVIALLDSTKFERRALA
FT                   TIATLDEVDVLITDQTPSERTLSALEAADIQLTMTQETP"
FT   gene            210733..211923
FT                   /locus_tag="Deide_3p01540"
FT   CDS_pept        210733..211923
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p01540"
FT                   /product="putative sugar isomerase, putative L-rhamnose
FT                   isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p01540"
FT                   /db_xref="EnsemblGenomes-Tr:ACO48097"
FT                   /db_xref="GOA:C1D3L8"
FT                   /db_xref="InterPro:IPR013457"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:C1D3L8"
FT                   /protein_id="ACO48097.1"
FT                   /translation="MNTSTLFQALDQQRIETPSWGYGNSGTRFKTFTSAGAARDVYEKI
FT                   EDAAEVHRLTGIAPSVALHIPWDEVADYSELRRFAEGRGVALGAINPNVFQDDAYKLGS
FT                   IAHPDAGVRAQAVDHLLDCVAIMKQTGSRDLSLWFADGTNYAGQDDLRARKRRVREALA
FT                   QVHDALPEGSRMLVEYKLFEPAFYATDLFDWGAAYAHCLAIGEKAQVLVDLGHHAQSVN
FT                   IEQIVAFLLDEGRLGGFHFNARRYADDDLIVGTTNPFELFCIYAELVAAQRSEDDLTRS
FT                   TAQNTAYMIDQSHNIEPKVEAMVQSVLNCQDAYAKSLLIDRERLAAAQQTGDVLEAHRT
FT                   LTDAFRTDVRPLLADWRRARGLPEDPIATHRASGYQQGAARKRGTASAGGGFPVKS"
FT   gene            211998..214082
FT                   /locus_tag="Deide_3p01550"
FT   CDS_pept        211998..214082
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p01550"
FT                   /product="putative bifunctional protein :
FT                   rhamnulose-1-phosphate aldolase; alcohol dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p01550"
FT                   /db_xref="EnsemblGenomes-Tr:ACO48098"
FT                   /db_xref="InterPro:IPR001303"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR013454"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036409"
FT                   /db_xref="UniProtKB/TrEMBL:C1D3L9"
FT                   /protein_id="ACO48098.1"
FT                   /translation="MTTTQAKTTITNRWNDAEAPQSDGLAALTYRSNLLGADRTLVNIY
FT                   GGNTSTKSVEKDHLGRDVTVLWVKGSGSDIASITEKGFAGLKLDEVLPLFDRPEMTDED
FT                   MTAYLERTTFEPGRPRQSIETLLHAFVPAKHVDHTHPDAIIAIACTPNGPDIMREIYGE
FT                   RAAWVDYIRPGFTLSQQIGAAVRNNPNLEAVVMGKHGLVTWGDTAKESYETTLRIIGEA
FT                   QAYLDARQEAQPFGGQRVASLPEEAANTLLAAVLPVLRGAMKGARPVILNVDRSPEVME
FT                   FVNSKAAAELSQVGAACPDHLVHTKRTPLFLNWTPEQGKDALLTAARDGVEQFKAEYAA
FT                   YFEENKGAGDVMFTPSPRVVLIPGLGMVNSGPDAQGADVSRQLYLRAIQVMKSASSLGG
FT                   FVSLTAAESYAVEYWPLELYKLAQKPAPKVLEGHVALVTGAASGIGRAIARRLAQDGAH
FT                   VVIADLNAEGGQQVAQEIIQERGYQRAASTGMNVTSEEQVQAAYQTAILQYGGVDIVVN
FT                   NAGIASSAPIEETSLEMWNKNQSILSTGYFLVAREAFKVLKAQNTGGNLVFIGSKNSLA
FT                   AGKNAAAYSTAKAAEIHLARCLAEEGGAHGIRVNSVLPDSVLSGSAIWDGKWRSERAAT
FT                   YGIREDQLEDFYRQRNTLKVNILPEDIAEATFYFATPAASKTTGGILTVDGGVPIAYVR
FT                   "
FT   gene            214072..215565
FT                   /gene="rhaB"
FT                   /locus_tag="Deide_3p01560"
FT   CDS_pept        214072..215565
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rhaB"
FT                   /locus_tag="Deide_3p01560"
FT                   /product="putative rhamnulokinase"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p01560"
FT                   /db_xref="EnsemblGenomes-Tr:ACO48099"
FT                   /db_xref="GOA:C1D3M0"
FT                   /db_xref="InterPro:IPR000577"
FT                   /db_xref="InterPro:IPR013449"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniProtKB/TrEMBL:C1D3M0"
FT                   /protein_id="ACO48099.1"
FT                   /translation="MSAEATLTDVKRHVAIDLGASSGRVALGTVHAGKLTVEVLHRFPN
FT                   GGIPVQGGLYWDVLGLWREILHGLRLAAGHGPIDSVGVDSWAVDYALIDEHGLLIDGVR
FT                   HYRDARTDGVMDQLLGVLPRDAVYEFTGIQFLPFNTAFQLVAHRQQAPTQLDRARTLLM
FT                   VPDLLHYWLTGRQVTEMTNASTTQLYDSRQTAWSEPVLNAFGIPAHLLPDVVHPGTDLG
FT                   AVQPDVARDTGLHGTRVIAPGTHDTASAVAAVPADGKGWAYLSSGTWSLVGVETDRPVI
FT                   TPQALALNLTNEAGVHGTTRLLKNVMGLWIAQECSRAWGNPSFAELYGAAALVEANGPL
FT                   IDPDDVRFLPPGLDMPARVQAYCAETGQVVPSTPAEITRCVLESLAFRCAEVLSQLEEV
FT                   TGESIHTLHVVGGGSQIRFLNQLLADISGRTVVAGPVEATLLGNLLVQAEACGSIPRGS
FT                   MREVSRICEILTTYTPVKKRTVTQHTIFAELTTRHAAST"
FT   gene            215595..216338
FT                   /locus_tag="Deide_3p01570"
FT   CDS_pept        215595..216338
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p01570"
FT                   /product="putative Fe-S oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p01570"
FT                   /db_xref="EnsemblGenomes-Tr:ACO48100"
FT                   /db_xref="InterPro:IPR004017"
FT                   /db_xref="UniProtKB/TrEMBL:C1D3M1"
FT                   /protein_id="ACO48100.1"
FT                   /translation="MRIDLFITCLNDAMFPRTGEATVKLLERLGHEVHFNDRQTCCGQM
FT                   HFNSGYQGEALGLVRHFVDTFQDADVVVAPSGSCVGMVRDLYPKAAEWAGDRELLDAVT
FT                   ALAPRVFELSEFLVKHQGIEDVGAYYPHRVTYHQTCHAMRVLRVGDAPLRLLQKVRGLS
FT                   LVGLPAVEQCCGFGGTFSVKNAETSTAMLADKVQNVMSTKAEACTAGDNSCLMHIGGGL
FT                   SRLQSGTRTVHLAEILASTEQEVFA"
FT   gene            216335..217837
FT                   /locus_tag="Deide_3p01580"
FT   CDS_pept        216335..217837
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p01580"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p01580"
FT                   /db_xref="EnsemblGenomes-Tr:ACO48101"
FT                   /db_xref="GOA:C1D3M2"
FT                   /db_xref="InterPro:IPR003741"
FT                   /db_xref="InterPro:IPR004452"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR024185"
FT                   /db_xref="InterPro:IPR024569"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:C1D3M2"
FT                   /protein_id="ACO48101.1"
FT                   /translation="MSAGGIKPAKPFQDAARVTLANPQMRRNLRHATTTIRDKRQRAVD
FT                   ELPDWEALRDEGAAIKDHVMANLSEYLLELEASVKARGGHVHWARDAEEARELVAGIAA
FT                   SHGAREIIKVKSISTDEIELNAALERHGIHAIETDLAELIVQLAEDRPSHILVPAIHRN
FT                   RAEIRDLFRRKLGAELLTDEPKVLAEAARVYLREKFLTTKVAVSGANFAVADSGTVCIV
FT                   ESEGNGRMCLTMPDVLISVMGIEKVLPTWEDLAVFMRLLPRSSTAERMNPYTSFWSGVT
FT                   SGDGPQEFHLVLLDNGRTDVLADEVGRQTLRCIRCSACLNVCPVYERAGGHAYGSVYPG
FT                   PIGAILTPQLLHLEDKHANTLPWASTLCGACYDACPVKINIPEVLLYLRGKITDDKPLN
FT                   SEAVAFKTAAWVMSEPFRFEGALKLARKGQGPLVKHGAIHALPGMLAGWTDSRDLPPLA
FT                   GQSFREWWRTRPAPEIHATDGNAQASQGEPIAPQRTDEQGPI"
FT   gene            217834..218463
FT                   /locus_tag="Deide_3p01590"
FT   CDS_pept        217834..218463
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p01590"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p01590"
FT                   /db_xref="EnsemblGenomes-Tr:ACO48102"
FT                   /db_xref="InterPro:IPR003741"
FT                   /db_xref="InterPro:IPR024185"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:C1D3M3"
FT                   /protein_id="ACO48102.1"
FT                   /translation="MSSEARLDILTRINRIGAQESQSFKRAPLRPSDRAHDVVVEQFAK
FT                   FAAEYRANVMRLSIDQLPQVISDRLSARGSARVVVPHDLPQDWLPTRLSVTRDNTGGTD
FT                   LTSFDAVITAAAVGIAETGTVVLDHGSGQGRRALTLVPDHHICLVRERQVVDSIPEAVA
FT                   LLQHAVQRGQPLTWISGPSATSDIELSRVEGVHGPRILDLLLVRDT"
FT   gene            218580..218930
FT                   /locus_tag="Deide_3p01600"
FT   CDS_pept        218580..218930
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p01600"
FT                   /product="Hypothetical protein; putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p01600"
FT                   /db_xref="EnsemblGenomes-Tr:ACO48103"
FT                   /db_xref="GOA:C1D3M4"
FT                   /db_xref="InterPro:IPR003445"
FT                   /db_xref="UniProtKB/TrEMBL:C1D3M4"
FT                   /protein_id="ACO48103.1"
FT                   /translation="MFHSVSAFNNAGFGLYPDNMIRFAEDPLVLLTTSTLVILGGLGYL
FT                   AVLGVALYLRDPHRNRLSLNTIIILVTSASLVVLRTVVAGEQQHRGGGDSALRYKGAPT
FT                   GRAGCGLRIVHQ"
FT   gene            complement(219062..219775)
FT                   /locus_tag="Deide_3p01610"
FT   CDS_pept        complement(219062..219775)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p01610"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p01610"
FT                   /db_xref="EnsemblGenomes-Tr:ACO48104"
FT                   /db_xref="GOA:C1D3M5"
FT                   /db_xref="InterPro:IPR008567"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:C1D3M5"
FT                   /protein_id="ACO48104.2"
FT                   /translation="MFIQACLNGNRRLDEHPAVPIGANELARDAQAARVAGASAVHIHP
FT                   RASCGRPSLDAKSVASAVSAIRLVCPGLPIGVSTTQEIDENLNRRVGTICAWSVLPDFA
FT                   SVNFWEAGATEIARSLRDRGVGIEAGVSTPADVNAFLSSGLQGRCVRVLIEVLWETNVE
FT                   AALVTADHLLSLLSAANVAEPRLVHGEDATAWPLLRWGSARGQQVRMGFEDVLTLPGGG
FT                   YTSSNTDLIRAAFMN"
FT   gene            complement(219870..220721)
FT                   /locus_tag="Deide_3p01620"
FT   CDS_pept        complement(219870..220721)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p01620"
FT                   /product="putative endonuclease IV-like and Xylose
FT                   isomerase-like TIM barrel protein"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p01620"
FT                   /db_xref="EnsemblGenomes-Tr:ACO48105"
FT                   /db_xref="GOA:C1D3M6"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:C1D3M6"
FT                   /protein_id="ACO48105.1"
FT                   /translation="MTITAPTTRHARSVHTLPLLGAAMPSAHLAAHREWLWEGRDLELQ
FT                   DPVSHLVLDGDWRTHAQNIRRDLDGFTGRLGIHGPFWGLTVMAQDPAVRRLTSARLRGG
FT                   LAMASEIGATHMVVHSPFDFFGHPLVAHTGVTGLDDQLEQVHETLREVVDEARQIGCML
FT                   VIENIRDLNPAPLLALVSSFDSGTVQISIDVGHAALMQAKGGPSPDHWIREAGRRLGHV
FT                   HLQDTDGLLDRHWKPGDGSINWRMVFRALREVQADPRLILELKPEEITAGQQWLVQEGL
FT                   AR"
FT   gene            complement(220718..222136)
FT                   /locus_tag="Deide_3p01630"
FT   CDS_pept        complement(220718..222136)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p01630"
FT                   /product="putative PHP-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p01630"
FT                   /db_xref="EnsemblGenomes-Tr:ACO48106"
FT                   /db_xref="GOA:C1D3M7"
FT                   /db_xref="InterPro:IPR003141"
FT                   /db_xref="InterPro:IPR016195"
FT                   /db_xref="UniProtKB/TrEMBL:C1D3M7"
FT                   /protein_id="ACO48106.1"
FT                   /translation="MTTIAPTSESLLSVRGQVSPVLHVPYLYHEFEVPDGATTLTVSLR
FT                   FHKKRRCQLFLSVFGPMNYRGTRMNPGGVGDIHLELTFGAHSASPGALAGLIEPGRWRA
FT                   QIDVESTEETAEYFLTVAAGFGESPTQTSPDPVTVNGRPGAGWYRGELHAHTHHSDGRP
FT                   TPGELAGAARRAGLDFVALTDHFTPAGWAEIDHHAGPDLAVIHSLELTGHRGHANLHGL
FT                   NGWVDVFVDDPAKEWTVNDVARGVRDQGGVFCVNHAFSNSLGWQYHEFDWSLCGAFEIY
FT                   HHLEGPNNAAQLIFWDGLLRAGHRITGVAGTDSHDPLAGRHRLGQVTTVINARNLTPAG
FT                   LIDGVRKHRAYVSLGPELTFAAECGGERADMGGELVLPGGHASPCRVRLLVEVGNLAHP
FT                   TRLFVMKNGLYHTHLDLAASAAPVQLEVLDPNPGPGYYRLEAYARAPQSGFSGGREWQN
FT                   TLLLSNPIFIRGES"
FT   gene            complement(222192..223406)
FT                   /locus_tag="Deide_3p01640"
FT   CDS_pept        complement(222192..223406)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p01640"
FT                   /product="putative sugar ABC transporter, periplasmic
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p01640"
FT                   /db_xref="EnsemblGenomes-Tr:ACO48107"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:C1D3M8"
FT                   /protein_id="ACO48107.1"
FT                   /translation="MHRTLITLSTVLLLGSTASAKTEVTMMYGLGGELGKAIESMIKEF
FT                   NASQNDVVVRGEFANTYEGVVQKALAGIAAGQPAADILQLEVSYVPRIAESGALANLKT
FT                   MPGFQKSFDNFWPVFKKQVGRPDGAVYAMPWNNSNPVLYYNPALLKKAGLSKPPRTYTE
FT                   LREASKKIKAATGMSAIALPSFPWVLEGAIWSNGGEMIKDGRLALDQPKAREVIEHWAG
FT                   FFRDGTAVLQDSNTNADFAAGKVAMVMNSVASRPSLTAAVPFKFGTAPLPYYKKAVVPV
FT                   GGATLAISKNITKERQAAAWAFINWLAQPQQQFTWIKKSNYVPVTRATSDLAVFRKYMG
FT                   TSAGLDLGYRQLPFARPRPSSAGYVQGTQEIIKSLDRIFLQNAPVEATLKDLVQRTAPL
FT                   FKDSK"
FT   gene            complement(223478..224296)
FT                   /locus_tag="Deide_3p01650"
FT   CDS_pept        complement(223478..224296)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p01650"
FT                   /product="putative sugar ABC transporter, permease
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p01650"
FT                   /db_xref="EnsemblGenomes-Tr:ACO48108"
FT                   /db_xref="GOA:C1D3M9"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C1D3M9"
FT                   /protein_id="ACO48108.1"
FT                   /translation="MRTPWTTRAAQELLSLVVTLVFLMPLVWMLLAAFKGRKAVYTGPL
FT                   LPETWVWQNFVEAWNSAPFGQYLLNSLLIASLTTILVVITSALAAFAFARLNFPGKPVL
FT                   FLFALGTLMIPGDALLIPNFITIREFGWINSYQALIAPFAASAFGVFLLRQAFLRTPAE
FT                   LEEAARLDGATALQYLCYVLLPVNGATVSALGVLTFLGSWNALVWPLVATNRDEFRTVQ
FT                   VGLASFSNLEGSNLPLVMAATVIVIAPVLIVYALAQKWFIESAAASGLKG"
FT   gene            complement(224293..225138)
FT                   /locus_tag="Deide_3p01660"
FT   CDS_pept        complement(224293..225138)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p01660"
FT                   /product="putative multiple sugar ABC transporter, permease
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p01660"
FT                   /db_xref="EnsemblGenomes-Tr:ACO48109"
FT                   /db_xref="GOA:C1D3N0"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C1D3N0"
FT                   /protein_id="ACO48109.1"
FT                   /translation="MAYLLPALLVFSLFTYYPLARVIYLSFTDSDMLKSSPSFIGLHNY
FT                   QQMVGSREFWSSLWITALFALGVTILEVVLGMALAFLMSARTRLQGLLRGAVFTPVVVS
FT                   IAATAVVWHYLLNPASGPVNRLLEAIGLPGPGWLSDPRTALASVILVAVWKGVGLPAVL
FT                   FLSGLQAISRELEEAAAIDGATRAQIARHVTVPLLAPTTMVVFFISLVGTFQSYGLVLL
FT                   LTQGGPAGSTNLLGYHIYQNAFSFFQMGFASALSVALFLLLMLLGFLHLRVAERRVHYQ
FT                   "
FT   gene            225555..226391
FT                   /locus_tag="Deide_3p01661"
FT   CDS_pept        225555..226391
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p01661"
FT                   /product="putative hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p01661"
FT                   /db_xref="EnsemblGenomes-Tr:ACO48110"
FT                   /db_xref="GOA:C1D3N1"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:C1D3N1"
FT                   /protein_id="ACO48110.1"
FT                   /translation="MLFAFDLDGTIVTKGNVLPPAIRDAILALRQEGHQVTILTGRHRT
FT                   GARMALDALGVVCHYGTCNGARVHGHGDEHHVELHLEPETVSYLLERFTHDSKAEFYLS
FT                   GRERMFVRDPDTDQWAQARVEGRDLRPAGDYDGEPAHKFILISEHAGQVQDELAERFPE
FT                   NAYYLWEGRYLEVMAPGGHKGNALARIAHEYGIHRSETVAFGDGPNDLEMLRWAGRSIG
FT                   VGQLAAGVSDVIDEHVSGPDELGVARWLTQEILGRSGKRQDHGIRPSMPLNAGNCS"
FT   gene            complement(226672..227568)
FT                   /locus_tag="Deide_3p01670"
FT   CDS_pept        complement(226672..227568)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p01670"
FT                   /product="putative prolyl aminopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p01670"
FT                   /db_xref="EnsemblGenomes-Tr:ACO48111"
FT                   /db_xref="GOA:C1D3N2"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C1D3N2"
FT                   /protein_id="ACO48111.1"
FT                   /translation="MSMTPGDHTFTTDGLNLAYRVAGRGEALVVQPPGWGIGAGLYERS
FT                   FGPLERHFTVVYLHPRGSGRSQSPSNPEDINVGRFIEDLDALRSHLGLETIRLIGHSHG
FT                   GYIALNYALRYPRHLSHLVVVDAQLGVKEPGEDMQRTLPVLALDPRCAEAVKAFSGPLD
FT                   LKTDEDVSVFLHRIAPLYFRDPEGEGAAMFREYARSNRISLVTSQAAGASDGRFLVRDR
FT                   LGEITVPTLVLVGRHDFICSPVQADIIHDGIQGSQLEVFEDSGHLPWMEEPEPYFDTVT
FT                   QFLHGERRLGSATHSAC"
FT   gene            228273..229181
FT                   /locus_tag="Deide_3p01680"
FT   CDS_pept        228273..229181
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p01680"
FT                   /product="Hypothetical protein, precursor"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p01680"
FT                   /db_xref="EnsemblGenomes-Tr:ACO48113"
FT                   /db_xref="UniProtKB/TrEMBL:C1D3N4"
FT                   /protein_id="ACO48113.1"
FT                   /translation="MKTPAPLLTLVLCTFALAQPGPTGSSSLLRLPLTPGAVRVTDPAA
FT                   TREFGLLLNTVAAGQGSGCQTSEYLAWNDADLAEQISDNLAAQLKARAISFKGLDEEED
FT                   EESYWLSFLLTEKQTRYVGVLYGDNESVVLGWCQLKAKVTVKPETPAPAKPAVPGPPKP
FT                   AVVVQAPAPVPQRTTGAALAGDYVCLSGGAPELSVAGPVSQAPVDPAAAQIRSYANASK
FT                   YRLSANGAWGDLTFGEKYVNQKGYKGTYRILANGDVDLLSDPGSRLYLFRPIPTTDRRL
FT                   ALVEVHQPADRYKAQFCTRVD"
FT   gene            229301..230281
FT                   /gene="tal"
FT                   /locus_tag="Deide_3p01690"
FT   CDS_pept        229301..230281
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tal"
FT                   /locus_tag="Deide_3p01690"
FT                   /product="putative transaldolase"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p01690"
FT                   /db_xref="EnsemblGenomes-Tr:ACO48114"
FT                   /db_xref="GOA:C1D3N5"
FT                   /db_xref="InterPro:IPR001585"
FT                   /db_xref="InterPro:IPR004730"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018225"
FT                   /db_xref="UniProtKB/TrEMBL:C1D3N5"
FT                   /protein_id="ACO48114.1"
FT                   /translation="MTSKLEQLRTHSVVVADTGDLTAIAQFRPRDCTTNPSLILKTAQQ
FT                   PESAALVREVVAQAARDGDDIEVVLDKLAVRIGVELTRLVPGDVSTEVDAQLSFDTDAM
FT                   VTKARRLIALYETQGVGRERVLIKLAATWEGIRAAEVLEREGIRCNLTLVFSLEQAIAC
FT                   AQAGAFLISPFVGRITDWYKKAEGRDAYPVDEDPGVRSVRTIYTHFKTHGYRTVVMGAS
FT                   FRNAAQVEALAGCDRLTVSPTLLAELDADHGPLHRQLNAPTQRTEDAQEPLTEAAFRWA
FT                   LVDNQMAGEKLTEGIRQFHQDYLQLHTDIAAQLKAHPTPAAVPAG"
FT   gene            complement(230415..232775)
FT                   /gene="iam"
FT                   /locus_tag="Deide_3p01700"
FT   CDS_pept        complement(230415..232775)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="iam"
FT                   /locus_tag="Deide_3p01700"
FT                   /product="putative isoamylase, precursor"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p01700"
FT                   /db_xref="EnsemblGenomes-Tr:ACO48115"
FT                   /db_xref="GOA:C1D3N6"
FT                   /db_xref="InterPro:IPR004193"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:C1D3N6"
FT                   /protein_id="ACO48115.1"
FT                   /translation="MRHVALLALALLVTACGTTPDTTRTVLSTQALSPTSLGARYTDST
FT                   GSATGTTHITFRVYSANASRMEVNLYAQRAGADEKVRYTLTKNTTTNVWSVTVPVSTLS
FT                   STYGITGPVYYGYRAWGPNWPYSSSWTKGSTAGFVSDVDSSGNRFNPNKLLIDPYALEI
FT                   SHDPISPASGNYSNAVYASGATHRAKDSGRVASKGIVLASDTTSFGTKPTRALKDDVIY
FT                   EVHLRGLTRGDSGVSCAGTYAGAAARASALQALGVTAVEFLPVQETDNDANDATDTATG
FT                   RSSTSTSGDNYWGYMTVNYFAPDRRYSCDQSAGGPTKEFKAMVKAYHDRGIKVFVDVVY
FT                   NHTAEGGTWSGTDATTSTLYSWRGLDNATYYSLTSDRQFFWDNTGIGANYNTFNPAAQN
FT                   LIVNSLNYWRTELGVDGFRFDLASVLGNTCTHGCFNYDKLNSSTALNRIVRDLSPRPEA
FT                   GGAGTDLIAEPWAIGGNSYQVGNFPAGWSEWNGIYRDTLRKDQNGLGVESVTPGQLATR
FT                   FAGSSDLYGDDGRKPWNSVNFMVAHDGFTLKDLYACNSKNNSQAWPYGPSDGGEDSNHS
FT                   WDQAGVAADQRKAARNGMAFLMLNAGTPMFNGGDETLRSVQCNNNAYNLDSSGNWLNPT
FT                   LTTDQTNFKSFTQNMISFRRGHPALRPANFYSSSDTNGNVMEQIRWFKPDGTVADSGYF
FT                   GNADNHALAYRIDGTEFGDTASAIYVAYNGWSGGVDFKLPWPGSGKSWYRVTDTCPWAE
FT                   GATQVDLNAAANVGGEYATYSVCGRGLLVLVAR"
FT   gene            complement(233396..233518)
FT                   /locus_tag="Deide_3p01705"
FT   CDS_pept        complement(233396..233518)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p01705"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p01705"
FT                   /db_xref="EnsemblGenomes-Tr:AHX26575"
FT                   /db_xref="UniProtKB/TrEMBL:X5H5S2"
FT                   /protein_id="AHX26575.1"
FT                   /translation="MQTFLEVEVEEVFTPFDMGEAVFAHVNHEALFHGRAMLLP"
FT   gene            233841..234752
FT                   /locus_tag="Deide_3p01711"
FT   CDS_pept        233841..234752
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p01711"
FT                   /product="putative phosphoesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p01711"
FT                   /db_xref="EnsemblGenomes-Tr:ACO48116"
FT                   /db_xref="GOA:C1D3N7"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:C1D3N7"
FT                   /protein_id="ACO48116.2"
FT                   /translation="MRSSRVLGTLGWSILTLGTLGVANAYRFVISKHQLSVPGLSRPVR
FT                   IVQLSDLHYGLFVGRATVARWVDAVLKQEPDLIVITGDFLDSGVGSRRHRKLMAELARL
FT                   RAPLGVYGVWGNHDWTSLNTNATRISFAEQLRLHGVRLINNTGVQVREDLYVAGVDDWW
FT                   FGTQDLDAALRGHTGGAVVLLSHNPDYLTQVPARVHLTLSGHTHGGQVRLPLFGSLKRR
FT                   STLLNVLRGWVRGPHVVQSPAEGTPATPPEGHALGFVSQGLGVTGVPFRLACPAEVVVL
FT                   TLVPVGQGPSSTSPVRGAPTAL"
FT   gene            235031..235459
FT                   /locus_tag="Deide_3p01712"
FT   CDS_pept        235031..235459
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p01712"
FT                   /product="putative mannose-6-phosphate isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p01712"
FT                   /db_xref="EnsemblGenomes-Tr:ACO48117"
FT                   /db_xref="GOA:C1D3N8"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR017102"
FT                   /db_xref="UniProtKB/TrEMBL:C1D3N8"
FT                   /protein_id="ACO48117.1"
FT                   /translation="MRSTMSVSDAGDIHVVVHGQQAYRGKQGLDYTPGISATSVGSRAL
FT                   WLGAVTIPPGGRTKAHVHEQHESAFYLVSGEEVELWIGNALEHRHLAHPGDYLYIPPGI
FT                   PHVAVNRTPVPAFFVGARTDPSEQESVVMTPNLDGLVP"
FT   gene            235656..235961
FT                   /locus_tag="Deide_3p01722"
FT   CDS_pept        235656..235961
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p01722"
FT                   /product="putative endoribonuclease L-PSP"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p01722"
FT                   /db_xref="EnsemblGenomes-Tr:ACO48118"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:C1D3N9"
FT                   /protein_id="ACO48118.1"
FT                   /translation="MSGQGAFDPETGRIVDGGIREQTSQVLRNISLILQSAGADLSSVV
FT                   KVTVFLHAWKDFAEMNEVYASFFPAKARARSTVQGERWPEGSLVAIEAIALVPPEH"
FT   gene            236385..237365
FT                   /locus_tag="Deide_3p01730"
FT   CDS_pept        236385..237365
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p01730"
FT                   /product="putative prolyl aminopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p01730"
FT                   /db_xref="EnsemblGenomes-Tr:ACO48119"
FT                   /db_xref="GOA:C1D3P0"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR002410"
FT                   /db_xref="InterPro:IPR005945"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C1D3P0"
FT                   /protein_id="ACO48119.1"
FT                   /translation="MTNKQPTPSYFDTTGRDDRLSGGVKLIPITTPHGTFRVWTKRIGN
FT                   HPTIKVLLLHGGPGATHEYFEAFDSFLPAAGIEYYYYDQLGSAYSDQPDQPELWDLSRF
FT                   VEEVEQVRQALGLTSENFYLLGHSWGGILALEYALRYPQHLKGLVISNMMASIPQYNTY
FT                   AREVLMPAMDPVVLAEIQQLEAAGKHDQPRYMELLVPHHYVHHVLRMPVDEWPDPVNRT
FT                   FKHLNASIYVPLQGPSELGASGKLADWDRTADLSSLMVPTLVIGAQHDTMDPAHMAWMA
FT                   QQLPNGRYLHCPEGSHMALYDNQDRYFEGLITFLEDVDQAAQGQR"
FT   gene            237967..238734
FT                   /locus_tag="Deide_3p01740"
FT   CDS_pept        237967..238734
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p01740"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p01740"
FT                   /db_xref="EnsemblGenomes-Tr:ACO48120"
FT                   /db_xref="UniProtKB/TrEMBL:C1D3P1"
FT                   /protein_id="ACO48120.1"
FT                   /translation="MRFELVPTLNELRSVYARPLDARRFQAYLDTVINGAQSAKAVRLP
FT                   PLVLANPMAKAHVLNVLDQWLTLDAEETARAALEEANARLLHVAYDAAVKVGLTLLDDV
FT                   AGGWTNRNINDAMRFHTAQALKTSGWVTVCLWTSAVPQRAALRQTVLECAQRAALAACH
FT                   GDPCTLLGMMRQEGAAAVFAERTLEFNAEELAYSRAVLAPLLESSHQPTVLAAMYGDEA
FT                   ARDWGYTPLGLSNQAGFQVALADALESQARPPA"
FT   gene            238731..239264
FT                   /locus_tag="Deide_3p01750"
FT   CDS_pept        238731..239264
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p01750"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p01750"
FT                   /db_xref="EnsemblGenomes-Tr:ACO48121"
FT                   /db_xref="UniProtKB/TrEMBL:C1D3P2"
FT                   /protein_id="ACO48121.1"
FT                   /translation="MTMDAPSMEACVGCGAVLPRVEGPIHRYMTSSPACWAAFTALGSA
FT                   QHLPTNASWEALLVDAYAVQHPGTPSNQAINSVAVHLMVLYGVLVRGYAPDQAQRLRQR
FT                   PGQQTKGHKHERFHWLTPPSFASVLTVADVQNAGDAQVRAQVAEAWVRDVWSVWAQLHE
FT                   GQVASWFAAYMAFE"
FT   gene            239853..240401
FT                   /locus_tag="Deide_3p01760"
FT   CDS_pept        239853..240401
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p01760"
FT                   /product="putative GAF domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p01760"
FT                   /db_xref="EnsemblGenomes-Tr:ACO48122"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="UniProtKB/TrEMBL:C1D3P3"
FT                   /protein_id="ACO48122.1"
FT                   /translation="MPSSITNAAVHEEQRLTLLERCRLMNTAQERSYDLIVEGLARLYG
FT                   VPIALITFLDGQRQFIKANVGTDVREMPVTESLCQYTLESDSPLVLPDLTQDWRCHSHS
FT                   LVTGDEELRFYAGAPIIVDGYRLGTVCIFDRVPHSANDLDASLLVHMAMMVAATIKARS
FT                   ENPRAPVSYPRYRAPQNEA"
FT   gene            240449..240637
FT                   /locus_tag="Deide_3p01770"
FT   CDS_pept        240449..240637
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p01770"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p01770"
FT                   /db_xref="EnsemblGenomes-Tr:ACO48123"
FT                   /db_xref="UniProtKB/TrEMBL:C1D3P4"
FT                   /protein_id="ACO48123.1"
FT                   /translation="MPDRDWMVGAKYSTPRLETHLEELRNRQQQLEEHKVAYLSRLLEY
FT                   QVLKDEQKWRKEHPKDR"
FT   gene            240677..241105
FT                   /locus_tag="Deide_3p01780"
FT   CDS_pept        240677..241105
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p01780"
FT                   /product="putative response regulator, CheY"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p01780"
FT                   /db_xref="EnsemblGenomes-Tr:ACO48124"
FT                   /db_xref="GOA:C1D3P5"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:C1D3P5"
FT                   /protein_id="ACO48124.1"
FT                   /translation="MPTPCHYLLVDDNPADHLLVQEAFELLGPGHCLTWVQSGQQALQI
FT                   LNAGTTQPDVVLLDINMPGMDGFEVLEAIKRDPRLRTIPVVMLSTSSAGGDVNRAYRLF
FT                   ASAFLVKSARFDAFLEQIEAFLNYWQTNRVCTPDRLLA"
FT   gene            241258..241761
FT                   /locus_tag="Deide_3p01790"
FT   CDS_pept        241258..241761
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p01790"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p01790"
FT                   /db_xref="EnsemblGenomes-Tr:ACO48125"
FT                   /db_xref="UniProtKB/TrEMBL:C1D3P6"
FT                   /protein_id="ACO48125.1"
FT                   /translation="MHTLVKGLIAGAAGVAAMTVAEKLEQQFTRRPNSYVPAHTAERLF
FT                   GLRHRPDEERLWLNWAMHWGQGVLLGMARATMAQRGLRGPVGSFMYMNLRLLNDQSLEN
FT                   STGVGAPPWTWPVDEQVIDLLHKGIYAFVTGYVADRLIQGPPGIPSARTPWTARPQPPT
FT                   APSD"
FT   gene            242467..243513
FT                   /locus_tag="Deide_3p01800"
FT   CDS_pept        242467..243513
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p01800"
FT                   /product="putative transcriptional regulator, ROK family"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p01800"
FT                   /db_xref="EnsemblGenomes-Tr:ACO48126"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C1D3P7"
FT                   /protein_id="ACO48126.1"
FT                   /translation="MTNPNPLRRKNRTALLQLLFQHGPLSKTALAQNSGLSSVTVNAII
FT                   NELLDAQLLVEIGKTGGNAGRPAGILDFHPQLSTVAGIDVQPKCLSVVTSNLRGEARSQ
FT                   RTLPAEPAYVTESLLNAIDELAQTMPHGPVGHIALSVPAPVNPITLKLLEPNSLPELDL
FT                   PHIINHCTARGITLLADNDANLAAVAERAYGCARGHTNFGVLVTRDSGIGMGLVLDGRL
FT                   FQGDDGQAGELALAYWPLNGEPVPIEHLPPREQDIAIAYLVSGNAVTLNLSQLVVYQAN
FT                   PDPNSDLIHRLRQLLPDRIPVCESLVAAEGPVLGALTMAVASHAEQLFTTHPTPAPVPT
FT                   PSRDASGG"
FT   gene            243515..244753
FT                   /locus_tag="Deide_3p01810"
FT   CDS_pept        243515..244753
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p01810"
FT                   /product="putative sugar ABC transporter, periplasmic
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p01810"
FT                   /db_xref="EnsemblGenomes-Tr:ACO48127"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:C1D3P8"
FT                   /protein_id="ACO48127.1"
FT                   /translation="MNRIHRTLALLSLAMTTAASAAPVTLNALLMKQAAYSEQDIRNMT
FT                   KEFEAKNPNLKVNIEFVAYEALHDKIVASQASGSNGYDVVLFDVIWPAEFAQNGFLQDV
FT                   TNRIPKASTDRVIKGAWTTVEYDNKRYGMPWILDTKYLYYNTDMLKQAGIKAPPRTWEE
FT                   LLQQADILKKKKITQYPIVWSWAQAEALICDYTTLVSAFGGQFYKGGTPAFNSGGGLKA
FT                   LTYMTDSVKRGLSNPNSKEYLEEDVRRVFSSGQAAFALNWTYMYNMANDPKESKVAGKV
FT                   GVVAAPGAAGISKASAMNGSMALGISGNSQKADDAWKYISFLTSQPTQNKYAKLSLPIW
FT                   KTSYTDPKVAQGQQQLIKAANTALPLMYPRPTITRYQELSVTLQKAIQEALLGRKTPQA
FT                   ALNDAAKTAARLR"
FT   gene            244755..245687
FT                   /locus_tag="Deide_3p01820"
FT   CDS_pept        244755..245687
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p01820"
FT                   /product="putative sugar ABC transporter, permease
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p01820"
FT                   /db_xref="EnsemblGenomes-Tr:ACO48128"
FT                   /db_xref="GOA:C1D3P9"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C1D3P9"
FT                   /protein_id="ACO48128.2"
FT                   /translation="MRLPVLAFRGRGAQGRPADNRTAWLMLAPLLTIILLIVGYPLVRT
FT                   LYLSFTAGILTAVKVPPRWVGWENYTQALTNPEFLASLWNSAYFTSVSVGLEMILGVLV
FT                   ALLLHQQFRGRKFVRALLILPWAIPTIVNAVMWRWIFNPEFGAFNALLTQTNVLNTYQS
FT                   WLGEPGLAMNMVILADVWKNYPIVALIALAALQGVPDDVYEAASLDGANAWTRFWRITF
FT                   PDIVGPLSVALVLRTIEAFKVFDIVFVMTRGGPADSTKTASFHVYQESFTYLRAGSGAS
FT                   YAYIVVLISMLLIGAYMWLLRRQAQGART"
FT   gene            245684..246598
FT                   /locus_tag="Deide_3p01830"
FT   CDS_pept        245684..246598
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p01830"
FT                   /product="putative sugar ABC transporter, permease
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p01830"
FT                   /db_xref="EnsemblGenomes-Tr:ACO48129"
FT                   /db_xref="GOA:C1D3Q0"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C1D3Q0"
FT                   /protein_id="ACO48129.1"
FT                   /translation="MTRVPSVSSPAIRQSTGRRAPSIKRNRWTAQVLTYLGVGVFVLSI
FT                   LGPVLWLLMTSVSSTNDLTTLPLRWFPAQLDLSRYASLLTVTPNSPGETFLYALRNSAF
FT                   VALVTTFLALLVGIPAAYSFSRLPQGRSGLLYATIATYMMPPVALVLPLYAILARAGLL
FT                   NNVWGLILVYCTIVMPFTTWLLKANFDGVPVDIEESGAIDGLSRWGILTRLTMPLALPG
FT                   IVTSTIFSILLAWDEFFYALLFTSNIQAKTLPVAISDFTAGRSADFGLIAAAGVLAALP
FT                   PVLIAFALQRGLMKGLTAGGVKG"
FT   gene            246595..247617
FT                   /locus_tag="Deide_3p01840"
FT   CDS_pept        246595..247617
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p01840"
FT                   /product="putative phosphosugar isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p01840"
FT                   /db_xref="EnsemblGenomes-Tr:ACO48130"
FT                   /db_xref="GOA:C1D3Q1"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="UniProtKB/TrEMBL:C1D3Q1"
FT                   /protein_id="ACO48130.1"
FT                   /translation="MILMNLTHECTGLQLIERERERQFRDALDTLDSNREMARQVAGSI
FT                   RRTGQVLLLGMGASHHANLVATAALRALGIEAFAMPLSEALYVPLPERPRTVLLTSQSG
FT                   GSVEAERYLHLGRQGEDYFGLTLNPDSLLACAVPCLVAAGGSEQGFAATRSYLLTLALH
FT                   STIAKALGDAQEDFRAVVKAAMSPDVTAAVDHLRLARSFVFSARGGLQGVAEVGALGIL
FT                   ELAHVPAFALEGGQLRHGPMEAVKADLGMIFLRDAAHRELIDSLIRACQEAGVVPVVLD
FT                   VSGEAPQPGRITISAGRHQGLAAAAALCEPLQKLLLAVAGQRVERVGEPVRSSKVTRTE
FT                   "
FT   gene            247614..248564
FT                   /locus_tag="Deide_3p01850"
FT   CDS_pept        247614..248564
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p01850"
FT                   /product="putative ribokinase"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p01850"
FT                   /db_xref="EnsemblGenomes-Tr:ACO48131"
FT                   /db_xref="GOA:C1D3Q2"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:C1D3Q2"
FT                   /protein_id="ACO48131.1"
FT                   /translation="MITPHLLVIGGVNIDLLVGPQAPWPTPGTEVILDHSDLRVGGGGG
FT                   NTALALEALSVPSVLVGGYGNDAFGPWLREKFTGVLCDWHQSASPTGLCVGITHPDGDR
FT                   TFFTHMGHLGDDPPERVYRALDRAGPGSTALFTAGFLMALWLPEYDQLLSYARARGVRV
FT                   ALDTGWPPPGWTPEVRAMVRSWLGKTDLLLINELEATALAETDDVYAAGMVLLEQLAQD
FT                   ATLIIKRGPWGAAAWVGSQQVEVSAPQVQVVDTIGAGDTFNAAFLAAQYDGRSLQNSMA
FT                   AAVAYASHSISTQPRTYAATLGDPLQDRPTELSRP"
FT   gene            complement(248892..249851)
FT                   /locus_tag="Deide_3p01851"
FT   CDS_pept        complement(248892..249851)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p01851"
FT                   /product="Conserved hypothetical protein, precursor"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p01851"
FT                   /db_xref="EnsemblGenomes-Tr:ACO48132"
FT                   /db_xref="InterPro:IPR025507"
FT                   /db_xref="UniProtKB/TrEMBL:C1D3Q3"
FT                   /protein_id="ACO48132.1"
FT                   /translation="MQQLRFLSIPMVIALAACGTASVPDGGMADRKTAPAPLMAASFGG
FT                   GDWGSGSWNDGGSWSGGSNMMYATTASNRLLRFSASTPGDVQAQPITGLAPGERVLGID
FT                   FRPANGRLYALGSTSRIYTIDLASGAATPVGAPFTPVLEGTSFGFDFNPVVDRIRVVSN
FT                   TGQDLRVHPDTGAVAGVDGRLAYAAGDRNQGRKPDVVAAAYTNPVAGATQTNLYLLDAS
FT                   LELLAEQGNPSATPPVSPNTGQLFSKSSLRVDVSTLAGFDIDSSRNAYAVFTPQGSRSS
FT                   ELYSVSIYRGSASRVGTIGSGETVTGLAIPIGSSSNDR"
FT   gene            complement(250119..251147)
FT                   /locus_tag="Deide_3p01860"
FT   CDS_pept        complement(250119..251147)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p01860"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p01860"
FT                   /db_xref="EnsemblGenomes-Tr:ACO48133"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="UniProtKB/TrEMBL:C1D3Q4"
FT                   /protein_id="ACO48133.1"
FT                   /translation="MLVTAQAAPHTTPTGLLVISKPARPVVASDPPSGRVFRTPPDLSA
FT                   AQLAFTIDGAPQSLEYVDFNSAGDAFITFDDGPSLVAPGGFLKIRNLAGRAAGRFDAAR
FT                   DQWVSGPRSGLKQPKDIVVSPRAGLVIIADFGDATLKVFAGGARGDIAPRFITPDLGRT
FT                   SAGPRRPWGLAYDESADRLIVGATDGTLVVFDRYLAGRGLGSYRVIVPTMQGQRAAANL
FT                   HDLVYLPAQDTVLMVDVGAAIDRDQSNFDSDGAILVLSGIRQLTGEAPVRLRISGPKSL
FT                   LGNPVGVAFDGSALFVADRARHTLMRFDGLLKLKGRRDLAPSAAVTVVAPESVMLIPPA
FT                   TR"
FT   gene            complement(251262..252212)
FT                   /locus_tag="Deide_3p01861"
FT   CDS_pept        complement(251262..252212)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p01861"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p01861"
FT                   /db_xref="EnsemblGenomes-Tr:ACO48134"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="UniProtKB/TrEMBL:C1D3Q5"
FT                   /protein_id="ACO48134.1"
FT                   /translation="MTGSPDRLEEYVLGTLSPDEQSQVEAELEHSPAGRAQVRALREAL
FT                   VALAEAAPVHPAPSGSWAAIESRLRTQTPLISQRRRSAWPFPQGWLAVACTTLLVGGAL
FT                   GGLRTYDMYQQTAGDRALLVAFLAHPEVRRLPLRAGGETIGSVLMRGQRALFVVSRTLP
FT                   PGQAYQAWGHTQADWQPGGRERLVSLRVSRDGVFEVETKRFVALYLSREPGGGSVQPSR
FT                   ALSRVNLAAAPTPDRLTVSQPLDGTVVTTHQVIVSGTAPSDVTTIAYRLNSGSLRSSAV
FT                   AEGRFTFTVLGLKSGENRIEVRAGSAQTAVRITVR"
FT   gene            complement(252209..252745)
FT                   /locus_tag="Deide_3p01870"
FT   CDS_pept        complement(252209..252745)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p01870"
FT                   /product="putative RNA polymerase, sigma-24 subunit, ECF
FT                   subfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p01870"
FT                   /db_xref="EnsemblGenomes-Tr:ACO48135"
FT                   /db_xref="GOA:C1D3Q6"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:C1D3Q6"
FT                   /protein_id="ACO48135.1"
FT                   /translation="MESSEEAALLGRLQQGDEAALAALYSGMGSKVFSLALQLLGSREE
FT                   AEEVMQDTFLKVYRQARTYRADLGSPRAFVYTIARNDCMSRLRARRARPQKADWDVHEL
FT                   DSPLPSASVDGHLGAVVTQALAQLEPLDRQLLHDSFYAGYTHLELAERSKLPLGTVKSR
FT                   VRRALLALERFLEQP"
FT   gene            254281..256047
FT                   /locus_tag="Deide_3p01890"
FT   CDS_pept        254281..256047
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p01890"
FT                   /product="putative dipeptide ABC transporter, periplasmic
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p01890"
FT                   /db_xref="EnsemblGenomes-Tr:ACO48136"
FT                   /db_xref="GOA:C1D3Q7"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:C1D3Q7"
FT                   /protein_id="ACO48136.1"
FT                   /translation="MKKALFVVLAMTVTSATAAPFVWPAAWTGEPNTANKRGGEFRSYT
FT                   ISDYKTINPFTTAEADSLTDLMTLRTSGLFTQDPRNDEFIPYMAEGKPTVSNGNKRFVV
FT                   KIRKGMKFSDGQPITADDWVTTATIHKDDKVGSNSRDTFFINDKPITVKKLDTYTLQFD
FT                   FPQVSAGAYSRMTYAPWPDHVFGKTYRSGGAAAIKKMWTLGTPADEIVSPGAWTLDSYQ
FT                   AGERAVLKKNTYWGEWNKDSRGNALPYLDRYSSRITADLNAALAAYLAGQIDTFGPSKA
FT                   DELAQIQKAISAGNLKATLIPNVSPQADSSWIVFNWNRAGNPAKQKLFRDVRFRRAMSH
FT                   LANRQAMVKLALGGLGTETYYSVYPIFKQQIAAGEKAKAPKYPYNPREAARLLAQLGYT
FT                   KKNAQGYLVDKAGKVLEFNLSTNAGNTVREQLGRVFADEAKKVGVKVNFTPIDFNNLVN
FT                   QLTAKGESRPFDAILLGLSGGDNIWPFGNNVVPCGGSLHMYNNNSKGTCLTPQETEMTK
FT                   LYNQGDAELNAAKRLAIGGRLMKVESELQPVIYMVGSNYHVTYNNRVGGTRDRKQMDAY
FT                   YGSRELPLTFIK"
FT   gene            256727..257152
FT                   /locus_tag="Deide_3p01891"
FT   CDS_pept        256727..257152
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p01891"
FT                   /product="putative response regulator, CheY"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p01891"
FT                   /db_xref="EnsemblGenomes-Tr:ACO48137"
FT                   /db_xref="GOA:C1D3Q8"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:C1D3Q8"
FT                   /protein_id="ACO48137.1"
FT                   /translation="MSIPQHYLLIDDSPTDQLLAQEAFAQLQPRSTLTCVSSGREALEL
FT                   LESGFSLPDVILLDINMPEMNGLQLLKLLKDQMPLKAIPVVMLSISGAEDDIQQAYRLH
FT                   ASSYLVKSKGFDAFLEQVKSFLRYWQANQVVGASAGR"
FT   gene            complement(257836..259224)
FT                   /locus_tag="Deide_3p01893"
FT   CDS_pept        complement(257836..259224)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p01893"
FT                   /product="putative RtcB family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p01893"
FT                   /db_xref="EnsemblGenomes-Tr:ACO48139"
FT                   /db_xref="GOA:C1D3R0"
FT                   /db_xref="InterPro:IPR001233"
FT                   /db_xref="InterPro:IPR036025"
FT                   /db_xref="UniProtKB/TrEMBL:C1D3R0"
FT                   /protein_id="ACO48139.1"
FT                   /translation="MNGNDITALGFTGKAIGLALNAARHRETAGQTNDEIRAELGRVLH
FT                   RPEAFIRDPLYADLGRELLGQAARFPDTLRERPLSYTEWGSELIDENTRAQMDTAMRLP
FT                   ISVAGALMPDAHVGFGLPIGGVLATDHAVIPYAVGVDIGCAMALSVLPVANLSREDEVR
FT                   LLRRNTRFGAGHAWERKLRPDHAVLDEDTWHELPLLRQLRNKAAEQLGTSGSGNHFVEF
FT                   GTLTLEAADLGLAPGQYIALLSHSGSRGFGAQVAGHYTQVAQNLHPDLDPDARKLAWLD
FT                   MDRDEGQAYWTAMNLAGRYALANHEVIHARIARALGVKPLVTVRNSHNLAWKQRMPDGR
FT                   EVIVHRKGATPAGQGQLGIIPGSMADPGYVVRGKGNTQALESASHGSGRLLGRKQAERE
FT                   LSRSAVKEYLEARDVTVMGGGVDEAPQAYKNIDRVMASQADLVDVVARFMPRVVRMDTG
FT                   RQDI"
FT   gene            259726..261039
FT                   /locus_tag="Deide_3p01900"
FT   CDS_pept        259726..261039
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p01900"
FT                   /product="putative hemolysin; putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p01900"
FT                   /db_xref="EnsemblGenomes-Tr:ACO48140"
FT                   /db_xref="GOA:C1D3R1"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR002550"
FT                   /db_xref="InterPro:IPR005170"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:C1D3R1"
FT                   /protein_id="ACO48140.1"
FT                   /translation="MTAALPFLVILMMVALNALYVAAEFATVGSRRSRVQEAAEGGHRT
FT                   AADLLDILKDPKRLDTYVAACQIGITLSSLVAGAYGQAQLIPLLTPVVGPVGGPVLATV
FT                   LVLVLITALQVVLGELLPKTVALRYPERLAMATLRPIQFSLFVFRPLISLFNGTAFFLM
FT                   RALKLQVDHSHAHVHSPEELEDLYRQSARGGLIDASERNMVAGVLNVEDRVVREIMTPR
FT                   TKLVVVPGHLTVREALARLANTPYTRFPVSGDTPDDVTGIIHLRQLFLAGESQPGRLVS
FT                   DVARPPLIVAESMPVPELWRRLREASRHAAIAVDEYGGVAGMATLEDALEEIFGEMQDE
FT                   FDHEEDPITVDGDRVLVRGDVLIDLLNDRFELDLPTDEVDTVSGLMWHELGRLPMVGDE
FT                   AGVRNLTLRVEAMDRRAVQRASFILPRGTTDGDTGRTV"
FT   gene            261039..262364
FT                   /locus_tag="Deide_3p01910"
FT   CDS_pept        261039..262364
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p01910"
FT                   /product="putative hemolysin; putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p01910"
FT                   /db_xref="EnsemblGenomes-Tr:ACO48141"
FT                   /db_xref="GOA:C1D3R2"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR002550"
FT                   /db_xref="InterPro:IPR005170"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:C1D3R2"
FT                   /protein_id="ACO48141.1"
FT                   /translation="MQDVFVPLVVIVILVVLNGLFVAAEFALVASRRSRLNTLADTGNP
FT                   AARWLTAVFDDETGKDRYIAIAQLGITLASIGLGMYGEPVIASWLYGPFEGAGLSYAAA
FT                   HTAGFIIALSAITFMHVVFGEMIPKALALQAPEAVSLQVNPLMRVFGFLFRPLIILLNV
FT                   LALGLMRALRIREPGKNAFLYTSKELSIITDESAESGQLGGVQRDLIQNIFALEDRTAQ
FT                   ELMTPRSSLEALSIHAPPDEVTRRIAGSPRSRYPVYEDNLDEIIGVLHVKDFIRARVSG
FT                   GSPQLGRLIRPLPSVAASTSAEHLLALFKRERLHAALVVDEFGGTLGFVTMDDLIEDVM
FT                   EEEDAGSSDWVQTNPDGSLILNGEVTLSELREDHGLNLHSEDATTIAGLLLGEYGTVPA
FT                   AGTTVFVQGHDLTAEDVQGLKITRVRVRPVASPDEVSTTGTS"
FT   gene            262955..263224
FT                   /locus_tag="Deide_3p01915"
FT   CDS_pept        262955..263224
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p01915"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p01915"
FT                   /db_xref="EnsemblGenomes-Tr:AHX26576"
FT                   /db_xref="UniProtKB/TrEMBL:X5HLN8"
FT                   /protein_id="AHX26576.1"
FT                   /translation="MSTPSPCLLVIVPGNWEAVPEGVQELKRYMAHEVGGTLTVQRTPA
FT                   PLRFPLVLPIGVWPPGSWRVARQDIELVLMSQAFFSLGWLEEVS"
FT   gene            complement(263396..264391)
FT                   /locus_tag="Deide_3p01920"
FT   CDS_pept        complement(263396..264391)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p01920"
FT                   /product="putative NADH-dependent dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p01920"
FT                   /db_xref="EnsemblGenomes-Tr:ACO48142"
FT                   /db_xref="GOA:C1D3R3"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C1D3R3"
FT                   /protein_id="ACO48142.1"
FT                   /translation="MPTRIALLGAAHVHADAYAAWLTGCKHVELLGFSEDSPHLAAEFA
FT                   ARTGLRHLPLAQLLESGPDGVIVCSETARHRFLVEAAAQAGAHVLCEKPIALTLDDARA
FT                   MNQACLQAGVEFRTAFPVRFSPEVQNLRHMVLTGGLGQILAYGGVNHSVCPDRERQWFS
FT                   DPLMAGGGAGMDHIVHLADLFHLFGEQVETVYARLVPVPEWVLPEHARVDAAALVTLRF
FT                   ASGASATIDSSWSRPRTYPRWGHLKLDVTGTQGLQTLDVFAESLAITNSEGRHWAGYGT
FT                   DLNALMLRDFLNVCTLREHSSGADWHAGYQALRVVLAAYQAEAGAQAVHL"
FT   gene            complement(264391..265365)
FT                   /locus_tag="Deide_3p01930"
FT   CDS_pept        complement(264391..265365)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p01930"
FT                   /product="putative NADH-dependent dehydrogenase, putative
FT                   inositol 2-dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p01930"
FT                   /db_xref="EnsemblGenomes-Tr:ACO48143"
FT                   /db_xref="GOA:C1D3R4"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR004104"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C1D3R4"
FT                   /protein_id="ACO48143.1"
FT                   /translation="MSGLSVGLIGTGLMGRTHAQGWQTRPGVLTCVYAPDERARTFARE
FT                   FNLRPCASTEELLDRVDIVDLCTPTPTHPDLAVQAARAGRHVICEKPLALTLAEADRIM
FT                   AACRTAGVRLFVAHVLRFFPQYRAAWDQVQAGNIGIPRVLRLSRVSSPPAPGSWLLDEA
FT                   QSGGVPLDLMIHDLDFARWVAGEVNTVYAAGRHHGGRTMVQVTLSHISGAISLIEGGWA
FT                   APAGVFRTALDLAGTRGVIEWSSDAPAALRRHGPQPEPRQLGAALPALAGDPYAAELLH
FT                   AYQAIEEGLPFLVEPEDARAALALSHAVRRSLASGQAVGMEDA"
FT   gene            complement(265362..266207)
FT                   /locus_tag="Deide_3p01940"
FT   CDS_pept        complement(265362..266207)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p01940"
FT                   /product="putative sugar ABC transporter, permease
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p01940"
FT                   /db_xref="EnsemblGenomes-Tr:ACO48144"
FT                   /db_xref="GOA:C1D3R5"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C1D3R5"
FT                   /protein_id="ACO48144.1"
FT                   /translation="MSASTAPLLNRRGQVLGHLVLMFYTLLAILPTLLIIVNSFKDRLA
FT                   IFSDPFALPTASTFTLDGYHTLASSANFSLFFLNSLLVTLGSLALILLLSSMAAFALSE
FT                   YRFRLNTLLGLYLAVGIMVPIRLGTIGILNLMVSLHLVNTLWALILVYTAQGIPLAVFV
FT                   LTSFMRGVPRDLKEAARIDGASEYRIYGMTLPLIRPALGAVTAISMIPIWNDLWFPLIL
FT                   APGEKTKTIVLGASAFLGQFVNDYNAVLAALTLAIVPVVVLYIIFSRQLVSGITGGALK
FT                   "
FT   gene            complement(266204..267145)
FT                   /locus_tag="Deide_3p01950"
FT   CDS_pept        complement(266204..267145)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p01950"
FT                   /product="putative sugar ABC transporter, permease
FT                   component, putative sn-glycerol-3-phosphate transport
FT                   system permease protein ugpA"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p01950"
FT                   /db_xref="EnsemblGenomes-Tr:ACO48145"
FT                   /db_xref="GOA:C1D3R6"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C1D3R6"
FT                   /protein_id="ACO48145.1"
FT                   /translation="MTDRSLPRVRTRRPFPWHVVVFLAPALLIYTLVMIYPILSSLWLS
FT                   LNNRSPDGSAVFVGLSNYQKLLGSELYAQPMWNALKNNFVFFAVHMLVQNPVGLLLAVL
FT                   LSFRLRGSAVYRTLLFTPTILSVVIIGFAWKLILNPAWGVQRALLTPLNLQEFDLPWLG
FT                   LPATALPTLSLISVWQNIGIPMLLFLAALVRIPEELYEAARLDGAGAWTIFRRIQLPLI
FT                   LPTVGIVSVLTFVGNFNAFDLIYSTQGALAGPNFASDILGTLFYRTFFGYQLQSGDPYM
FT                   GAAVAGVMLVVILAGLLIYLTAWQRRITEVQL"
FT   gene            complement(267312..268565)
FT                   /locus_tag="Deide_3p01960"
FT   CDS_pept        complement(267312..268565)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p01960"
FT                   /product="putative sugar ABC transporter, periplasmic
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p01960"
FT                   /db_xref="EnsemblGenomes-Tr:ACO48146"
FT                   /db_xref="GOA:C1D3R7"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="InterPro:IPR006061"
FT                   /db_xref="UniProtKB/TrEMBL:C1D3R7"
FT                   /protein_id="ACO48146.1"
FT                   /translation="MKRLGFSLSLLLLASLAGAQKTTLTIESWRNDDLKVWRDSIIPAF
FT                   QKAHPNIQVVFAPSAPAEYNAVLDAKLKAGTAGDLITCRPFDKSLDLYKAKQVISLNGL
FT                   KGLNNFDPVAKAAWSTDDGKTTFCVPMASVIHGFIYNKALFRELGLSVPKTEAAFLSTL
FT                   AKIKANGKYAPLVMGTKDQWEAATVGYQNIGPTAWDGEKGRKGLISGTAQYNKGGFLQA
FT                   FTSLASWKPYLPNGYQALAYPDAQNLFAQGRGVIYPAGSWDIGTFRQMNPKLEMGAFAP
FT                   YSINGKKCVIDDHPDIGMGINAASKNQEAAKTFLNWVASDAFATLYANALPGFFPLANV
FT                   KYTVKDPVAQEFLKWRTQCAKSFRSSYQILSRNANPNNENDLWNVSAQLLNGSMTPKAA
FT                   ADLVQKNLGSWYAPQKGK"
FT   gene            269005..269481
FT                   /locus_tag="Deide_3p01970"
FT   CDS_pept        269005..269481
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p01970"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p01970"
FT                   /db_xref="EnsemblGenomes-Tr:ACO48147"
FT                   /db_xref="UniProtKB/TrEMBL:C1D3R8"
FT                   /protein_id="ACO48147.1"
FT                   /translation="MTTITGRVGGRSQGYDVNLGGTPTELKGRVGGVHIGRDLVLQITR
FT                   TQVRGRLGGPTIGHDVNLALGNHTLSGRLGGGILGRNVDLTASGSSVAGRCGGLMSGFD
FT                   VMLTITADGVKGRLGGARIGADVSLTGDAPPLLMALAATLAYDSLVEDSTATGG"
FT   gene            complement(269666..270439)
FT                   /locus_tag="Deide_3p01971"
FT   CDS_pept        complement(269666..270439)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p01971"
FT                   /product="putative transposase"
FT                   /note="ISDds4 - IS982 family member"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p01971"
FT                   /db_xref="EnsemblGenomes-Tr:ACO48148"
FT                   /db_xref="GOA:C1D3R9"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="UniProtKB/TrEMBL:C1D3R9"
FT                   /protein_id="ACO48148.1"
FT                   /translation="MARYRLHHSLGRRRVIRTLWRWGRKHFSDQKSCRHQKVTDAFLVA
FT                   LLLSRYVFKHPYPSIWWNILGEDRPNLPSYTQAFTRGQRLLEHLEALVSPPLPCTEVVV
FT                   DSMPLPVCRPKRGKRCAFPGARWGFGTQGDFFGFKLHAWVSPAGQVMQYLIRPANLHDT
FT                   TVAYELNRRWVDFAGPQIIGDKGYCALGFIYPPKKNTRYDTGWRENRHPRLRKRIETVF
FT                   SQLVESQIRSVQTKTLTSLRFRVVLAILAHNLMQP"
FT   gene            complement(270640..270741)
FT                   /locus_tag="Deide_3p01976"
FT                   /note="nonfunctional hypothetical protein"
FT   gene            complement(270904..271110)
FT                   /locus_tag="Deide_3p01977"
FT   CDS_pept        complement(270904..271110)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p01977"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p01977"
FT                   /db_xref="EnsemblGenomes-Tr:AHX26577"
FT                   /db_xref="UniProtKB/TrEMBL:X5HNB3"
FT                   /protein_id="AHX26577.1"
FT                   /translation="MPSFSYLLKVGEASLEKVLRHIVQDNYPEAAEDELYVARKALGKT
FT                   AHEVLVPYHQASRIYGIHRQRGS"
FT   gene            complement(271315..272418)
FT                   /locus_tag="Deide_3p01980"
FT   CDS_pept        complement(271315..272418)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p01980"
FT                   /product="putative basic membrane lipoprotein, precursor"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p01980"
FT                   /db_xref="EnsemblGenomes-Tr:ACO48149"
FT                   /db_xref="GOA:C1D3S0"
FT                   /db_xref="InterPro:IPR003760"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:C1D3S0"
FT                   /protein_id="ACO48149.1"
FT                   /translation="MKKSMMLVCFMALSLADAQSQVTVGLVLDAGGKNDRSFNQAAYEG
FT                   ALRAKRDFGVDIEIFEPAKNGDLNPGINKFSKAGKNLIIGVGFVANAGITAAAKAYPKS
FT                   NFAVVDDLPEGDNTTGLRFREQEGSFLVGYLAARTSSTGVVGFVGGMNVPVIKKFEAGF
FT                   KAGVKFSCPDCKVLVQYVGDTPAAWNNPAKAKTIAGSMKAQGADIIFAAAGGSGKGVID
FT                   YVNKTQCLKRTDLPKDLAFKHNQYAGVAKSAGYKAACAGDTRPMFFIGVDSNQNHLGDT
FT                   DTKSKTLNHGLTSMVKRVDNAVYAQIRDMVHGEPWRKGDRNFSLENDGVEYALDSYNRA
FT                   LVPATLQKQLQTVQRLILNGTIKVPKE"
FT   gene            complement(273308..274588)
FT                   /locus_tag="Deide_3p01990"
FT   CDS_pept        complement(273308..274588)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p01990"
FT                   /product="Conserved hypothetical protein, precursor"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p01990"
FT                   /db_xref="EnsemblGenomes-Tr:ACO48150"
FT                   /db_xref="InterPro:IPR010352"
FT                   /db_xref="UniProtKB/TrEMBL:C1D3S1"
FT                   /protein_id="ACO48150.1"
FT                   /translation="MKKPVKIAAISAALLLGSAGIAAVAGQQTQKDIQAQLSRTQKALN
FT                   DSGMATVVSGPFQGNAFGGTQTTTITVLPESEDPLVITLNSRVYSGPFPQGKRFGAATV
FT                   ITNVLFEPDLQAQLDKAFGGKKIELNTLVQFGGTSTTTFKVPGGTLTDEGTTVAWQPAG
FT                   GTVRAAGNQVFTAGEWPGAQVTGEELRMNFGRVQWDLKAAQAADNLGDGMGNITLAELK
FT                   VSGADGADFALKGLNVRTESRGSATTFDSMVSYGIKALTVGGKDIEDIKLNLTLKNLDR
FT                   SALVKLNEATRGGKTLSDRTIDGIVSEMLGAKPALVLDRLSVGTGQDEVRLNGLIGMKA
FT                   PAGTDWTRVSENPELLMGLLHVKVHGEAERAALIDLLSTVAPSPEMAPELINMGEKSGM
FT                   LIKEGSRIVTDVSLSEHGLMVNGQPLQ"
FT   gene            complement(275050..276024)
FT                   /locus_tag="Deide_3p01997"
FT   CDS_pept        complement(275050..276024)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p01997"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p01997"
FT                   /db_xref="EnsemblGenomes-Tr:AHX26578"
FT                   /db_xref="GOA:X5H5Y2"
FT                   /db_xref="UniProtKB/TrEMBL:X5H5Y2"
FT                   /protein_id="AHX26578.1"
FT                   /translation="MMSRVPRKELSEEKRNPEARDCRTSLKLSLTYFLAVTHVLVSLAL
FT                   AGGVGVLTHKSLPPFTQRWELYGGVSSYQLYLERGTVDGRFRWCITEQTRFHCVPYEST
FT                   FLGFTPRLQYLADERLAINGLVNGQYHTIILNRDLRVVEIRPLGTVIGKATFSYKRGQR
FT                   GVTRHEKGKRHEVLIKSLDGMPHDNVMAVLPFRDAPAVITGGGWVHTAKQAVRLTDEVI
FT                   TDVEPDQDGFVMASRTKLFLHRGALMRKAVRSVSTPGLQSFCVAQDYVVYATPTALMAV
FT                   HKSSLTVQKIRDGKVRSLACNPTLSRFVANFVHGAVQFDLSSP"
FT   gene            complement(276244..276996)
FT                   /locus_tag="Deide_3p02000"
FT   CDS_pept        complement(276244..276996)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p02000"
FT                   /product="putative transcriptional regulator, AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p02000"
FT                   /db_xref="EnsemblGenomes-Tr:ACO48152"
FT                   /db_xref="GOA:C1D3S3"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:C1D3S3"
FT                   /protein_id="ACO48152.2"
FT                   /translation="MNDPRRWLQPAPDGSWPIEVLLDEVPDLIFYVKDVQGRYVSVNET
FT                   LRRRCGAQHKRDVLGRTAAEVFTGEPGHRFNEQDDYAMRHRRELRDVLEMYVGPQGEAL
FT                   WCLTHKLPVVNDDGVVVGLAGVSRDVPPLSERHADFARVAQALAFMHAHFARPLRTSAL
FT                   AAQVGLSEDSFERLMRRVCHMTPKQFLLRVRFDAALRLLRESRRSVADIAHECGYSDHS
FT                   AFSRKFRAMTGFTPQEYRHRLQHAGRDD"
FT   gene            277109..278017
FT                   /locus_tag="Deide_3p02010"
FT   CDS_pept        277109..278017
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p02010"
FT                   /product="Conserved hypothetical protein; putative membrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p02010"
FT                   /db_xref="EnsemblGenomes-Tr:ACO48153"
FT                   /db_xref="GOA:C1D3S4"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:C1D3S4"
FT                   /protein_id="ACO48153.2"
FT                   /translation="MTQAHSVPISPVSTNHREEVSGIGLALVSAAASGTLGVWGKLAMG
FT                   LSLSTPTLLTWRFGLTTLLLLALGSFKVSRRERVTLLLLGVLYAGTTVAYFMALTRITA
FT                   STSALLVYVAPAFVILYGVMARVRPTRWQLGALACTLLGLTVVIGMPGAADGDVLGLLF
FT                   GGLSGALYGAYLFASGRVARDVPPLTLTAHVTLVCTATFMLMGGVTGQLAVPVMLEHWG
FT                   VILAMILIPTLVALPALAGAVRRIGAARVSLLASTDPLWAVAFATLLLGEVLAVSQVLG
FT                   GLLILVGAAFAQRSDRAAPAQ"
FT   gene            complement(278349..279395)
FT                   /locus_tag="Deide_3p02020"
FT   CDS_pept        complement(278349..279395)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p02020"
FT                   /product="putative CheB methylesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p02020"
FT                   /db_xref="EnsemblGenomes-Tr:ACO48154"
FT                   /db_xref="GOA:C1D3S5"
FT                   /db_xref="InterPro:IPR000673"
FT                   /db_xref="InterPro:IPR011247"
FT                   /db_xref="InterPro:IPR035909"
FT                   /db_xref="UniProtKB/TrEMBL:C1D3S5"
FT                   /protein_id="ACO48154.2"
FT                   /translation="MLPYWLVVIGASAGGTKPLMDLVANLPADFPAAVCLTTHIPPYTP
FT                   SHLPEILGRSGLLPVVHAQDGEPIQPGRIYCAVPDHHLLLQDECLGVKKGPKENRVRPA
FT                   VDTLFRSAAYSAGPGVIGVVLSGMLDDGTSGLWTIKQFGGIAIVQDPEDAEHSSMPASA
FT                   LNQVEVDHTVRGQDLGDLLVQLVAEPLPYAAGVDIDPATQHRVKTEVKIALSDHAFRKG
FT                   VMEFGKVTPQTCPECGGVLVQIKEGGFTRYRCHTGHAYTGDTLLVGVTEHVEETLWRTM
FT                   RTMEEAVMLLENTGREFAQAGDQRLAEAYKRKARDLEERSVLIFRDVTENERLSVDTLK
FT                   NEVQHRNP"
FT   gene            complement(279793..280488)
FT                   /locus_tag="Deide_3p02021"
FT   CDS_pept        complement(279793..280488)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p02021"
FT                   /product="putative iron dependent repressor"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p02021"
FT                   /db_xref="EnsemblGenomes-Tr:ACO48155"
FT                   /db_xref="GOA:C1D3S6"
FT                   /db_xref="InterPro:IPR001367"
FT                   /db_xref="InterPro:IPR007167"
FT                   /db_xref="InterPro:IPR008988"
FT                   /db_xref="InterPro:IPR022687"
FT                   /db_xref="InterPro:IPR022689"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR036421"
FT                   /db_xref="InterPro:IPR038157"
FT                   /db_xref="UniProtKB/TrEMBL:C1D3S6"
FT                   /protein_id="ACO48155.1"
FT                   /translation="MRERLTPQSEDCLKAIYLLSREGKAGTQDIAQSLGITSASVTGML
FT                   KRLAELQLVSYQAYKGVQLTAAGESVALEILRHHRIIEAYLHHSLGVPLEELHQEADRL
FT                   EHHISESLEARLFAALGAPTHDPHGDPIPSLTGVMPREARRSLMDVRAGETVRVGRLAQ
FT                   NDPSRLAALASLGVVPGTDLEVLEVDSLGVIRVQLPDSDSFALGTTVAEGIWVEDEVAS
FT                   ALKETPATL"
FT   gene            complement(280565..281173)
FT                   /locus_tag="Deide_3p02031"
FT   CDS_pept        complement(280565..281173)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p02031"
FT                   /product="Hypothetical protein; putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p02031"
FT                   /db_xref="EnsemblGenomes-Tr:ACO48156"
FT                   /db_xref="GOA:C1D3S7"
FT                   /db_xref="UniProtKB/TrEMBL:C1D3S7"
FT                   /protein_id="ACO48156.1"
FT                   /translation="MERTPHLENTMTPGTFHHHTLNPRVNFETVVNTASLLFFVVLRCA
FT                   YGLAWIMAGVTKETEKHWWSEPGLFLRQYLLEALDKPNVVEPYKHFLRIVVMENLLIFN
FT                   YTIPVVQVIAGALIMIGLFTLPMLFVCLFMHINFVLSGNMNEISLFLYTAVFVLFIGWS
FT                   KTISMSVDARLKSTRLRRQGTQLAPAGVADSEIAVNMRA"
FT   gene            complement(281307..281951)
FT                   /locus_tag="Deide_3p02032"
FT   CDS_pept        complement(281307..281951)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p02032"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p02032"
FT                   /db_xref="EnsemblGenomes-Tr:ACO48157"
FT                   /db_xref="UniProtKB/TrEMBL:C1D3S8"
FT                   /protein_id="ACO48157.1"
FT                   /translation="MHLLTLRLGVRPGAGLLTYNGQLEDVFLFVVLQDLDRKSGEFRKP
FT                   ADASRRRLMCLARHAARVICEQHVSLHRRQCRNKHSGSVLRKQAHVSTRSRNFISGGRE
FT                   VRGIQALHSGLIRDALKFKVKASLIDIRYPSCCPPQTFHQQKSQKGKFASLESSVFTCS
FT                   RPAPCWRGGLSADPFSSTGQCLAVQQHVCLSASGFAQGEKPAGLLRGGRPT"
FT   gene            281972..282580
FT                   /locus_tag="Deide_3p02033"
FT   CDS_pept        281972..282580
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p02033"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p02033"
FT                   /db_xref="EnsemblGenomes-Tr:ACO48158"
FT                   /db_xref="UniProtKB/TrEMBL:C1D3S9"
FT                   /protein_id="ACO48158.1"
FT                   /translation="MRVPLAILQHSMLNPTLEHQSGVYDRKNWQLEQDSGDVSMAWSGC
FT                   TVDGPIPGRGSRTRLQLRYRRPTPGHASTTRRLGRTLSRTGLGVRRGPVVPDPAGREAS
FT                   NSSSVIRPAAQGNARCTERVEVYAGFEIRGPVLPASNVLGERHHGSGVRGLARVRLGTS
FT                   GKSDRCYSNTSSRKTAGTSEQENFYSSGSSMWDGGISPS"
FT   gene            282771..282980
FT                   /locus_tag="Deide_3p02038"
FT   CDS_pept        282771..282980
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p02038"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p02038"
FT                   /db_xref="EnsemblGenomes-Tr:AHX26579"
FT                   /db_xref="UniProtKB/TrEMBL:X5GYB3"
FT                   /protein_id="AHX26579.1"
FT                   /translation="MTLLSSPTEPCVPTTVYHADHGRLCVCPTTGGLYVTIQPYGAPAQ
FT                   SITIDREQVLELIHQLQREYPTES"
FT   gene            complement(283032..283445)
FT                   /locus_tag="Deide_3p02040"
FT   CDS_pept        complement(283032..283445)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p02040"
FT                   /product="putative response regulator, cheY"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p02040"
FT                   /db_xref="EnsemblGenomes-Tr:ACO48160"
FT                   /db_xref="GOA:C1D3T1"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:C1D3T1"
FT                   /protein_id="ACO48160.1"
FT                   /translation="MPAPYHYLLVDDDPTDRLLAEEAFNHLSSSCTLSCAASGEDALRQ
FT                   LRNGEVRPDVILLDINMPGLTGFQVLEQLKQEPSLRTIPVVMLSTSKANADITQAYNLN
FT                   ASSYLVKSSGFDAFVQQAEAFLSYWQANRVPMP"
FT   gene            complement(283482..284321)
FT                   /locus_tag="Deide_3p02050"
FT   CDS_pept        complement(283482..284321)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p02050"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p02050"
FT                   /db_xref="EnsemblGenomes-Tr:ACO48161"
FT                   /db_xref="UniProtKB/TrEMBL:C1D3T2"
FT                   /protein_id="ACO48161.1"
FT                   /translation="MTNPRDDHRAAELLDVTENASFNSARRHVGAAGFVQRDVLEQIIS
FT                   AGKEQIGVTRSLRQVIDVTQAQLRDLAGGGSSPEAQLHIATLQGIIASSQEQKKTATDL
FT                   REAIQRTLENVRGTPLEDVSGTLLHTLSAVVQRQMEQLQDLITTALQEADTAGQVAQLQ
FT                   QVSTEAHARQIQTEHEQAERDLAQLEVLGSEALDRVRELEESGRTHAVQRADLEQKADS
FT                   TRSLISALEREEGENLAQLTRLEQERVVSAEVQHALEVQVVESKARLETTPLHESQE"
FT   gene            complement(284614..285495)
FT                   /locus_tag="Deide_3p02060"
FT   CDS_pept        complement(284614..285495)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p02060"
FT                   /product="conserved hypothetical protein; putative membrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p02060"
FT                   /db_xref="EnsemblGenomes-Tr:ACO48162"
FT                   /db_xref="GOA:C1D3T3"
FT                   /db_xref="InterPro:IPR000432"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:C1D3T3"
FT                   /protein_id="ACO48162.1"
FT                   /translation="MGYACALITVVIWSGFILVSRLGAQGTLSAFDVAALRFGVSGLVM
FT                   LPYLLRHGTGGLTLLQVAALGVTAGLGYALLAYSGFHFAPAAHAAVFMPGMLPFFTAAL
FT                   AWWLLGERWTRGRLLGLAVVAAGVALLVADELGRGGTTWRGDLLFLSASVSWAVFGVLA
FT                   RRWRVQPLQATAVIGVFCLVTYWPPYLLSGHSNLLEAPLAEVVIQGVYQGLLAVVVALI
FT                   TYTRALQILGPNLTTTITSLTPALAALSAVPLLGEELSALAVLGVMIVTLGVLVSVIRP
FT                   RSTPTAQVSDED"
FT   gene            complement(286092..286979)
FT                   /locus_tag="Deide_3p02070"
FT   CDS_pept        complement(286092..286979)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p02070"
FT                   /product="putative O-Glycosyl hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p02070"
FT                   /db_xref="EnsemblGenomes-Tr:ACO48163"
FT                   /db_xref="GOA:C1D3T4"
FT                   /db_xref="InterPro:IPR000757"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="UniProtKB/TrEMBL:C1D3T4"
FT                   /protein_id="ACO48163.1"
FT                   /translation="MNLEPESPHSDRILEDDSRALPAFRSPDQGPFAPQERSSYQLEFQ
FT                   EEFEGATLSEHRWLPFYLPHWSAREKSSARYTLPGKGLHLHIERDQEPWLPDIDGALRV
FT                   SCLQTGSFSGPVGSCIGQHRFHPDLRVREEQPTLQLYAPLYGYFETRFQAVPIPGYMVA
FT                   LWMIGVETQPHESGEICICEVFGQDMTAETAQVRYGVHPFGDTSLYDEFYTETFQMDAS
FT                   QFHTYAVDWKPDSLTFFVDGVAVRTIHQSPSYPMQFMLTLYELPHQLTEASVDAPWPRT
FT                   AHIDYVRGYRRRGQ"
FT   gene            complement(287325..288350)
FT                   /locus_tag="Deide_3p02080"
FT   CDS_pept        complement(287325..288350)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p02080"
FT                   /product="putative transcriptional regulator, LacI family"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p02080"
FT                   /db_xref="EnsemblGenomes-Tr:ACO48164"
FT                   /db_xref="GOA:C1D3T5"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:C1D3T5"
FT                   /protein_id="ACO48164.1"
FT                   /translation="MATIQDVARLAGVSPTTAKRALREPDKLTPDTLARVQAAVQTLAY
FT                   EPDQRAGSLRGGQSRTIGLTVASIVEPFFAEFARTVSRTLGEAGYTIIISEIEYTAARE
FT                   VKELQRLYGQRVAGILLRPGYGPESRAYIHRLVSKGVHILEYDYVPPGSPYPHVNVDHV
FT                   GAIRQAVQYLHSLGHRHIAALGTYHPLIHPETRSQSFPAIMAELGLTVLPEYQRVTLLT
FT                   EETAFRLTHELMALPTPPTAIIALAGTQGIGAFRAIRERGWKIPDDISLVTFDNYSWTS
FT                   LVTPPVTVIEQPVHDMAVTAARNMIALLEGHTVTSQVFPANLIPRQSCAPPRSAISSKV
FT                   G"
FT   gene            288585..289907
FT                   /locus_tag="Deide_3p02090"
FT   CDS_pept        288585..289907
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p02090"
FT                   /product="putative sugar ABC transporter, periplasmic
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p02090"
FT                   /db_xref="EnsemblGenomes-Tr:ACO48165"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:C1D3T6"
FT                   /protein_id="ACO48165.1"
FT                   /translation="MKRIALLSLSLFASAQAATITIATVNNPDMVTMQKLTPEFNKKYP
FT                   DINVKWVVLPENELRQKITLDVASGAGSFDIATVGAYEVPIWAKNGWLKPLTPLFSKNP
FT                   AIASSYKLNDVLPGVRGALTVKGQLYAVPFYAESSMTFYNKDLFKAAGLTMPANPTWKQ
FT                   IQSFAAKIHNPSKGVYGICLRGLPGWGENMAVFSTVVNTFGGRWFDQNWNAQLNSPAWK
FT                   NAMTFYVDTIRKYGPPGATSNGFTENLTLMSQGKCGMWVDATVAAGFLSDPSSSKITKS
FT                   VGFAAAPVGTTPRGNAWYWSWNLAIPKSTKQEDAAFKFITWATSQEYIALVAKTKGTWA
FT                   SVPPGTRTSTYNNANYKKAAGAFSAQVLSSISKADVNKATKDPVPYTGIQYVAIPEFQA
FT                   LGTQVGQYLAGAISGQTTVDQALKQAQEAAQRVAKEGGYQK"
FT   gene            290004..290930
FT                   /locus_tag="Deide_3p02100"
FT   CDS_pept        290004..290930
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p02100"
FT                   /product="putative sugar ABC transporter, permease
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p02100"
FT                   /db_xref="EnsemblGenomes-Tr:ACO48166"
FT                   /db_xref="GOA:C1D3T7"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C1D3T7"
FT                   /protein_id="ACO48166.1"
FT                   /translation="MTAITPPTTVTTTSPAPKRGLRLTPSVLIWPAMLYLILTTQVPFF
FT                   MTVYYSFFRYNLVDPSSRPFIGVQNYVTLLTDPQNLRILGNTVLLAGGSLLLTLILGGA
FT                   LALLLNRQFAGRALLRTLMISSFLVMPIVTAVIWKNMLLNPVFGFFSWVVASLGGQPVD
FT                   WLAQYPMASVIAMVTWEWTPFAMLILLTGLQSLPDDQIEAARLDGASPMQEFRHIVLPH
FT                   WMQAIQVVVLMETIALLQVYGEIYGSTSGGPGVATTNLPYFIYQKAFAEYNIGLASAAG
FT                   VITVILTNILAVYLLKLINRSTSSRGG"
FT   gene            290932..291777
FT                   /locus_tag="Deide_3p02110"
FT   CDS_pept        290932..291777
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p02110"
FT                   /product="putative sugar ABC transporter, permease
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p02110"
FT                   /db_xref="EnsemblGenomes-Tr:ACO48167"
FT                   /db_xref="GOA:C1D3T8"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C1D3T8"
FT                   /protein_id="ACO48167.1"
FT                   /translation="MTASPFIRNVSDRHRVRNILLTVLTYLLAAAFLFPLVWMFMAAFK
FT                   TEAQAFAAPPVFSFTPIFDNFERALPGYLPALKNSLVAAVGSTILAFILGLPAAFALAV
FT                   YPTRRAQGVLTWMLSTKFMPAVGVIVPLFLLFRNLQLLDTLPGLILMYTTMNLPLVVWM
FT                   MHSYMTEIPFAIYEAAKVDGATVGQEFFRIALPLSTPGMAATALLCLIFAWNEVFFALN
FT                   LTSSDAAPLSVFIGSFKTSMGLFWAQLSAAAVLTVLPVLIFGWVAQRQLVRGLSFGAVK
FT                   "
FT   gene            291921..293504
FT                   /locus_tag="Deide_3p02120"
FT   CDS_pept        291921..293504
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p02120"
FT                   /product="putative mannitol 2-dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p02120"
FT                   /db_xref="EnsemblGenomes-Tr:ACO48168"
FT                   /db_xref="GOA:C1D3T9"
FT                   /db_xref="InterPro:IPR000669"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013118"
FT                   /db_xref="InterPro:IPR013131"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR023027"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C1D3T9"
FT                   /protein_id="ACO48168.1"
FT                   /translation="MTVKLNASTLATLNRNVAVPQYDPSQLTSGIVHFGVGAFHRAHQA
FT                   MYLDRLLNTGAGSEWAICGVGLLPGDARMRDVFAAQDNLYTLVTRSPEGHSEACVIGAI
FT                   REYLYAPDSPEAVLEKLADPATKIVSLTITEGGYGTNNATGEFDPSTPELQHDLTEGAV
FT                   PRTVFGFITEGLRRRRERGLLPFTVMSCDNMQGNGHVTARAFISFARLKNPELAEWISQ
FT                   GVAFPNSMVDRITPVTTPQIQQDVADQYGIDDAWPVVAESFTQWVLEDTFTLGRPPLEQ
FT                   VGVQLVQDVEPYELMKLRLLNATHQAMGQLGLLAGYTYAHEVCQDPVFVDFLLGYMIDE
FT                   ATPTLHPVPGVDIAAYREQLIARFASTAIQDTLARLVVDGSERIPKFLLPVVRERLAAG
FT                   GSVNRSALVVAAWSRYIAAAHEGHYPALVDPRAESITGGAVRDVQHPGAFLELQDIFGD
FT                   LAQNARFREAYLTARNTLDSHGALGAIQVMVQQHAAAPVQPLSPAFTSPKTATNLPDAG
FT                   QSKPVHEETP"
FT   gene            293501..294595
FT                   /locus_tag="Deide_3p02130"
FT   CDS_pept        293501..294595
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p02130"
FT                   /product="putative L-iditol 2-dehydrogenase (Sorbitol
FT                   dehydrogenase); putative Alcohol dehydrogenase GroES-like
FT                   domain; putative L-threonine 3-dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p02130"
FT                   /db_xref="EnsemblGenomes-Tr:ACO48169"
FT                   /db_xref="GOA:C1D3U0"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C1D3U0"
FT                   /protein_id="ACO48169.1"
FT                   /translation="MTSSDLASHSAARSSRTSVLHGIRDLRWETRDVGVPGPREVRVRV
FT                   RRIGVCGSDIHYYTHGRIGQYVVDAPLILGHEVMGVVDAVGEEVTRVKAGDRVALEPGY
FT                   PCRRCAYCKRGEYNLCPDMTFMATPPIHGALSEHVLWPDDFVFPLPDSLSDDAGALIEP
FT                   LAVGVWAARKGAVTPGQSIAVFGAGPIGCTTLQAAKAAGATTLIAVDLEDFRLDLARQV
FT                   GATHTINARHEDPTQRIREITRSDLPESHAGVDVAFETAGSLPTTRLSLAAPRPGGSTV
FT                   LVGLPPDPEVSLDIVSAASREVTIRGVFRYANCYPAAIALVESGAVNLDALVTHRYTFD
FT                   QTPEAFEFADREKRTSMKVMIDVG"
FT   gene            295395..295847
FT                   /locus_tag="Deide_3p02131"
FT   CDS_pept        295395..295847
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p02131"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p02131"
FT                   /db_xref="EnsemblGenomes-Tr:ACO48170"
FT                   /db_xref="UniProtKB/TrEMBL:C1D3U1"
FT                   /protein_id="ACO48170.1"
FT                   /translation="MSSSPGRPKRARILMADVELSRRAEGTENSWTQRLACRHCGGWPV
FT                   IRDVVNELAQILPERVKISPVSFTVRHSQRSHWTSWGNHNGPILLELALREEIEARGWY
FT                   WSVESTPNNEYSAVIHKGVKTFSAYACASTPTEALACALMAALKAP"
FT   gene            295962..298136
FT                   /locus_tag="Deide_3p02140"
FT   CDS_pept        295962..298136
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p02140"
FT                   /product="putative
FT                   UDP-N-acetylmuramoylalanyl-D-glutamate--2,
FT                   6-diaminopimelate ligase (MurE synthetase)
FT                   (UDP-N-acetylmuramyl-tripeptide synthetase); putative Mur
FT                   ligase family protein; putative Cyanophycin synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p02140"
FT                   /db_xref="EnsemblGenomes-Tr:ACO48171"
FT                   /db_xref="GOA:C1D3U2"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR018109"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:C1D3U2"
FT                   /protein_id="ACO48171.1"
FT                   /translation="MTLPRGVTATGYAGNTHDAPPAKDTTVVTGSQAAPSEGRTTLPMR
FT                   VLERGVYRGPHVHSMRPMVRIVLDLGALEAWPTTRLPEFTDALLEQLPTLKSHPGSSRQ
FT                   PGGFIRRLQEGTRLGQVAQHIALELQSIVGERTRHGRTLRAHGQSGLYTVMYTYRDEHV
FT                   GFLAGFLALRLVDSLLPPQLQGLRNLERLYHDPAEPALTAVPFDLAAAMAALERLAHRT
FT                   SPDPATEAIVRAARRRDIPVIHLDDGEVQLGYGHHARLVQRSSAGDTRHPAPGAGMDGK
FT                   EPDLSRSAVDPVRGVQRHPPASDGQLRGVAKAVLEQLFPSGSRSRIPILALTGTNGKST
FT                   TARMVAHILAHAGHTVGFTNTSGVYVADKRIHSGDATGPKSARMVLRHPAVTVAVLETA
FT                   RGGLLREGLGFDRADVGAVLNVKSDHLGLGGVNTVRDLARVKSLVVRVVASSGLSVLNA
FT                   DDPLTLGMRRVARGRIALFSISGLDGNKALRDHIDAGGLAVVCEPQADGDVIAVYDGGE
FT                   RQSLMRAADIPATLGGLARFNVENALAAAAMCLGLDLTLEVIRSALTTFTSSFEQSPGR
FT                   LNVHDAHGFRVILDYAHNPDALAAQRALLHRLRSPGGRLIGMVSVPGDRRDDDIREVGE
FT                   IAAGTFDELVFREGPDGRGRPRGETMSLMAEGARSAGFASERIHLVLEESDAVDATLNL
FT                   ARPGDIAVIMPTQVDAVWQQIVRYVPHEAR"
FT   gene            complement(298258..299322)
FT                   /locus_tag="Deide_3p02150"
FT   CDS_pept        complement(298258..299322)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p02150"
FT                   /product="putative DNA repair photolyase; distantly
FT                   putative Spore photoproduct lyase SplB"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p02150"
FT                   /db_xref="EnsemblGenomes-Tr:ACO48172"
FT                   /db_xref="GOA:C1D3U3"
FT                   /db_xref="InterPro:IPR023805"
FT                   /db_xref="UniProtKB/TrEMBL:C1D3U3"
FT                   /protein_id="ACO48172.1"
FT                   /translation="MPSRFPLDIRLIYVDPQAAQLSRGQDILNRFPDAQRIEVTSHQNI
FT                   PGLHGNAGLVKDWLRIKRQVLVLGIRKTLTMRPNGRSADFIAPGMANGCALSCAYCYVP
FT                   RHKGYANPITTFANIGDVDAALRKHVQRLGPKLEPNSVDPHSWVYDLGENSDLSVDALI
FT                   SDNVLDLVTLFRGLPNAKASFATKYVNRNLLTYDPQGRTRLRFSLMPASMARVVDIGTS
FT                   PMPERLTAINDFVEAGYEVHLNFSPVVIFEGWTAAYTELFRQIDALLSPQAKAQLAAEV
FT                   IFLTHNVGLHEVNLGWHPKAEELLWTPQWQETKRSEYGGVNIRYRRGLKGKAVERFTTL
FT                   LRRELPYCTVRYAF"
FT   gene            299583..300092
FT                   /locus_tag="Deide_3p02160"
FT   CDS_pept        299583..300092
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p02160"
FT                   /product="Hypothetical protein, precursor"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p02160"
FT                   /db_xref="EnsemblGenomes-Tr:ACO48173"
FT                   /db_xref="UniProtKB/TrEMBL:C1D3U4"
FT                   /protein_id="ACO48173.1"
FT                   /translation="MRRITWLALLTVSPLALAQNAKVPDFLQRIDSVSSRPFCRTYGCR
FT                   PLKVTVGPHETYPSVVLTTSRYEIQKIFGQLTIIRMTDGYVYDMQLTASAYPLAETHAQ
FT                   AFSALTKDLLNLSLTKDELNTCLNNARKEKDLGMYLTLVDQWAVGCALIPQDGGFKSVL
FT                   SIWPIG"
FT   gene            complement(300157..300546)
FT                   /locus_tag="Deide_3p02170"
FT   CDS_pept        complement(300157..300546)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p02170"
FT                   /product="putative transcriptional regulator, XRE Family"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p02170"
FT                   /db_xref="EnsemblGenomes-Tr:ACO48174"
FT                   /db_xref="GOA:C1D3U5"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/Swiss-Prot:C1D3U5"
FT                   /protein_id="ACO48174.1"
FT                   /translation="MKLCERLRELRQERGLRLKDIAGAAQISVPYLSDLERGRTNPSLE
FT                   TLQSLASTYGITVHDLLEGVEFYGDQTAGALPQGLADLIADPALGAQLTPDWIRTLARI
FT                   ELRGKRPRDKQDWFEIYLHLKRILD"
FT   gene            complement(300624..301013)
FT                   /locus_tag="Deide_3p02175"
FT   CDS_pept        complement(300624..301013)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p02175"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p02175"
FT                   /db_xref="EnsemblGenomes-Tr:AHX26580"
FT                   /db_xref="GOA:X5H5T0"
FT                   /db_xref="UniProtKB/TrEMBL:X5H5T0"
FT                   /protein_id="AHX26580.1"
FT                   /translation="MTSPANAKPGSWLLYIILIVLAFGLGAFLRSVPGQEDSAPQASAA
FT                   SSVITVDESGWTACPTRLGFETFSRLASSGDETASARAYETYGCTTIRKGQPVYREAGS
FT                   AFGTVVGIRYVGETRMRWTAADALR"
FT   gene            301565..302470
FT                   /locus_tag="Deide_3p02181"
FT   CDS_pept        301565..302470
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p02181"
FT                   /product="putative ornithine cyclodeaminase/mu-crystallin"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p02181"
FT                   /db_xref="EnsemblGenomes-Tr:ACO48175"
FT                   /db_xref="InterPro:IPR003462"
FT                   /db_xref="InterPro:IPR023401"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C1D3U6"
FT                   /protein_id="ACO48175.1"
FT                   /translation="MLILDARQIRQRTTYGRVAEAIADLLRSDSPPVAPPRQVIPLPSG
FT                   GAMLVMPVADEQCAVVKTVTVHLENARSGRPAIQGQVLVLHARSGTSLALLDGPAITAL
FT                   RTAAVSLLAARTWGIPEGPLLMIGAGQQAQAHLEALTEGLPPRDIWCSSVRPESMNALV
FT                   AWGDERGLRIRLAADLGQVVRDAAVIVTATTSKSPVIPDVVRDDVLVLAVGAFRPDMQE
FT                   IPPSLVERSTIVVDDLAGARHEAGDLLQARVDWNTVLTLRELVQSGAPAHGPRLFKSVG
FT                   HAFWDLAAAKLCLSPAARPL"
FT   gene            complement(302394..302801)
FT                   /locus_tag="Deide_3p02182"
FT   CDS_pept        complement(302394..302801)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p02182"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p02182"
FT                   /db_xref="EnsemblGenomes-Tr:ACO48176"
FT                   /db_xref="UniProtKB/TrEMBL:C1D3U7"
FT                   /protein_id="ACO48176.1"
FT                   /translation="MILWSTEGLLSVSPEKYDDVSNFAARLVNNIHCLEAKADFVFEIL
FT                   IALRTHFPENGLRAASLSGSNLIAHLCSWVHQYSNISRFSIQMPDPGRTSTCSSCDSQL
FT                   EPSPSGFKEAVRRGTDTVWPLLDPKKRVRRS"
FT   gene            complement(303030..305864)
FT                   /locus_tag="Deide_3p02190"
FT   CDS_pept        complement(303030..305864)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p02190"
FT                   /product="putative histidine kinase, classic"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p02190"
FT                   /db_xref="EnsemblGenomes-Tr:ACO48177"
FT                   /db_xref="GOA:C1D3U8"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C1D3U8"
FT                   /protein_id="ACO48177.1"
FT                   /translation="MLIPSSNRSGFEPLQGTLLDALPSPTWILDGQGTIIFANKAYQVQ
FT                   LRLPEMPVLRQHFTEFLGAHQQDAGAHAWRHAQDTRAPFALELQLPLEQGNDCVLAQAQ
FT                   FSYLTGFDDQWLVTLTPLQTDDVEHHELLTALDQINEAISAQLDEEGLAQTVTDAAVRL
FT                   TCAQCGVFIYTLKDQRGEQLPQYSLSGVPKDTFVNSPLHHMASAFAPKVDDRGILRADD
FT                   ITQDARFGRAPACEAMPQGSLAVRSFLAIPAISRSGEVIGRFFFSHERPGIFNGRSERL
FT                   ATIIAAQAASALDNTQLKQDARMNERRFQSLVQASAQIVWSCTPHGEFPGEQPSWSRFT
FT                   GQNAEQQLGRGWLDAIHPDDRKDVLQAWMRAVETQCLYEVQHRLRRHDGQYRFMQARAT
FT                   PVLSDNGQLVEWIGTHEDVTERHEAEMQLREREERYRALVEYTIAGVTRISLDGTFIDV
FT                   NPAAAAFLGYSQEQLAGMSVKDVTHPDDLNDTFAALGRVLSGEVAATTLEKRYVRGDGT
FT                   IVWSNSGVTVVRSETGEPQYIIAVISNITERKLAEAELHRLNLELETRVRDRTRDLEQE
FT                   RRFLRALLESLAEGIVACDAHGQVNLFNDASTRFFGLPAAPLRPIEWPAHFGLYQLDGL
FT                   TPLSVEEVPLYRALSGEQVRDQPIVIAPERAPRRYVTASGSAIFGPGGEKLGAVVALHD
FT                   VTAQREAEQAVERVTQDLKRSNAELTRFAAVASHDLKAPLRTIGSQLQLLQRRYGGQLD
FT                   EKADRMISFTVEAANRMDALIDDLLAYAQLGQQRRVTDVNAHLVMQDVLANLDATIQAR
FT                   NAHVSVGHLPWVKADETLFRQILQNLVGNALKFQPTGRAPRVRVSAIQERAFVHFTVKD
FT                   NGIGIAPAYFDQIFEVFHRLHAASVYPGSGLGLAIVRKSIEEQDGRIWVESTEGEGAAF
FT                   HFTLPAAKVTAQFR"
FT   gene            complement(306045..306986)
FT                   /locus_tag="Deide_3p02210"
FT   CDS_pept        complement(306045..306986)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p02210"
FT                   /product="putative transcriptional regulator, RpiR family"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p02210"
FT                   /db_xref="EnsemblGenomes-Tr:ACO48178"
FT                   /db_xref="GOA:C1D3U9"
FT                   /db_xref="InterPro:IPR000281"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR035472"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:C1D3U9"
FT                   /protein_id="ACO48178.1"
FT                   /translation="MSTSRPGFINLNGFRQFLQSELPEFSGAQRRLALYILQHAAELPM
FT                   LTTTALAQAAGTSQSTVTRFASRLGFSSYAAFTDALGRMVLDELHMNIPLERFRHSEGN
FT                   GGLASLINQEILHLRSLQSLVETKAFHRSVELLTQSRSVLVAGCAASTSLAVHTHLYLS
FT                   RLRPQVQCATEFNASLFTQAVHYSAGDCALLFSVPRMTGDLARMLGLLQQRDVQVILVT
FT                   DPSGLIFTEGVTETLVVPVSNTPTTAVPASMMMLASLLIDATALRLPEDSLRNLQRFEG
FT                   LAKAGNLFVANDPAVRPGWTDPTRHPEEVLSH"
FT   gene            307266..308012
FT                   /locus_tag="Deide_3p02220"
FT   CDS_pept        307266..308012
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p02220"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p02220"
FT                   /db_xref="EnsemblGenomes-Tr:ACO48179"
FT                   /db_xref="InterPro:IPR010430"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:C1D3V0"
FT                   /protein_id="ACO48179.1"
FT                   /translation="MIKLNTFSITARCEHTGQLGVAVSTAIPCVGMLCPFVQSGVGAIA
FT                   TQSFVNPYLGIWGLENLAQGHSAEATLKKLSDRDDGFDLRQIAIVDANGESAAFSGNQC
FT                   DGWYGHLTGRNYAVAGNMLTGPETLEAMQASFCQDMALPLAERLVHALAAGQRAGGDKR
FT                   GKQSAALRVFSTEQYPLVDLRVDDHPDPVSELDRIYRVVERQLLPLMDLLPSRAYPAGR
FT                   LDLDEARRRNLVQASTAPPLSPTNTT"
FT   gene            308135..309646
FT                   /locus_tag="Deide_3p02230"
FT   CDS_pept        308135..309646
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p02230"
FT                   /product="putative dipeptide ABC transporter, periplasmic
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p02230"
FT                   /db_xref="EnsemblGenomes-Tr:ACO48180"
FT                   /db_xref="GOA:C1D3V1"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:C1D3V1"
FT                   /protein_id="ACO48180.1"
FT                   /translation="MRHNRMIGFALTILLSGLSVSDAQTRGGTLRVGGQADIVGLDPHT
FT                   VSAASSAWVAEQIYDSLLTVTPTGEPAPSIAQKWTVSSDGRTYTFNLRPNVKFSDGKAL
FT                   TSKDVVYSLKRITDPKTASPRQNDLGKIASITAPNATTVVIKLKEPFAPFLTKVGGSLM
FT                   GIMPSGYAEANDVNKKPMGSGPFKYAAWVPGDSVTLERNPHYWEAGKPYLDKVIFKALK
FT                   DDVTRITNVQTGTVDLALSVPQNQVDTLKKSSSIKLVGGAGTWYDYLGLNLTKKPFGTL
FT                   KVRQAISLALNRDVIVRTALFGKGTPINCGPIPPSHWAYADCKVQVANQARAKQLLSEA
FT                   GFANGFDMTIKVGADYKSQVNIAQSIQAQLKPLKINVKVMPMEWGSFLNDFNKKNFDAV
FT                   VLGWIGSVDPDDYLYYQFRSGEKFNAQGFSDKTVDQLLDQGRRTVDKAKRREIYRKAQQ
FT                   RIAEQVGYVFLHINDQYEAFRPNVQGYVHYSTGSLESLKDTFLKK"
FT   gene            309660..310604
FT                   /locus_tag="Deide_3p02240"
FT   CDS_pept        309660..310604
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p02240"
FT                   /product="putative ABC transporter, permease component"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p02240"
FT                   /db_xref="EnsemblGenomes-Tr:ACO48181"
FT                   /db_xref="GOA:C1D3V2"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C1D3V2"
FT                   /protein_id="ACO48181.1"
FT                   /translation="MLVFAFKRLVSVIPILLGITVIAYFLTRTIPGDVVAVMLGTNADP
FT                   EVAAQLRRNLRLDQPIIVGYFDWLAALLRGDLGESIRSGLPIGQDLMTRFGRTAQLTLA
FT                   AIVLATALSIPLGILAAVRRNRAADQVISITALLGISVPDFWLGTLLILFFALKLGWLP
FT                   PAGYASPSEDPALFLKLLILPTITLAFQVMGILTRFTRGAMLEVLNQDFVRTARAKGVA
FT                   ERAVLYRHALRNALIPVITVIGLNIGFLLSGTILVETIFGWPGVGSLAVTAINQRDYPV
FT                   VQACVMLFALTFTVVNLVVDLLYGVIDARIRYS"
FT   gene            310601..311485
FT                   /locus_tag="Deide_3p02250"
FT   CDS_pept        310601..311485
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p02250"
FT                   /product="putative ABC transporter, permease component"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p02250"
FT                   /db_xref="EnsemblGenomes-Tr:ACO48182"
FT                   /db_xref="GOA:C1D3V3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR025966"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C1D3V3"
FT                   /protein_id="ACO48182.1"
FT                   /translation="MTPINATPAAPPRLSDRRRFLRKYLQNRSLMVGTVILLIMALCAL
FT                   LAPWLAPYDPAEQYTDYALQGPSPQFPLGTDMFGRDQLSRIIYGTRLSFVVSSVSVGIA
FT                   LVLGTLLGLIAVTARGWVDNVIMRVMDVLFAFPFLLLVIAIMAAFGTSLTNAMIAIGIV
FT                   YTPSFARVTRAAALNVMEQLYIEASHSLGASRSRLIFRHILPNIQGPLIIQTTLSLAFA
FT                   ILAEAALSFLGLGAQPPAPSWGLMLNEGRDFFNMADWLAIFPGLAITVAVLGFNLLGDG
FT                   LRDLLDPRSHREN"
FT   gene            312020..313198
FT                   /locus_tag="Deide_3p02261"
FT   CDS_pept        312020..313198
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p02261"
FT                   /product="putative metal-dependent
FT                   amidase/aminoacylase/carboxypeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p02261"
FT                   /db_xref="EnsemblGenomes-Tr:ACO48183"
FT                   /db_xref="GOA:C1D3V4"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR017439"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:C1D3V4"
FT                   /protein_id="ACO48183.1"
FT                   /translation="MTTVKEAQSALDAQVIAWRRHLHQHPELSFQEHETANYVEAQLRK
FT                   MKGLSITRPTPTSVLAVLRGQGGTGRTVLLRADMDALPIQENTDFDFASRNDGVMHACG
FT                   HDGHTAMLLGAAQVLSEQQEQLRGEIRFIFQHAEELFPGGGQQVVDAGVMDGVDVAVGT
FT                   HLFSPIPVGLVALKSGPLMAAPDTFEVTVVGKGGHGAMPQETIDPIVIACHVVTAMQSI
FT                   VSRQRDPLEPAVVSVTTIHAGTAHNVIPNTAVLTGTVRTFDPALREQIPQLMERLVRGI
FT                   TEAFGATYEFRYEQGYRATINDPAVTEVLREVVQETVGAQALVEAQPTMGGEDFSAYLS
FT                   RAPGAFIFIGARNEEAGITAPHHHPNFAIDEDALAIGVKVLVGAARRLSAGA"
FT   gene            313538..315124
FT                   /locus_tag="Deide_3p02270"
FT   CDS_pept        313538..315124
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p02270"
FT                   /product="putative dipeptide ABC transporter, periplasmic
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p02270"
FT                   /db_xref="EnsemblGenomes-Tr:ACO48184"
FT                   /db_xref="GOA:C1D3V5"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:C1D3V5"
FT                   /protein_id="ACO48184.1"
FT                   /translation="MIKKLLCTGLTLALISGTASASTLVFGAGGEPVSLDSGTITDGNS
FT                   SLAQALVYDMLVRFKKGTTTITPGLATSWKANKDASEWTFTLRPNVKFSDGTPFNANAV
FT                   VFNVNRWWDQAADAGAKEHSKTFTSWTFIFGGFKGEQNSLLKSVRADGPNKVVFTLNRS
FT                   FAPFPEALATPFFGIASPDAVKKAGARYGTPAALPVGTGPFIMQSWKTGDRITLVPNKG
FT                   HWGKKASYDQLLLRFLKDPSVRLNELKAGTIDFTTDLNPDQLNVVKADKNLNPVIIPGF
FT                   NVGFLSLNLGNQHLKNDKVRQAISMAINKKAIVEAFWGDLGVSDASFLPPALGWANSKK
FT                   VPADYKFDPAAAKKLLAEAGYPNGFSIDLWYMPVSRPYFPTPKPIAEAMAADLGAIGIK
FT                   ATLKTEDWAKYLEDRNKKPGFDMYMIGWTGPYASPYNFYNVYYGEEASADSNYGNPKLF
FT                   QLLRTAVATSSRSAQAKAYSQIHEISYDANVRIPIVHSRPLAAARTYVKGWVPSPSVIT
FT                   PFEDITISGKK"
FT   gene            complement(315640..316035)
FT                   /locus_tag="Deide_3p02280"
FT   CDS_pept        complement(315640..316035)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p02280"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p02280"
FT                   /db_xref="EnsemblGenomes-Tr:ACO48185"
FT                   /db_xref="InterPro:IPR009794"
FT                   /db_xref="InterPro:IPR036698"
FT                   /db_xref="UniProtKB/TrEMBL:C1D3V6"
FT                   /protein_id="ACO48185.1"
FT                   /translation="MKSYGHRIWCVPAGHIPLRSTGEEPRYTSYDQLCILNTGDQDAQL
FT                   KLSIFYADRDPEGPYLLCVASRRVRHVRVNDLIDPRAIPLDVEYACLVESEVPVVVQFV
FT                   RQDTSAGAQALMTSMAYPLHDPGDHQE"
FT   gene            complement(316032..317327)
FT                   /locus_tag="Deide_3p02290"
FT   CDS_pept        complement(316032..317327)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p02290"
FT                   /product="putative FAD/FMN-containing dehydrogenase;
FT                   putative L-gulonolactone oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p02290"
FT                   /db_xref="EnsemblGenomes-Tr:ACO48186"
FT                   /db_xref="GOA:C1D3V7"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR007173"
FT                   /db_xref="InterPro:IPR010031"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR016171"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:C1D3V7"
FT                   /protein_id="ACO48186.1"
FT                   /translation="MSHLHPDCPPFTFLNWSGSLRFTADELARPRSEEELASLVRSSAA
FT                   AGATVRVCGHGHSSVPLMQTKQQLISLEYLRGLIDHNGDEQTATVWAGTPLREVGEALY
FT                   QAGLALHNYGDVATQYIAGAFGTGTKGTGRRLRDLSSALIQVRFVTASGEVQEWNENEH
FT                   PDQLRAARVSLGTLGIFTQLKLRVLPTYDLHRQEFCTTTALCLEHLDELIEHNRNFDFY
FT                   WYPRSDAVKLRLLNEPGKEQGALPYARLVKEETSPSWQALPRNRTLKFDEMEYAVPLEA
FT                   GPACFLEVRDRILERHRQHVGWRVLYRTVEQDDSWLGNASGRASVTISLHQNAGLAYWP
FT                   FFKDIESIFRAYGGRPHWGKKHTLGGTQLRDLYPHWDDFQLLRGRMDPQGMFLNDYLRA
FT                   LLGEQESSEGAVRVHEVPLHEISPKAAPEERA"
FT   gene            complement(317340..318341)
FT                   /locus_tag="Deide_3p02291"
FT   CDS_pept        complement(317340..318341)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p02291"
FT                   /product="putative permease; putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p02291"
FT                   /db_xref="EnsemblGenomes-Tr:ACO48187"
FT                   /db_xref="GOA:C1D3V8"
FT                   /db_xref="InterPro:IPR002549"
FT                   /db_xref="UniProtKB/TrEMBL:C1D3V8"
FT                   /protein_id="ACO48187.1"
FT                   /translation="MLMGSVSTVAIVTIAVLLTLGGLHVTQDATLPLVFGAVIALFFRP
FT                   LQRRLEQRLPRWLSVALIILLFLAFLALILGSVVYAVNVVAQDLPRYAERLKGYGIRLP
FT                   DSLSSGSPSGSNVMGVVFGGLRAVLSPLGLTGLLLVFLVLLLAEADAWRRRLVQAFGAE
FT                   RGRRLTDAFGRMGRQFEQFMWVQTVTGLITAVLTWGICALVGLPFPFVWAVLTFVLEFF
FT                   PTIGSLLSVVPPVLFAFAFGGAAQGALVLLGLTVVQLGVGSLLNPKWQGDRLKLSPTVV
FT                   AFSVVFWGWLWGVGGAIIAVPLTAGIALLLSEFSSTRPLAVLLGHSEGPEGS"
FT   gene            complement(318725..320089)
FT                   /locus_tag="Deide_3p02300"
FT   CDS_pept        complement(318725..320089)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p02300"
FT                   /product="putative NRAMP family Mn2+/Fe2+ transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p02300"
FT                   /db_xref="EnsemblGenomes-Tr:ACO48188"
FT                   /db_xref="GOA:C1D3V9"
FT                   /db_xref="InterPro:IPR001046"
FT                   /db_xref="UniProtKB/TrEMBL:C1D3V9"
FT                   /protein_id="ACO48188.2"
FT                   /translation="MNDRAHGQPDSEHSRVPEAPQGRERLKWLGPSFLWMMSAAGSGEL
FT                   LFTPRIAAQYGYTLLWALLIAVAFKWFINREVGRYAVCTGGNVLRGFANLPGPRHWALW
FT                   FILVPQIVVAVATVAGLAGTAGTAGALFTSGGAAAWSIGIVLLAGTVIVLGQYKLVERV
FT                   ITWLAVLITLAVLVTAISVTPDLGALAGGLAPQLPAGVDFAEVVPWLGFMLAGAAGLVW
FT                   FSYWVQARGYGAAYAAEEVDPHSLSDTERSRLRGWLAFLTLSNTLAVVGALIIAVAFLI
FT                   LGTELLRPEGLVPDESEVARTLGRLLGDVWGPAGFWFMVTAVVVTFSSTILSAQDGFAR
FT                   MFSGGVRTLLTGFGVRASEVNRTWMRRGVVVGLLVALPIGAYLLFGEPVALLQLAGAIE
FT                   AAHIPVVALLTLLLNRRALPQELQPSGLALAATALAAVFFAAFAAYYMYQVATAG"
FT   gene            complement(320082..320393)
FT                   /locus_tag="Deide_3p02301"
FT   CDS_pept        complement(320082..320393)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p02301"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p02301"
FT                   /db_xref="EnsemblGenomes-Tr:ACO48189"
FT                   /db_xref="UniProtKB/TrEMBL:C1D3W0"
FT                   /protein_id="ACO48189.1"
FT                   /translation="MISPTRALDISWPPEFGPNRRTASVAQGVLARMPALLRIFLPKDG
FT                   DHVLDVLRQDDWRFEPWPCNLTFRFIRPSLPGHERPAGRPARVKYRFICSGHERSRHE"
FT   gene            320873..321880
FT                   /locus_tag="Deide_3p02310"
FT   CDS_pept        320873..321880
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p02310"
FT                   /product="putative 5,10-methylenetetrahydromethanopterin
FT                   reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p02310"
FT                   /db_xref="EnsemblGenomes-Tr:ACO48190"
FT                   /db_xref="GOA:C1D3W1"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR019945"
FT                   /db_xref="InterPro:IPR023907"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:C1D3W1"
FT                   /protein_id="ACO48190.1"
FT                   /translation="MTDPTIGFHASHEQFTPAELLRLVRFAEQAGFGAGMCSDHFHPWT
FT                   PAQGQSGFAWAWMGAALQATSWSFGAVSAPGQRYHPAILAQAAATLAQMFPDRLWCALG
FT                   SGQHLNEHITGQRWPTKTERNERLLECVQIMRALWRGETVTHRGHVVVEEAKLYTLPAR
FT                   PPLIVGAALTPETARWVGSWADAMITVSAPHDELRQMVEAFRAGGGDGKPMYLQVHLAY
FT                   APTSEEALAAAHQQWRANVFGSPIQSEVKTPEQYETLGSRVRPDDMHGVVRISSDVEQH
FT                   LTWLRQDLDLGFDHLYLHETGPHQERFIEVFGQQVLPRLRGGLTAFPARRSGQS"
FT   gene            322178..322366
FT                   /locus_tag="Deide_3p02312"
FT                   /note="nonfunctional hypothetical protein"
FT   gene            complement(322634..323056)
FT                   /locus_tag="Deide_3p02315"
FT   CDS_pept        complement(322634..323056)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p02315"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p02315"
FT                   /db_xref="EnsemblGenomes-Tr:ADT91188"
FT                   /db_xref="UniProtKB/TrEMBL:E6RGA7"
FT                   /protein_id="ADT91188.1"
FT                   /translation="MAVLVEAITVITRLSSIESHFQGGLDAFHALLPNASSCADAHLIR
FT                   VGFMTPQDTQQFVDQLVAGGLRLFDGQHFVDVAVVDQINGPTAPTPWLNIYQITEDRIQ
FT                   FAALAGTDPGELVVPTAWTVEESLYRTGSFAQERQD"
FT   gene            complement(323119..325410)
FT                   /locus_tag="Deide_3p02320"
FT   CDS_pept        complement(323119..325410)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p02320"
FT                   /product="putative transcriptional regulator, LuxR family"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p02320"
FT                   /db_xref="EnsemblGenomes-Tr:ACO48191"
FT                   /db_xref="GOA:C1D3W2"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:C1D3W2"
FT                   /protein_id="ACO48191.1"
FT                   /translation="MDGRERHHVWGAGGRQPRLVGRQSELRIAQALLLRPDVRLLNLRG
FT                   PGGIGKTRLALELARLLAPHFEQVYFVELAPIRDTALLLPTIATAVRAPQNIPPLQGII
FT                   ETLGTMRALLILDNLEHLLPGLQALVTLLVNTENLTVLSTSRAVLHLRDEHELALGPLT
FT                   LPHGIAGESEAVTFFVQQARTVDPNFEVTSDNRTQVEHVCTLLDGIPLAIELAAARLRA
FT                   LPLAALVEWLAEPLEVLGDGPRDVPERARSLRDAVRWSADLLSEAERDVFIACGVFVGG
FT                   FTRAAFETVTGQQDGRSVLLHLVEHSLLRPVAHLEARWSMLEPVREFAEEQLHSHPDAE
FT                   RVRERHAHFYLSLVGQARQSIQTLESEWMARFKDEHGNLHAALRWFIHRDRFEDAVSLC
FT                   QGLFNYWRGRGLNNFALEWITQVLAMPGAKAAPAMQALILRQAGMHAVRVTTRLDDAER
FT                   YFQESFNLYAALGDEEGEAFALDGMAAVLGTRGDTEGARRLHLDLAVRFEAYGRLDWLH
FT                   ATWFNLGSGYINEGDAAHGSEFLDKARDLAERRGDVFALAWDSAWRAVLYQRQDRPQAA
FT                   LDECRRAWQLGAGMEDAMFDWACLWLLSTLARVFGQPLFAARLTGARDAVLATTQFPPS
FT                   PENKARFVAEEQLLRAALGEGVFEREWQAGSQLPLPELRTEIDRWLNLPLERNSPATPP
FT                   AQGGLTSRERDVVALVAAGMSDKRVAQVLGISMGTVSKHVGHVLEKLELRNRVELARWA
FT                   IEHGISPPTS"
FT   gene            complement(325854..326375)
FT                   /locus_tag="Deide_3p02330"
FT   CDS_pept        complement(325854..326375)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p02330"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p02330"
FT                   /db_xref="EnsemblGenomes-Tr:ACO48192"
FT                   /db_xref="UniProtKB/TrEMBL:C1D3W3"
FT                   /protein_id="ACO48192.2"
FT                   /translation="MNTVWGKVMLGVIVAGMHEAAGINIPGTRVDYFAAQDSVTTDNRG
FT                   VVRIFEINDTTGLTYVRFACEARVLQAYFHGKNPLVSPAARAMELYPLVVYQVDDQQLK
FT                   TFKVSGMLSKTGQGLLESVAFENDQLVVDAFRHAVRRVTLRIPRLGMSELTYVFAVKGF
FT                   RQALSRIKPC"
FT   gene            complement(326520..327203)
FT                   /locus_tag="Deide_3p02340"
FT   CDS_pept        complement(326520..327203)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p02340"
FT                   /product="putative response regulator, OmpR"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p02340"
FT                   /db_xref="EnsemblGenomes-Tr:ACO48193"
FT                   /db_xref="GOA:C1D3W4"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:C1D3W4"
FT                   /protein_id="ACO48193.1"
FT                   /translation="MQQTILVIEDDPDIAQILTTEIEDAGYRVLTAPNRMSGLTCARSE
FT                   APDLVILDLGLPDMHGTEVARRLRRTSRTPIVVLTGMDTVASKVGLLEAGASDYLTKPF
FT                   HPEELVARVRVQLRKHQQAGEVSVGALKLYLQQQVCLYQGREVRLSPKEFELLGLLAEV
FT                   PGRVYSRDVIVAELWPGVVDVGRSVVEVHMANLRSKLREVGGAGVLRTVRGVGYALRDA
FT                   GDAQN"
FT   gene            327257..329797
FT                   /locus_tag="Deide_3p02350"
FT   CDS_pept        327257..329797
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p02350"
FT                   /product="putative histidine kinase, classic"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p02350"
FT                   /db_xref="EnsemblGenomes-Tr:ACO48194"
FT                   /db_xref="GOA:C1D3W5"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C1D3W5"
FT                   /protein_id="ACO48194.1"
FT                   /translation="MQALKFGETPLFTDQTRNLGKATNAAVTDALSCSMPDPSAGDAIL
FT                   SSAAFPHLAWTTGRHGHLLWSNHAWLTYTGAEATQGTVSFVDLLQPEDQHLMAVQLAQR
FT                   VPFELELRLSDKGGQLHWFRVHGQPSTLDGGPAWVFTGVNIDDLQQERQRSAQLQSMMD
FT                   ASSSCIKILDLDSHLLSMNEGGMTTMEIDDFDVCRNLLWLDFWEGNTRTMVEDALERAR
FT                   RGEHVSFEASRTTFKGTPKWWHISISPLYDTEGRVHQLSAVSRDITSTKATQEAVAALD
FT                   AFVAFSEISGASTDVLLLAQHAREVLQATLGDVTVAYYTLEGDLWKCRVWSDNLAPEIV
FT                   DVLTAGIPVTAPSYAQATQTLQPVFVAGWNAETQGVSRTEQYNAAAFYPCVVDGRAQGL
FT                   LAMGIQKSGDLTERERAVFRSVGRSLTLALERADVAQRIDDQRAELEARTRALEGFATL
FT                   TRDLTLQPERDALFRRSMELVLSLIPEGYALYYQPHGEKWCATAQVGHVRSAPLQAAIE
FT                   GGFPVGQTPSLDIPCQTKEALFQDEYDCTRDVEASLVQHVRTVASLPVVVGGHVHGIFS
FT                   VALFEPRPWSAADRAVLTTTVHSLGLALESAQSVVHLAEERRKLEAANEELEAFAYSVS
FT                   HDLRTPVRHIVGFATLLRKHLGTGLDDKANRYLTVIDEGAGRMNTLIDAMLDLSRTSRL
FT                   PLRVTPVDLEILIDRVKLDLRPDLVGREVCWKVSPLPLVMGDPDMLLQVMENLLSNALK
FT                   YSRNQNVATIEVWAEEREWDWAVFIRDNGAGFDPRYGDKLFGVFQRLHRQDEFEGVGVG
FT                   LANVRRIIHRHGGEVSAVGLPGQGATFGFTLPKP"
FT   gene            complement(329917..331695)
FT                   /locus_tag="Deide_3p02351"
FT   CDS_pept        complement(329917..331695)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p02351"
FT                   /product="putative response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p02351"
FT                   /db_xref="EnsemblGenomes-Tr:ACO48195"
FT                   /db_xref="GOA:C1D3W6"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:C1D3W6"
FT                   /protein_id="ACO48195.1"
FT                   /translation="MYEPLSDNELRRIEVLARYAVVDTLPEPAFDRLTTLAARLFSVPY
FT                   AMINLIDEQQIWAKACFGTKTGSLTREHAPCVRTIESTQVMVVPDARQNHRFASHGVMA
FT                   EHGLRFYAGAPLVTHDGYSIGTLCLLDEQPRTGLSDEESSTLQDLAALVMDELELRLAQ
FT                   LTLARDAKAKSQMLTRMTGAADHAQHLAAVTQLLAYDLTVDAYLQATGPLVAQATNICS
FT                   VTLHARGESMRAEAPSWTVPVQAFAGEHPPAWTRLPNVTLDMDFPVFLENLRTAPGFSD
FT                   WIRDGVGSAAFLPLTTVEGARHVVSYARGGEAVVWSPEDRQLLTAVAQGLNILLSRWEH
FT                   IARRDMARNDKPDVHLGTQATLYSAVHHAHLNSLELTLVRLSVRGAPLDSEWARWLTLM
FT                   LQTGPGEHRTACRLGDREYAVISTDGMHDLQAVLQQGLSGGLKGAQVQVGIARMPEDAT
FT                   DADALMALAEARLARLESAGLGNTSKEEPRAPEVLSHGSLTLDCRERVVRGGHEFVKLS
FT                   KQECALLAVLMQHPHQVFSRERLAAAAWGEVRLESDPLVNVHISNLRRKLLRLHPDPLV
FT                   HTVRGQGYSLQGAAEA"
FT   gene            complement(331854..332459)
FT                   /locus_tag="Deide_3p02353"
FT   CDS_pept        complement(331854..332459)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p02353"
FT                   /product="putative transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p02353"
FT                   /db_xref="EnsemblGenomes-Tr:ADT91189"
FT                   /db_xref="GOA:E6RGA8"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:E6RGA8"
FT                   /protein_id="ADT91189.1"
FT                   /translation="MLPVPARVDPRVRRTRQAILEALEALLRERPYSSITVHDIAERAG
FT                   INRATFYAHYREKHELFVQLVEKHFASVLTAHALPPGKVFIQDVRRLFQGVCVFLAQVH
FT                   LDRRAHPCEMDAQVDLQVQRQLNTLVSDALRGSEQRCNSRRISRDMTATLMASGIYSSA
FT                   TAWAIQSPPPPLEAYIEEAMVFLSAGLLATGYVQDPVA"
FT   gene            332610..333368
FT                   /locus_tag="Deide_3p02352"
FT   CDS_pept        332610..333368
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p02352"
FT                   /product="conserved hypothetical protein; putative membrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p02352"
FT                   /db_xref="EnsemblGenomes-Tr:ACO48196"
FT                   /db_xref="GOA:C1D3W7"
FT                   /db_xref="InterPro:IPR025495"
FT                   /db_xref="UniProtKB/TrEMBL:C1D3W7"
FT                   /protein_id="ACO48196.2"
FT                   /translation="MTSSKMDARITGVLFILATVSAVLGVLLYAPLLNDPDFLRSGQSH
FT                   THRVILGALFELILASAAVGTAITLFPYVKRQNESLALGYVSFRVLEATLIIVGVLSML
FT                   SYLTLRNQFMAAPAPHLPSFQTVGGLLLALHEWTFLLGPNFMLGINTLMCAFLLHQSRL
FT                   VPRGIATLGLVGGALILTAAVLELFGVVRQLSPWGVALALPVAAYEMILAGWLITKGFR
FT                   PTAIHHLESGPQASGSAAAQPMQTLYGTGK"
FT   gene            complement(333607..334068)
FT                   /locus_tag="Deide_3p02360"
FT   CDS_pept        complement(333607..334068)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p02360"
FT                   /product="putative response regulator, CheY"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p02360"
FT                   /db_xref="EnsemblGenomes-Tr:ACO48197"
FT                   /db_xref="GOA:C1D3W8"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:C1D3W8"
FT                   /protein_id="ACO48197.2"
FT                   /translation="MNRKSFTLLLVEDELADVALFQDLLADAVAEVDVIHVENGRQALQ
FT                   YLNREDQFLNATYPDLVVLDLNMPVMNGHDFLAHVKQQPELRSIPVMILSTSDHPDDIQ
FT                   RAYHGYASGYVVKPSTYEEFVRVVKTIEAYWRGLVRLPSIAEVATRAAR"
FT   gene            334435..336741
FT                   /locus_tag="Deide_3p02370"
FT   CDS_pept        334435..336741
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p02370"
FT                   /product="putative histidine kinase, classic,
FT                   bacteriophytochrome"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p02370"
FT                   /db_xref="EnsemblGenomes-Tr:ACO48198"
FT                   /db_xref="GOA:C1D3W9"
FT                   /db_xref="InterPro:IPR001294"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013515"
FT                   /db_xref="InterPro:IPR013654"
FT                   /db_xref="InterPro:IPR016132"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C1D3W9"
FT                   /protein_id="ACO48198.1"
FT                   /translation="MSDEHLLAPAHLGGPAIDASNCAREPIHIPGSIQPHGALLVLSVH
FT                   EMCIVQVSANIPEFFERPAESLLGQPLELLVTPTSLSPLKKMLTLEGRTHTFPVTLLKG
FT                   LTYDATAHLAQGVLVLELERPNSPEVAADIYRATQQALTELDSSRDVLGLCATAASQVR
FT                   ELTGFDRVMIYRFAEDGSGEVVAEARHSDIASYLGHRFPESDIPRQARALYLKNLLRLT
FT                   ADVNAGVIPLVPLLNPVTGAPLDMSLMVLRSTSPMHVQYLKNMGVTSSLSVSIVQDGRL
FT                   WGLIACHHTTARVIPHQVRASCEFLGRVLAMQLAAKRDAETYRFREKLKHRHQQILNAM
FT                   MSSRLPVEAIRRPDLDVVGFMRASGFAVRLAGQVVTLGETPAEPELQHLLGWLREHHPS
FT                   SFHTNTLSAFLPAATAYSDKASGVLGMSVSGHWEEYLLWFRPEIPQTVTWGGNPAKPVQ
FT                   SGEDGTVDLTPRASFEAYVQQVRHTALPWHPGEVAEAESMRDALVETTSVRLTALQEHH
FT                   QQLQRAHDALGRSNAELQRRNEELAQFAYVASHDLQEPLRILGTYSDILLHRYQGQLDE
FT                   RAQGYLRHIGEQVFRARQLVRDVLTLSNVTAQPPLTDVDLNRVWEDISPTLPWPADAQV
FT                   ECADLPHVHANVAQVQQLLTNVFGNAIKFRADRPLRIRFTGEQRGEWVHLAIRDNGIGI
FT                   AQEHAEQVFVMFQRLQSRTDQLTGNGIGLAVCKKVVERHGGNIWIDGQVGEGTTVSFTL
FT                   PAVSTKTRSSPPVMT"
FT   gene            337185..337508
FT                   /locus_tag="Deide_3p02390"
FT   CDS_pept        337185..337508
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p02390"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p02390"
FT                   /db_xref="EnsemblGenomes-Tr:ACO48199"
FT                   /db_xref="UniProtKB/TrEMBL:C1D3X0"
FT                   /protein_id="ACO48199.2"
FT                   /translation="MATKTNSRVQTLIRHALDEQAARGHQGDLPEGKVTLRLQAIDLYW
FT                   LSQLAVLMDASRTRAASQLLSAAIRDAAHTAGLPTEGEQFQTSFQAFLKQEFPHETSPP
FT                   SDT"
FT   gene            337520..339211
FT                   /locus_tag="Deide_3p02400"
FT   CDS_pept        337520..339211
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p02400"
FT                   /product="putative TrkA-N domain-containing Sodium/hydrogen
FT                   exchanger family protein; putative Potassium efflux system
FT                   family protein; putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p02400"
FT                   /db_xref="EnsemblGenomes-Tr:ACO48200"
FT                   /db_xref="GOA:C1D3X1"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:C1D3X1"
FT                   /protein_id="ACO48200.1"
FT                   /translation="MPHHTELISALAVGLTLAFFGGLLATRLHLPPLIGYLLAGLAVGP
FT                   FTPGFVADASIAAQLSEIGVMLLMFGVGLHFSISDLLAVRRIAVPGALLRILTITLLGA
FT                   GVSQLWGWSMGEGLVFGLALSVASTVVLLRALEERGTLDTTNGKIAVGWLVVEDLVMVL
FT                   ALVLLPALAPLLSGGEGTVNLGALGMSLALTLGKMLLFVVVMMLAGRRFIPWMLARVAR
FT                   IGSRELFTLAVLGTALGIAYVAGALFGVSFALGAFLAGVVASESKFSHQVAEDALPFQD
FT                   AFAVLFFVSVGMLFNPAILLQAPLLVLATSLIIVVAKTLIAFLTMRLLRASFTTSLTVA
FT                   ISLAQIGEFSFILATLGRDLNLLSVQGQNLILAGAIVSIILNPFLFRLIPLVQRWQQRG
FT                   EPQGTPQSHPPVGLTRHAVLIGYGRVGRMIAQTLQAQHVPFVVVEQDERRIDELRESNI
FT                   PAIYGDAARTSVLHQAALRDARVVIIATPDAIQAQLIVEHVRRVNPDVYVTARSHDEHT
FT                   QRALRDLGASDVLYAEHELGLAMGNHVLAALRPAHDAPASRAGTSS"
FT   gene            complement(339552..340547)
FT                   /locus_tag="Deide_3p02410"
FT   CDS_pept        complement(339552..340547)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p02410"
FT                   /product="putative Ornithine cyclodeaminase"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p02410"
FT                   /db_xref="EnsemblGenomes-Tr:ACO48201"
FT                   /db_xref="InterPro:IPR003462"
FT                   /db_xref="InterPro:IPR023401"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C1D3X2"
FT                   /protein_id="ACO48201.1"
FT                   /translation="MNHGAMPLTVLSDTVIRSLLDEREVIDIVRDAFAADGRGQAAVLP
FT                   VVGHSLNGGRYSIKTSHLQLSGHHEVFGLKMGSYYPDNVRRGLPTHSAVMLMGDPVTGQ
FT                   PHALLAANVITEARTAAAGAVAAQMLSRPDAQVVALFGTGGQALAQLRALQEVRSLKEV
FT                   RVWSRTPERAEAFVEAADLPGLAVRAVPDGQAACEDADIVVTVTPAEEPIISRQWIRPG
FT                   THINAMGSDAPGKQELDPYLVAVAKVVVDRRAQSLTIGEMQRPVALQLVQPEDIYAELG
FT                   ELCAGLKPGREHSEEITVFDSTGVSFQDTALAGHLLRLAEQRCVGEVVSL"
FT   gene            complement(340544..341527)
FT                   /locus_tag="Deide_3p02420"
FT   CDS_pept        complement(340544..341527)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p02420"
FT                   /product="putative Threonine ammonia-lyase (Threonine
FT                   dehydratase)"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p02420"
FT                   /db_xref="EnsemblGenomes-Tr:ACO48202"
FT                   /db_xref="GOA:C1D3X3"
FT                   /db_xref="InterPro:IPR000634"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR027278"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:C1D3X3"
FT                   /protein_id="ACO48202.1"
FT                   /translation="MSHPTAVSSLIALNELLSAHQRIRGHVVRTPLVPFPLEGFWVKPE
FT                   NLQPTGAFKLRGAFNALLALSEDERQRGVVAHSSGNHAQAVAYAAQQLGIPAVIVMPDN
FT                   APQLKLDMTRAFGADVIVVGPASEERAARAKELTSERGLSPIPPYDDARIIAGAGTVGL
FT                   EILEDLPDVHTVLVPVSGGGLLSGVAAALKLQRPDVRVIGVEPEVAADAHDSFKSGQRV
FT                   TYTAEQVGRTLADGLRVQHLGDLNWLHVQAFVDDIITVSEAELRRAVRETTLRTRLVTE
FT                   PSGAVTLAAALSHRQELQAAGPLVAVLSGGNLDRDLLVHLLKEEQE"
FT   gene            341643..342308
FT                   /locus_tag="Deide_3p02431"
FT   CDS_pept        341643..342308
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p02431"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p02431"
FT                   /db_xref="EnsemblGenomes-Tr:ACO48203"
FT                   /db_xref="InterPro:IPR013559"
FT                   /db_xref="InterPro:IPR039445"
FT                   /db_xref="InterPro:IPR039446"
FT                   /db_xref="UniProtKB/TrEMBL:C1D3X4"
FT                   /protein_id="ACO48203.1"
FT                   /translation="MSETEADHIHLLAQLQQIAQGLAETFAPFCEVVVHDLTCPDHAVI
FT                   AIHNNLSGREHHQPATELGLARIQDSQYPQIITNYANRFADGRPAKSTSIGIKDSRGSY
FT                   VAALCLNIDLTVFRSLQSVIESFVQLDNTVSVQESLEPAGAELLRAHMDQFAARRGTVP
FT                   QALKVEDRRTLVKELKAGGHLQVRRAMEIVASHLGVSRAAAYSYAKISPGDQLRSRRP"
FT   gene            342353..342697
FT                   /locus_tag="Deide_3p02432"
FT   CDS_pept        342353..342697
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p02432"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p02432"
FT                   /db_xref="EnsemblGenomes-Tr:ACO48204"
FT                   /db_xref="UniProtKB/TrEMBL:C1D3X5"
FT                   /protein_id="ACO48204.1"
FT                   /translation="MCRRKVRLKQPPGVRSRTCRPAGVTLPDDGSMGYVSLRLPSTAPL
FT                   SEKGLAGGYPKNLFPAFTPMEQIVPSCEGMQQASAHRLRGLMSGQNDVTVLRGAIQRLQ
FT                   LIDRVESKDV"
FT   gene            342846..343325
FT                   /locus_tag="Deide_3p02433"
FT   CDS_pept        342846..343325
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p02433"
FT                   /product="Hypothetical protein, precursor"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p02433"
FT                   /db_xref="EnsemblGenomes-Tr:ACO48205"
FT                   /db_xref="UniProtKB/TrEMBL:C1D3X6"
FT                   /protein_id="ACO48205.2"
FT                   /translation="MFRMRPALVLTSALVIAAPLQSAHATALEKAKFVFHLGAAYYAFN
FT                   TWVWKPYRQYKFQVGAPNQKTNIVKAGAALLFAGYQVNSAIKMTRNTQDPFLKSIGGLL
FT                   PNFRKSLTAVGNDLKQGRFNEQGIQQLNRSATQLLNAAQQQGQTIRPVAVPIPGL"
FT   gene            343580..344353
FT                   /locus_tag="Deide_3p02434"
FT   CDS_pept        343580..344353
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p02434"
FT                   /product="putative transposase"
FT                   /note="ISDds5 - IS982 family member"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p02434"
FT                   /db_xref="EnsemblGenomes-Tr:ACO48206"
FT                   /db_xref="GOA:C1D3X7"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="UniProtKB/TrEMBL:C1D3X7"
FT                   /protein_id="ACO48206.1"
FT                   /translation="MARYRLHHSLGRRRVIRTLWRWGRKHFSDHRSCRHQKVTDAFLVA
FT                   LLLSRYVFKHPYPSIWWNILREDRPGLPSYTQAFTRGQRLLEHLEALVSPPLPCTDVVV
FT                   DSMPLPVCRPKRGKRCAFPGARWGYGTQGDFFGFKLHAWVSPAGQVMQYLIRPANLHDT
FT                   TVAYELNRRWADFGGPRVIGDKGYCALGFIYPPKKNTRYDTRWREDHHPKLRKRIETVF
FT                   SQLVEAQVRSVQSKTLTSLRLRVVLAVLAHNLMHR"
FT   gene            344862..345182
FT                   /locus_tag="Deide_3p02435"
FT   CDS_pept        344862..345182
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p02435"
FT                   /product="putative transcriptional regulator, ArsR family"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p02435"
FT                   /db_xref="EnsemblGenomes-Tr:ACO48207"
FT                   /db_xref="GOA:C1D3X8"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C1D3X8"
FT                   /protein_id="ACO48207.1"
FT                   /translation="MTALESPSILDQVKALSHEIRYDLIRHLAQGERCVCDLEELLELP
FT                   QSKVSYHLGILKDAELVRSEQRGKNTYYTLKQEQLFLLGGGLLTEIFTDRVSLTEQKKS
FT                   IC"
FT   gene            345190..345651
FT                   /locus_tag="Deide_3p02440"
FT   CDS_pept        345190..345651
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p02440"
FT                   /product="putative Protein-tyrosine-phosphatase (Low
FT                   molecular weight phosphotyrosine protein phosphatase)"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p02440"
FT                   /db_xref="EnsemblGenomes-Tr:ACO48208"
FT                   /db_xref="InterPro:IPR023485"
FT                   /db_xref="InterPro:IPR036196"
FT                   /db_xref="UniProtKB/TrEMBL:C1D3X9"
FT                   /protein_id="ACO48208.1"
FT                   /translation="MTRVLILCTHNSARSQMAEALTREAARKAGVDLEVYSAGTEATCV
FT                   KDDARTVIAELGLSLDTHTSKTLFDVPEPQNFDYVVTVCDSAAEACPVYPGKTTRRHYP
FT                   FVDPSGGSLDRWRAVRDQLQTQFEAFVAALKNGHRVPDSYTDSPAVTVA"
FT   gene            345653..346351
FT                   /locus_tag="Deide_3p02450"
FT   CDS_pept        345653..346351
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p02450"
FT                   /product="putative MIP family protein (Major Intrinsic
FT                   Protein) (aquaporin); putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p02450"
FT                   /db_xref="EnsemblGenomes-Tr:ACO48209"
FT                   /db_xref="GOA:C1D3Y0"
FT                   /db_xref="InterPro:IPR000425"
FT                   /db_xref="InterPro:IPR023271"
FT                   /db_xref="InterPro:IPR034294"
FT                   /db_xref="UniProtKB/TrEMBL:C1D3Y0"
FT                   /protein_id="ACO48209.1"
FT                   /translation="MTLPTPVPLSRALAAEGIGTFALVFFGPGAAVVQAQTGALGHLGV
FT                   AVVFGLTVTAVIAALAPISGAHINPAATFALTLAGRFPRERVLPYVAAQLLAAALAGFV
FT                   LLALFGMKGDLGVTVPSGSVAQAFVLELTLTFFLLLVALRSGLPWVVGGVVALEAAMGG
FT                   PMTGASMNPARSFGPSLASGIWTAHWLYWAAPLMGAGLAVAANHFLNPTEPVETAPHQA
FT                   QEFVPTEKPT"
FT   gene            346605..347330
FT                   /locus_tag="Deide_3p02460"
FT   CDS_pept        346605..347330
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p02460"
FT                   /product="putative Metallophosphoesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p02460"
FT                   /db_xref="EnsemblGenomes-Tr:ACO48210"
FT                   /db_xref="InterPro:IPR011152"
FT                   /db_xref="InterPro:IPR024654"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:C1D3Y1"
FT                   /protein_id="ACO48210.1"
FT                   /translation="MKIAVFGDVHGNRFALEAVVQDIEQHQPDMWLNLGDQLFGGADPV
FT                   GAWQVQQELRAKYGALEVRGNTDERLGQDLTETTEKRAMLEWLHSILPEDAAAHVAGLP
FT                   TSVTVADGQVIAAHGAPDSAWTYLLLDGKAWATNDLILERLGDTGKARVVIVGHSHQEH
FT                   VRQIGQVTVVNAGAVSRQKDGCPLARWVLLEGHNGIWNVTFRRVTYNVEAAARWAEQHA
FT                   HKGAQEAVQLRTGAPHKKP"
FT   gene            complement(347415..350114)
FT                   /locus_tag="Deide_3p02470"
FT   CDS_pept        complement(347415..350114)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p02470"
FT                   /product="putative histidine kinase, classic"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p02470"
FT                   /db_xref="EnsemblGenomes-Tr:ACO48211"
FT                   /db_xref="GOA:C1D3Y2"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C1D3Y2"
FT                   /protein_id="ACO48211.1"
FT                   /translation="MGALMREVDWSSTSLGPPDHWSPRLRTYIELMLTSKQPMYVGWTH
FT                   DLIAIYNDAYRPILGADKHPGALGRRTADIFEHDGYPGLKPYFDAVLERGEGVAFVDIL
FT                   VPLFRDGYLEECYFDVSYTPIHGETHVEGMLASVSETTERVLSIRRTETLAALASGLLG
FT                   SSDLSQIASAIVQGELNNPHDLPFTLLYLPDAQELRLQAAAGLDAALLDTFAVLPEAWR
FT                   GGAEVRVESISPLTVGPWPEPVTQVAILPLAQESTAAANPGVLVIGLNARKRFDRPYRD
FT                   YLNLLRGQVMGALRTADLTAVLQEQNAELDARTRILEAFATLTHDLGILSDPLHLIHET
FT                   QQVILGLLAPGFSQYYEPEDARWVVRSQVGQPGNPEVQTALHAGLPLHEAPALSVPWST
FT                   GELYFQTAVGPAAGDLTGDEAPHRATASLPITVGGHRRGVLSFALTPDQGWSRSDRALL
FT                   ATAMRSLNLMLERVDQTHALAARQAEVESRNQALEAFAQLSMDLVVETDRVALIRRAQQ
FT                   IVLSLLPGGYAAYYELEEGRWRAKSQVGEIGDEGLQTLIDAGFAHDVPSLATPLITDEP
FT                   FYQDAYVHGSDSPKEMVQHIQAVATLPLRMQGVTVGMFVIALFHQRAWTAVDRALLETT
FT                   MRSLSLALERADFTQQLTEHRDALNARTQALGEANKELESFAYSVSHDLRTPVRHIAGF
FT                   TSLLRKALDTPLDPKVARYLTVIEQSAQRMNNLIDAMLDLSRSARQPLQIQLIDLGALL
FT                   TDVRAELLPDLRGRDISWLVDPLPKVWADQALMRQVLLNLISNALKYTRTREHAVIEVR
FT                   AEERPEFTVLTVQDNGVGFDARYADKLFGVFQRLHLQEEFEGTGVGLANVRRIMARHGG
FT                   QAWAKGAVGEGAAFSVSLPRTGPLQPPP"
FT   gene            complement(350430..350882)
FT                   /locus_tag="Deide_3p02480"
FT   CDS_pept        complement(350430..350882)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p02480"
FT                   /product="putative Response regulator, CheY"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p02480"
FT                   /db_xref="EnsemblGenomes-Tr:ACO48212"
FT                   /db_xref="GOA:C1D3Y3"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:C1D3Y3"
FT                   /protein_id="ACO48212.1"
FT                   /translation="MSVPCRYLLVDDNPTDLLLAQEAFEELQPDCTLTCVQSGEEALNF
FT                   LHSTPTLPDVILLDINMPGMSGFQLLGLLKQEPKLRRIPVVMLSTSAAAKDISEAYSLH
FT                   ASSYMVKSSAFDTFLRQIDAFLKYWQANRVCNETPGEITPEGHREL"
FT   gene            complement(351014..351652)
FT                   /locus_tag="Deide_3p02481"
FT   CDS_pept        complement(351014..351652)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p02481"
FT                   /product="putative transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p02481"
FT                   /db_xref="EnsemblGenomes-Tr:ACO48213"
FT                   /db_xref="GOA:C1D3Y4"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR025996"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:C1D3Y4"
FT                   /protein_id="ACO48213.1"
FT                   /translation="MMLTVSRSKSENALERRELRSQPAAQQRPYHHGQLREALLSAAFD
FT                   LLQEQQAAHISLRQVAKHAGVSHAAPYHYFPDRRQLLLALAERCMEAFYQKQVEAFERA
FT                   GPDPLHQLVAIGEAYIQFALQHTNAFHLIFDPSLCIPDQPSPVHQANQQLLRFTIERCM
FT                   AQGSVPPNDPDLVAAGMWGTVHGLAQLILLGHLPAEAARPALQALNGLS"
FT   gene            351755..352330
FT                   /locus_tag="Deide_3p02491"
FT   CDS_pept        351755..352330
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p02491"
FT                   /product="putative NAD(P)H dehydrogenase (quinone)"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p02491"
FT                   /db_xref="EnsemblGenomes-Tr:ACO48214"
FT                   /db_xref="InterPro:IPR003680"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:C1D3Y5"
FT                   /protein_id="ACO48214.1"
FT                   /translation="MRTLVIIGHPNPNSFCHALAQQYIDAGRTSGAEIRVLDLSTLRFD
FT                   PSLRNGFQGAQDLESELQEAQALLKWCSHLCLIYPVWWGSTPAVLKGFFDRVLLPGFAF
FT                   KYRPSGLPDKLLAGRSARLIVTSDSPTWYLKWMMRDAAIHSVKHSTLAFCGFKVRVSRV
FT                   DNVRQSSPGKRTQWLNRMTSVALQDHRH"
FT   gene            complement(352492..353331)
FT                   /locus_tag="Deide_3p02500"
FT   CDS_pept        complement(352492..353331)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p02500"
FT                   /product="conserved hypothetical protein; putative membrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p02500"
FT                   /db_xref="EnsemblGenomes-Tr:ACO48215"
FT                   /db_xref="GOA:C1D3Y6"
FT                   /db_xref="InterPro:IPR019108"
FT                   /db_xref="UniProtKB/TrEMBL:C1D3Y6"
FT                   /protein_id="ACO48215.1"
FT                   /translation="MHSRHSLTTDPEVFSLLGWGLLLILGALYLMMAARQRRKRQSWPV
FT                   HRTASFILGLALLAWAFSPLQNALAHTSVRAHMRQHLVSGMFAPLALALGWPLTLLLRS
FT                   LPVSSARRLIRWLHWPSMGLLTSPGSVLVLNVGGLYLLYLTPLYSHMLGSALLHTVVAC
FT                   HVVAAGFLYAVVLSGIEPVAVRTSFRARLVVLLLGTAAHAILAKVLYAGLWPRGTTDSP
FT                   ENLRAAAQLMYSWGDLAEVLLMGVAFWGWFQTQRRSQRRARPEAELPVEEGNTAWIR"
FT   gene            complement(353331..353837)
FT                   /locus_tag="Deide_3p02510"
FT   CDS_pept        complement(353331..353837)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p02510"
FT                   /product="conserved hypothetical protein; putative membrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p02510"
FT                   /db_xref="EnsemblGenomes-Tr:ACO48216"
FT                   /db_xref="GOA:C1D3Y7"
FT                   /db_xref="InterPro:IPR018719"
FT                   /db_xref="UniProtKB/TrEMBL:C1D3Y7"
FT                   /protein_id="ACO48216.1"
FT                   /translation="MNIPPSQRRDTGPVTPGLPGLRLNIRRSRMSGALLGIAFMAGVDE
FT                   IIFHQVLGWHHFYDRSTPALGLVSDGLLHAAELMAIVAGIFFLVDVLRAQSFAPAYFRA
FT                   GLFLGLGGFQLFDGLVNHKVLHAHQIRYGVPLLPYDVTWNLAGLLLLLLGVVLHRQASR
FT                   AALGR"
FT   gene            354024..355442
FT                   /locus_tag="Deide_3p02520"
FT   CDS_pept        354024..355442
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p02520"
FT                   /product="putative WGR domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p02520"
FT                   /db_xref="EnsemblGenomes-Tr:ACO48217"
FT                   /db_xref="InterPro:IPR008893"
FT                   /db_xref="InterPro:IPR011047"
FT                   /db_xref="InterPro:IPR036930"
FT                   /db_xref="UniProtKB/TrEMBL:C1D3Y8"
FT                   /protein_id="ACO48217.1"
FT                   /translation="MERAYLEYSDPNGAEHKFYEVLVEGSELTIRYGRIGSEGQKQVKT
FT                   LASPEKAVAEAAKKVAEKRRKGYEDAVQGIRQKRSVVRRTVTESRVTVKKVAPVLWRFH
FT                   SGAPAYGIFVDSQHAWVGNERGEVYALTLDGEPNLKFKLPDGVKCLVRDGRWTFAGCDD
FT                   GNVYDLSGKLPFMAYEVHTEASLLWLDVNQGVLGVGDHLGGVYAFDAESDQQWANVSED
FT                   ANMTWMVRVDEAGVYFGHSRGIGMFDRMSGLPVWEQKTRGNVLFGWQEGESVYAGTSAS
FT                   LVQRFNKTGRHEADYQCDSSVLSCATSSSGKYVFAGDSASAIYCFAEDGTRLWKLGSGC
FT                   GSVLSMQYFQERLYLVTTTGFLAAVDASATAIEVAQQGVTPQMREVKPAAIEAHTPPTS
FT                   LTLTNDVGEGIVLICTREAGKLRVRAAGPEYRPWNVQFPRDLREEGARYVVDGLLDAGG
FT                   FYRVVGEIRRLNGE"
FT   gene            355898..356293
FT                   /locus_tag="Deide_3p02530"
FT   CDS_pept        355898..356293
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p02530"
FT                   /product="putative Transcriptional regulator, MerR family"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p02530"
FT                   /db_xref="EnsemblGenomes-Tr:ACO48218"
FT                   /db_xref="GOA:C1D3Y9"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="UniProtKB/TrEMBL:C1D3Y9"
FT                   /protein_id="ACO48218.1"
FT                   /translation="MEKLRIGQVAQASGVSVRAIRHYEQLGLLAATRTDSQYRVFQPED
FT                   IDRVKLIQLFLSVGFKLEEINRWAPCFQEGRSDRDTSPQEMHAFYMRKIANVDMQLAAL
FT                   KIVRDKLATEARRIEEQARDLHLHPDR"
FT   gene            356360..357109
FT                   /locus_tag="Deide_3p02540"
FT   CDS_pept        356360..357109
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p02540"
FT                   /product="putative Zn-dependent hydrolases of the
FT                   beta-lactamase fold protein"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p02540"
FT                   /db_xref="EnsemblGenomes-Tr:ACO48219"
FT                   /db_xref="GOA:C1D3Z0"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:C1D3Z0"
FT                   /protein_id="ACO48219.1"
FT                   /translation="MRLQLIRNATLRLAYAGTTLLVDPFLADQFSLPSIAGKSQNPTAA
FT                   LPVSAEHVVQNVVLVLVSHLHPDHIDLTPPRIPTQLPLLSQPTDADALRAAGFTDVTGI
FT                   SNEFHWKGICITRTGGAHGTGPVGAALGEVSGFVLQAPGEPTVYIAGDTIWNDDVRAAI
FT                   QAFGPEVIITNSGGALIRDTLIIMDTEQTLAVAAAAPQATVIAVHLEAYDHAPVTRDQL
FT                   RAAASEAGITERVLVPEDGETIEIYVQ"
FT   gene            357261..357830
FT                   /locus_tag="Deide_3p02550"
FT   CDS_pept        357261..357830
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p02550"
FT                   /product="putative dienelactone hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p02550"
FT                   /db_xref="EnsemblGenomes-Tr:ACO48220"
FT                   /db_xref="GOA:C1D3Z1"
FT                   /db_xref="InterPro:IPR002925"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C1D3Z1"
FT                   /protein_id="ACO48220.1"
FT                   /translation="MSEILLFHHVLGLTKGVHTFAEHLRQAGHTVHTPDLFQGQTFATL
FT                   DEGIHYAEQVGFKTLEGRAVRIADELPRHLVYAGFSLGVMPAQKLAQTRTGALGALFFH
FT                   GCLPPEAYGAGWPTDLPVQIHAMDADPWFAEDKEAAQVVVHSASNGHLFMYPGDKHLFT
FT                   DCSLAAYDSGATSLLMERVLAFLARL"
FT   gene            complement(357987..358454)
FT                   /locus_tag="Deide_3p02551"
FT   CDS_pept        complement(357987..358454)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p02551"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p02551"
FT                   /db_xref="EnsemblGenomes-Tr:ACO48221"
FT                   /db_xref="UniProtKB/TrEMBL:C1D3Z2"
FT                   /protein_id="ACO48221.1"
FT                   /translation="MNTQQALTPPTTLEQEWTELLSYAKEQGRQLEAIRKRAGHLPSNQ
FT                   TSVHVPWSLFLLAGGAYALYRRNPSVQQRVQGIADRIPPGARNNLTQTARAAKDAIRKV
FT                   NPKTRGTYPGTGTEWRRDGELPLDHATSSSDPLKDKVIDRLQQNPESSGSS"
FT   gene            complement(358955..359314)
FT                   /locus_tag="Deide_3p02560"
FT   CDS_pept        complement(358955..359314)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p02560"
FT                   /product="putative tRNA-binding-domain-containing CsaA-like
FT                   protein (Secretion chaperone CsaA)"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p02560"
FT                   /db_xref="EnsemblGenomes-Tr:ACO48222"
FT                   /db_xref="GOA:C1D3Z3"
FT                   /db_xref="InterPro:IPR002547"
FT                   /db_xref="InterPro:IPR008231"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:C1D3Z3"
FT                   /protein_id="ACO48222.1"
FT                   /translation="MASDLKAAVSYEETLARLDIRLGRVVEAVLEESAPKQAYRLTVDF
FT                   GKYGRRVSVGRFTQHQSEELVGQQVVGVLNFEPRLVGKTMSEVLILGVQVPGAASGEAT
FT                   FLTPKREAKLGSKVF"
FT   gene            359993..360970
FT                   /locus_tag="Deide_3p02570"
FT   CDS_pept        359993..360970
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p02570"
FT                   /product="putative sugar uptake ABC transporter,
FT                   periplasmic component"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p02570"
FT                   /db_xref="EnsemblGenomes-Tr:ACO48223"
FT                   /db_xref="GOA:C1D3Z4"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="InterPro:IPR033893"
FT                   /db_xref="UniProtKB/TrEMBL:C1D3Z4"
FT                   /protein_id="ACO48223.1"
FT                   /translation="MNAIRPALTLTLALTLTGVTVVAVAQTLPKLAKKSTYKVGFAQTE
FT                   SNNPWRIAQTKSMQDEAKRLGHQLVYTDAAGSAAKQVSDVDSMIAQRVDAIFLAPREEK
FT                   PLAAAVKKARAAGIPVILLDRNVDQKLARAGTDYVTFIGSDFIEEGRRIGNWLAKNKKG
FT                   EARVIQLLGTTGSSPANDRRKGFEDAIKGKAGIRILASQTGDFARDKGRQVMETLLQSH
FT                   PDVNVVYAHNDEMAIGAIAALEAAGKKPGKDVMILSIDGGREIVKLIVDGKVNYVVECN
FT                   PKFGPKAFETLSNYAAGKKIPVKLINPDREFTPANAKKLLASAY"
FT   gene            361144..362694
FT                   /locus_tag="Deide_3p02580"
FT   CDS_pept        361144..362694
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p02580"
FT                   /product="putative sugar uptake ABC transporter,
FT                   ATP-binding component; putative Monosaccharide-transporting
FT                   ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p02580"
FT                   /db_xref="EnsemblGenomes-Tr:ACO48224"
FT                   /db_xref="GOA:C1D3Z5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C1D3Z5"
FT                   /protein_id="ACO48224.1"
FT                   /translation="MEQPPPLLLMQGISKSFSGVPALQDAHLRIRPAEVHALIGQNGAG
FT                   KSTLIKILTGAYRRDQGKVIFRGQEVEFTSPQMAQAGGISTIYQEVNLVGFRSVTENIF
FT                   LGRELKRGLFLDWRRMNAEARQVLERFNVHVDVTSPLMSHSVAVQQMVAIARAVSFRSE
FT                   LVIMDEPTSSLDDREVETLFGVIRQLKADGVAVVFVSHRLDELYAVCDRITIMRDGQTV
FT                   AEENMATLSKLQLVAMMLGKDTSELRQEGETAFVRTGDPKGKTLLDAQRLHTGTVLQGA
FT                   DVSVRAGEIVGLAGLLGSGRTETARAIFGADPLLGGELHMGDRPVQFRSPRDAIRAGIG
FT                   FCSEDRKIEGIIPDLSVRENLTLALLPALSQRGIIDPRRQAEIVDRFITKLGIKTAGPD
FT                   QKIRELSGGNQQKVLLGRWLCMNPTLLILDEPTRGIDVGAKGEIQALLSELAREGLGVL
FT                   MISSELEELAEGADRVVVMRDGRSIRELPREDLTQDAIMDAMAHGAAGHSGLPIGGQA"
FT   gene            362691..363683
FT                   /locus_tag="Deide_3p02590"
FT   CDS_pept        362691..363683
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p02590"
FT                   /product="putative ribose/xylose/arabinose/galactoside ABC
FT                   transporter, permease component"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p02590"
FT                   /db_xref="EnsemblGenomes-Tr:ACO48225"
FT                   /db_xref="GOA:C1D3Z6"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:C1D3Z6"
FT                   /protein_id="ACO48225.1"
FT                   /translation="MTGPDGKVLTTTMPPAGTRKERRVPELLGPLLALVVLLLFNALFT
FT                   PNFLTPQTLNVNLTQVATTVIVAVGMTLVIATGGIDLSVGALMAISGALAPMLFLHPPF
FT                   GSPALGLALAFVLPVLAAGAFGLFNGTLVARFNIQPFIATLILFIAGRGIAQVITNGQL
FT                   QTFSHPGFQYIGLGRPLGIPFQVILMVLVVGLFAWVMRRTVFGRQVLAVGGNEAAARLA
FT                   GVPVGRVKLAVYGITGLLAGLAGLIVIAINASSDANQVGLNMELDAIAAVAVGGTVLTG
FT                   GRATIIGTLIGALIIQLIRYTLLARGVPEAVALVVKAIIILVAVYIQRR"
FT   gene            363709..364701
FT                   /locus_tag="Deide_3p02600"
FT   CDS_pept        363709..364701
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p02600"
FT                   /product="putative ribose/xylose/arabinose/galactoside ABC
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p02600"
FT                   /db_xref="EnsemblGenomes-Tr:ACO48226"
FT                   /db_xref="GOA:C1D3Z7"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:C1D3Z7"
FT                   /protein_id="ACO48226.1"
FT                   /translation="MTTTPAPLASPTRIRTAQLLQQYGVLVALGLLILFGALRYDGFLT
FT                   PYNISTVLAYNSMFGLIALGMTFVIMTGGIDLSVGSVAALASVVAALLSPYGLWPALFG
FT                   AVAAATLLGLINGLIIAYLKILPFITTLAMLLAARGLALMFSNNESVSADFDHGFTTFG
FT                   QGSIGGVPFTAIVLFGAFAVGMLALRYTRFGRHVLAIGGNEEASRLMGLPVERTLVLVY
FT                   VLSGALAGLAGVILASQFGAGQPTEGLGWELTAIAAVVVGGTLLTGGSGSVGSTLVGVL
FT                   LLGMIFNILNFENGRGTISLSAYWQSVIRGAFLLVVVLLQNRLTRGSKP"
FT   gene            364754..365599
FT                   /locus_tag="Deide_3p02610"
FT   CDS_pept        364754..365599
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p02610"
FT                   /product="putative Phytanoyl-CoA dioxygenase PhyH family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p02610"
FT                   /db_xref="EnsemblGenomes-Tr:ACO48227"
FT                   /db_xref="GOA:C1D3Z8"
FT                   /db_xref="InterPro:IPR008775"
FT                   /db_xref="UniProtKB/TrEMBL:C1D3Z8"
FT                   /protein_id="ACO48227.1"
FT                   /translation="MTLSSATKPVQEQYDVPSIMAGIYGDGIIGLKGAFSREWVAQLGR
FT                   ELPELYTAALARPGGAVGRGTNRHYVEIHPEDISGFLDLVTHPWIVAVCTSVLGPNYKI
FT                   VEIGFDVPNPGAKDQPWHRDFPATSETLVDRRLNSLAFNLTTVDVEEDMGPFEIAPGTQ
FT                   WDDPSEYDHGMFPPVSLFPRYHALAQRKLPKMGDISARSALTIHRGTANVSNKPRPVLV
FT                   LGVDAPGAGHDEKHDLQFTRAYYEGLPQEVKDHLICRVVDELEPIMQGHTIEGLMMGDA
FT                   "
FT   gene            365604..365840
FT                   /locus_tag="Deide_3p02615"
FT   CDS_pept        365604..365840
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p02615"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p02615"
FT                   /db_xref="EnsemblGenomes-Tr:AHX26581"
FT                   /db_xref="UniProtKB/TrEMBL:X5HLP4"
FT                   /protein_id="AHX26581.1"
FT                   /translation="MREFNSVTAFFGDLAVPGRIEALEGGRGLMRVSLNGAPDISEGAE
FT                   AILEMHDGVRFRVAVTERLDDTNEVRMKLLARS"
FT   gene            365918..366313
FT                   /locus_tag="Deide_3p02621"
FT                   /note="nonfunctional transposase (degenerated IS - IS5
FT                   family)"
FT   gene            complement(366450..367229)
FT                   /locus_tag="Deide_3p02622"
FT   CDS_pept        complement(366450..367229)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p02622"
FT                   /product="putative transcriptional regulator, DeoR family"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p02622"
FT                   /db_xref="EnsemblGenomes-Tr:ACO48229"
FT                   /db_xref="GOA:C1D400"
FT                   /db_xref="InterPro:IPR001034"
FT                   /db_xref="InterPro:IPR014036"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:C1D400"
FT                   /protein_id="ACO48229.1"
FT                   /translation="MLRRGTLLIKERRQQILSLIQSRGEILVSEVAPLLGVSEVTVRSD
FT                   LKALVDTGHLRRTRGGARLPLDPRMEAPLEEMQLQQRAEKRRIGRAAAALIQDGETIFL
FT                   DVGSTATEVARHLPPTLREVTVVTPGLNIALELEKLPHVRVIVTGGTLRRLQHSLVSPY
FT                   ALEILRHVHADRLFLGCNGIDAVNGITNANHEEAEVKRCMVRYARTVVVLADHSKLGVT
FT                   SRAWLASADQVQTLITSRHTTPPPAALVNLISDFRIV"
FT   gene            367593..368738
FT                   /locus_tag="Deide_3p02640"
FT   CDS_pept        367593..368738
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p02640"
FT                   /product="putative Major Facilitator Superfamily protein;
FT                   putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p02640"
FT                   /db_xref="EnsemblGenomes-Tr:ACO48230"
FT                   /db_xref="GOA:C1D401"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C1D401"
FT                   /protein_id="ACO48230.2"
FT                   /translation="MSLIPVPSPAPPKRLAGIGVGAFLLLGLLYPILGPALPLLSEQFG
FT                   LRATGASLLLSLNSAGAVLGVILAGVLSARLTSRNRSLLAVATLAVGCVGLAFAPTFVL
FT                   ALLAALLLGSGFGMLDLTLNVWLSTSYGLRSAAMLNLLSATFGVGAVLAPLAVGFADGD
FT                   FRLPLLGCAALAGLLLLSLFALPSAAPEVYTPTQGLQTEVRSPRLILGGFMCLFLAYVA
FT                   VESGVASWEVTHLRDTLGITTGTASQLSALFWVSFTLGRLISAPLALRVAPAHLVTGSL
FT                   VLAAFSLALATIPAVAPYAYTLTGLFLAPVFTTGLVWLTRVLPGGAAPTFVFAGAFLGP
FT                   VLFSPVVGAMRDQFGPPAIPLTLMGIALLDLAIVIGLRRNL"
FT   gene            complement(369178..371061)
FT                   /locus_tag="Deide_3p02660"
FT   CDS_pept        complement(369178..371061)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p02660"
FT                   /product="putative GAF/PAS/PAC domains-containing metal
FT                   dependent phosphohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p02660"
FT                   /db_xref="EnsemblGenomes-Tr:ACO48231"
FT                   /db_xref="GOA:C1D402"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR037522"
FT                   /db_xref="UniProtKB/TrEMBL:C1D402"
FT                   /protein_id="ACO48231.2"
FT                   /translation="MIRGSGDSSDQQPLEEDLQLTAVWRYHLLAAPLEAAFRRTVNLAA
FT                   RLLNAPIALINLLDDRTQWTKGCYGMDLREMDRSLSFCQHTLGMNGVLVVPDTTQDPRF
FT                   SSLPLVTGDSAIRFYAGAPLITPDGHRVGSLCVLDTAPRIGLTEDECAFLQDLADSVVS
FT                   ELELRRGVAQREQQDARHAAVLTSSLDAVVIVDAHARVTDWNPEAERLFGYRRDEALAQ
FT                   DVRKLILTDETLKLLHRYRREGTEAVPRQRTLVTMRRRDGTVIPTEISVTPFQGDGTVY
FT                   FAAFFRDLTELQVTREALDTSHALLRKVIDNVPDVIYVKNTAREYLMVNASGAELVGRP
FT                   FSSILGQTDEVLLPPDTAAGMRERDETVLSSGQRGQYEVTATLPGQPTRSFRSTRTPFY
FT                   DVHGNPKGLVGTITDVTEQKAAQDAIRDHNERLASEVQAAQLEILERLAHAAEYRDDDT
FT                   GEHMRRVGRIAAGVARELGLPDDTVQLLERAAPMHDVGKIGISDSILLKPGRLTPEEFD
FT                   IIKTHPMIGSGILSGGTSPLIKMAEEIARTHHERWYGAGYPAGLAGEAIPVSGRIVAVV
FT                   DVLDALTSERPYKAAWTLDEAMEEIRRQTGRQFDREVVAALERLLSKQGQG"
FT   gene            complement(371351..372550)
FT                   /locus_tag="Deide_3p02670"
FT   CDS_pept        complement(371351..372550)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p02670"
FT                   /product="putative Benzoate membrane transport protein;
FT                   putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p02670"
FT                   /db_xref="EnsemblGenomes-Tr:ACO48232"
FT                   /db_xref="GOA:C1D403"
FT                   /db_xref="InterPro:IPR004711"
FT                   /db_xref="UniProtKB/TrEMBL:C1D403"
FT                   /protein_id="ACO48232.1"
FT                   /translation="MSNPLNVMRALPYSALAAGLISVIVSASSNLPLFVQMFAALHFTA
FT                   DQAVSSLTSMYLTLAVLGAGLSLLYRAPIILGWNTAGLALLIAEGPRFTPGEAVGALMA
FT                   AALILTFLGLTGLFDWIARCLPPPLAAALLAGMLLPFVLRGLSAVPTAPELLLPMVAAY
FT                   LLARAFVPRWAVPLALTAGLTATILTGASPDGLFLPSGTAGHLSYIRPVFDVHALLTIT
FT                   IPSVLLAVASQHLPGLAILSASGYGHVPPRPLVSLTGLGALLAAPFGSITLNLAAITSA
FT                   ISTGPDAHPDPAKRYVAGLSCAAGYGVLGLTAGGLLGLASIFPAPLMQGLAGLALLGPL
FT                   LVGREGTMVAEARWREAALLTLVVTASGITVLGVSAPVWGLLLGWSLAWMRGWRERSGG
FT                   "
FT   gene            373463..374752
FT                   /locus_tag="Deide_3p02680"
FT   CDS_pept        373463..374752
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p02680"
FT                   /product="putative plasmid replication initiator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p02680"
FT                   /db_xref="EnsemblGenomes-Tr:ACO48233"
FT                   /db_xref="InterPro:IPR018777"
FT                   /db_xref="UniProtKB/TrEMBL:C1D404"
FT                   /protein_id="ACO48233.1"
FT                   /translation="MDIRINELDLTRSGIISVHRDLPATDTSWEAEYTLGEAMYRVMGS
FT                   AFHGRPHGRDADVLLALQTVFFRAGCPDSNAIELTAAQLLALSGHARNGKNYAFLRASL
FT                   LRLSSVKWTMVRTQFDEKKGRHQGETTTTGIIAEMQVTDQATGSQRPFEGRELTETSPI
FT                   RISFVPSFAASIRDGFFQILDGELMSRLGQPQARSLYRVLQAHRVTSGGSLAGELVYKL
FT                   SDWFGACGLEGERIDNAKRTLDQAHERLKTEGYLHTVEYQGRGRAGKITYTFSAAPEPE
FT                   LVDQLMERGVTRPVAETLAADHPQRVVPALKMVDERLGSGWKPRSLAASVVDAVRNPAK
FT                   WGYVEPGVPVSTVPARKSRKAVVVEEEARDPRETIRILLRLKLGRAPTEEASRVLQELD
FT                   EEAVGAVREAVGRPKDEALKLVRALLNVDL"
FT   gene            complement(375335..376264)
FT                   /locus_tag="Deide_3p02690"
FT   CDS_pept        complement(375335..376264)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p02690"
FT                   /product="putative Nucleoside-diphosphate-sugar epimerases;
FT                   putative Epimerase, NAD dependent epimerase/dehydratase
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p02690"
FT                   /db_xref="EnsemblGenomes-Tr:ACO48234"
FT                   /db_xref="GOA:C1D405"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C1D405"
FT                   /protein_id="ACO48234.1"
FT                   /translation="MKVLITGAGGNLGRVLAPALAETGYTPVLMDFRPLESPHQCIQGD
FT                   ATSKADVFAAAEGVDVIVHGAALHGVHLSNHSRDDFWKLNMEGTYHVYEAARAHGIKKV
FT                   LLCSTMGVYGASVTVPDDSFAVVTEDLPCLPGDFYGMTKTLAEELAGFYSRSHDIRTIS
FT                   YRLGMFVPENFVRYGFRLLKGGVDDRDVAQAFLLGLKNDTILYDAFNIMAAVPFSLEQL
FT                   PQWRQDPRALVESQFPGISELVNRRGEDIDQLLRSWGHVYWSIEKARRELGYQPAYTFT
FT                   EFYSALKSGNDAHYPFADLPWWGVPEQA"
FT   gene            complement(376287..377060)
FT                   /locus_tag="Deide_3p02700"
FT   CDS_pept        complement(376287..377060)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p02700"
FT                   /product="putative short chain dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p02700"
FT                   /db_xref="EnsemblGenomes-Tr:ACO48235"
FT                   /db_xref="GOA:C1D406"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C1D406"
FT                   /protein_id="ACO48235.1"
FT                   /translation="MTGHNRVAPDSLSGQVALVTGASSGLGRATAVALAQAGADLVLLA
FT                   RSEGNLQSVAQEVEAMGRRALVCAVDLSSGPAVVDVVQQAVQTLGGLDILVNNAATDVP
FT                   GPVVDLSAEDWDRVLNVNLRAPFLLAKAAFPYMQRAGRGTIINVSSVAGKRGWANASAY
FT                   CASKFALTGFTQALAAEGRPHGIRACVVYPGGMATGWGTFDPQERRDQNPPEASPTVAL
FT                   PPRRVADLLVWMCAAPPELVLNEVIVTPLNEAGWP"
FT   gene            complement(377063..378001)
FT                   /locus_tag="Deide_3p02710"
FT   CDS_pept        complement(377063..378001)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p02710"
FT                   /product="putative Oxidoreductase, aldo/keto reductase
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p02710"
FT                   /db_xref="EnsemblGenomes-Tr:ACO48236"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:C1D407"
FT                   /protein_id="ACO48236.1"
FT                   /translation="MHYRQLGRTGIEVSEIGFGAWAIGGDAWGPVEDAASIRAMERALE
FT                   LGVNFIDTADVYGNGHSETLVAQVIKNRRDQIVVASKGGLMGHHRDPNQEPVYDRPEKI
FT                   IAAFEESLRRLQTDYIDVYFDHIWWNNPRETEAFLTAFDRLKQEGRVRAVGVSTDDFEY
FT                   VQHFNHGAALDVVQLDYSLLNRKAEQHILPYCLEQGIGVVVRGPLRMGMLTGKFTAGTE
FT                   FPEGDVRHNWPREDWYQAQLGQVQQLSALTSQERSLGQLALRFVLNHPAVSVAIPGGKT
FT                   PEQVEQNVEASARPLLEEEDIRQIEQVTPGA"
FT   gene            378350..379318
FT                   /locus_tag="Deide_3p02720"
FT   CDS_pept        378350..379318
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p02720"
FT                   /product="putative metal ion ABC transporter, periplasmic
FT                   component/surface adhesin"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p02720"
FT                   /db_xref="EnsemblGenomes-Tr:ACO48237"
FT                   /db_xref="GOA:C1D408"
FT                   /db_xref="InterPro:IPR006127"
FT                   /db_xref="InterPro:IPR006128"
FT                   /db_xref="InterPro:IPR006129"
FT                   /db_xref="UniProtKB/TrEMBL:C1D408"
FT                   /protein_id="ACO48237.1"
FT                   /translation="MKKMLPKFFLIAGLMALVSPAASAGEKVAKVSELKPVQLKGGKVK
FT                   VTTTINMISDLVQNVGGNRVQVTGLMGPGVDPHLYKASARDVRSIQDAHLIFYNGLHLE
FT                   GKMVDLLERSPKAVAVTDAIPRDLLITPPGGFIGIEGLQDPHVWFDVPLWKHTVHIVRD
FT                   ALTKVDPSGRKVYANNAASYLKKLDALHQRVDKMMSSVPKRQRVLITAHDAFSYFGRRY
FT                   GVEVRGIQGISTVAEAGTKDIQDLATFIVDRKIPAVFIESSVPKRTVEAVVQATRARGT
FT                   SLKIGGELFSDAAGAPGTREGTYIGMVEHNARTISDALRGK"
FT   gene            379331..380086
FT                   /locus_tag="Deide_3p02730"
FT   CDS_pept        379331..380086
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p02730"
FT                   /product="putative manganese/zinc/iron ABC transporter,
FT                   ATP-binding component"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p02730"
FT                   /db_xref="EnsemblGenomes-Tr:ACO48238"
FT                   /db_xref="GOA:C1D409"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C1D409"
FT                   /protein_id="ACO48238.1"
FT                   /translation="MTAPAHPAPLAVRDLTVAYREAPVLWDINLEFPAGQLCAIVGPNG
FT                   AGKSTFLKAVLGLMPKASGSIRFFGAPLAQSRRRIGYVPQRTSVDWDFPTDALDVVTMG
FT                   LYGRLGWIRRPGKRERELAMQALDRVRMTEFAGRQISQLSGGQQQRVFLARALAQDADV
FT                   YFMDEPFAGVDATTERAILDVMRDLQEQGKTVVVVHHDLDTVREYFDHVTLLNVSLVAS
FT                   GPIETTFSPELLRKTYGGKVAFLRESVAG"
FT   gene            380083..381045
FT                   /locus_tag="Deide_3p02740"
FT   CDS_pept        380083..381045
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p02740"
FT                   /product="putative manganese/zinc ABC transporter, permease
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p02740"
FT                   /db_xref="EnsemblGenomes-Tr:ACO48239"
FT                   /db_xref="GOA:C1D410"
FT                   /db_xref="InterPro:IPR001626"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:C1D410"
FT                   /protein_id="ACO48239.1"
FT                   /translation="MNVEFLLSVFTDYTLRNVALGSALLGITGGIVGAFAVLRRQSLLG
FT                   DALSHAALPGIGLAFLLSGGKAPLWLLLGGGATAWLAALAMITVLRFTRLSEDAALGTM
FT                   LASFFGFGIALLTFIQNGSNASQSGLDKFLFGQAATIVAADVILMAILAALALGAVMLL
FT                   FKEFKLVSFDPAYAATLGVPAPLIGTVMTSLAVVAVMIGLQSVGVVLMAAMLVAPAVAA
FT                   RQWTDHLGKMLLLSAGFGAASGVAGALVSAAVTNLPTGPLVIVAISILMIFSLLFAPLR
FT                   GLLWARISASRRDRNLRESTRRIVPPLGHLHDQGVQHER"
FT   gene            381035..382117
FT                   /locus_tag="Deide_3p02750"
FT   CDS_pept        381035..382117
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p02750"
FT                   /product="putative manganese/zinc ABC transporter, permease
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p02750"
FT                   /db_xref="EnsemblGenomes-Tr:ACO48240"
FT                   /db_xref="GOA:C1D411"
FT                   /db_xref="InterPro:IPR001626"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:C1D411"
FT                   /protein_id="ACO48240.1"
FT                   /translation="MSADLIIVLTACLVAVAGSLLGVFLVLRRLSMISDAISHSVLPGI
FT                   VAAFWFSGGDTATVPALIGAAAMGLLTVVAVEVLVRSGRVKNDAAIGVVFPLLFSIGVI
FT                   LISVYFRNAHLDLDAVLYGEIAYAPFNLVGVFGQMLPESLVLMGTLTLLNAAFVGMFFK
FT                   ELRLSTFDAGLAASLGFAPGVLHYALMTLLSFTTVGAFEAVGAVLIVAFVIVPPASAYL
FT                   LTRKLSAMLGLSLGIGVICSVAGYFVAMAVDASIAGMIASLLGAVFFLCLLLSPLDGVL
FT                   ATLYRRARQRDSVAARQLVAYFFKKGREASLSEVAQRFEWTPRQTKRAHHYARKQGWLS
FT                   QDGVTVSRTPPGMGMGHASD"
FT   gene            382104..382502
FT                   /locus_tag="Deide_3p02751"
FT   CDS_pept        382104..382502
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p02751"
FT                   /product="putative iron dependent repressor"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p02751"
FT                   /db_xref="EnsemblGenomes-Tr:ACO48241"
FT                   /db_xref="GOA:C1D412"
FT                   /db_xref="InterPro:IPR001367"
FT                   /db_xref="InterPro:IPR022687"
FT                   /db_xref="InterPro:IPR022689"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR036421"
FT                   /db_xref="UniProtKB/TrEMBL:C1D412"
FT                   /protein_id="ACO48241.1"
FT                   /translation="MPRTERCSHVSPAQGKYLMRLLYLQETAGTHVVSTGRLAQDLNVK
FT                   DSSVTGMLERLAEAGWVIYMPYRGARLSEQGLCIARDLTCTHDNLIAFLCETLGYSLAN
FT                   AESEAEHLEHHVSPEFIQRLKIWIKQKN"
FT   gene            382714..383334
FT                   /locus_tag="Deide_3p02760"
FT   CDS_pept        382714..383334
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p02760"
FT                   /product="conserved hypothetical protein; putative membrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p02760"
FT                   /db_xref="EnsemblGenomes-Tr:ACO48242"
FT                   /db_xref="GOA:C1D413"
FT                   /db_xref="InterPro:IPR032808"
FT                   /db_xref="UniProtKB/TrEMBL:C1D413"
FT                   /protein_id="ACO48242.1"
FT                   /translation="MSRIEPRNRTAGATPPPPILNSQGIGQIKSEMNLLDARLLGWWAQ
FT                   HGVTLLRLSLGIIFFWFGVQKFFPGVSSAEGLATRTISVLTFGAVPPGVSLPVLATWEC
FT                   AIGLGLLTGRFLRLTLLLLFAQMAGTFLPLVFFPEETFSVVPWVPNLEGQYIIKNLVLV
FT                   SAGLVVGATARGGKLIMDARAAQTAERTQALHQRFRRRFHREP"
FT   gene            383469..384809
FT                   /locus_tag="Deide_3p02770"
FT   CDS_pept        383469..384809
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p02770"
FT                   /product="putative Sulfite oxidase, precursor; putative
FT                   Nitrate reductase (NADH), precursor"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p02770"
FT                   /db_xref="EnsemblGenomes-Tr:ACO48243"
FT                   /db_xref="GOA:C1D414"
FT                   /db_xref="InterPro:IPR000572"
FT                   /db_xref="InterPro:IPR005066"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR008335"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR019546"
FT                   /db_xref="InterPro:IPR036374"
FT                   /db_xref="UniProtKB/TrEMBL:C1D414"
FT                   /protein_id="ACO48243.1"
FT                   /translation="MHDELNATLSAGESSTEHGPTRRNFLALGAAAAGALATGSFGSAQ
FT                   TATCIDIPERPTAKRPDPQPNPRVYSDKETLLAFRNHGHFAEFLDQPVTPLGMHYLLVH
FT                   FDVPKLSANGYEISIGGRVRTPKRVSLSEIKARKQITEPVIMECAGTGRSTFQPRGIYV
FT                   PWFKEAIGNYEWTGTPLRPLLEEAGLLDDAVEVLFTGWDTGVDLGVEHAFERSLPIKEA
FT                   LRDGVMLAWAQNGQPLLPQHGFPLRLIVPTWYGMASVKWLRAITVLNQPFKGVEQAKVY
FT                   RYQKSATDPGVPVTVKRVHSVMKPPGLADAISRYRFVAPGRHLLQGMAWSGTGAVRRVE
FT                   VSTDGGRTWKDAQLGRPGGPYSWTPWRTEWQVTQPGEYVLSSRATDTAGNIQPLSSAAI
FT                   WNRQGMGGNVIERIHVIVQPGVGRSGDHVPSRPRQAVSGADMPPPTK"
FT   gene            385203..385622
FT                   /locus_tag="Deide_3p02771"
FT   CDS_pept        385203..385622
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p02771"
FT                   /product="putative transcriptional regulator, MerR family"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p02771"
FT                   /db_xref="EnsemblGenomes-Tr:ACO48244"
FT                   /db_xref="GOA:C1D415"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR015358"
FT                   /db_xref="UniProtKB/TrEMBL:C1D415"
FT                   /protein_id="ACO48244.1"
FT                   /translation="MTVPAALPIGDLAALTGETVKSVRYWTDLGLLTVGRRPSGYRAYP
FT                   IEAAEQIAFIRSAQAAGFRLKEIRRILSIRQNGQKPCAQVKEDLERHLGAVRVQIAQLQ
FT                   ALEAQLQAKVAWADRHPEPDCHCAGCVYLEVTPRA"
FT   gene            385657..386148
FT                   /locus_tag="Deide_3p02772"
FT   CDS_pept        385657..386148
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p02772"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p02772"
FT                   /db_xref="EnsemblGenomes-Tr:ACO48245"
FT                   /db_xref="InterPro:IPR040890"
FT                   /db_xref="InterPro:IPR041854"
FT                   /db_xref="UniProtKB/TrEMBL:C1D416"
FT                   /protein_id="ACO48245.1"
FT                   /translation="MASSGCCAPEPGLSTLPICPTCGTTGRTVKLITLKALLRPPALAT
FT                   LDPNRIYRFCPNSGCEVVYFFDLFVYVRADVKVPVFQKDQATDTPVCYCFGLTRGDLSA
FT                   ATQGGLPETISSTIQAHIKAGRCGCEVNNPQGKCCLGDIYKTLSALQQASERRGPSRLP
FT                   "
FT   gene            386345..387028
FT                   /locus_tag="Deide_3p02780"
FT   CDS_pept        386345..387028
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p02780"
FT                   /product="Hypothetical protein; putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p02780"
FT                   /db_xref="EnsemblGenomes-Tr:ACO48246"
FT                   /db_xref="GOA:C1D417"
FT                   /db_xref="InterPro:IPR025509"
FT                   /db_xref="UniProtKB/TrEMBL:C1D417"
FT                   /protein_id="ACO48246.1"
FT                   /translation="MDMDMSAMNMLPDWWTPAAWIYLIASVISAGFLAYDLYVRRRRLH
FT                   VPAMRPVWVVSALFLGPLAILLYARWGLELADGRAGSTRMAWILLALLPGAAASTVAHL
FT                   IGVPVVFGAGWTIAGDALWAVALFILILATLLLFMFDTAAATGERANHLVRLFLGAFFT
FT                   VLAFDIGMVGWMLYLHGNGLMQPITDVVFTTQMQIGMLLGMLTALPVAAWLTPKPASGP
FT                   QAFVP"
FT   gene            complement(387427..387621)
FT                   /locus_tag="Deide_3p02782"
FT                   /note="nonfunctional hypothetical protein"
FT   gene            complement(387594..387929)
FT                   /locus_tag="Deide_3p02781"
FT                   /note="nonfunctional hypothetical protein"
FT   gene            388355..388612
FT                   /locus_tag="Deide_3p02786"
FT   CDS_pept        388355..388612
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p02786"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p02786"
FT                   /db_xref="EnsemblGenomes-Tr:AHX26582"
FT                   /db_xref="GOA:X5HNC1"
FT                   /db_xref="UniProtKB/TrEMBL:X5HNC1"
FT                   /protein_id="AHX26582.1"
FT                   /translation="MNQLRSPLTGLGVIAFLGSIILMARPQTQLMGGPLFGMVLALALL
FT                   VLAGQLQDARSHTASHLLSLCGLVSLAVCFYRLGHTLTWW"
FT   gene            389710..389964
FT                   /locus_tag="Deide_3p02790"
FT   CDS_pept        389710..389964
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p02790"
FT                   /product="Hypothetical protein; putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p02790"
FT                   /db_xref="EnsemblGenomes-Tr:ACO48248"
FT                   /db_xref="GOA:C1D419"
FT                   /db_xref="UniProtKB/TrEMBL:C1D419"
FT                   /protein_id="ACO48248.1"
FT                   /translation="MPIRRSLKIAWGIALTFACALMFLEPDAMHVAQALLTLVILSALC
FT                   VLILHCWRTGAYPLAIAMTICGLGVLAGVLMLLVISFTA"
FT   gene            complement(392552..393841)
FT                   /locus_tag="Deide_3p02810"
FT   CDS_pept        complement(392552..393841)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p02810"
FT                   /product="putative plasmid replication initiator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p02810"
FT                   /db_xref="EnsemblGenomes-Tr:ACO48249"
FT                   /db_xref="InterPro:IPR018777"
FT                   /db_xref="UniProtKB/TrEMBL:C1D420"
FT                   /protein_id="ACO48249.1"
FT                   /translation="MALDTVDMDRWDVQFDAGDRLVRVSCEAMPKYRVPHGLDSDVTAA
FT                   LINLYFEQGEPDDGTLVTSVGQLIRLCGWHNNGNYISSLRESLKRLHTSSFTISGGWRD
FT                   FPNRRWTHASFHFIERLSFSTPDQASTFDLRSIITLRLAEDIVASLRSGYVKPLDMEFM
FT                   GTLTRPRTRVLYRVLDAARYKVDEPDMPLTHLEVNVLTWADQCKIPSQDEAWRVIKALN
FT                   GPHEELKKKGYLRNVTISGRGRSQKILYEFSEDYSPIDPVLARRFRGYGVADGVARRLV
FT                   RDKGRAFLIASMDRFDLLVKRQVLVVKKSPAAALMHLIAHPDDYPYPAQEASPRSAPAR
FT                   MDPLLVIPEVDHSAQFEGLSPEMAAERLIAYLNPHYRKLWGVAELDALRHAVASGTVQA
FT                   GDQARAGITAVTQLKREAFVQSLRDELFQE"
FT   gene            394663..394824
FT                   /locus_tag="Deide_3p02812"
FT   CDS_pept        394663..394824
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p02812"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p02812"
FT                   /db_xref="EnsemblGenomes-Tr:AHX26583"
FT                   /db_xref="UniProtKB/TrEMBL:X5H5Y9"
FT                   /protein_id="AHX26583.1"
FT                   /translation="MPLNKQALQTLLKLREEAVSRFPMLLKQDTRIAEATQLTSRSEQR
FT                   RVTNNVST"
FT   gene            395096..395524
FT                   /locus_tag="Deide_3p02814"
FT   CDS_pept        395096..395524
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_3p02814"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_3p02814"
FT                   /db_xref="EnsemblGenomes-Tr:AHX26584"
FT                   /db_xref="UniProtKB/TrEMBL:X5GYB8"
FT                   /protein_id="AHX26584.1"
FT                   /translation="MTRVPEKTLRRTLRGRGHRHPQKIILLIQGSALSAQNLQTLAIRA
FT                   LTANRLEQRVVLQAISDNLSVQTIKANLSDLKVVAAQVLLGLLAQKTQFIFSIQHGRLH
FT                   RSCSTPENLKRIEHALDEFRVDRGLVTLTQSKATPLGN"
XX
SQ   Sequence 396459 BP; 76123 A; 121986 C; 121486 G; 76864 T; 0 other;
     gggcgttacg gcggttcgaa acaacctccg ttctgtcctg aagaaggtcg agcgcgaaca        60
     ggcgcaggtg atcatcatga acaacggtga acctgtagcc gcgctgatcc ccctcaaaga       120
     tttccaccgc atccccccca tcaagctgga ggacccgcaa tgactaaagt gattaccttc       180
     ttcagcaacg ctgggggcgt cggcaagacc agcgcgaccc gcgacttcgg gtatgagcta       240
     tcgcaacaag gctaccgcgt cctcttgatc gacctggact cccaggcaaa cctcaccgac       300
     tggctcggtg ccactgttga tgagtcactc gatcttgagc aggaaaagaa ctttacgatg       360
     ttcaacgcca ttatcaatgg agcgcctctc ccagtgcctg tcacccgtca cggcatggac       420
     atcattccct ccggaatttc catcaccgaa attgaaggca ttctccctaa caaaccgctg       480
     ggcggcgaga acctgctgcg taaggctctt gcaccggtaa aacaggagaa acagtacgat       540
     ttcattttga ttgactcgcc cccgacgctc ggtaagattg tgaatctctg cctgatggcc       600
     agtgatgaga ttgttgtgcc ggtgagcagc cgaaacaagg ggtataaggc agtcgccatg       660
     gtacacaaga agattgccga cttccgcgaa aataacccga gcctcaatgt ggccacccac       720
     ctgatcacgc agctgaataa cacttcgcac tcaaaaatta cagacgaggt cgcccggcaa       780
     actttaaaga atgtcagcgg gccgctgcgt caccgaccag cggtgtacga caactgtcag       840
     ctggccatga tgccggtagg cgcatatgaa ccgaacgggg aagcccgcaa ggaagtgatg       900
     gctgcagttc agcagatgct gacatatatc ggagtctcag cgtgagcccg aagcctgaca       960
     tccgcgcaag cctgctgaac agcaagacct cgaaagaggc agtgtacaac cagcgcagta      1020
     agaccattct ggaagttccc ctggatcagg ttgtaccgtt cagcggtcag gctcggcgtt      1080
     attttgacca cgactccatc aaggcgctgg cggactccat tgaaaagcac gggcaactgt      1140
     cgcccctgct tgtatggcgc aacaatgacg agcagtacga gataatcgct ggggagcgcc      1200
     gttggaaggc gcttagaatg ctcaagcggc gggtggcgct ggcagacgtg attatggatg      1260
     tcacccgaga ccaggcgttt gagattgccc tggtggacaa ccttcagcga gagaacctga      1320
     atcgctatga ggaggtgcgt gccaagctgg acctgatcgc ccggcgcctg atgatgacgc      1380
     cggacgacgc ccgggcagaa ctgctgcgct tgcgcaacgg caccagctcg aatacacagc      1440
     acctggtcat cgttgaggag gtgctgaaga tggcaggcaa cgagtcgctg caatcttttg      1500
     tggccaacgg ctttcccgtc ctggatctgc cgcaggtttt gcgacaggca gtagaagacg      1560
     gatcactgca tccaagtaaa gcaaccgtca ttaagggagc gccagaggag catcacgcag      1620
     tcctgatcca acagacagtg gaggagaagc tcacacgcca gcaggtgctt gatcgcgtcc      1680
     gggcccttgc ggcccccaaa ggaataacat accggtcaaa cgcggacgcc gtgcgcaagc      1740
     tcctgactcc ctcacgcctg aaaacgctcg acactgccag gagaaacgag cttgaaaccc      1800
     tcttggcaaa ggtgaaatcc ttactgcagt gagcggagaa agagtccgcg gcccgcgaca      1860
     gtcgggccgc tattattttg aaataacact tgattcaccg ttgagtcaca gacgagaaaa      1920
     tttccttttt tgtgtcaggc ggtagtcctc atgcagagag cattgaccag aagtcaggga      1980
     aaagtcctta aaccctattg ggagccggtg ctgatgcagc tctccgtctc acggtgccag      2040
     atgtcgatgt gcaacgagga ggcagacaaa cccggcgggt gaaacgtgag gacgcactgc      2100
     agcagactgt acccagaccg cgtggaagtg cctctgatgc tccggcggta actgcccgaa      2160
     caactgttta gcggcgcgca attcacctgc tgcctgctgc gtgagctctt cgtcagacac      2220
     gtcaatcgac acaaccccgg cttatacctc caccaggtcg tgcatcactc ctcatcgtga      2280
     gtgatggcca tcagcgccag gcgccggaca ggtgccggaa gcgcccggca ctgttttcgt      2340
     accggcttcg tcgtgcaggc gggtcggagc gcgcggagcc agttgccatt ccggtcatca      2400
     ccgggcgcca ggacatctca ccgccgcggg aagtgccgtg gagcgggcac acgatgaagg      2460
     tcaaaatttg catcggcgtg gccaccatgc cgtgacgtac cccgcagtac agcgaagcat      2520
     cctgatgagc cagaccaaca cggcgctgta cgatgccatg accgcagggc ccaatcacat      2580
     gacggtcgcc cgcagccgct cccctcctcc ttcactcccc agtaggtgcc tgatgaccgc      2640
     caacgaaacc ccccaactcc aggatcttga gctggtccag ctgatcaacg gtatcgtctg      2700
     ggaagccgac cctgtcaccc gggtcaacac cttcgtatct gaccgcatca cgtcgttgct      2760
     ggggtacacg cctgaacaat ggcgctcacc gggcttctgg gaggcccaca ttcacccgga      2820
     cgaccaggcg cgcatcgtgg ccgagggcga ggcgctgatg ggccgcgggc agccttacca      2880
     gctcgaatac cgcatgaccc gcgccgacgg ccagactatg tggctgcgcg atctgatcac      2940
     gccggtattc aggggaggcg tgatggtcaa gctcggcggc gtgatgctcg acatcactgc      3000
     cgaaaagaac gcccaggctg agctgctcgc ggcccgggcg cgcttcagcc ggattattga      3060
     atcgagccct gtgggcatgg ttttgtcgga tatcaagacc tcgcgggtgc tggagaccaa      3120
     cgacgcattc ctgcgcatta tcaactgccc gcgcgccatc tttatgggcg aggaggacga      3180
     cttcaacccc tgggtcagtg ccgatgaccg tgctgagctg gtgcgccggc tcaaggaaga      3240
     ccgcaccgta cgcgacttcg agacgctgca caagcgccgc ttgactgggg agcagcgcaa      3300
     tgtcctgatc agcgccgagt acctggaaat ggacggccag gaaaccctgc tggtgatggc      3360
     ccaggacatc accgaccgca aagccagcga gatggcactt gaagagagcc gccgaacctt      3420
     tgaggcgctg ttcgagcatt ctcctgacgc cattaagctg atcgacttcg acaccgagga      3480
     gatgccgatt ttgcagtgca ataaagtcgc cgcccgtatg agcggctata cccgcgagga      3540
     gatcatcggc aagagcgcct acgccaccct gcctgacgac cagcgcgcgg ccatcctggc      3600
     cagtggcgac gctgaattcc gcgccagcct cgaatccgag ctggagatgc gttttgagtc      3660
     ggtgcagcag cgcaaagacg gttcgctcta tccggtggac attaacctcg cgctgctgac      3720
     ggtaggtgac aagcgagtgg tgctgagcat tgagcgcgac atgaccgcac gcaagaaggc      3780
     tgaagcagaa ctcaagtcca gccaggagcg gctgctgtta tctgaaaagc tcgccagcct      3840
     gggccgcctc accgccggcc tggcccatga aatcaatacg ccgctggccg cggcgatgaa      3900
     ctacctgcac gaagccgaac ggctggcccg ggaatatcag gcgtctatcg gcgaggcgtc      3960
     ggtgactgac gacgaccacc gcgagattgc cggtgagctc atctcgacct taggcgaagg      4020
     cgccaaaacc gccacccgca ttggtgaatt tatccgccgc atgcgtgaac acacccgcga      4080
     caccgtcact ggtgtgctgg actttgacgc tggccgcggc gctgaggcta ccctgactat      4140
     gctgacccac caggcccgcg ccgcaaacgt agagctgatc tttgaggcgc cggagcagct      4200
     ggtggtgctg cgcggcgaac ctggcagatt tacacaggtg gtgaccaacc tggtagtcaa      4260
     cgccattcac gcctgtgaag gcaccagcca gcaggctggc acggtcacag tacgcctgtt      4320
     tgagcagctc gggcatccgg tgctgcaggt gcaggacacc ggcaccggca tctccccgga      4380
     agtgctgccc aagatcttcg acccgatgtt cacgaccaaa gacgttggca aaggcactgg      4440
     gctggggctg tctatcatcc acgacatcgt aactggccac tttggcggtg aaattagcgt      4500
     gcagaccagc atcggagaag gcagcacctt cagcgtcagc tttccgcggc gcacgcgcag      4560
     cgaagcgctg gccgggtaaa cccgttcgct ttttttcggg gtgtgtctgc tggggctgga      4620
     aacgactgat gtcaaagact gatgcagtga cgtttgccat taaaagacac ctgcgtgttc      4680
     acagttgatt tccggagtga gggccacgtt tttacagccc gacaagaagt tcattgcctg      4740
     ggcgtggtct ggcaatcaga tacccctgcc tcagggtgca tcccagactc taaaccacgc      4800
     tcagtacctc cggcctttcg atgcctccgg caatcgtggt catgcgcagt ccatccgcca      4860
     gacgagaatc aaccgggagt gctcagcttc acggcgcatt ctagagatcc tgtctgcaat      4920
     gcatcatgac gaatgctgag gctgctggga acagcgattg ccaggggaga gtgcatctcc      4980
     gtttttcgag cctgtacggt cgggttcaaa tcatccgctg ccagctgcgc gtggtccttg      5040
     cgaatcgtct ctacggactc gcgcccaagg tgtgctgcca cgcgtccgaa atccctcacc      5100
     tgctacagca gatgcccgcc agcgtacctc cgtgctgggt gaaaaccccg gaatatcagg      5160
     cccgctccct tgaaggcctt ctcggtctgg taccgcgccg tcatcacgct cgcgtaccga      5220
     aacacatgcg ctgaggacgt cgtgcgcttt ctgtccgtga catcccggcg gggcgaggag      5280
     aggttgcccg tctcgacggc cacactcgtg tcgttcccga gttccatcag tttcatctcg      5340
     acgtaggcgg ccagcatcag cagatgctcc gcgagggctg gcgtgttgag gaagctgccc      5400
     gtcggctgcg gggcgagggt gtgaatatcc tggatgtacc gcgcgatggg ggagtctgat      5460
     ctctacctgg cgcgaacagt tcctcagcga cacgcaagcc gagcagaggg atcaggttaa      5520
     gggggccggt aagagcgcgc ccgagctgaa gggtgtcgtt aagtgcgact gctcgccgca      5580
     atacgtgatg gtcaggggcg tcccggcact gttcgcgtag gctaacctcg cgccggtgag      5640
     cagagcgagc gtggcttcca gaaccgtgct gttcaagtgg atgacgggac agggtctcag      5700
     gcaggccatt cacctgacgg ttgaagccag cggggccagg cccacccgtt gccggtaggc      5760
     cgcgatgggc caggcccgcc caccgccctg gcgtacccac tcgatatcgc ctgccgcagt      5820
     gcgctggaac tggaacggct caccaaccga accgaagcca gcctccggtt tgggagtcac      5880
     ggtgttggcg tctactactg tcaattccgt gacactcagg gcagggtccc cctggggggc      5940
     cagggacacc aggcggcctc ccagatcaac caggtcgaac acgccccagt ctgtggcaaa      6000
     ccggccggta tatgagtcga ggttgaagac tgacccgtcg gaagttttct tctccgacag      6060
     gttcattgcc agatcgatca gcttgatcag gttcgtcgcc cattcggtcg cgggaccgcc      6120
     cagacagttc gtcaggacag acaccgtcag gcccgattcc gggtcgagcc acgactgcgt      6180
     gatgtgccca ggaaagccgc ccgaatggcc gacgaccagg cggtccccaa tttcctcgac      6240
     gataaagccc aacccgtacc agcgcttaac tggtcgacgg atttcggatt ccttgcgctg      6300
     catcaggcgc ttggacgcgt ccgtgagcag ttcgtcaagg cccatggcat gcgcggccag      6360
     gtaagccgta acgtcttcag ccgtgccgta aaaccctgtg gcggccgcca tcgctcgcgt      6420
     gtccgttgac ggcaggaccc gccgggcatc gttgcctgcc aggcgcccgc tatgcccggc      6480
     cgccagctcg gattcgcgtt ccagcggcag ctccggcccc aggttggtca gcgtgagcgg      6540
     cccggtgatg tgtgcggcga tgtactcctc gtaggtctgt ccgctgaccg cctcgatgat      6600
     caggcccagc agcgagtaac ccatgttcga gtacttaaag aactgatccg gtgcgaacac      6660
     ggcgtccgcc cggcacagcg tgatcagagc gtcgcggttg gggaaatcgc agagctgctg      6720
     ccagtagtcg ctgtcggccc catcacggtt gatgccggac tggtgtccca gcagggcccg      6780
     caccgtcagc cctgctgcgg gcgaccccgc cagttccggc agccagaggc ctgccaggtc      6840
     gtccaggcgc agcgcgccgg tttcgaccaa ttggaagaca gcggtcgcgg tgaaagtttt      6900
     ggagtgtgag gcaatccgga agaggtgccg tggggtgagc ggctgcccgg tggcctcgtt      6960
     ggctacgccc agagcaaacg aagccgccag ctcaccgttc acccggaccg ccacctgtac      7020
     gcctggcacc cgcgccagat ccctctggta ctccaaccat gactgcaggt aaggggccag      7080
     ggcttggacg gtgtcgaata ggggcatgag tacagggtag tgcttggggc ataagccggg      7140
     gtccgagggc aaggtgcgct ttggcaactc gggcaggaga gtcagtgggc gatacagcgc      7200
     tgatccagct gatccagcgc ggaaggtttg gataaaatca gtgggcagcg atctgtccat      7260
     acccttctgg ttatatagat ccgttcaact gaggaagcca cggatggtct ggttgggaag      7320
     atttcaattg gctgtgcagc cagcgctgtt gccctgccgt aagggaagga cgcaaccgtg      7380
     caaaatcacg cgcgtccttg aggcgcattc ccccctcgcc gcgaccagcc ttgaacagca      7440
     gcgccgcttc tggtgtcaga taggggagac catggggtcc ctgcaatctc gcccgctcta      7500
     atggcagtgt aatgttggga tcgcggcgat acctccatcg cccgccgctc agatccgtga      7560
     gcatcaggtc gagcatgaca acgtctggca ggtccgggtg ccgcgcgtgc acctgaaagc      7620
     tggggggttc cagaggcggt acccagggct ggtaggtgcg gtttaccgaa gcgtccagtc      7680
     tccagccaga ttgctgcaga tgatcgtgaa gttcggcctg ctggtcgtac ggcacgatga      7740
     catctaaatc gtcgtgcgga cgagtcacgc gccccatgta caagtcgagt gcgacgccgc      7800
     cagcgaacat ccacggaaga tcgagaccag cgaacatgcg cgccacgaaa cacgcagggt      7860
     gaaacccgac ggtgcaggcg taatgggcac tggcacgctc ctggaaggcc agatcagctg      7920
     tgtcgcgacc atggcttccg aacacctgga cgtatgctgc tgcagcctcc ggactgtcga      7980
     gtagcagtgc cctgagagcc tgctgcccgg cacgccatcc cgacgcttcg tccggcagaa      8040
     ccagtcgcca cccaccagga tgctgccagt gtaggcctgc cgggacgtat cccagggaac      8100
     ggagcacatc cacctgagtg gaagtgattg ggccagggag aagatccacg tgaagttctg      8160
     gcatgtccag ggctttcaag gccggtacgc ttcctggtcc gccaatctgc aggtggaata      8220
     ccccgtcagt gcgggagcgg tcgtggtagt ttccgatggc gccgcacagg tcaatcagag      8280
     ccagatgcag gtcaggcatg aagtgattct cgcctgtgca attggatgtt gaatccgtca      8340
     tctggcccat ccatgctgct tttgggacgg agcgcccggt ggagcactgc gctggtttgt      8400
     ctccgcacct gttcggctgt caggctctgt gactgtaact cttcagttcc gttttctggt      8460
     gtcatgcatg actgatgaca cgggttccag atagccctga cagggcatgc tgaccgttgt      8520
     atttggggac gagaagacac aacttcgctc cagacagggc gaacctcttg catttatggg      8580
     gtgtggtccc tcacactgcg gctatgacga agaaaaatac aaaagcgccc gccaagaaac      8640
     ctgctgccac aaaatcggcc gccagtgctg cccctaagaa ggccgctgct gccgagaaga      8700
     tcggtaagac ccagatggtg gatatgatcg ccgaccgggc gggcctgacc aaaaagcaga      8760
     gtgaagaagt ggtcagcgtg atgctcgaga gcatcgtcga ggccgtgcgc agcgggaaga      8820
     gtgtcggtct gccaggtctg gggaccctga gtgtcaggga aaccgcagcg cgcaccggcg      8880
     tgcgtcccgg caccagcgag aagattcaga ttgccgctgg caagaagctc gcgttcaagg      8940
     cggccaccac cctcaagggc acgctgtaat tcaggtctat tcttcactga gccccctcgt      9000
     gtgagggggc tcactcttga cctccaagcg tcgggaacag ccccagaatc ttgggccaac      9060
     cataacccca gtgcttgccg tctgttccta ccctggctac gtacagtgtc cagatgaggg      9120
     aaaacagata ctgctccgca tctcaccgcg tagtcaggtt cgagagggac aacggcacag      9180
     gaaccgggtg cagcagggcc cgcacatgca aaaatgcttc agcaggggag gccaggtgct      9240
     ccaggcttgg ccctgagacc cggaaggtgt ctccacgtcc acgctcaaag gcaccatacc      9300
     ctaacccgct gattgtttat gcctactccc cagtttaact gggaacatca cacaccaacc      9360
     atcaggcact acggacagga agcggttcaa ccggaaatca accggccatc ccagcatgcg      9420
     tgctgggact ctgcaggaga tgcggaacca gaaccgctaa cgcggttgct cactccaggc      9480
     catcatggac ggctttgtca gtcgatttta ttgcaacccg tgtgctttcc gtgagcttca      9540
     tttttcaata cccgcactgc ggaagataac cgatgaccgt atctgggctg attaaaaaaa      9600
     gcacacgggg ttatggctgt gtggcatgac agaatctttc tgctcacaaa gagcagcccg      9660
     ggttgacagc aaaaagcagc attcgttcgc gatgacgcgg tgtgccccaa gtagctctat      9720
     ccgctaagct gagctacacc gatcttgctc gccattgcca gaccactccg tattacctac      9780
     gaaccagagg agtccggatg acccgaccac ccctgccccc cttcacgatc cacaccgcac      9840
     gcgacaaggt caggctcgca gaagatgcct ggaattctcg tgatcctgcc cgggttgcgc      9900
     aggcatacac cgaggatagt gtgtggcgca accgcgacga attcttctcc ggccgccctg      9960
     ccattgaagc ctttcttacg cacaaatggg aacgcgaaca cgactaccgc cttatcaagg     10020
     aactgtggac cttccacgaa aaccgcatca gtgttcgctt ccagtacgaa tttcatgatc     10080
     actcgggtca gtggtaccgg gcccacggca atgagcagtg ggagttcgac gaccggggcc     10140
     taatgcggcg ccgggaagcg agcatcaatg atgtgccaat tcgtgaggag gagcgcctgt     10200
     ttcggtggcc tgcaggtcgg cgtccagacg atcatcccgg cttgactgaa ctggggaggt     10260
     aaggccataa gatgctgttc tgttcagccg gttttgcccg gccaggccca acctgcaccg     10320
     cagcgtgaac atgcaaactg ctgtgtcccg acgcaggtta cggtgctggc acagcggcca     10380
     cccgcaaagt cgggcagatc ctgaatccct gatccccatt cagagcagtg gttgtcagat     10440
     cagtgaaaac ctggtttggg atgactcaaa tctcacccag aaagtgggaa tcatatggcc     10500
     gcccagttaa aagcctgttg gatgatagtt atcaagttgg aagtggatga ggacaaagaa     10560
     accgcttcga tttccttccc ctggatgaga agaccaaccg ctatgtggag gtgcagtcca     10620
     gcagccccga caggaatgcc tgcaacaaat ccagttccag cagcagggcc ggccgcgtca     10680
     ccagcagtgc cattgagtga gcgtcacggg cacggccttg gcgggcgact acatatgcgt     10740
     gagcggcggc gcgcgacatt ctcaacagcc gggtcactgt ccgtggctcc cgtcaatccc     10800
     gttgcagcac agatttcgcc ctggtcaata ccagtgttag gacttgacct catccggcac     10860
     cggattcaac caatcaccca acgcctggag gttctcttga gcccggatca aatgacgctg     10920
     gactgcgtct tgcgtagcga caggatcacg ccgtttcagt ccgtcataga tcgcccagtg     10980
     gaatacctgc gcctgctggg ctgcgccggg tttgaggatg gtctggcgga agcccacctt     11040
     aagcagctcg tggactggtt ccagcagctt ggccagaatc gcgttctttc ctccctggat     11100
     cagggccacg tggaactctg cgtccagctc tgaaaaccgg tcagggtcat ccagaaactg     11160
     gtccatggtg cgcagcaggg actccatatg tccgaggtca cggtccgtca tgcgcgtggc     11220
     agccagccct gccagcttga cctcaaacac cagacgcgct tcaagaagtt cggactgtac     11280
     cgtatagaac gacgatccct ttccgagatg catcagcacc tgcggatcca tgggattcca     11340
     gcggtgcgca ggattgactg tggttccccg gccctgctga atctcgatca atcctttttc     11400
     tgccagtact ttcatcgcct cgcggatcac gacgcggctg acatcaaatt cttcggccag     11460
     ctcggtttcc ttcggcaggc gcgagagcgg tgaaacgtgt ccgctcacga tccgacgcgt     11520
     cagttccgac tgcaccaggt ggcggcgact gaggcttttg gtggtcacgc ttccagctta     11580
     tgacatccag ggacgctttg tccagaaagg tactacctat tgtccgcgga caggatcgga     11640
     gggttcacat acgttttcta tcgttcagta cgctttctgt cacacggaag catggaccgt     11700
     atttgacaaa gcttaactcc tcccgtatat aaagatagta cgtttaattc gctgccgctc     11760
     ctgttgtcgg tgttggaccc aggtcgatcg ttttccatcg atcagctccc tttctgttcc     11820
     tggaggtctg tatgtcacgc acttctctgc ctgtaaccct tgccctgacg ctgtgtgcct     11880
     tgagcgtcgc ctccaatgct caggctcaga cgtttaactg gaaggcccaa agaggtaaga     11940
     ccatttcggt cagcgtggtg aagagcccct ggtccgacat cctgcaagac cggctgggag     12000
     aattcgaaaa gctcagcgga atcaacgtca acctgagcgt ccttcctgag cagcaggccc     12060
     ggcagaagct ggccatcgat tttgcgtccg gcgggcggac cgttgacgtc tttgactcga     12120
     gcctgaccgt cgaaaaaacc cgatttgctc aggccggctg gtacgaaccc ctcaacaagt     12180
     acatggtggc tggcaaactc gatccgacct accgcttcga cgactttttt acttctgccc     12240
     gcacagctgt gaaaacatct gatggccgca tcattggctt gccctggaaa gcggacgtgc     12300
     aggtgctgta ttaccgcaag gacctgttcg cacaggcggg cctgaaagtc cccactaccc     12360
     tcgacgaact ggagaatgct gcggaaaaac tgcatgttcc cggcaagatg tacggctacg     12420
     ctgcccgcgg tctgaaaaat gcgaacgtct ataccttcgc gttcccactt caggcgtttg     12480
     gcggcaagtg gatagacggc aaggggaact ccacggtcaa cagtgcccag gcggtcaagg     12540
     ccctgaactg gtacagcagc atgctgaaaa agtacgctcc gcccagcgtg atcagctaca     12600
     actggagcga ggtgctcggc ctgtttcagc aggagcagct ggccatgttt aacgacggca     12660
     ttggcttcgc agtccagctg gaagacaaat ccaaatccaa ggtcgccggg aaagttgggt     12720
     acgctgtgct ccctggacgc ctggctcccg cgacctacaa cgccctggcc atgtcatcac     12780
     gcagtggcaa caaggacgcg gcattcatct ttatgcagtg ggcaaccaac cgggcttttg     12840
     acaaacatct ggtggaaaat ggtgtgacct caccccgtca gtccagctgg acgactgcca     12900
     ccaacaagcc cctggaaacc attccctggg ccaagacgta ctttgacgcc ctgaaggtgg     12960
     ccaagccagc cttcccggaa gttccgcctg ttcaggagat gcgcgatacc gttggcattg     13020
     cgatcgtcca gtccatccag ggctctgctt ctaaaccagc gctcgatcag gccagccgag     13080
     acttccagac cgcgctgaac agcgccaagc aatgacatga ccacctcgcc gttgcctggc     13140
     acggccgtcc ggcgcgctaa gcgccggcca gccgcaccga tcctgtttgt tctgcccgcg     13200
     ttgctgctca cggtcatcgt gattgccttt cccctgggct acaccctgta ccagtcgatg     13260
     accaactggg tgatcaccag ccccaatccg ccgaagttca tcgggctggc caattacgct     13320
     gaactgctgc gggatcagcg tgcgatgcag tcgctggtgc gaacgctgct gatcacggtg     13380
     tgctcagtga gcctccagat ggtcctgggc gtagccatgg cgctggtcat gaacaagcat     13440
     tttttcggtc gaggtctgtt ccggaccctg gcgttatttc ctgtggtggc cacgccggtg     13500
     gccatttcat tgattttcgt cacgatgatg aatccgcaga ccggggtcct gaaccatttt     13560
     ctgacgtcgc tcggtctgag cgcccagcag tggatctacg ccgagaaaag cgtgctgccg     13620
     gccctgattc tggtggatac ctggcaatgg actcccttcg tgatgctgat tgccctggcc     13680
     ggtctggcca ccctgcccag cgaaccttat gaagcggcca agatcgatgg cgccaccgct     13740
     tggcagacct tctggggcat tacgctgccc atgttgatgc cgtccctgtt cgtggcgttg     13800
     ctgttccgcg ccatcgacac cctgaaactg tttgacacca tctatgccat gacgcagggt     13860
     ggccctggga cggcttcaga gaccatcaac ctgtacctct acaccctgag cttcaactac     13920
     ttccgtatgg ggtatgcctc cagcatggtt attgcactgc tggtcctggt gctcgggatc     13980
     accctgctgc tgattcgggc ccggaagctc gcggaggacc gctcatgacc gttaccggtg     14040
     ttcgctcccc tgccgccacc gccgcccgcc gcaaaacacg gccgcacccg cttatgaccc     14100
     acctgctgcc gctcctgatc tccgcgttct tcattgtgcc catcgtgttc gtcttttact     14160
     ggatggtctc gatgtcgttt cagacccagg tggagatcag cgccagcccg ccgaccttct     14220
     ggtcagccaa tccgaccacc gagtggtaca gccagctgat gcgccggatg ccctttttgc     14280
     agtacacctg gaacagcatg gtggtgggcg tcagtgccac cgcgattggc ctggccatag     14340
     gccttccggc tgcctacgcc atcgcccgct ggaagctcac aagcctcagc acactgttcc     14400
     tgatcacccg catcacaccg gccatcagct ttctgattcc ctggtacatc attgccaaac     14460
     ggctgggtct gggtgactcg ctggtgatca tcaccctgct gcacatcacc atcaccctgc     14520
     cgctgatcat ctggattatg atcggatttt tcgaggcgct gccgactgat ctcgagcagg     14580
     ccgccacggt ggacggctgc aatgcctggc agtccttcgc cctgattgcc gtgcccctgg     14640
     tgaagccagg catcgtggcc gcgattatcc tggctttcat tcagtcgtgg aacaacttcc     14700
     tgttcgcggc ggtcctgggt ggacccgggt cgcagaccct ccctgtgacg gtttacggca     14760
     tgttgagctt cgagcaggcg aactggggcc ctctggccgc agcggccacc ctggtgtgcc     14820
     tgcctgtcat cgtgggcacc attttcttcc aacgccaact ggtcgagggc ctgacggccg     14880
     gcgccatgaa gggctgaacc tccttttcac cgaccttcct tcaagtccta cagggaccag     14940
     acctgacatc tgctgagttg ccaggagtgg tcccgtgttc ttacccgcct tgttctcctg     15000
     ctccgccgag gtatctatga cgcacgctca ttcttctgcc tttcacgttc gtggcctggt     15060
     cgttcccatc gtcacgcctt acacccctca tggcgcagtg gacctcaagc aggccgaagc     15120
     cctggcccgt ttttatgcgc ttcagggggt gccggcgcta tttcctgggg ggaccacggg     15180
     cgagttcgcc ctgctgacgc tggacgagcg cgaggccctg ctggaagcgg tcgtgcgggg     15240
     tgtccggtcc agcggcacgg ctgagacgca gatcattgcc cacacggggg cggcaacgct     15300
     ggacgaggtg ctgcgtctta gccgacacgc ccaggctcag ggcgtgccag ccgtggcggt     15360
     cgttacgccc ttttattacg agtacgagga cgcggccgtg ctggctttct accagaccgt     15420
     gtgccggacc ctgcccgacc tgggggtgta cgcatacacc atcccgcagc gcgccggcaa     15480
     ctcaatgacc gcttccagcg tggctgaact gtgccgtgag ccgaactttg caggaatcaa     15540
     agactccagc ggtgatatgc accgcctgct gactctcatc gaggtgccag gcctgagcgt     15600
     gctggccggg gcggacgatc tgtgctttcc cttcatgatc agcggggggc acggccttgt     15660
     ctcaggcccg gccggtgtgg ttccggagtt gttccaggcc tttttcgcag cgctgaatac     15720
     ccagcaggtt gaacgcgcca tggcgctcgc acggcacatc cgtgtcttca gccgcatcat     15780
     ccgtgggggc ggccgcatcg attacctcaa ggccggcctc gactggcggg ggctgaccaa     15840
     cggcccatcg cgccagcctc ttccgaacat gggcgctgaa gagaggcgcg cgttgacgca     15900
     gcagctcgtg acgtttgccc aggccctggc cggagacggc gtcacgctga ccagtgccgc     15960
     cgtacgggac gccgtggtgt gaagcgcagc atagttgctt gtttttgcgc cgctcgctgt     16020
     ctgaagccca gctgtgcctg gtggagcgcc gcatgatcct ggttgccggc agcatcaata     16080
     tcgactttgc cgtgcaggtc caggcgctgc ccgctccagg tgagacggtg atgggcagcg     16140
     cctacctggt gagtcccggc ggcaaggggg ccaatcaggc ggtggcctgt gcgcgcgccg     16200
     gcgccccggt gcagtttgtg ggctgcgccg gatccgacgc atatggcgac cagcttcgcg     16260
     aggccctcca gtctgacggg atcgatacca cctccctgcg ccgtgtcgac ggtcagaccg     16320
     gcgcggcatt cgttacggtc gggagcgacg gtgaaaacac cattgccgtg gcgagcggcg     16380
     tgaaccaggc cctgcgggag gctgacctgc ctgagctcaa cggcgtgacg cacctgatct     16440
     tgcagctgga aattcctttg gaaacggtcc gcgcctttgc tcaggcagcc cgccgcgcag     16500
     gtgtacatgt caccctgaac gcagccccgg cacatccctt ggatgatgag ctgctagggc     16560
     tggtggacct tctgatcgtc aatgccggtg agctggaagc cctgtgtggt gcccaggctg     16620
     gcgccggtct ggagtaccag cttgaagtgc tgtccggccg tggaccgaaa gcgattgtgg     16680
     tgaccttagg agcggacggc gccgccttct ggaccaatgg gcgctgccac cgaagtgccg     16740
     catttgccgt acaggcagtg gacacgaccg gagccggcga caccttcgtg ggtgtgctgg     16800
     tcgcagcgct gcgtcatatg gacctgaccg ctgcggtgca gcgcgcttca gccgcggccg     16860
     cactggcctg cacccagcgt ggcgcccaga tcagcatgcc ccggttgtcc gctatcgagc     16920
     ggcttctcgc ttccactgtg cgctgaatat ttttgctccc cacgggggcg agcggccctg     16980
     tgctgtgcgg gccctggaga acctatgacc atatcctccc ttcccttgac tgaagcctat     17040
     ctggtcgcca gcggtgacat gcgcctcgct gccaaccagc agtgctggcc ggcccaggcc     17100
     catatggagg cgcagctgac tcaggcgctc agtgcgctgg gcgtgaagct cacccgggcg     17160
     cacgacgtcg atccacagga gcgccacggc tttatttcct cgcagcgaat ggggatggac     17220
     gtcttcagac gcattcccaa ggatgccccg gttattgtcg ctgaggccgt ctggcaatac     17280
     agccaccatg ttctggctgg cctgcgtgca caccgcggcc ccattctgac ggtggccaac     17340
     tggagtgggc agtggccagg actggtaggg ctgctcaatc tcaatggcag cctcaccaag     17400
     atgaacatcg attacagctc gctctggagc gaagattttc aggacgaatt ttttgtttcc     17460
     aggctggccg aatgggtccg gacaggtcgg gtgacccatg accgcacgca tgtccggtcg     17520
     tttgacgctc agcgcgtgcc cgaggcgcac cggaccctgg gcacccagct ggcccaaagc     17580
     atgctggagc aacaggccat cctgggcact ttcgacgaag gctgcatggg catgtacaac     17640
     gctgttattg acgacgagct gctcaatcct ctggggatct acaaggagcg gctcagccag     17700
     tcggccctgt atgccggaat gcagcaggta acagacagtg aggccgaggc ggccctggac     17760
     tggctgctcg aacgagggat gcagttcgcc tggggcgcgg acccggccac cgaactgacc     17820
     cgcgcccaga cccttgacca gctcaagatg tacgtggctg ccatgcgcat cgccgcgcag     17880
     tttggctgtg acgcgatcgg gatccagtac cagcagggcc tcaaggacct cgctccagcc     17940
     agcgacctgg ctgaaggact gctgaataac cctgagcgtc cacccgtgca cgacgcccgg     18000
     actggcgagg agctctacgc tggtcaggcg ctgccacatt tcaacgaagt ggatgaagga     18060
     gcggcggtgg acggtctggt gacccatcac gtctggacgg cgctgggcct gaatcctgcc     18120
     aacacccttc atgacctgcg gtggggcgaa gaccatgacg gacagttcgt gtgggttctg     18180
     atgatttccg gcgcggctcc agcggctcac tttgcaggtg gatatcaggg agcgtccagt     18240
     gagcgccagc cgccgatgta ctttgcccag gggggcggca cgctgaaagg ggagagccgg     18300
     cccggtgacc tggtctggtc gcgggtttat attcagggcg gccggttgca cgtggacctg     18360
     ggcctgggac gggcggtggc cctgccggag gcagaagtgc agcgtcgctg gtctctcacg     18420
     acaccccagt ggccgataat gaatgcggtg ctggaggggg taagccggga ccagatgatg     18480
     gcgcagcacc aggccaacca tattcaggtg gcctacgcgc ccagccggga cgcggccctg     18540
     gaagcgctca acgtcaaggc cacgctgttc gacgcgctgg gtgtggacgt ccatctgtgc     18600
     ggattccagg cgtgaccgcg ggcagtcccg tactgctcgg gctggacatt ggaacctact     18660
     cgagtaaggg tgttctggtc ggtgtagacg gacgcattgt tgcccagcat gtcatcgcgc     18720
     accagatttc gatgcccgcg cccggtcatg tggaacagga tgcagacgcg gtgtggtggg     18780
     gagatgccca gaccctgatc cgcacgctcc tgcaaggcgt tgatcctgct cgtgtggtcg     18840
     gagtggcatg cagcgccatc gggccgactc tgctgccgct ggacgagcgc ggggctcctt     18900
     tgcggcccgg catcctctac ggggtggata ctcgcgctgg ggcccagatc gacgccatga     18960
     accatgacct gggagaggac caggtgtttc tccacagcaa tatggccctg accagccagg     19020
     ccatcggccc caaaatccgc tggttgcgcg agcatgagcc tgcgctctgg gccaggaccc     19080
     gaacgctgac aacggcaagc agttacctgg tgtaccgcct gaccggacgg cacgtgatgg     19140
     accatcatac gggcgcgcac ttcatgcccc tgtatgaccc gcgcacgcgg cagtggtccg     19200
     agaccttccg cgccgctgtg ctcgctgacc ggggccttga cctcctgccg gacctggcat     19260
     ggagtgatga gcgggcgggc gtggtcacag cggaggcggg cgcgctgact ggcctgcgtc     19320
     cgggcacccc cgtagcggtg ggcacggtgg acgcgctggc cgaagccatc agcgtcgggg     19380
     cgacccagcc aggcgacctg atggtcatgt atggctcgac cacatttttc gtgctggtgc     19440
     agacggcccc gaccccggac ccgcgggtgt ggtcggtggg cggagctttt ccaggtcagg     19500
     ttaatctcgc ggcggggatg ggaaccaccg gcagcctgac ccgctggatg gccgacgagt     19560
     ttgcccgtga actgcccacc gatcaagcgt atgacgcact cttcgctgag gccgcccgga     19620
     tcgatccagg tgctgacggt ctgctcatgc tgccctatct cagtggtgag cggacgccga     19680
     tcaacgatcc ccgcgcgcgt ggcgtgatcg cgggtctgac gctgacgcat acacgcggtc     19740
     atctgttcag ggcggcactt gagggcgtgg gatttggcat tcgtcacaac ctggaagcct     19800
     ttagcgacct gggtgcagat atccgccggg tcattgctgt gggtggcggc acgaaaggcc     19860
     gggtctggct tcagatcgtc agtgacatca ctggcgtttc acaggagatg gcgcagatca     19920
     gtctcggtgc gagttatggc gacgcgttcc tggcgggacg ggcagcgggg gtgcttgccc     19980
     ctgaagagct gcagaggtgg atccagccgg ctgaaccggt ggtaccgaac atggcagcca     20040
     agagaacgta cgaccggctc taccccttgt accgcgacct gtacaccacg acagcttcaa     20100
     cggtgcatgc gctctctcag tgattggctc tggcctcatg ctcgttgcct gcgcaaaccg     20160
     ttccgtagcg taggcacagc ggggacctct ctgatgctcg gtgtgcccca gcgtcaccat     20220
     ggcgcaggaa gcgtctcctc cccgagattt cgggaaagtg gagccggtgc ctgcccaaac     20280
     ccgcgcacct cgaccccggg aatagaaatt tcccgtcggt cgaggtgcgc agctacagca     20340
     gattgagtgt tcagatcatt tgcgcagtgc tcaggctgcc tctcagcacc cgatattctg     20400
     tccgaaatac ttgcggctca actgcgccga accgccattc gtctccacct gatgcagcgc     20460
     ggcgttcacg gcggtcttca gctccgtgtt gcctttggcg aatgccatgg cgatctgctc     20520
     tttccagagc gtttccccaa gcaccaggcc ggcttttgga aaggtcttct gcgcttcgat     20580
     cgcagcgaaa cggtcggtca cgatagcggc cacctgacca gtcgcgacag cggtggtgac     20640
     tgccagactg gagttgtaaa cctgcacgct cttgtcgaac ggcagcttac gcaggaagct     20700
     gaagtacgta ctgccagctt cagcgcccag cttctttccg gccagtgcct tggttgtcag     20760
     cgggccaccc ttacgggtca ggatgacacc gcctgtgcag tagtgcggtg acgcaaattc     20820
     cacggtcttt gcccgggtgc tgttaatagc gtgcgaggcg atgaccacgt cgatttcttt     20880
     tgggcggtcg ttcacttcct tgagcaatcc gtcgaacggc cgcacgaccc actcgatgcg     20940
     caggcccatc tgccgggcca cctgctctgc gaggtccact tcaaacccct tggcgacgcc     21000
     acctttcatg tagttaaacg gctcgaaatc agcgcttgtg gcaaccttca atacgccgct     21060
     ggctttgatg tcactgagcg tgcgggcctg agcggcactt cctaccatca atgccagccc     21120
     agccagcaac gaaatcttta aacgcataca gttctcctga aatccataaa tatgcataca     21180
     agatgcgtca ggcagtctca ccaagatgtc acggcgccta gagtccagag tattaaggtt     21240
     gcctcccgga gtgctgtttg gctgactctt ctcttcgtat ccggcgcaat ttcagtcatt     21300
     gtttgtagaa atttcacagc cagcccggca tgacccggtc gggacaaact cactgcatcg     21360
     accgaatccc gacaggaagc caggtaaacg ctttctgaac tgatttacct gccgcttctt     21420
     ctatggaaat gggcgcctga atggttggct ggcagccatt ttctgctacc ctgaagtctc     21480
     ctcagagtgt tccactggtc ttggtcacga acagcagttg gagtggagat ctgggacgat     21540
     aaggagtctc atgcatcctt cagagaccgg tcccgtgttc gcaggctcga tcccatcagt     21600
     ttatgcgcag tacctggtgc cgctcatttt tgaatcctac gctgctgatc tggcttcccg     21660
     agtggccgga caccagccgg ccagggttct ggagattgcc gcaggcacgg gtgttgtgac     21720
     ccgccagctt gcccacgctt tgccaccggg aacctcgatt gtggcttccg atctcagcca     21780
     gccgatgctc gatcaggcgg cattggcggg aacagagcgg cccgtcgagt ggaagcaggc     21840
     ggacgcccag cacctcccgt ttcctgacgc atcgtttgac gtggtggttt gtcagttcgg     21900
     ggtcatgttt tttccagaga aagcgagggc attcgcggaa gtcaggcggg tgctccgtcc     21960
     tcacggcgag tttgtattca atgtctggga ccggatcgaa gaaaacgaat ttcctcagac     22020
     catcgtccag gcaatcagta ctctcctccc ggaggatcta ttgcctttca tcacccggat     22080
     cccctatggg tatcacgatc ctgtcgtcat cgctcgggac cttgcggctg gggggttcac     22140
     cgagacgcct gcaatcacgt tcctgactgc actcagccgc gcgggttcac cggatatacc     22200
     cgctgtggcg ttctgccagg gtacgcctat gcgggatgaa ctggaggaac gggggcctac     22260
     aacactcgca caggccactg accttgcgac cgctgcgata gccgcccgtt tcgggccggg     22320
     tgacgtgact gggaaattgc gcgccctggt cgtttcggtg aaacgggatg cgccagcagt     22380
     ccacaggtga aggatgttcc ggatggtcct tgggatagac cggcagcgtg ccccaggtcg     22440
     acctcttcaa ggctgagcgt ggaaagtaac tggaattctg cgcctgatca gggaagcagg     22500
     gttgttcatc tggctgggcg caggcatagg gatagcaact ttcgaaggcg tcccagacag     22560
     cctggaaagt aagcgcctgg ttaccggtcc cgcatggcgc tcaccagggc aaggcgttac     22620
     atctctgctg aaccagcgcg gcgctcgttc aaggaactag gtatagcgcg gtcccaacaa     22680
     gggtcactcc ctgcctcatg acagtgcggt ggttcctgtc ttgatgactg caaaccttgg     22740
     aaaagcggct cgcctaaact gcactctctt gacaaggcag cctgtgaaga cttccctctg     22800
     accggcatat gggtcaagaa cggggccggg atgggccggg tcctgaaggt cttcacgatt     22860
     gacaaaggaa tttcgctggc tgtgtgttgt ttccctatgc tcacctcaca aggaagacgg     22920
     taccccgaat ctcggataat tcactggttg tctgacttca aggtccgccc agtgatggca     22980
     gtcggggaga aggacctgcc ccttgttcac aggatgaagc gtctcgtttt gagccgtatg     23040
     tggacgcctg gctacgcctg gtcccgttgt ttctggaact gctttgctga ggagtgcagc     23100
     gatggatttt agggatgacc ctccgcaacc cgcttctctg atccaggccg gtgccggact     23160
     gaccggggcc attgccacgg ccctcctaca gacgtcgctg gactgcatga tcgttataga     23220
     ccagaacaac ctggtggtgg aatggaaccc ggcagcggag caggtgtttt cctacagccg     23280
     tcaggacacg ttaggaagga atctgagcac gctgattatc ccgcctgcgt tccgcgaggg     23340
     ccatgaacga ggcatgcgcc ggtacctgac cacacgtatt ccccgtatcg ccaaccgtgt     23400
     caaggttttt gctcagcgcc gcaatggcga tacctttccc tgcgaaatcg cctttcatcc     23460
     cctggagttc agcggctcta ccttctttgc tgccgtattg cgtgacatca gcgaacagat     23520
     tcgtaccgag gaggtcctgc gggaaagcga ggagcggtac cgtacgatct ttgatcaggc     23580
     ggctctgggg attgcccatg tcagtgtgaa ggggcactgg gagcgcgtga atcagacgct     23640
     ttgccatatc ctgggataca cgcatgaaga ccttctggcg ctgacctatc cggacgtaac     23700
     gcaccaggac gatctggagc aggtcaagga gcatgccgaa ctgctgctgt cggatggagt     23760
     ccatacctcg tgcattcagc accgcttcgt tcgccgggac cagtctgtgg tgtgggtgaa     23820
     agtcacgagt tctgtgatgc gcaaggcaag cggcgaggcc cagtcgttta tcgccatggt     23880
     cgaagacatc actgagatcc agcgcgcgga ggaggaactt cggttggccg cagaggatct     23940
     cgaacggcgt gtcgaggccc gtacggctga cctgacgaac ctcagcgcgc agcttcagac     24000
     gcaggtgctc gaacttgagc agcggaaccg tgaaacgcgt ctcctgggtg aaatgagcga     24060
     catgctgcag gcctgcctga ctatttcgga agttgaacag gtggtggcgc aacatgcctc     24120
     cgaattgttt ccgggcgtgg gcggggcatt gtatgccttc gaatcgtcca ggacagttct     24180
     tcaggagacc atcagctgga acggtggcag ctcaagttcg tcggtctttg tgccggtcga     24240
     atgctggggc ctgcgccggg gccgaccctt ctcggccctc ggcgaggaag ggcttcattg     24300
     ccgtcacagt tctgcctctc attccaccct gtgtgttccg atgttggccc agggagaaac     24360
     ggtcggactc ctgcacctgg aggctggcag tgcagcgccg ttgaccaggc ggcaggaacg     24420
     gcttgcgcag accgttgctg agacggcggc cctggcaatc gtgaacttaa ggctccgcga     24480
     gagccttcgt cagcagtcca tccgggatcc cctgacgggg ctctacaacc ggcgttacct     24540
     ggaggaatcc ttcgaacgcg aactgcaccg cgctcagcgc agtgatgatc ctattgccgt     24600
     catcatgctg gatatcgacc atttcaaaca cttcaatgac tcgcacggtc atgaggccgg     24660
     ggatgaactg ctgcgggccc tgggtcagct cctgtcagga tgtatccgcg cggaggatgt     24720
     ggcctgccgc tacgggggag aggagttcgc tatggtgttt cccggcatga ctctggacca     24780
     ggcgacacgg tgggccgatc agctgcgcca tacggtcgaa agcacacagt tcgcaagtcg     24840
     cggtgaagcc ctggagcagg tcagcgtctc ccttggtgta gccgcctttc cgcagcatgg     24900
     ccgccatctg gccgatctga tccgggctgc ggacgctgcc ttgtaccggg caaaacgcga     24960
     ggggcgaaac cgtgtcatca cggcagacgg tgcctcaaga taagcatcag cgcaagctga     25020
     tgaagtggcc agcgatcgac ctgaagctgc catcactgga aatgttgacg cttttacccg     25080
     catgcacagt ccgaatcagg cagtgatctg gaactacctg gttgaggata atggtcacaa     25140
     cgaaatccat aggaattcat agatgcacac tttgatgcct tttcggtgtc gtagtgcact     25200
     gtcattgtgc gtacctgcgg gaacacatgc gaggctgacg tcgggtgctg gaaggttgct     25260
     gccccagggc ttatgcacac ttttggctgg atccggtgac gtctggttgg cagaggttgg     25320
     cctagatatg ccagagacgg cattctgggt gtgatgaccg atgacggaac accacggcgc     25380
     tacctgcagg ttcagcagcg ccttcaggaa atgcttgatg gcggggatta ccaacccgga     25440
     gacaaggtgc cgtccgagcg ggaactggcc cagaccctgg gagtcagtcg catgacggtt     25500
     cgccgcgcgg tggataacct cgtgaaactg gggttactgg agcgtgacag cacgacaggc     25560
     acccgggtca gcacacccag ggtccggcgt ctgctgaacc atgcccacct gcacagcatc     25620
     acgcaaatgg tggcggccac aggtggacgg gcagggggaa agctgctgga gtttctggtc     25680
     acccctgcct cggtaggtgt ggcggagaaa ctgcttgtgc cggcaggaag tccggttgtg     25740
     acgattcgtc gactgaggct ggtggatgac atgccgttct gtctggaaac cagttatctg     25800
     ccggcgcggc gcgtacctgg gctggcagct gaggacctgt tggagggagg gtccctgtat     25860
     gagctgctgg aggcgcggta tgggattgca gcggcggtag gggagagcct gatcagtgtc     25920
     tcattcgcga ccgtatctga agcgcaggcc ttgaagttgc ctgtgaatca tgccgtgttg     25980
     ctgtaccggt cggttgtgca ggatacacag gggcaaccgt tcgagtatct gaaatcggtg     26040
     aaccatccgg ggctcgtggt gttcaacatc ggcgagggac ggcctggacc tcaggaagga     26100
     tagatggaac ggcgtcttga cgaagcaggc tcctcccctt acgcttggtc tataccaagt     26160
     agaccaagga gttgcatgac catttcagat gctggcccgg ccgttgtggc ctcacccatc     26220
     aaccgcgagc tcattatcaa cagcctgcaa ggcgcactgc aggccaagaa cgcagcggca     26280
     acgcttggcc gcgacctcgc tcaccagatc gaccgcatct atttcgtggc ctgcggtgcc     26340
     cccaaccgcg tcatgctcag cctggagtac tggctggatc atgcgcgcac cgacctgcag     26400
     gtcaaacggt acttcccggc tgaattcctg gcgatgcaac ctcacctgga cgagcgcacc     26460
     ctggtgatcc ttgcgtcgaa gtccggcacg acacaggaaa ccgttcaggc agcgcagttc     26520
     ctgcggagcc agccctgccg cacgctcgtc gtcacgacaa cagccgacaa gccccttgcg     26580
     cagggcgcac agcacctgtt cctgatgggt gaaaccgaac aggcgcacac cggcatctac     26640
     atcgtgctgc agggcctgat ggccggactg ctcgacgccc ggcacggcta cccgctgtac     26700
     gaccaggtga tgcgctcgct ggacgccctg cccgctgtcc tggtggagtc cgccgaagtc     26760
     agcgacgcca ggggacgcgc cgacgcgcac acctaccggg acgaccatac cctctaccac     26820
     ctggcgtccg gcccggtctt taccaccgcg tacgtgttcg gcgtatgcat gctcatggaa     26880
     atgcagtggc tgcacagcgt gccgtttgag gcggcagaat ggtttcacgg tccgttcgaa     26940
     attctggacg cgcagacccc tgtcatggtg ctcctcggtg aggatcccag ccgtccgctg     27000
     gccgagcggg ccctgacctt ctgccgcaag tacaccaacc gcgtgatgaa gtacgactcc     27060
     cgggacctgc ccatgaccgg cgtcgatccc gaagtgcgcg ccctctttgc cccttacgcc     27120
     cttcaggctg ctctcaaccg ctttgctgag catctggcag ccgagcgcaa ccactcgctg     27180
     gacacccggc ggtacatgtg ggtcacggac tactgacatg ccccgcctgc ttggcatcgg     27240
     tgacaacaca gtagacctct acctgagcga cggcaccatg taccccggcg ggaacgccgt     27300
     aaacgtggcg gtactcagcg ccaggctcgg gcattcagcc agttacgttg gctgcgtcgg     27360
     cacggacgcc gctggagaac tgatcctcag cgctctgcgt gcagaaggcg tagacctgag     27420
     ccattgccgt cagatggagg gcatgacctc ctggagcggc attgagcacc gtgacgggga     27480
     ccgttatttc gtcggcagtg cccccggggt acagggcgag tggaccctca ccgaagccga     27540
     cctgacgttc accgccgcac atgacctggt gcacaccagc atctacagcc ggctggacga     27600
     tgctctgccg cgcatccggc aggccgctgc tctcctgtcc tatgactttt catccgagtg     27660
     gacaacggac ctgctggccc gcgttgctcc gcaactggac gtggccttcc tctcggccgg     27720
     ggaagacccg ctgccagagg cgaccgcgct tgccgaggag gtcgctgggt acggtgctgg     27780
     cgttgttgtt gtgacgcgcg gtgcacgggg ggcgctggct ctgaccgaca ccgtgctcta     27840
     tacgcagaat cccgtgccgg cagcggtggt cgatactctg ggtgccggag acgcctttat     27900
     tacggcgttc ctgcactgct gggccaccca ccatgacgtt cccgcagccc taacggccgg     27960
     ggcgcacgaa gccgcacgca actgtgccgt acacggcgcc ttcggttacg gcactcccat     28020
     tcctgctcat catctcgccc ggccctgaac ctcacgtcat aaggagaagc ccatgtgtca     28080
     tacccggatg tctgccctgc tggttctggt tcccgccctg tgcgctgctg cgcctgctca     28140
     cgctgcgacc ctcgcgcagg tcaaggcgtc gggtgttctg cggctcgcta ccgaaggcaa     28200
     ctacccgcct ttcaaccatt acaagaacaa ggcacttacc gggttcgaag tagagcttgg     28260
     gaacgccatc gcaaagcagt tgggcgtcaa gccccagtgg acaaccgtgg tgtttgaaag     28320
     cctgctgctg ggtctggacc ggaaccggta tgacctggtg atcgcctcgc acggcatcac     28380
     gcccgagcgt ctgaaagcgg tgacgttctc caccccgcac tactgcagcg gaggcgttct     28440
     tgtcgcccgc cccggcggtc cccgaacgct cgaggatctg aagggcaaag tcgtaaccat     28500
     gggcgtgaac acctcgtacc tcggatatgt gcagaaactc ccgggcattg gaggtgtgaa     28560
     aacctttccc accacgaacg atcagctgaa cgccgtgttg aacaaccggg cagacgccat     28620
     ggttctggac cggttcaacg cgatcgacgc gagcaaggtg ctgccaggca aactgcagat     28680
     cggggatgtg gtgttcccgg agcggatcgg tatggccatg cgcaggaaca acgcagaact     28740
     cgagcaggcg gtgaaccggg ccctcgccac cctgatggcg aacggtacct atacgaagct     28800
     ctctcaggcc tacttcgggc aggacgtacg gtgccccgtc actccgggtt gatggcctga     28860
     ataccgtttc ctgattcagg tgacacggcg ggagcgacct ccaaaaggta cgagggcagg     28920
     agcataggtt tcacgacata ttccaaaccg tatgtacaga acgctgtcgt cggtgcgagc     28980
     cccggtcccc acaagaggtg gggcaattcc gtatcgactt ccgaccgggt ccggagcatc     29040
     tcgttgactg gaaatcatcc aggccaggtt tagcaggatg ggtccaatgc ccgaccggta     29100
     cataaccaat agtgctgata tctccgcaca tgatcgaagc gcgctcctgc agtgaattgc     29160
     tcagcgactt agcgtgaccc acaggaaaag acgcccgcat gcgggcgtct gacgtatccg     29220
     gggccatacc agtgaccccg gaggtgcgat cttcagtcgg cagagagggc gggttcaggg     29280
     aggggagcga caggggtgcc gcgcatctgg gcgagcacac gctcgcggat atcggcaagc     29340
     agatccggac gctcactcag gaaggcaatg gctttttcct tgccctgccc gatgcgttcg     29400
     tccccgtagc tgtagaagct cccagccttc ttgatcacct cgaaagtggt ggcgagcgtg     29460
     accaggtcat ccatggcatc gaacccgtgg ccgtagcgca gcgtcagctc cacttccttg     29520
     aacggcggcg cgaccttgtt cttgacggtc ttgaccttga cgctgtgcga caccgccaca     29580
     ttgtcgacca tggtggactt gccgcccatc ttgcgcacgt ccaaccggac cgaggcgtag     29640
     aacttcaggg ccttgccgcc ggtggtggtt tcggggttgc cgtacatcac gccgatcttc     29700
     tcgcgcacct ggttgatgaa gatcgcggcg gtgccggttt tggagacgat gctggtgagt     29760
     ttgcgcagcg cctggctcat cagccgggcc tgcaaccccg ggaggctgtc gcccatctcg     29820
     ccctcgatct cggcgcgggg ggtcagcgca gccaccgagt ccacaacaac aacgtcgatg     29880
     gcgccggagc ggatcagcag ttccatgatt tccagggcct gctcgccgtt gtcgggctgg     29940
     gagaccagga ggtcatcggt gttcacaccc agggcgcggg cgtagacggg gtcgagggcg     30000
     tgttcggcgt cgataaaggc gcaggtgccg ccggctttct gggactgggc gatgatgctc     30060
     agggcgaggg tggttttgcc gccggattcg gggccgtaga tttcagtgac gcggcctttg     30120
     gggatgccgc cgacgcccag ggcgacgtcg aggctgaggc tgccggtgct gatggcctgg     30180
     acgtcgagct tgctatcggc gccgagtttc atgatgctgc ctttgccgaa ttgtttttca     30240
     atctggctca tggcggtttg cagagctttg tgctggtcgg tatccatggg gtctccgggt     30300
     gggggcgctc taggggcagc cccagaacag ggcgttatga ttccagcata attgtagcag     30360
     tatggttagg ttaaaatgtg gacttttgtt cggtttaccg ggtttcaggc gcggtaaagg     30420
     ctgccagttc acagggtgac gaaccaaatg cattggccct acttccaaga cctgatctct     30480
     gaatagagtc atgaactcca atcacggcta acggcgagac ttcatgctca gaaccggacc     30540
     agtcaacggc accgagccct ggcgcgctgt gactttcccc gagcgcgccg cctctaagga     30600
     cgtgatcatg ccccggaacg tcattctcat ccagatcgac tcgttgaacc gtcacttcct     30660
     gcgggcttac gggaacgact gggtacaggc gcccaacctt gaaggcttcg cccagcgcgc     30720
     agtcatcttc gatcggcact tcacaggttc gcttccttgc atgcctgccc gccgcgaaat     30780
     ctgggccggc gtggaggagt tctggtggcg cgggtgggga ccactggaac cgtgggatga     30840
     gcccatcgcg tatcacgcca accgcgcggg catcaccaca cagctcatca cggaccacta     30900
     ccacttcttc gagtggggtg cgcacagcta ccaccatgat ttcgccgggt acgagttcat     30960
     tcgtggacac gagcatgaca atcacatcac cgcgcctctg cgcggggaac cgtcctgggc     31020
     acgccgtatg gtggccgagc acggggaaag cgcccgaatt tatctgcgta acgtcgcctc     31080
     cttcgcccat gagaaggact tctttgcgcc cagggtcatg gacgccgcgg cccgctggat     31140
     tgatctcaat cacactcagg aacggttctt cctgcatgtg gactgcttcg atgtgcatga     31200
     gcctttccac ataccggagc cgtaccgcag cctgtatacc gatgaggcgc ctgacgactt     31260
     taatccctgg ccacggtacg gccgcagcga cgagggcgaa ctcgcgctga ccgagcagga     31320
     acttcagtgg atccgcgctc agtttgctgg gaagctcacg atggtcgata cctggctggg     31380
     ccgggtattc gacgccttgt caaggcacga cctctggcca gacactgccg tcattatcac     31440
     gaccgatcac ggacactacc tgggagaaca cgggcgcatc ggcaagcctg ccagccccct     31500
     gtggaacacc cttacgcacg tgccgctgat ggtctggtgt cccggacagc ccgcacggag     31560
     agaaggggcc atcacgcagc ccgtagacct acacgctacc gtgctcgacc tgctgaacct     31620
     gccgggtacc ggtccgcact cacggagctt tctgcccgtg cttctgggtc agcgcacaga     31680
     tcaccgtgac ctggcggtgt acggctacgc caacgccaga gtgggcgtaa caaacggcga     31740
     atggacgctg ctgcgcgacc acgatcccag acttggcccg gcgcactggt actccctgca     31800
     ggttggtcat ctggatgccc gaagctaccc ggcccgccac acgcgcccaa ctgtcttccc     31860
     ggacctcgtg gccggacagt tcattcctgg cgtccagacc gcacattggc gcatgccggc     31920
     tcagtcggac gacctgcggc acctgacgct cccgcgggaa gacctgctct accacgcggc     31980
     tgatctcgga caacagcaga acctgcgtgt tgagcatccc cgcgagatgc ggcgcctgga     32040
     agaacagttg cgcgcccaca tgacccaact gggggtacca caagaacaat ttgctcgcct     32100
     gcggctgtga ctggctgtgc tcctcactca ggatgcgttc ctctgtgcat cgaacacaca     32160
     gtcacagacc agccgaggtg caggaacaag tgtttttgtc catctggttg cacgcgagag     32220
     cagttacttt caggtctggg cggcactctg acatttcgtg caaggtggag agcttggtct     32280
     ccagtgatga atcttgccga ggtgcagcat gcttcccgcg gagcagccta acgctgcgtt     32340
     atccggaagc attcagtgtc agttgccgtc cagaaaaaag cctccagtat cgctggaggc     32400
     agggcatccg acttcactcg gccggtgtgt tttacaactg gtgtcagtgt gctggctgcg     32460
     tcgccgagct ttctgaacgg gatcttgaga aggcttcatt gagacgtctt cattggtcag     32520
     tgatgaagtg ggaagaatct cgatttgatt cttcagaggg ttggccgaag gtgccccggc     32580
     acatcgaaca actagcaaga agaatcggga cagacatgaa gattacacct ctgtgtcttc     32640
     gctgagaaat gagcaacagg tgtcatacac atgctttgtt agagagtcga aattgaacct     32700
     gtacactttt attaagcttc cctcaacatc ttgcgggtcg ttccgtctcg acttttcctg     32760
     ctccccaggc ttcagagcct gagtccatac catttggagt tcaaatgatc gaagtgaaat     32820
     gcacctggat ccctggcacc ctggatatgc ttcaactgcg cgccggtaac cgccatggtc     32880
     ggctttccgt ccatgagctg cgccggcggt tcggcatggg cgctatgaat tcgatgtacc     32940
     tgattggtcg ctttcaaaca ctggcagaac ctggcgcgct caccggtttg gcattgagct     33000
     gacgtactga aaattgcgtg atggcgctgg gcctggagga tttcaggcat tggacgcggc     33060
     gaaccaccac aagcggacag gatgccctgg cataccgttg ttgggtatcc cgcccggtct     33120
     gcgcactgag gagttcattt ttcggcccct gcgtatcact gatgcagaat tggattttga     33180
     cgctctgacc gctagccgcg aggcgctgct cgtgttcagt ggtggccgct ggccggcggg     33240
     gggcttttcc ctatcctgac cgttgtattt gggactggcg ttccggcttc ttgctcgatc     33300
     gtgaagctct gccgtttact ggagatttga ttgtgccgca gattagcgca atgcgtccgc     33360
     atcagcctgt ttcagaattt ttgcattttc gggaaccgtg acaccgtccc gcaatgtcac     33420
     atcaatcacc agggcgccac tcccgattgt cacaccagta ccgaccttgc tgcggaaaag     33480
     gaccgcgtcg tctccgattg tcaggttgtc gcccaccgtc aggggaccat ggaacacgat     33540
     gttgtcatcg gtatcaagat tacggccaat ctgaatgctg gtgcctttga gtgcgtggaa     33600
     ggtgacccgg tcctcaattt ccgcacgctc tccgataatg attggtgctc cttcatccgc     33660
     gcgtatggag gtccggcggc ctaccacact gttggccccc agccggacat caccgaccag     33720
     gcgcgcaaac tcttccagcc tgacattggc actcagagtt gggcgtatcg cgcgcgggtt     33780
     gaacgacgtc ttgggattgg cactgacccc cgagaccgca tcgaagcctc cttctaggta     33840
     tagctcaacg tagtgctcgg caaattcctc gttgacctcc agaacttcct cctggaactc     33900
     cgagttggcc gcggccttga ggggcagggc attcgcttga gcctgggtgg tgatcgccgc     33960
     accggtaggc accagcctgt cgcggggaat gcgcacgttc cgaacgaccg caccatgcag     34020
     tacgaatacg ccgtcttcga gcacactgtt ttcaatccgg gaccggaacc ctacgaaggt     34080
     aaagttcccg atgacgctgt ttttgatgac ggcctggtgt gcgatgctca cgcggtcccg     34140
     gacggtcgtg gcgcgtggag cgcagccacc agcgggcaaa ggttgattgc gtagggcgag     34200
     caggagaata ttgtcctgca gattagtatc gctgccaatg caaatgctct gcccggggtc     34260
     agcacgcacg acggtattag cggccacgaa gctgtgctgg cccacgctaa tggtgccgaa     34320
     atactcagaa agaggtgaaa ggaaactccg gttgatcacc gtagggggcg tcgaggtgaa     34380
     gcgggcgagt gctcctttga cgccttcact accgccagcg agcgctgcag taagcaatgt     34440
     acatccacct aaaccaagga cccacttcca tgactgcttg cgcatagtgc ctccaggaat     34500
     tgttggtgcg atacctgttg accttaacgc ccagccgaaa gaagcggcct ccattcactc     34560
     tgcggattgc ctcatgaagg ttcgatggga gaggtccagg cagaatgccg gttcgtttgg     34620
     gtgctctgga attggaaaaa attccgatat cgaataatgg cggacatatg ggaataagcc     34680
     attgattatg aggtgaggtg ggccgcttct tcctttgttc tgattgctca agcttgttcg     34740
     cctacccttg gagtatgtcg gtacatccca gtcggcgcaa gcaatggatt tttctcccca     34800
     tcctgtggct cagctctttc gcgttggcag aggtgcagtt ggtgcctgtt cctgcgagtg     34860
     atgtcacacg gctccttgtc aagatatatt ccgcccgcaa ggtcccagca gacatgacat     34920
     ttgttgcatt gttgcttcgt cagcagccgt ctctcgctca gcgcatcaat tccatggaaa     34980
     tcgacgtcga atcgagaacg atccgcatcg gtgtttcaga gccgttactg ctgaaaaatg     35040
     acccggtcct ggattccttg cgggaatatg cgcatgcact caacatttct atggatgtga     35100
     cggccgtaag atattttcgt ttttgatgat gcgtactgtg ccgcattcct gccgttctca     35160
     accgttgatg cttagaaaat tacgattagc ggttgagtca agggtttggg acaataacaa     35220
     tgacgtgttg atgcgaatca cgacaatctg aaatgaggaa catgggtgag aaaaccactc     35280
     tatgaatcaa ttccagccag ccctcataga ggagaaggcc ggacgagcaa cgaaacccac     35340
     ggagtctgcc gggcatatcg gaacactcag ggacatgatc tacaggtctt ctccgcgctt     35400
     tagaacggca tgtctcagtt cccgccatgg ccgagggcga cccgttgctc ggtatcagcg     35460
     tacccggtac cccatcggaa ccccgaacgc tgtgtgccag gtgtcgagtc gtacatcagg     35520
     cgacatggca acaagcgttt atatccgatc ggctgagggt tttctgactt tgctgccacc     35580
     gtgcaggcga cggccgggac gggctcccgt agtaagtcca gccctcacga ccggctggcc     35640
     attcacccag acatgatgta ccccttcaga caggtgccca ggttccagga aggtggcacg     35700
     gtccctgatt tcgtgtgggt caaagacgac cacgtctgcg aacgcgcctg tgcgcagttc     35760
     accccggccg gccagacgaa ggtgccgggc tggcaggctg gtcatccggc gcaccccctc     35820
     ttcaaggctc atcagtcctc tgtcgcgcac gtaataaccc agaaagcgtg caaaatttcc     35880
     acatgcccgg ggatgcagcc ccagcgcgtc gcggcttgac cgtgacgggt cgaagccctg     35940
     ggcatcagat ccgggcatga cccagggctc caggagctga cgctcgatgt tgtcctcgct     36000
     catcaggtcg aaggccgtga agatccgccc aggctccttc aggatcagtt ctatcgccgt     36060
     gtcaatccag tcgagaccta atgcttctga gatcttgacc aggctctgac cgttgaattg     36120
     cagatggttg ggcagcctga gtcccagagg cgtcacactt gccgggccgt tcagacttcc     36180
     cagcggctcc caggtgccat ccggcgtctg cactgcctga taaatttgcg cccgctcccg     36240
     gggatctgcc aggcggtctt tgagcctgtc atccgtgctg gcccacggag gcagcacaga     36300
     tgacaacccg gtccctgctg aagtgtagag gtacatatca gcgtacacct cagtaccgag     36360
     ggtccgtatc ccattgatgc gctgaagaag ctgggccatt tttggccacg atgagcgtcc     36420
     tgcagccttc aggtgataca gatgcaggcg tgctcccgag cgatgacaga tctccagcgc     36480
     ttcatccaga gcctcaagta tgctgtcgtc ttccgctcgg agatgcgtac tgtagatgcc     36540
     tccataccga gcgacctccc cgcacaggac cgtcagttcg tcagtgtctg caaaactgcc     36600
     gggtggatat tccagggcag ttgccagccc gaatgctccg tcttccatgg actcccgaac     36660
     tattcgccgc atggagtcga gctcctctgg ggtactgggc ccagcagcat gcccacgcac     36720
     acaaagccgg accgtagttc cgccgaggaa tgaaccaaag ttcactgaag cccccacgcc     36780
     ttcctgtgcg ctcatccagt cgccaaatcg cgtccagttc ctggcccggt tctcccagct     36840
     tttctcccct ccagggcacc catgcaggcg aaagggctca gtatttgccc cccagaccgg     36900
     agctggcgtc cagccttcac ccatgatctc tgtcgtaatt ccttgggtga tcttagacac     36960
     ggaccgtccg tcctccagga gggtggagac cgagtggctc atcacatcga taaaaccagg     37020
     agcgaccacc aggccatcgg cctggatcac ctccgccgcc gtttcatccg cagctccggg     37080
     caaagcgatt tgagtgatcc gatggtcgtc catacgcagg tctgccggaa atcgggaggc     37140
     tccggtgccg tcgatcaata caccaccttt aatcacgaag gcacacatgg ttgttcctcc     37200
     tcatttcagg agtgaagcac atccgctgac aggagccgcg gtattggcgc ctggtccgtg     37260
     aaagggtcct ggggtcgttg tgccccgcgg tgaaaacccc gtcaaccacc tcgcctgaag     37320
     cacgtgtact cataggcatt gagcatcggg tttaccctga atccttgcgc actgctgcag     37380
     acattcgctc ggcgtgcaga gatttcttgc tctgctggtc taacagcggc gttttctgct     37440
     cttcgccgct tccatgaagc tgagcaccgc tgtccaatac cgttcagtga ccaccggttc     37500
     ggtcgttttg gccgggtcaa gatttacagc gccacgcagc ccgaaacctg gcggaacata     37560
     ctgccgtttg catgccgagg cggtggcgtt caacagttcc cgtgcggcct gtacctcgaa     37620
     cggatcatcg ctgctggtga cgaacagtgg aacgtgcatc cgccgcgcag cagccagggc     37680
     gtctgtttca aacaggtcgc cccgataagg actgaaggcc agcacgcctg ccagctccgg     37740
     acgctgagcc gcgaacggaa tcagcaaagt tccgctcgcg ccgcttccta atgcgaagac     37800
     tgaagcgttc gggtacgtgc gcttgagcca ccgccacgcc acgtccaggt cactcagtgc     37860
     actgcgttcc gtcaggatcc gggtgcccag ccctgcgaca gtggggttgt tgtggccgtc     37920
     gtaccggcca cccgagcgtt ggtccagcgc gagcgacgcg tacccttcgc gggccagacg     37980
     cccgacaatc cccctgaact catgtctgtt ctgccccggg gcatgaagaa ggagaactgc     38040
     accacgcgga tgggttaccg ccgtatgctc cgcatggagt gtgagaccgt caggcgctct     38100
     gagctggact ggcgcagcga gagccaccga gatgatcagc agatgcagca gagcagacat     38160
     acgcacggtg cctccagtgg cttgacggtg aggaggacaa agctgttccc atgatgcgct     38220
     tcagcaggcg cacgcatggt gaggtgcgtg cgcctggctg tccactttct ctgtgtggcg     38280
     cttgcgcata caaccggtca ttggttgtct ggccagaagc aggcgacaca cgggcccggt     38340
     ccaagtggac aagcctcatt cggtttttcc agagcacaga tagactcacc ctaagcacca     38400
     ggcaggtaaa agggggagtc gtgcggaaaa agctgccgct ggacacgcca gggatgaact     38460
     tgatccggtc atggtggtaa cggtgctgct gacgccacag gatcaaatgc cctgtccact     38520
     ggcccaggct ttacgaaaag cttgtcagga tgttccctca gtcatggtcg gtgcagccgt     38580
     gcgctgtgtt ggagaatgac tctcctggta tacgaggccg tgtcccccga gaggacgcgt     38640
     gacgaaccgc tcgccgaagc cggtaataag aggtcgccct tgctgaatgg cctggcgcac     38700
     tgagggaaga gccaaagacg cctgatgact tgcctcgctg tcccagactt ctgtcaccca     38760
     caaggctttg tcgtcgtcag gatcctgagc caccacgtaa ctcaggcacc cgggcatccc     38820
     ggtggtccct tccagcagaa ttgacgcgag cgcatctctc tggccaggta atacctggat     38880
     ttttccaatc agaccgtaca tgtgggacct ccgttgcggc tcttgaacag cctggccatc     38940
     ttcgctttac actactgccc acccgcgtgt ctgctgcccg aacgcccctt acgctacagg     39000
     aacaggtgct gcagtgcgta agcagctcag cacacaatgc tctgcccggc tcacgcggcg     39060
     gcatgcctgc cgacatgccg gtcagccagt gggaaatggc gggtcaagag ctgcgtccgt     39120
     gaattatggt ctgtgtggcc agctgtgcgg caccccggca aattccccca ggaaaaacgc     39180
     acgagcagta tgagcagact gtcgccgaaa gctcttcaga cctatcacgg agtctggcca     39240
     ggttttgttt gcaacctgcg ctgtcgctgc cccgcgtttt tcggtatggg ggcaaccggc     39300
     cagtcccacg tgtgtccggg gcttcgtcaa ggaccacctt gtagggcaga agatctacgc     39360
     tggttttccc ggcgcgactg ggcgaggtcg gctgggtgcc gattcgcgct cagtcaggaa     39420
     cgctgctgag ccaatacgag caacgccgcc tcaacaacgt gagggtcaaa ccgacggcca     39480
     gcctgcaggc gaagttcttc aatcgcggcg tccaccgtcc aggcgtgttt gtagggccgc     39540
     gaacgggtca aggcgtcaaa cacgtcaacc acggtgaaga tgcgtgctgc cagcgggatc     39600
     atgtcccccg ccaactggtc cgggtatccg gtgccgtccc accgctcgtg atgatgccgg     39660
     atcaccgccc ttgcacctgg cagcacagtc ggaatccggc tcatcagttc atccccgacc     39720
     accgtatgac gctgcatcag ctgcctctgt gcggcattca gttttcccgg tttcaacaaa     39780
     atgtcatcag gaatagccag cttgccgatg tcatgaaggt acgcgccgac ccgcagatca     39840
     tccaactgct cggcggtcag tccgagcgcc tgtcccactt gaacggccag gacaaccaca     39900
     cgttcggtat gtcccgccgt ctcgaaatcc cgcagctcca gcgacaggcc aagtgccatc     39960
     aaggcgcctt cacgggtagc ttcaatatcc gccaaatgtg cttcccggtt cagtacctgc     40020
     ccgatcagtt cagctgaacg gttcatcagt gcttcagctg tgcgcggcag cgcttcgagc     40080
     gggcggagcc acaccagaaa gaccttgcca atccggcgtc cccgctccat gacgggtacc     40140
     tctaccaccc cgtggacgcc cgcgctcacc atttccggga gcgcgccagg aagttctgga     40200
     tagcaggacg tggccctgcc ctgctccccg gtgaacgggg gcataccggc cgatccatcc     40260
     aataacctgg cggctgcctt caggaaatct tctgcccctt cgcccacagt gatctcaagc     40320
     ccgcgctcag gacaggtaaa cagcgccagg tcagcttcca gaaaggtttt acagacgctc     40380
     aggcattccc gcgcgatcgt gcccacgtca tccgcgagcc ccacatggcg cgccagttcc     40440
     gccagcatgc gcagttcctc ggtccgccgt tgttcttcaa cggtcacccg gaggcgctca     40500
     aacgctgtca cgccagccga cgccaatgcc cccaacaggc gtccatcgag ggggctgaag     40560
     gattgagacg cgggtcgtac ggccaggatc acgccgatgg gaacgtcagc agtccggatc     40620
     agtggcgctg ccagcagcgt cccgtccggc agggcgccag gagtgtgcac ccgcggatcc     40680
     tggtcgagac gctcgacgtg aaggaccttt ccagagtgaa tcgcatgcca ggaaatgccc     40740
     tgaccctcgg gaatgacctg atacgggaag tgctcgtaca ccccggaagg cgaaaccagt     40800
     cgaaggacca tgtctctgtg gtcatacctg gcgaaggcca cgtgcgctgt ccggaggagt     40860
     tccttggttt cctgtacaag aatccgttcc agttcttcgg gttcctgaac aagcccaagg     40920
     gcagcattgg cctgggccag gacttcgagt tcctgggtgc ggttgacttc ccgcgcgcgc     40980
     cggtcgtgcg aagccacaat ggccgccgcc tgccgtgcga attcttctgc aatattgagt     41040
     tcatacggct caaaagcctg ctcggaacga aggttgtcca ggttaatggt ggcgaccacc     41100
     tgacccgaca ccatcaccgg gacgcacaag gacgcctgaa tatgatcgag cccgccaagg     41160
     tcgtcgaata aggcgatgtc cgcgttgccg gccggccact gcgggattgg gtgagctgcc     41220
     gcacgtattg caggagagcc tcgcaaaacc cgtgcctccc ccaacgccca gttcttttca     41280
     gtgccgtacc agaggcccat tccctccgcc gggtgcccga ccccgatcag ggcttcggaa     41340
     tagccgactt gtgcgcgcat gacaaacaag gagccctccc gcacatacat ggatcctgcc     41400
     tcagcgctgg gaagggccgt caccgcggcc tgcagaaatg cctgccagcc ggcccgatcg     41460
     atcaggccat ctgtactgat cagggcggat gttgcgcgga gcgcttgcca catcatctct     41520
     gcggacaagt gcgtgtcggt ttcggactgg tgtggtccct gaaaggtccg gaccgcccgg     41580
     tgcgctgctt tgtcacgcag catgcggcga tctgccaggc ggagcaggtc atttggcgcg     41640
     gacgcatcct gaggaaaggt aactgcgccc atggacgccc ggagggatgg gtacccctgg     41700
     aggccgacct ggcggtgaac gcggtgcatc atttcacgca gccgggctgg accgaagtgc     41760
     ccggtctgga gaagcaccgc aaattcgtcc ccgccctgcc ggtatgcctg cccgtgcgga     41820
     ccaaagacct cctgtaaggc gctggcaaag cactggagca ggtggtcccc ctgggcgtgt     41880
     ccggccaggt cgttgacggt tttcaagtca tccacgtcca gcagcaggag ttgaaaaccc     41940
     tggggctgtt ctgtcgcccg ttcaaacgcc tcctcgaatg cccggcggct gggaaggctc     42000
     gtcagtacat cctggtaggc tttggtgcgg agctctgctg ttcgctcggt cacacgccgc     42060
     tccaggtctt catttgcatt ccggagcgag tcttcaagct gtttgcgagc agtgatatcg     42120
     acaaaggaga tggccatgcc gtcctcgtgg gaagcggccg agatctcgaa ccatgcgccg     42180
     gtttctggag tgtgcacctc aaactgcaga gtgcttgtgc ccggaacagc ctgtaaccgg     42240
     tctttgaggt gcagtccagt cagccggtga aggaaaggcc agaccggctg tcccaggacc     42300
     tcgtccggcg cccgtccgaa catgcgggct gccacagcgt tgatgtatac gaatctccac     42360
     gctgggtcca aggcgataaa tgcactgggc aggctttcca ggatgctgct ggtgcggcgc     42420
     gcctgacgca ccagttgctc ctcaaggttc cgatgtgcgg agatgtcacg actgatgccc     42480
     agcacgcctg ccagttctcc gttcacgata tacgggtgct tggtggtttg cataaccgtc     42540
     gtgcggtcag ggaacggcac ttcatacgtc acaggctgcc tcgtaagcat tacctgctgg     42600
     tccatggcgt ggatgcgctc ggcctgcccg ggaaacaggt cggcgtcgac tgccccgtat     42660
     gcctggtcag catcctgctt cacaaagctg agggcagcgg ggttgaacat cctgtagcgc     42720
     ccgttgaggt ctttcagata aatcggctcg gaaatggtct ccagcacggt ccgcagccgc     42780
     gtctcacttt caagcagtgc ggcttcatct cgtttctggc gagtaatgtt ctggacgcaa     42840
     cccacaaagc acagcacctg gcccgctgca tccagttgcg gctgaccctg cgcacggagc     42900
     caggtcacct cgcctgtcgc agagactacc cggtaatcct cagcgtaggc tctacggcta     42960
     tcaatcgcct cgtgcagctg gcgaacggtc cgctcccggt cctccggatg aatcaaccgg     43020
     gcccagtcct cgatggtgtc cggcatgccg atatgcgtga gtccgaggtc ctcagcactt     43080
     cctccgaggc tgaaacgctg gctggaagga tggaataccc agctgatggt ttgtgtcagt     43140
     gcaagggtac gctgaagccg gtgctgctgg agggtcaggt cgagccgtcc gttgtggagg     43200
     ttgatcgcct cacccgcaag gtcagcgagt ccgcggaggg tgtcctgatc aaaaggagac     43260
     agcggcgggc gtgtctgctg gtgaagcaga atcaaggaac ctgtgtgggt gccgtcgggc     43320
     gtggtcaccg ccactgccgc gtacgaccgc atggcgtcag ggcccgtagc cagaggatga     43380
     tctctggtat gcgggtccag agtcaggtta ttgatgtcgg cggcacgctg cccaggaatt     43440
     atcaggctct gagcggtctc caggaggtgg cgtgatacgt ctcccttgag gctgaaggcc     43500
     gccatgatct gctggtcgga cagccggctg ataaaggcga cggaggcgcc caaaagcctg     43560
     gcagccagcc acgtaatcct gtccagaccc ggtggatgct caggctcaca gagatcaggc     43620
     atgggggaaa gctgccacgg ttgacggtta tgatcagtca cggcttcacc gctctttcca     43680
     gcagcctggg tcacgcaggg cctgtcctga caaggtgccc tgacgttgac ctcctatgcg     43740
     tcgccacatt tcctgcagtg tatctccttg gatctcctgc gctggggatt cacgctgccg     43800
     ggcttccatg taccagcggg gtctcgcact ggctgccaac ggggggctac cgcctggacc     43860
     aggcaggcca aggatgagga aatgcgcggg ccgtggatgg aggtgatcac agtctcaggg     43920
     ctggcgaatc caaggttgat tcagctgtcc gtgcagatag ctcggcctgc agcggtttta     43980
     accacgattg tcgctggtat ggcagacaat agaggctttt gatcgggtgt cgagccatca     44040
     ggagcggcga ttggacgcga aggtcctgca gcaaaagcac gggctaacct gctggttcac     44100
     gggggcccgg tggttgaggg gcagcggtgc cctggccagg cccccggcgg aaactcaggt     44160
     acgcgccccg aacttgacct tgacggtatt cgcataattg gcgcggagtc cggcattgaa     44220
     gatcaattta atctggcctt gctgatcaaa cacaaactcc accgcggcgg tgccgtccct     44280
     gaacagcaaa ggcttcccgt gctccccgtc ggtggccacg tcgagcatgg cattgaaggt     44340
     gccgaccatc gccacgactg cctgctgcag ttcggtgctc gctgcgtcca ggagctcatc     44400
     tggcaaggtg agcgaaaggt tgatggtctg agtcattgat tctttggcgc cagccgagac     44460
     ctcaatgtca ctcagccatg gcactttcag gctgaaccct gcaccctgct cctggagagt     44520
     tttgagagtc aggtcaacct gtgtgatggg tgtacgctgg ttgctcacgt cccagagtgc     44580
     tcgtttcaca gccttcacga cttccagcgg ttcatatccg ttcactgcca acctccgagt     44640
     gccagatggt aaaaaggcac ttcatcagaa acacagccgg agcgcggaaa caagggggca     44700
     gcaatacagg catcaacctt acccacggtc ctgcactacc gcggcgcggc agcacataga     44760
     aatacccgcc aagcctatgt ggtcggcggg gacagcggta aagctctggc gatcagatgg     44820
     cgttgacagt actgatgggt tctacggcca tgacgacagg caacgcttca acggagccca     44880
     catgcgcctg gtccacatgt cctgagacca gcgagtagct tttcaggtac cgggtgtcga     44940
     cttcgcggac accagcgcgg tgcagttcct cgaggacgct gtcggcctgg gcatcgactt     45000
     ccgcttcgtt cagattgagg gtgatatgca cgagcatgag ggagcctcct gcccgcagtg     45060
     tacgtattct tcctggcaac atcgtgatgc ggtactcagg gagcctggac aatgcccgtc     45120
     ccgacgtcgt cggcacttaa ggctgctaca gtccgcgcac gttctgtcag gagtttccac     45180
     agcgtccggc ccgtattggc tgggttctgc tcaacataca gggcggcaac tcccgcgacg     45240
     tgcggcgtgg ccatactggt gccgctggag cgctgcacgg tggcgccagg ccaggcgctg     45300
     aggacgccga cgccaggggc ggcgatgtcc accacaccga tggcgtccat cgtggggttg     45360
     gaaaatgcag caatgcggtc atggtgatct acggcggcga cccccatgat ggacggacag     45420
     gcagccggat tgcggactgg gcgcacgtaa tgggggcggg cgctgtcgtt tccagcggcg     45480
     gccaccagca ggatgccccg gtcgagcaag cggctggcga tggtttcgta ccgtgcactg     45540
     aaggagctgc caggggtgcg gggcgagccc agactcatcg aaatgatctc tgcgcccagg     45600
     ttggcagccc agttgatggc atcaactatt tcggcgtcgg tgccggttcc ctttctgttg     45660
     agcactttcg cgataagtag cgttgcctct ggcgctacgc cgtagcgtat gccgcctgct     45720
     ggtgtggcag aaccggcaat gatgccggcg cagtgcgtgc catgcccgtt ttgatcctgc     45780
     acgtcaggtt cccctggaac gtaactgatg gtgtttccgg gcagaatgtt caggtcggga     45840
     tgttggaggt ccacgccggt atccagcacg gcaacccgta cgccgttccc ggtcagctct     45900
     gaggtgtgcg ggttcaaccc aatctgatgg aaagtgcctt ctgcaggcag gtcggttcct     45960
     tcaaatacct gacgttcagg aatgctccgt tcttcgttgg gcgcaaccgt gatgatgttg     46020
     cccaacacac gcagctgcca gatctgatgc ggcgtgagtg tggcgactgc gacgcccagc     46080
     tgcaggtaga tgcgggcgtg ggtgccgttg gccgcgctga ggatggtgcg gttgatgctc     46140
     tgggctccag cgtccgcacc gggtagaggc actgcttcca ggattgaggc gaggacatca     46200
     gcattttcag gggtgacatc gcggaagacg atgatatgtg ccggctgctc cagtgtcagg     46260
     ctttgagggt ccatacaact ccttctgggg taggggtctc ccggcagacg cttcgtgacc     46320
     agggcgctgg tgggagtgaa accacgcgtc accatagatc ttgcaccagc ccggcggcgt     46380
     aatgtgcttg tgctgtgttt ttggcgtcct gatagagcat ttgcgtgccg agaggaactc     46440
     tggcaggtaa atgcacacgg gcaaccagga cgcggcggtt caactgatgt gtgcacggat     46500
     ttgtcatgcg tgtggatgtc acatcagccg caggtggtca gtcgcgccat gtcgtccacg     46560
     tcggacccgg tcgtcggatc gaccggccgg actcctgttc ggcgccctgc atgttgatcc     46620
     agaggtgttc gccgcgcctt atctccccga acagatgacg gcggtcgcta cgggtcacct     46680
     gccggacggc tcgtgtcacc tgtgacagcc tgaagattct ttgtaccggc tgtaggttcc     46740
     cgcaagtcag gccactgacg cgttggtggt cggctcaggg cgactctgca cattttgcca     46800
     gaggctcaag cgcgtggaag gtgacttgcc acgtgcggcc gcgtgatgca gcgtttcgtg     46860
     gtgcacgcag acgcaggtat ttctgcgctg ctcctgcatg ggcgcccagt atactttgct     46920
     tccatatgtt ccgacccctg ccgctggcag ttctggctct ggcaggcgtc gcctgcgccg     46980
     cagctcctcc cgtgaagttc accctggcca cgcctcctgg cacaaagtcc ctggtcatgg     47040
     tcacgcaccc ggcactggcc ctcaagtaca acgtcaccgc gggccccggc agcacggatc     47100
     caaaagcgga atttacgttc gaggtgaacc cggacggttg cttgggctat gagtatttcg     47160
     cccggcctgg gtttgggtct ttttacggcc gcaaggacct gtgcgggttc tctccgaaga     47220
     ccttcaaaat caaagtggtg aatgccgccc ccaaactcgg gcagtggaca gtcgtggcgt     47280
     acctcacaaa cgccagagga cagtcggtgc cgctgcaact gctggccagt gtgaccccct     47340
     ggtcttctgc cgcgcgaccc accgtgaaac aaattacccc acccctgaga ccctgaaact     47400
     cttttcctgc agacaggaat ccgcctcacg acgtgccgga ggctctgatc gcgcgatgct     47460
     tccgggagcg cggcaggtgg agcagagtcc tggagtgatt cataaacagg gccccgatcc     47520
     cttacaggag gacctgggtg gcctctgcaa cggctacagc cgaacgcgcg aacggtcgaa     47580
     tcctcagggt gcctgacctg gcggaaggga cgtactgtgt gccggacagc tcagcaggtt     47640
     ctgtagcgcg gctgaacatg gggtcaggct cccagggaac ctccgttgtc atttagtcgg     47700
     aaggaagacg gtccgttcat gctgctgtcc gggtcaagtg cccgtgcggt aagcacagga     47760
     acaggagatt cacgtacgat ccgctgggcg accgatccaa acatcaaccg ctccacaccg     47820
     ccgcgcccgg cagtccccaa cgcgatcagg ccatacatgc cactgcgagc gcgctccaga     47880
     gcgacttctg ctgggtcgcc ctccacgatt tctcctccgc caagtgtggc gagttgctca     47940
     cgtgcttcct ggatccactc gcggttgcgg gcgatgagtg aagaggccgt gatggcgcgg     48000
     cccgctggtg gcaacgagac aggtgccgtc agtgcggtag gtgagacgac gtgcatcagg     48060
     tgcacctctg cgccaggaaa gtactgctga actgcgccgt atgccctgtt cgcggccgat     48120
     gaaaaatcgg tcatgaccag tattcggctg gtcggctcag gctcaccgtg acgaacggtg     48180
     atgaccggta gagcggattc gcgcaccacc ctttcagcaa tggaaccgag cagtgcacgg     48240
     gccaggccgc gcctgccact ggtgcccatc accaccaggt cgaactcctg ggtgaaggtg     48300
     cggcgcacaa tctcactggc cggatcactt ccgctcacca cctccccgtt ccctagcgca     48360
     ctcaactgtt gctctgcttc acggtgtgcc ggttcgccag tgccaatcat gatcacaggg     48420
     ccccccaggg acgacacggt ctggggggcc gcaggcagca catgcaacag gtggcatggt     48480
     gcagtgggga agaacctgcg tgccgtcgtg agggcaggcg acgccatgtc gagggtctcc     48540
     acaggtatga gaacgcgcgg gatcatcatg tgacctcctg gaattgcaat gaacggctcg     48600
     ggatcatcgc ccgccggcca gaaaagcgct gccggccgga agccacggtt ggcagcctcc     48660
     aaaaagcaac ggcggagacc agtgactgac tccgccgcgt cagcgtatga gcgctgaatc     48720
     ccggaagccc tttcaggcct cctacttcat attcagcgta tacctgtacc ggtcactgag     48780
     cgatgtacgt ttttttagtg tcgcttcagg aacagctcaa gagtgtgaga gatctccggt     48840
     cttctgatgc cgtgtgaggg gaaagccgga caccatcctg aggcaccgtc tgtcagccgc     48900
     ctgaactgga ctcagaggcc cccgtacagt ggcggtcaga tccgtccaag caaggcacgc     48960
     agaatgcggc gttcggctgg ggtcaggcca cctaggagcc gctcctcgtt cgccacatga     49020
     gccgtcagca agctgtccac gacctggcgt ccctcggctg tgagctgcgc ccgcacggtg     49080
     cgccggtcct gagtgtctgc ctgtctcgcc acccatcccc gcctctccag tccgtccatt     49140
     cgttttgtga tggcaggagg cgtgatggcc atcagcccgg cgagatctcc cagggtcagg     49200
     ccctctggcg gagccgagcg ccgcagggtc gccagcaggt cgaacgctga gggggtgagg     49260
     tcatgttgcg cgaaaaagtc ctccaacgct gcctggagca ggcttgaggt tcgctgcacg     49320
     gcaatgacag tcagcatggg ttccgggtcc acgtcaggcc gggcggcccg ccagtcccgt     49380
     tcaatccggt tcagcagggc gggagtgtcc atgaattcct cactcggcat ctttacccct     49440
     tcgcctgctc acggtcccgc gccagcagcg ctaccgcgcc caacagcagg gccgcgctga     49500
     gcagggcagc cagagtaggg cgctgggagg gctggcccaa ccaccccacg gtcccgatga     49560
     ggagggcccc cagcacctgc ccgagggtga cagcgacggt gctcagacct acgcccagcc     49620
     gcgcggcccc aatgaggctc agcgtcacgt aagtcgcgcc cagcagtcca ccgcacagca     49680
     tccaaagtgg gggcagggcg cttgggcgtg tgccgtcgac ccccaggagc cagagaccca     49740
     gcagcagcgc cgccccgacc atgaaattga caagagtagc ggccagcggc gaacccagag     49800
     cccgggccag gcgaagatta aacgctagcc cggcggacag gccaatgccc gcgcccaacg     49860
     tgcccagcag aacggcaaag gtcatcctgt cccccacagg cgcaggctga gagcccccag     49920
     ggcgagcaac acagccagga gccgggtccg gttgatcctt cgtcgctgaa gaccaagcgc     49980
     gccgaaatgg tcaagcagaa tggctgtcac gatttgtgca gcaatcacca gggttgtggc     50040
     caatgcagcc ccgagcattc gggtgagcag cacgctgccg acgacgtacg cgctgccaac     50100
     tatcccaccc agccaggccc accgcggagc ctggtgcgca gcagcccagt ctggagtgag     50160
     ccgctgcgcc ttcagcagca ggaaaagaaa cagagctccc tccaggtagg acgtggcagc     50220
     tgtcagggta agcggccatt gcccggcgag ggcgccgttc gtggcgaatt gcgccggaag     50280
     aaggctgccc gcgaacacgg cgaggaccag tggaaatgtc tgctgaggga tggaagggat     50340
     agccatgacg ctcctttatt tcactagtaa aatgtttact ggtgaaatag tcaagcctgg     50400
     cgcttatgcc tgttgtctcc aggcctcggc gtatgaaggc cgcccccaga cacatctgag     50460
     cgttaccgtc acgacgagca ggcaggagcg tgctttaagg cgtcacacgc cccagtacct     50520
     tgagacgatc gtcctgaaaa cgcacgatga ttccttcacc cgaggcgggc acaatacctg     50580
     tgagcgccgt aatgttgacc tggtgcgtta ccacgacaag gacgcccggc cccttccacc     50640
     gtgccagcac gccgcgcgct gcgcgagtct gcgcgggttc ctgcgcgctg ttgtcgaaga     50700
     aggagttgaa cgccgcttcg ttatgcacct tgcccggaaa tgcaagcgag gccgtttcgc     50760
     gcgctcggca ccatcgagaa ctcagcaccc gcgtcaccgt gacacgccgc tcgcggaacg     50820
     cgcgaccgat acggcgggcc tgcgcgcgtc cctcggcatt caggttgcgt tgtgtacggc     50880
     agtcattcaa acgaaagcca ggcgggtcac ctgtgccggg cgctagggcg tgccggaaga     50940
     gcacgaccgc gccatctgtc agggcattcc actggctctg tgccttggca gtggagaggg     51000
     cgcacagacc aagagtgatc agccacctcg tgagggtttc tcgcttccgt gtcataaggc     51060
     ctccggcggg cttgaaacag gtcaaggtcc tgatgcctct attgacggtt tactcctgga     51120
     tgaaaagctt gctgcagccc catcacattc atgatccttc aggaccggat gtcatcgggg     51180
     cgattgagtt cgaggagcct gtccgtgcgt ttagggccat tgagttcatc aagcagcgct     51240
     gcggggtaca caggaaaagc attcccccac cactgctcaa ccggagtgct ccagacgcgc     51300
     cagcccacgc ccggcacatt ttttgccaca taccgcgctt cagatttttt catggagaag     51360
     atcagcttaa ttcaccggcg acctgccaac ctaaagctcc ccttcactga gcttttactt     51420
     cggttccggc ggagctgtac caggggagcc accggtagtg ggtggcagcg ttcatccagc     51480
     agatgatgaa ggcgttacac gtgtagaaca ctgctctggc agttccgaac tccaagtatc     51540
     agaaccggga gagcggcaga tgccaggaag ggcggcgccg ggaaatgtca cgatgctgaa     51600
     tatgcctatg gaaattgaac ggaagttcct ggtccgagcg gacgtctggg ctgcaacggt     51660
     aaagcctgaa ggctctgagt tgcgtcaggg ctacctcagt acggacccgg cgcggacggt     51720
     gcgggtccgt gtggcgaaca cgcaggcgtg gctgaccatc aaaggaaaga cgcagggtgt     51780
     gagccgggcg gagttcgagt atgccttgcc ggtggacgat gcccggcaac tgctcaccct     51840
     gagcgtcagt cagcttcata agacccggta ccgtatgccc gtgggggtac acacctggga     51900
     tgtggacgtg ttccatggcc cgctgagtgg gttgattctg gcagaggtgg aactgcgcgc     51960
     cgaggatgag cagttcgagc ctcccttgtg ggtgggcgtg gaggtgagtg cagacgcgcg     52020
     ctattacaac agtgcactga gcggcgctca gcaggtaccg gacccgccgg agttataagc     52080
     ggcgcgtcgt gcctctgact tgcggcgcgg acacatcaga agaaaagaag agccaggcgt     52140
     gcttgcagtc cattcactgg tcagggtatg tcaatagctg ccttggggag cactgtcaaa     52200
     tgagcgcgtc gcgatcttca gtgcgtggtc ctgccgcgcg ccgctcccgt gcggaaagtt     52260
     gttgtgtggt cctgggagcg aactttgcac aacggtgcag cagggcggtg atgtggaagc     52320
     ccgaaaaaca tgtcaggtcg ctagttggcg tcatttccag aaccacaggc cattcggaca     52380
     cggcgcggcg acgtgtgaac ctgcggagcg gtttgcctgt accttctggg ataacgtatt     52440
     gatggctaca ttgtccgccc acgacgacct ccgttggcaa gcgcacggca ctcagacggg     52500
     catatgatgc gtgggccggg tggtaagggg cacgagatac gaggccgtga aggggttcct     52560
     actgcggacg gaagacgtcg gtgctgagat accgcagacc ggaatcacac acgatggtcg     52620
     ccacggtcgc gccctcgccc agacgttcgg cgacgcggag tgcagccacc acattggctc     52680
     cggtcgagac cccggcgaac agcccttcct cgcgcgccag acgccgcgcc atgtgtgtgg     52740
     cctcctccgt agagactgtc tgtatctcgc tgatttcctc ggggtgccac aaggggggca     52800
     ggaacccaat gccaattccc tcgatccggt gcgcaccact ggttcctcca gaaagcactg     52860
     ccgattcggc gggttccaca gccaccaccg tcacgtctgc tccccgacgc cgaagctcgc     52920
     gtgaaacgcc gtgaatgcta tgggccgtac caaccgcgtg aacgaaggcg tccagtgacc     52980
     cttccgtctg ttcccacagt tcactgccca gcgcgtggta cccctcaatg gcatcgtgat     53040
     tgttcagctg gtcgcaccac cagtgcccag gctgtcctcc gagttcgtgg gagacccgga     53100
     tcatctcctt gatcagctgt tgcgtgatcc tgccctggtc actggggacg agggtaatct     53160
     cagcgccgaa ggcctgcatg gtgcgcagct tctcctgact gaaagcgtcg gaaaatacga     53220
     catgcaagcg gtagcctctg gcggcacaca cgaacgccag ggaaataccg gtggtgcctg     53280
     ccgtgtactc gaccacagtg ccccctggaa ccagacggcc gtcctgcacg gctgcgctca     53340
     ccgccgcctg tgccatacgg tctttcatgc ttcccgtcgg atttgctggt tcgaacttcg     53400
     ccacaaggcg ggccgatccc cgtggaacga cattcgtcag ttcgatcagt ggggtgtgcc     53460
     ctatgccgcc cagcgtgcct gcccgcaagg gcgtcaggtt caaatcggac ctggtcatgg     53520
     ctgcgagctc ctataaagac acatagctcc acgttggggc cggactgagg tgccacatgc     53580
     ctggcgtcgt ccacccccgc gactcccgga ggcacaggca ccgtctcgcc cgtgtatgcc     53640
     agtgtcgaga tgcggttgat cagccacgaa gaccgtcata tgtacctcct tgacggccag     53700
     tcttcctcca ttttttccag gagcgctccg gtctggtccc ttggcccctt tcgcgcgcat     53760
     tttcagcagc gcgaatctga agactggtgt gtttcatcgt acctccaccg aaagccgaat     53820
     aggtaaggtt gacgacgacc agaacgatgt aggaacgcaa ggggtgaggg ctctggtcat     53880
     cccttgactc tccagttgat ggagggtcta cggcaaaggc aggaggggcc cctatggatg     53940
     ccaaccaggc ccgattcctg ctcgaagtcc agcgcgtgag tgcccgggtg gccgccgagt     54000
     gttcgtatac ccccacacct tcacggcagc cgacagtccg aagcatttcc gtgaggcacg     54060
     ccattgccgt atggctgcgt cacctggctt cgcgggttga cgttccatct gcgccactgc     54120
     cggtataact gctcctggcg tcttcggagc caggaggtga ggctcgcttg tgaggatgcg     54180
     gtcaggtcgt cattctctgt ggcgaccctc ctgtgagcag atcgagattg atgcggaagc     54240
     tcgcggcacg caaagaacgc tacctgcagt ctgctgggcg atcgggccgt tccatacgct     54300
     gtcttcttgc cctggtagcg gaaggtgaca aattcctcct ggtggtgcag tggagtagcg     54360
     gtggtgtgta gcggagggca catgtaatta gctccactgc ggcacagcgc ctggtacgac     54420
     ccagatcaat agggggtcat cctgtgcctg gagttgtcgg gatcagggct gctgttcggc     54480
     gtgtccacat cacctcatcc ggaggtcagt agctcggccg ctgacccagc gcgaactgca     54540
     cgtccacgcg gtgcaagcgg gtgctgccct ccgtggtgcc caattcaggg cgcggcatca     54600
     gggaaaaagt cgcgcgccgc tcctgccccc cctgccgcgc ggtcaggctg acggtccact     54660
     ctccttccgg ggtctgctgc ggagcaccct gagcccagcc ctgcgcctgg agtgcagcga     54720
     gatagtgcgt cagcaccgtg tccggagaat gcggcgtgcg cacggtggca taggtgatgt     54780
     aaaacggacc gttcgggccc tcactgccgt aactgctccc gctggagccg accctggcgc     54840
     cgggtggcga gggaagcgag ggcaggacca gaccagcggc ccgcagctcg gccaggggat     54900
     cgcgtgcggg aacattgcgg cccggcgagt agaagttccg aaggtccggg tctgtccatt     54960
     ccaggttggc cgggcaggtc acactgaccc cttcggacac gaaaaagcgg taggcgacct     55020
     gactgcctcc aggggtaggg gagacctgca tggtaaggct gccagctacg ccaggtctgc     55080
     actggctggt ctggtggttc gcacgatcgt ctgatctcca gtgtgacttc gaaagatgtc     55140
     ctgagtggcg gtcgtatcgt actgatcgcg ccacccttcc agtgcaagcg cctttgttgc     55200
     cgctacccga actgcttcag gagttgccgt ggtgcggacc accaccaggg tggaccacgg     55260
     ctggacgacc gatccgatca atgtctgccc gggcaacagg ggcaggcggt acggcaacat     55320
     tggcggaagc tggccaggtc ggaaggcgtc agaactgccc acaccagcgg cggtcagcag     55380
     aaggacccgc tcggaatcgg tcaactttga gaggaggtca gggctggccg attgtgccaa     55440
     agcgacggca ctgccgaaaa ggcccagggc aaggatccgc agaaaaggtt tcatgctgca     55500
     ctgtatgtgg tccggtccgg tcgtgggggc gaatttgtgg atcccggatg gagcaggcct     55560
     gacctcatcc cggcacgcgt caggcagtca aggcgttcgg gcacgggtgg tatggttctg     55620
     tcgctccgga cctggcccac agccacaaat tttcccggcg aaggcaacct gaaagaacaa     55680
     gccgcgctcg agagtctcac ggtattgagc ggtccgggcc agtcgccgcc gggcgctaac     55740
     ggatcacaag tcggcgtcta ccagcaggac taaactcgtt tcacgatgag cgtgcttgaa     55800
     cgggcggctc ctctggggaa gctactcagg cggtcacggg aagccgcctc aggtgaaggc     55860
     tggtggcaaa gctggtatgg aacagtcgtg ctccgggaat gcggcaatcg gactgacgat     55920
     aagaggacgt gctgttcggc gcagcgaaca ccacgaatag ccgcctgacc gttatcaacc     55980
     gaatgcctgc gtccgcccgt gcatgtccgg cagccggcac atgctgattc gcccagaata     56040
     gaaagagctt tcgtgtactc tggatgacga acatcaggcg cctcgctgga gtctgacctg     56100
     cgcacgtttc ctcgacctca gtccaggaga agatcatgcc agaaaacgat ccgacagcca     56160
     ccgtccgacg catgttcgcc gccttcgcca gcggcgacct cgacgcggtt ctggagacac     56220
     tccatgaaga ctcgcactgg atttacatcg gagcgaaccc tgatctgacc aaagtagaat     56280
     tccgcggtaa agcgggggtc aggaggttct tcgaacacat cctcgagaag tacgagatca     56340
     cggcgttcac tcccgacgaa tggattgagc agggtgacgc tgtggtggtc ttcgggagcg     56400
     aagagggccg tatccgcgcc acgggcgcgc cgttccgaca tgaatggtca cagaagtacg     56460
     ttgtgacgca caacctgatt tccaggatga ctgaatacaa tattcgggtg gagccgaaag     56520
     gctcagcaga ctaaagccgt aggggtctgc cgtaccagaa tgctcgcggt tgatcacgtg     56580
     atgcgaggcc cggcacgttg tccggatcaa cggtgtccac gccgggttcc ggaggagttt     56640
     tccattgatg cagcccggtc aggcctgttc ccaggccgtt aagctcggaa gcgcggaatc     56700
     acgtcctgcc cgaagcgccg catctcttca agctgtgggc tgaactgaag caacagcagg     56760
     tccacgccag ccgcttcata ctcgcggatg cgcgccgcaa tctgctcagg ggtcccgatc     56820
     aggcggggac gcaagccgcg gttgctcacg ctgtactctt cgagacttac ctggctctca     56880
     agctggctgc cccggacgaa gtcctgatac gacgcgtatg cctgtgggct ttgctgcaca     56940
     tcggtgatgc gtgccagttc ggcctgtgcc tcttcctcag tgtcacggca gatgacgtaa     57000
     gcggccatcc cgaactgcat gggcgcgccg cccgacgttt cacgccgtgc gcgcagatcg     57060
     gcgatctttg cggcgatgac ttccggcgga tcaccatgca tgacgtaagc gtcggacttc     57120
     tccgagataa gctgcttggc acggggcgac tcgccgccca tgtacacggt gggcagctgg     57180
     gccggtttgg gttccaggtg ggtgcctgag agctgataca acgctccagc gtggtccacg     57240
     accggctcgg tgagcagccg gcgcacgacg ctcagccact cctcggtgcg cgtgtagcgg     57300
     tcgtcgtgct ggtcaaacgg catcccgtac tgccgcgcct cgtcagccca ccagctgctg     57360
     accacgttca ggctgacgcg gcccggcgcg atggtctcca gcgtgctaat cgccttggcg     57420
     gtcagggcag gagcgtgata gttcgggcgc actgccatca tcagttccag attctgcgtc     57480
     acggcggcca cagcgggcgc cagtgtccag gcgtccaggc ttggcgcctg tggacccttg     57540
     atgtcgttga gattgagttc cgcaatcagg ctgaggtcaa agcccagctg ttcggactgc     57600
     acggcaacgt cgcgcacgta cgaccagtct gtggtcatgt cctcctgttc aacgttgcgg     57660
     agccaaccgc caaaaatagg catccagtaa ccaaaacgca tgacgtctcc ttaaagtgtc     57720
     tgccaaaaag acaatctctt tctggctgag tgcagtgggt aggtaaaaag gggcgcctgg     57780
     gagatccagg gcgtgaagca ggcctctccg tctcgggccg ccggtctagc aggcgcaggt     57840
     ataacgaaac ccgaacagct cacccttgag cacttcgtag aagggttcgg gatcgtcggg     57900
     atcgaggatt ccgtcgacca gggtgccgcc tgctggaatt tcaccccgga tcaggctgag     57960
     ccactcgtct ttggtgacat gctcctgcgg catgacgccc gcgcgttcac ggaccagctt     58020
     cacgtagtcg cgcagaaagg tccaccgcac cccatcccgc tgctgcgggg cgtcgaacgc     58080
     ctcgccaatg gcgtcgcggt aggccagcga tggcagatcg atgccgctgg cgatgggcaa     58140
     cccgatccat ttccagctgc gggtgttcac atcgagcagg aggtgctcgc ctgtatcagg     58200
     gtcctgcacg aactcgatct cgctgatgcc gtgaaagccc agcgcctgta acacccgcac     58260
     gccccgctcg gcgatttcag gaacaaaccg ggcgtctgcc aggcaggagg tgccgaaatc     58320
     aggcgggtac tgttcgagct tgcgtccgac aaacacgcca cgcggacggc tttgcgcgtc     58380
     aaggtagctg cagacactgt aaaagccgcc cggccgggtc cgaacgatgc gctgggcgac     58440
     cagccgaaga ccctgctgcg ccgcttcctg cacgcgggct tcaaactcac tgggagtttg     58500
     cacgacaaag accttggccc ggaaggcttc gtaaaaggcg cgcgactcat cgggtttgag     58560
     gatgacgggg tacggcacct gcgctgcaac ctgccgcacc tgttcgtgtg gccctgcagc     58620
     caggtctgcc acaggcacgc cgtccagata ccagctttgc ggaatgggaa tgccaagttt     58680
     ctccgcggcc cggtacaggc tggtcttgtt cagggccgtg tcaatcacat cctgtccact     58740
     gaacggcaca tggtagaaac gctccagctc ggttttatgg cgcgaagtgg cgaacaccca     58800
     gtcgtcattc gtaggaaaga gaaccggttt ctgtgcgaag tgcgggccca ggtcaaggag     58860
     gaagtcggtg aactcgcgcc cgccgtccgc cacgtccggg catagggcca gggcgctgag     58920
     gtgccggctc cgctgtccca ggccgccgcc ttcgcggtcc aggccaagaa ccgggatgcc     58980
     ctgtcgtccc agactgcgcg caatggcgag tgcggtgatg tgagtgttga aagtgatcgc     59040
     ggcgggcaga cccaccccgt tgagctggtc aattgcagca agcaggtcgg aacgttcagt     59100
     aatcatgcgg gggtcttcac acttctttcg ggaaggggca ccaggccccg ggcgtactgg     59160
     agcgtgcgct ccacaaggac atcggtcgag ttgacgagcg gcacgggcac atcctgcgcg     59220
     tccagcacca gagggacctc ggtgcatcct gccaccagca cctcggcccc cgaatccacc     59280
     agttctagcg caagcgtacg catctcagcc cggacgcggg gaccggtgtc tcccgcctta     59340
     atctggtaca ggaggtccat gaagcgcgcc agagcggagc cttccagggc aagggtactg     59400
     acgccatacg gcgcgaaagc tgactggtac agaccggcgc cgaggcaggt gctggtggca     59460
     agcaggccga cccgttgcag tcccggctgt tcacgcagag ctgcgtcccg cgtctcctcg     59520
     atcaggctga cgaaaggaag ggtggtggcg ttgaggatgt cctcctcaaa ggcgtgcgcg     59580
     gtgttgcata ccatcaccag aaagtctgcg ccggaggcct gcagcccgcg cgccatctgc     59640
     gccagtacgg ggccggggga ctcgccccgg ccggacagcg cggcgttacg gtcgggaaca     59700
     ccgggattgt tgtcaatcag aaggcggaga tggtcctggt cactcctggc cccagcccgg     59760
     cgcaagactt tggcaaagaa atccagcgtg gcctccggac ccatgccacc cagcacgccg     59820
     acagccctgt tcatgcgaga agcacgtcct ggtaggcata aagcgcgggt gctcccccgg     59880
     tgtgcacaaa caggaccttc tgccccggct tgaattcgcc ccggcgcaca aggccaatga     59940
     gtcctgccat cgctttgccg gtatagaccg ggtcaagcag gatgccttcc aggcgtgcga     60000
     gaagctgaac ggcctcgacc atatcggtgg tcggtagaga atagcccggc cccacccact     60060
     catccagagc ccgcaccgtt tcccggggaa tctctggcac gcccagcagc tccgccgtct     60120
     gttgtgcgag ggcgtgcacg ttgccttcct gcgtctcgcg ctcgcgacgg acgttgattc     60180
     ccgtcagcgg gaggtgtgcg ttgttgccgg tcaaaccgac aagcaaacca gcatgcgtgc     60240
     cggcactgcc actggcacac acaatatgat cgaggtccag gcccatcctg taggtctgcc     60300
     ccagaatttc ttcggcgcag gcgacatatc ccagcgctcc aagggcgttt gagccgcccc     60360
     cgggaatgac atagccctta cggccctccc gggcaagatc gtcggcaatg ctctgcatgg     60420
     tgcccgccag gtcggcgcca ccttccacca cggtgaggct ttcggctccc agaagccgga     60480
     acaggaagtt gttgccgctg gcgttttcct ggtaacttcc cgccacacgc tcttcaagca     60540
     ccaggcggca ctggaggcct tctttaacgg cagcagccag tgtcaggcgg cagtggttgg     60600
     attggaccgc tccgacggtg atcagggtgt cggcgccgcg cgcgagagca tcggccacca     60660
     ggaattccag tttgcgcgtt ttgttgccgc ctccagtcag gccggtcagg tcgtcccgct     60720
     tgatgtagat gtctggcccg ccgagaaaag cgctgaggcg ctcgagtttc tcgataggtg     60780
     tgggatcggc cgtgtactga cgccgtggga agcgggcaag atgcatggaa tcctccttaa     60840
     aatctgactc aacctatatt ggttgataaa ccttgtcaac aaggcaaaca ggcctcagtc     60900
     agggtcaact gttgggtgcg ctgatggacc gaggaaagta gttggaagtg cgtgacacag     60960
     ctggaccaga ttgaacaggt gtggcctgcg cgaccctgat ttcgggtggc caccataagc     61020
     atccgacgac gatacaaggg tagccagcag atcaaagatt tccttgaaaa cgaagtgtac     61080
     gccattcaag gggtccaagg ggctctggaa aacaaggcgg ctttcaccat tcgttcagag     61140
     gagcgcgggt ggagattggc tgaagtgacc agatgggcct ggtgcgtgaa gcgatggcgg     61200
     caacgcaggc gtcgaaattc tcgaggctat gggaaaacca ggccgccagt cgtgagcgat     61260
     catgctttca gcgccgcaga ggtatgccgt aacagaaacg tagctgaacg ggcaatccga     61320
     aaaaggaagc tgatcaggct ggttcacaac cggggatact tctgaagcag cgcgcccgac     61380
     tcgataagct tcacaagccc cggatcactc acaggctcat gtttgtcccc cacggccctt     61440
     cccccaccgc gcggggaaag tcgtacaccc ctgcgacacc ttttgacagg agattgattg     61500
     tcctggcaac ccgcctcgta cctgagcaag ggcgcatgcc acggtttacg gcgtggcata     61560
     cgccctataa gggcgatgag catcaaccca ggcactcggt cgtaccatac ttgtcaacgg     61620
     tctgttgcac ggacgcctct ttcagagaaa gcattcgcag gttcacgcac tgcagctttt     61680
     gcacccacgc gtcttattga tacctgcgta atttgggaac agcttaccct gcggctatgc     61740
     cacagatttg gcggcctgaa aggctgaccc gtcctcaact ggaggaacgg cgtttgttcg     61800
     cggaacccta catccgagag gacaagctca gttccgctca gctcagcgag ctgtgcggcg     61860
     tgggttccag caccgtccga aaatggcgtc aacgactgcg tcaccaaggt tcactggaag     61920
     cgacctttgc ctgaggcccg cccagacgcc tcccggatga gcagatagcg gatgtgatgg     61980
     ctctgctgca agcagggcct gatccacact tttaccccga ccaacgctgg acctgccccc     62040
     gagtgcagga agtcatcggc gtgaaatttg acgtctggta ccacgtggat cacctgagtc     62100
     gcttactcca tgcgtggggg ttctcacggc aaaaaccgac gaagcgggca gcagaacaag     62160
     atcaagaagc ggtcatgtcc tggatccaaa tgtggggcct gagctcgaaa agaaggtgga     62220
     agacggagaa acgcttgctt ttctagttga agtgggtttc agtttgaaac ccacggtatc     62280
     gcggacttgg gcgccgtgtg ggcagagccc agtgctcgac gccaaaacga actgggacaa     62340
     ggtgtcgacg attggggcga tcacgacgac aggcagttct tgcagcagac tcatcaggcc     62400
     gccatcaaag gcacccaggt catccatttc ctgacccatc tgctccgaca tgtgcctggg     62460
     aaggtcacag tgatcccaag cattcacaaa acgaaggcgc tgagcgcctt cgtcgccggt     62520
     gaggttcgtc tgtctctcaa gtatctgccg ccgtactcac cagagttgaa tcctattgaa     62580
     ctggtctggg cctacatcaa gcaacacatg ttggcgaatt tctgtccaaa agatttgctc     62640
     actctgaagt cacgaccgct tcaggcgtgg cagcgtgttt ggtacatcca actctcgacc     62700
     cgattgtttt acggcagcca agcgtgaccg atttaagaag gtatcaataa tggcggaggg     62760
     tcacagcgag gagccggatt gcacccaggt gataagcact gtgcgtcagg atgctcaaaa     62820
     aaccaccgat gggctcgtcg tcccagacct caatctgatg gaggtgcgtc atggcagcgg     62880
     catactcatc acgaattgcc cgcttgaggt cgctccattc ctcaggggtg accgtacggg     62940
     tttcccaact tcccggccag tcaggtcgca catcttcctc ctgggcgatg aagcggcgga     63000
     gaatgtggat gtaatagcga atgtgttccg tgtgcgccgc aatggttgct ccatccggct     63060
     tcagaggtgt tgaggcgagt tcatgatcaa gatcatctag tgtttcaaag acgctcccgt     63120
     ggcctctccc atcgatgtaa tggcttcctt ggccgcctgt cccttcaaag gtttcgcgga     63180
     gaagatcggt taagttgctg aggtagtccg gagcatcaac cgtaggcata gtgcctccag     63240
     cgcgccttat aaggcgacgc agaataagtg gggcgtgggc gacgcgttgg cctcgccttg     63300
     tggtgactca attcggttta agtggggagt acgaagcgtg gttggccatg acacacctgt     63360
     cggcgcatac gcgagatcag cggaggcgcg cggaacactg cacactctac gcggtttatg     63420
     acgtgtgagg tctgttggcc tcactgttcc ttatctacgc aggcatcaat actggcaacc     63480
     acgtcatggc ctgaaaagcg caggcggttg aactcgtcac atcagaagct gccgccgccg     63540
     cccacgcgca caccctggta ataggcatac gcagcgctgt aacaggctgg ttcggcatac     63600
     caggattttg cggcgcaaat cactttcatg ttgctgtaaa acacgtcgtc actggtcttt     63660
     cggttggcat ctgttcgttg atagactttg agattccggt acgcaaagtc atgaacgttg     63720
     caagcggggc gaaagtcttc ccggtagccg agaccgagtc cgtcgggtgc gctgcatcca     63780
     tcccgtgtcc agttcaggcc gctatagggc agtgtggtgc cggcatagct cgcgtattga     63840
     ccgttgtaat aagtgaccgt cctccagccg acacgcttga tataagccag gcggtcagca     63900
     gcaagatcct ggcctgtgat cgttggtgtc tctgggaaac tcagaactgt aggccgctcg     63960
     ccataagctt cctgaagcgc ctgaaccagt cctggatcgt tggcatatcg gctgaggatc     64020
     gcctgcgatt ccggatcctg taattcgggt ctctctgcat aggcgcccac cagagagtcc     64080
     cctggaagtg tgacggcgac gtcggggaca gtctgtccac aagaggccaa cagagagaca     64140
     agaacagcag cagagagcac ctggcgcata agactccttg ttttcggaat tgaataggga     64200
     tgctttctga gtgtactcag ttcattttct gctgatacca ctagctgacg taagtaaacg     64260
     aatgatgaag cttatgtaaa tgcaggaata agcggctccg atgacgtacg ctttttcgcc     64320
     cagctgatag atatggccag gcgcttgatt ccttgtcagg gagcgggagc ctgaccgtta     64380
     catttcaaag ccaggaaagc ctttcgaaat ggggggtcag atcttggcca tgcgcccacg     64440
     cactctcagt gacgcctgaa cgctgaaaca ttacgaatca tgacggtcat gaggaccgga     64500
     ggcaccattc cagaatcccg gtgatcaagg cgcgagccct gtcaagttgg cccgatgatg     64560
     ttgtgtcgtc agcctttgca agtctccggt catgcggctg acgacgcctc gcccagcgcc     64620
     tggctccaaa ctgtgtccac cgcatctacg tgcgccgcct gatagggctg gcaccagggt     64680
     ggtgctgagc acggctgcat cgtaccgggg agagtccacc gccatgtggc cctgccattc     64740
     ttaggaaggc ccctgttcgc catcttgcag gactgaaggt gccattgata catgcgttcg     64800
     tggtgaccga tgaaggtgtc ggtctccgcg cagggcttga gaggcaacga ggagagggag     64860
     atatgcattt tgatcctcgc accactggaa accgtcgtgg gcgccggact cctctgaagc     64920
     gtacatccca cccggtacgt gttcaaagga tgcagaagcc gccatccagg acttctcagg     64980
     ctgagaggcg cagtctgtct ccccctcata atcctggctg gttatggaaa atgcagctcg     65040
     ataagggaga attggttgtc gaagctttgg ctgtcgccag agcttctgcg aatcagcctc     65100
     tcttgcgtcg ttctgctccg gacgtgttca cctcaccttg gttctcctgc ctgcctctgc     65160
     tccccgctcg tatcctgaat tatgagcatc gccccgcgcc actacctgct cgtcgatgac     65220
     aaccccacgg accgcctgct cgcccaggaa gcttttgcag aactccagcc ggattgcacg     65280
     ctgacctgcg tcgcaagtgg cttagaagcc ctggacttcc tccaggtggc tgtccccttg     65340
     ccagacgtga ttctcctgga catcaacatg cctggaatga atggtttcca gctgctggag     65400
     cgattgaaaa accgtccgga gctcaaaggg atccctgtag ttatgctgag cacttcaaat     65460
     gctgccgagg acattcggca ggcatacacg ctgcacgcga gctcgtacgt cgtgaaatca     65520
     ccctccttcg aagcgtttat ggcgcaggtg gaggcattct tggggtactg gcaggcgacg     65580
     cgggtggcgc gcccatcaac cgctgagcag ccttgaccct ggggttcacg ccatatgctc     65640
     acatgatatg ccggtaccct gccatgccct tctgatcggc gacaacgcca gcggccggat     65700
     gctggcgcag gaagcctccg agcagctccg cccagaatgc acgctcacca ccacggcaga     65760
     aggcaagaaa gccctacagc tgctgcgcaa cgagtccctt ctgccggatg tggtcctgct     65820
     ggacatcaac atgccggcaa tgagcggatt tgaactgctc taggaattga agaaggattc     65880
     tgccttacgg gaggtcccgg tggtcatgct gacgacctcg agcgcccagc gcgacattac     65940
     gcaggcgtac agtctgcatg cgaattcata cctgggaaag tctccagctt ttgaagctgt     66000
     tctggagcag gtggaggctt tttgaaatac cggcaggcta atcggttgac aggcaggtga     66060
     acgggcgagc tcttgcttaa gcaggaggag cgcagcgggc tgaattcctt gtggccgtgc     66120
     aggtgatgac gcacctggca gaattccttt tgcatgtgcg gctaccggtc gtcctccgtg     66180
     gccgtcttgg tattcttcgt ggcgttcaca ggcctgccca ttatcgtcca ctctttggga     66240
     aagatgccat tttgcccgtg cggccgccgt cttcctcagt cgtgttcgcc acgctgcctg     66300
     aaggaactga gtccgccgcc agatacagac aaaggaaaca aaggttggaa agcgcaaacc     66360
     gtttgcaggt gatggctgca ggtacagttt ccgtgaccgt ctctgtccac ccaccaagag     66420
     gcattcaggc ccttaacggg gttagttcgc ttctccatcg aaacttactc cctttattct     66480
     gcgagccagt tctgtacagc actgctcagg aaggtcaatt cctcaggaag tccagcggga     66540
     cttcctgcac ggtggcccca gaggctcggg atcgatcgca gctctgcggc ttgcagatac     66600
     ggcagttctg cggcattgtc agccacccga aaatagaggt cggtctcgct gggcatcagc     66660
     agaacccgcg cctggatgct ggccagtgcc tggctaaggt ccccgccgta caggtcattg     66720
     ccgctgatgt caccgtgaaa ccagctcaga gcctgagcat agagattcgc tgcccggtac     66780
     ggagcaaacc tcacctccca gtccgagcgc agatacgtct ccaggtcagg gaaccccagg     66840
     accgtgcgga acagttccgc gcggtagaag tcctggctca gcccccagcc tgcgtagata     66900
     tgcccgaacg ccttgagcgc ctcgtggggc tcagcagcga accgcccgtt cccaaggtgc     66960
     tctggtgcgg cttcaagcgt cctcagcagg ccagagagaa ataccttgtt gtgcagggac     67020
     gtgcgggcac ttccgcaaac cacgatggcc cgttcaacct gacctggaaa cagggcggcc     67080
     cagtggtaag cctgcatcgc ccccatcgag aagccataca ccgcggcaac ccgttgcact     67140
     ccgaaaatct cgcggaggag ccgggactgt gcaagcacgt tgtcccgcag agtgaccagg     67200
     tcagggtaat ccggggtttc agccgccccc gaggagagcc cgttggagaa catatcggga     67260
     atgacgatga accaccgctc cgggtccagc acgccacccg gcccgatcaa ccagctctga     67320
     ctgtcatggg tcgcggcata gctgcagggg tacacgatga cgttgtcgcg ggcgctattg     67380
     agggtgccgt gggtctgcca cgccagccgg gccccctgaa taacacctcc acgttcgacg     67440
     ttcaggtcac ccaattcgaa cacaccctcc tgcaccggcc aggaagtcat gtcagcctcg     67500
     ggagcgtgga ctggaaggaa ggctgatcct ggctcggacg ggacatgacc tcaccttacg     67560
     ctgcttgaaa cctctttgcg ggtgttcgac ccaacctggc tgcacccata gaacacgaga     67620
     atacgcatgt acccactgac aggcgcgtgg tcgcgacccg aggtaacact gctctggccg     67680
     atatcggcgg catcgttcgg gcaggggtct gctgcaatag cgtcctcgag cagccttcgc     67740
     gagcaccccg gttgaagtgg cgctctggtg gaggctcagc tgcgtcacag tctcggcgca     67800
     cgtgtgctca cgtcttcggc tgcccgaggg cgtgacagtc cagcgtcact gctcaaggaa     67860
     attgacctcg ctttgagtgc cgtcctgacc caggcggaac gttttgatct gatgcggggt     67920
     aaccgtcgct tcaaaggaca ggttgaggag cggtacggtc acttgaactg cagccgggcg     67980
     cccgtacggc tcgtacagac gcagaatcca gtcctcacct tcctccgcct gtttgagcgc     68040
     tgtaacgaga accgcgtcag ggggctcgac cgtcagaaac gatagggtgc gtggcaaccg     68100
     gccagaatgc gcgaattccc gcacgaaggt gagtggctcg ttgaaatcct gcgccgccgc     68160
     tacgacccca gcgtcctgcc aggctcccat gtgcggcatt aacgcccaac gggtctccga     68220
     gaggccctgg tcgagatact gatccactgg cctgggctgc tcggggcggt cgcctccccc     68280
     atagatcgga ctgcgcagaa tggacaggcg tacctcgcca ccgtgcacat ccgcaccgta     68340
     cttgctgtcg ttgagcagcg ccacgccgta gggtgcccgg cctgcgtgcc gctgggccat     68400
     ggagccggcc tgatccccga gctgctgaaa gtttgcctcg gtcggcttcc ccgagctggc     68460
     aagcacaccg ctcacagcaa gccacgcctg cgaaggctcc tcctgcccgc ctgccggacg     68520
     cgtgacgtac ccaaatggca cggagaacgt ggccgtcgtg tcctccagtg caaagggaaa     68580
     ggcgagtttc gccattcggt actcttcgtg ccagtccagc tgcaggtggc catgaatggc     68640
     ggggctgtcc cggtagatcg agaggtcctg ccgggcggtg gagcggcccc agcgggtggt     68700
     gacccgcacc gtggcccgga ccgggccggt ttcgagcagt tcgatgtgcg gatcgccgaa     68760
     cacgccggcc agatggcgga agtagtcgcc tttcccccat gggttggtgg gatcctcgat     68820
     caccagcacc tgtgcagcgg cgccggcaag gagttcgcgg tccagcctct tgtcgcggag     68880
     gctgcgcagt gctcccgtgc gtgggtcaag ttccagacgc caccaggcgt tttcaagaac     68940
     acggtcagtg gcgctgagtg gacgggcgtc ggcgccaggc tggtgcggag gccggtccac     69000
     gatgcggtac acgcggtatc ccagtgcggg aacgtcggcg aggaacgcgg cccgcttccg     69060
     gggcggccca gcttcgccca tggcaaactg gtgcaccacc ggctcgttgc ggtcatccag     69120
     cacctgcatg tccaggacgt gccagtcgtt gagttcgacg tcgatcactt cctgccgcgg     69180
     ccagggattc gggttgaaca ccaccaccgg gacaccatcg cccatatcag ccacgacatt     69240
     gcctgcccct gtgcggacac ggcgcatggt ttcttccacc acgacgtcat cggtgcttcg     69300
     tgtgtcgatg tggcgggcaa tcacctgcac cgcctcgtga agcgtcctct tcgcggtgcc     69360
     gaccgcctcg ccctgctcat accgggcgtc atcgtacgcc cggggaatac tggtaccgca     69420
     gatgatgtcg tggaactggt tgaataggag gtgtttccag gaccggtcaa gtgccgcgcc     69480
     cgggtaggca cggccgtaac gggtcgcgat cgtcgaccat ttttcagcgg cgctcaaggt     69540
     gtgttcaccc aggcggttga accgtttgac gctgctgtgc gaggtgtagc acccgcggaa     69600
     cgtgtactgc agcggcgcat gaaattcagc ctggacgtcc cgctgggctg cgcgagcgaa     69660
     aaagccggca acagtcccca tctgcagggt aggccagtcg ggatcaacca tcagggcgcg     69720
     catgttcgcg atggctttct tggtggggcc tccaccgtgg ttgccgacac cgtacaccac     69780
     cagccattcc gggctgtccg ccggtcgcca gtcgatagac gcgttcaagg tgtcgacgac     69840
     gtcgcgagga ttggagttat aggactccac gcgcgcactc agcacgcgtg tgccgtctgg     69900
     accttgccac cagaagaggt tggacggcag gtcgacctca tgagggtggg ggcgccagaa     69960
     cacgaagtga tccagtccag acagtttgaa catctgcggc agggtgtggg ggtgcccgaa     70020
     cgtgtcaggc agaaaggcca cccgggatcg ttgaccgaag gtgtgctcga aataccgctg     70080
     tccgtggagc gcctggcggg ccagggactc gccggacggg atgttcacgt cgggctccac     70140
     ccactgtccc cccagcaatt cccactgccc gcggtcaact gctgcacgga tttcggccag     70200
     caggtcggga tccacgtcca tccatgcgta ctgcgctgca gacgtgtgcc caaacatcag     70260
     gtccgggttt tctttgagcc ggtctaggac gctccgaaag gtggccttga cggcttcgag     70320
     accttcctgg cggtcccaga gccagactgg gtcaaggtga gcgtggccaa ccagggtgaa     70380
     ggtcaggtct ttgctgcggg ggtcagccat ggttcatcca gtctacaaat tatttcaaac     70440
     ttttaaagaa tccgggcatc ggccaggtca agctctgcga tatggaccat ttcggttgcc     70500
     tatctctaca ttctgctctg gaatcacagc aggccctgac gcagcgcttt cactgccgcc     70560
     tgcgtccggt ccgacgcctg aagcttttcc aacaggtcct gaacgtgcaa cttcacgctg     70620
     ctcacgctga tctccaactg cattccaatt tcccggtttc ccagtccgtc ggcgatcaga     70680
     cgcagcacct ccagctcccg ggccgacagc tccaccggca cgcccggcgt gcgcatcgcg     70740
     cccagcacgt ggtgcgccac ctgtgggtcc aggaaagcgc tgccgaccgc agccgcccgg     70800
     atggccagca gcagcaggtc cggccgggca cttttcaggc agtaggcgtc tgccccggag     70860
     gccagggccg ccagaacctc cgcgcgcagg ttatgtgccg tgagcatcac cacccgcgtc     70920
     tgcggataat gcctgcgcac ttcacccgcc gtctgaatgc cgtccatgcc cggcagccca     70980
     atgtccacca cggccacatc cacggcggtg cgggagagca cctcgagggc ctcctcgcca     71040
     ctgcgcgctt cgcccaccac ccgcaggtcc ggttcgaagt tcaccgccac gcgtaagccg     71100
     tcccgggtaa acgcatgatc ttctaccagc aggacccgga tgggggaggc cgtcatgtcg     71160
     tttcaccctt cggtacggtc agcgtgaaca ccgtacgcgc ctgggcagtc ctgcggtacg     71220
     acacggtgcc gccgtgcgct tccgcgatgc gccgcgtgag gtacagcccc aggcccgtac     71280
     tgccgcccgc gccaccggtc cggaaccgct ggaacaaatt tcccgtccgc gaggagggca     71340
     cgcccgggcc ctcatcggtg accttgatca gagcgtcgtc caggtccagt ttcagttcga     71400
     tggtcacggt gccctcagac ggactgaact tcaccgcgtt gtcgaccagg ttctgcaccg     71460
     cccgccgcag gtcgtgtttc gagccgtaca cccggacact gtcaaggcgc aggtcaaacc     71520
     ccacccggcg ggcctgtgcc cgaggctgca cctggtccac gacgcccagg acgatgctgc     71580
     gcaggttgac ctcctgcgct tcttcctgcg cttcaccgcc ttcgtagcgg gcgaccgtga     71640
     ggagctgatc ggccaggctc agcagactgt cgttggcctc caggccattg tgcaaggtgc     71700
     ggcggtactc ttcaggcaac ggaccaaagg ctcccttgag ggcctgttcc atgtgcaggg     71760
     cgttggccat cagaggagtc ctcaggtcgt gggagaacgc gtagatcagg tcacggacca     71820
     cttcaccctg ctccgcaagg tgcgctcgct gggcagcgag gtcgtcaagc agggtcgtcc     71880
     gttccagaag tggccgcagg gtggtgatgg cctcgacgag ttgggccgcg ttcacctgtg     71940
     gctggtgcac acgaaccagc agatccccgt ctcgtcctgg caggaacgcc agcaagtctg     72000
     actcctgact ggcagtccac actgatccgt cgctcgacgg cggaacccgc acatcgagcg     72060
     gcagggtctg gttcaggtga tgccgggccc cggcaggaaa aatggcgtgc ggggttcgca     72120
     tggtcgtgcg gtccacccgg ccgatctcca cctcctgcgc tccggtaaat gctgcgaggc     72180
     cctccgctgc gcgcgccacg aacgcttcca gaccgtacgg accgctgaca aactccacca     72240
     gcgtccgcag gttccgttcc tgctcagcac ggcgcttttc cgcctccacc tgcacggcac     72300
     gctcggaagc cagccgggcc cgccaggtca gtccgcccac gagcagcgtt gctcccagac     72360
     tcactgcccg gttgaggaca tcgaatgtgg atgtgggcag gtcatgccag tgatggaagc     72420
     ctgctcccac attcgccacc acagcgaaca ccagcaggcc gagcgcaaac cgccacgaac     72480
     ttgccagcgc tgccagcgcg accggcgcgc tgagcagcgt cccgaccacc agtgcggggg     72540
     gcgtggccag gtcggccagg aacacaagtg cggccagtac gacagcgacc acttccagtc     72600
     cctggaaagg cctgcgggac gtcgagtgtg aggatggcag ggcgaagtgc atgcggtatg     72660
     gagcttactg cgcgcggacg agcgcgtctt ggccacctgg ccaggacaag ggcacccagc     72720
     gcggcttagc gtacggtcat gtcgaccgcc cggacttctg gctcatttaa acaatggttt     72780
     ctggaaattg agcagtccga gccagaaggg ttctacgaaa acgaatctgc cgtacgcgtg     72840
     cagcaccacc agcatccatg gtggaaagtg atgtgcctga ccggggtgga ttacttctcc     72900
     acgctggggt accagcctgg aatcgcggcg ctcgccgcag ggccgctggc accggtggcc     72960
     accctggtgc tggtcctggt gaccctgttc ggcgccctcc ccatgtaccg gcgggtcgcg     73020
     caggaaagcc cgcatgggga tggttcgatc agcatgctcg agcggctgct cagctactgg     73080
     ccgggcaagc tgctcgtgct gaccctgatc ggcttcgtcg cgaccggatt catcattacc     73140
     atcacgctgt cggcggcgga cgccaccgca catctggtcg agaacccgtt cctgaaagcg     73200
     cgtctggacg ggtaccaggt ccccttgacg ctggcgctca ttgggctgct cgggggggtc     73260
     ttcctgaaag gcttcaagga agccatcggg atcgccgttg ccattgtggt gctctacatc     73320
     ggtctgaacc tggtggtgat cgggaaggga actctggacg tgctggccca gcctgcagtg     73380
     ctgacaaact ggcaaaccgg actggcccag gcgtaccagt cgccgctggc catgaccggc     73440
     gcagcgctgc tcgtttttcc ccgccttgcc ctgggtctga gcggctttga gaccggcgtg     73500
     gtcgtgatgc cgctggtcca gggaggcccg ggggacgccc ggaagcgcct cgcggggcga     73560
     atccggaaca cgaaaaaact gctgacgact gctgcgttac tgatgagcgc gctgttgctc     73620
     ggttcggcca tggtcaccac cctgctgatc ccaccggacg ctttccgacc ggggggggaa     73680
     gcgagtggac gggccctggc gtacctggcc cacgagcggc tgggggacgc tttcggcagc     73740
     ctctatgacg cggccaccat cctgatcctg tggtttgcgg gtgcgtcggc gatggcgggc     73800
     ctgctgaaca tcgtgccgcg gtatctgccc cgatacggca tggcgcctga ctggtcgcgc     73860
     gcctcccggc cgctggtggt gatcttcgtt gctctcagtg ccctggtaac catcctgttc     73920
     cgggccaacg tcgagaccca agctggcgcc tatgccacag gtgtcctcgc gctgatgacc     73980
     agcgccgctg tcgccgtgtt cttgaccgaa gtccggcgca agcatgcccg gagcgcagcc     74040
     gtgttcgctg tcatcagtgc cctgttcatc tataccagcg tcgtcaccgt cgccgaccgc     74100
     ccagagggac tgtttatcgc cctgctgttt atcgctgcca tcctgaccgt gagcgtggcg     74160
     tcgcgcgtga gccggtccac agaacttcgt gttcaacacg tcacactgga tgggccggcc     74220
     cagcagctgc tccgagaaac ggtactgcgc ggcctgccgg tccgcttcat cgccaatcgc     74280
     ctgcacgccg gggattccac tgagtaccac ttgaaagaat tggaggttcg cctggacacg     74340
     cacctgcccc agggtgaacc agcactgttt cttgaggtcg ccatcacaga cgccagcaac     74400
     ttcacggata ccgtccaggt ccagggcgtc cggatcggcc ggcacgcagt tctgcgtgcc     74460
     ggtgggagca gtgtgcccaa caccattgct gccgtgctgc ttcatgtgcg ggacgttacc     74520
     ggcagccctc cacatgtgta ctttgagtgg agcgagacag gacctgccgc aaacgccttg     74580
     cgcttcctgc tggctggcga gggcgacatt cccccgctca cgcatgaggt actccgggtg     74640
     gctgaaccaa accagcagcg ccggccgatc gtgcacgtgg gcggctgagc accatgacca     74700
     gtccgaaccg tcgcctgctc ctgaaccgcc tgacgccacc acagctgatc gccttgtcgt     74760
     tcgccgtggc cattctggtg ggcaccctgc tgctgtattc ccctgtcacg cacgctcccg     74820
     ggaagaacgt gaccctcctt caggcgctat ttactgccac cagcgccacg tgtgtgaccg     74880
     gcctgaacgt cctcgacccg ggcagcacct tcaaccgtct tggcgaggtg atcctgatgg     74940
     tcctgattca ggttggtggg ctgggcatta tcaccttcgg aactctgttt gccagcctcc     75000
     ggggccagcg ggtaggcgtc caggaacggc tgcgcactgc ccagcaggcc aacctgaacg     75060
     agtttgggga tgttacccgg gtcatcaaag gcatcttcat ttacaccctg ctgactgaac     75120
     tgatcggcgc gctgctgctg atggtccact ttgtgccgct ggagggctgg gaccgtggca     75180
     tccatctttc cgtgttccat tcggtgagtg ccttcaacaa cgcgggattc gggttgtacc     75240
     cggataacat gatccgtttt gccgaagatc cgctggtgct gctgaccacc agcaccctgg     75300
     tcatcctggg gggtctgggg tacctggcag tgctgggcgt ggcgctttac ctgcgcgacc     75360
     cgcgccggaa ccgtctgagc ctgaacacca tcatcattct ggtcacttca gcgttcctga     75420
     ttgtgctggg caccgtggtc gtcaccgtcc tggagtggaa caaccccggc acgctcggtc     75480
     cactcagtac aggcggcaaa ctgctcagcg ggtactacca gggggtcgcc ccgcgtacgg     75540
     cgggcttcaa ttccgtcgac tacggggcca tgcacggggc aacgctcttc atcacgatgc     75600
     tgctgatgtt tgtggggggc agtcccgggt ccacggcggg aggcatcaag accaccacgt     75660
     tctacgtgct ggtgtcgagt atcgtgtctc acgccaaagg cgagcacgag aacgtctcgt     75720
     tccaccggcg gatcgaaacc gaggacctgc tgcgcgcctc ggtggtaaca gcgctcagcc     75780
     tggtggtggt gacgtccgga atgtttcttc tgctggccac caatccgaaa ctgccgttcg     75840
     tgaacgttgc cttcgaggcg ttctcggcgt tcgccacagt gggcctgagc atgaacacca     75900
     cgccgctgtt taatgcaccc gggcagctgg tgctgatcgg gctgatgttc ctgggccgca     75960
     tcgggccact gacgttcgcc atcgcgttcg cccggcagca gcggcaccgc gtccggtacc     76020
     ctgtcgataa atccatcgtt gttggctgag tcactacgtg gtggctgacg tgcggctccg     76080
     atgaaaagat cggatccacg cgctactgtc gcatctacat catcagaaac ctcagaagaa     76140
     tcggtgtgag gtcacgacag ccacaggccc gttcgaagga aatgaatgaa gaatcactcc     76200
     tccttcaccc atggaataac tgaaattgcg acaccttgat agaaggtcat gcagtagcgt     76260
     cagcctgccg gtatgtgtcc tgcggacctg cataaggcgt gtcggccaag attggctatg     76320
     agcttgaggc cggcaggctt ggccgctgtg cccagaagaa atgactgacg atcaatggca     76380
     gcgactcgcc tcactccttc ctgcacaagt cggcttggga aggacctcat cgcccggcgg     76440
     ctactggatc aggttgtccg cgtcgttcaa gcgggggtgc agccgcgccg gaagcgtcag     76500
     gcatgcgagg cacgccagca ccatcacccc ggcgaacaac gaggacgagt gactcagcag     76560
     cacgccgggc gcaagcggcg caacggtgcg ggccagcagc ccggacaggg acaccagcgc     76620
     gttgtaccgg cccagcaact ccccgggcgc caccacggca acgagcgggg tgaggctggg     76680
     aggcatcagc agctctccca gcccgaacag cagcatgccc agcaccagga ggggcaccac     76740
     cagcccagac gaagcggttc ccaggaacag aaccgccagc caagcagcga cccacaccag     76800
     gaacatcagt cgcagggcgc ttgtccgccg ccggccacgc agcgcacgcg tcaccgccac     76860
     ctgcccgaga acaatcacga aggcgttgca cgccacggca gccccaaaga cgcctgtcgg     76920
     gaccgcgcgc acatccattg cgacgagggc gatgccggtg ttgagctggc tgatcccgat     76980
     aaacacaaag gcgaacatca gggcgcacag cagcagcagg cgagggtcgc gcagcgcagt     77040
     acgccagccg ccacgcccac gcgcaccgga cccggagggt gagaacagcc gcggcagccg     77100
     cgaggcaagc cccccggcga gcagcagcag cagggcttgc agccagaaca gccgggcgaa     77160
     tgacgtgagg tcatccgcgt gtacgatcac gccaccgagc agcgcgccaa cgccgatgcc     77220
     ggcattcagt cctgtggcgc gcaatgagaa cgcgttcgaa tgcaggtggg caggcagcag     77280
     cagcgcgagc gcggacagca ccgctggccc caccactgcc tgccccgcaa agacgagcac     77340
     cgcgccgctc agcaccaggg gtagcgtcgt tgccacggcc atcgtcatgg cgccgagcag     77400
     cgccgctccc aggccaccca gcagggtggc gcgactgcca agtcggtccg tcaggctgcc     77460
     cgccaggggg gtggcgagca caccggccag agacaccagc gcaaccaaca tccctgcctg     77520
     cgccgcgctt tgttggtgca cgcgctgcca gtacagcatc aggaagggga acatgacgcc     77580
     ggtggccagc caggtcaagg tatcggccag cagcacagcc cacgctggcc cccgtatgga     77640
     cgacgccaca ggcggcatct ccttcacgcg tccaacttct tgccgccggc ggccggcgac     77700
     cggccgcaca gccacgacac catcgtgagg gcatggggac ggggcaggag tgacaccaac     77760
     ggggaccgaa ccaggcttgc catcatgaca gtctccacgt tcgccggcac caaaggccag     77820
     acctacatac agcctgacgc ctcgttatcc gtctgcggaa tcggcgagcg cgtcaccaag     77880
     ctcgaccacg ggttttccca ggccaggcag cctgttcgcc tccgaagaaa actcctcgaa     77940
     cacctgcttc agaaaccggg tgctcgtatg gccgcaggtg atgtagagca gctggcgcga     78000
     agagcccagg ctcgtgaccc ggtcaggaaa accagagtcc ttggagacga ccaccgctcc     78060
     ggcagcccgc gcggaagaca ccccgtctgc ggcatcccgg tatcccagat cactggcact     78120
     ggaggctccg gtaccaatgg tctgggtgag ccagcgagcg agttgcggcc gaagccgggc     78180
     gtccagccag tacgggccgg cagcatgtca ggcgctcaaa cacctcaacg tcctgctgga     78240
     tactgtgccg gaaaacgagt tgtgcctgat gctcagcccg tgcgaaaaag ctatttgcac     78300
     cggcaagttc gtggtcgtgc ggatttgcgg cacgtaccga ctcttcgggt gcttccagat     78360
     taacgacggt attcagtgtg tcggagccgc tgaccgcccg cgatgagttg tgcctcgcct     78420
     ttaacgccag cgagcatgac gtgcaggccg cagcgtacac caacggtggg gaccagtacc     78480
     tcgttcatcc gggtgcagcg ggcggcggga cgttcggctc aaacgtgcag cagagcttcc     78540
     agaagtctga cggtaaaact gccgttccgg gtcaggatgc cggaccccag ctccctgcgg     78600
     gtgctgaagc tgcgggatgt ccgtctggat aacctcgccg ttcgccctat gcacgcagga     78660
     gtcacggctg ctcccaccgt ttcagcctcg gcacccatca ccctgaacgg gaagtacacc     78720
     tccgcattca acaactgcaa agccgtggtg tccggcatag tgacctgcgc ggtgacgctc     78780
     acacccgtcc ggtaaggcca ccagccttca gactctggtc ggagcagaaa gtgcgacttc     78840
     ctcacgcact ccctgctttc ttgacgggcg gtgaggcggc atgttggacc ggacagaccc     78900
     ggtgcgttcg cctgctgacg tcgtttcgct tatgccgtgc caggcgagca tcgtccagaa     78960
     aggtcctgtg ctcagctgcc acccacggcc cggatgcggg tgccggtggc aggcgtgatg     79020
     gtgccgcgct gctggatata ctccagcacg acttgagcgt cgggttcccg gctaaccccc     79080
     tgcccgtcag cgaacatggt gtactcgtcg ccgccagcgt tggtgaagtc cgacagtgcc     79140
     agagtatagg tcgtggcgtc ccgcaggacc ggggctccgc tgtcgagggt gacactcacg     79200
     atgcgtgagc cgactggccg gctgacgtca taggtaaacg agaagccgga aatctgaagg     79260
     aagcgtccgc tggcaccggg aagcgcggag acgctgttct ccagcgcggc gtacagctgc     79320
     gagccggtga cggtgcgggt caccgccgtg ttgccgaacg gcagcacgct gtacacgtcc     79380
     cccgcgacaa tgtcataggg cggacccggc tggtacccgg gggccggccg gcgcagggat     79440
     ttgtcctggg gggtatagct tgaaggcagg gcgctgcgga tgctgccgcc gttctggatg     79500
     gcgagttgcg tgccataccg cgcacgtaag gcatccgtga tcaggttgcc cagggccact     79560
     tcacgtagac gttcgatgtt gctgccgcgc gcgaacactt cggtggccac gccaatcttg     79620
     cggtcgagct gctgggcgag ctgggtgcgg taggtcgaaa gcacctgctc gaccgccgga     79680
     tccggcgtga ccccggtggt gacgggctcg atgaaggtgt tgatgcgctc ggtgacctgc     79740
     ccggtggagc ggtctaccgt cacgttcact ttggagtagg ttgcgccctt gctgaggttt     79800
     tctatcacca gggcaccgtt gatggtggcg ctgaactgct cgttggtgtg gtcgccgaaa     79860
     atcacgtcga agccgttgac actcttggca aagtcgatca gcggaccggt gtgcgcctgc     79920
     gtcaccggat cgcggccagt tacaccgagg tgagcgatca ccacgaagac gcgtgctccc     79980
     tccgcctgag ccatcaagcg ggcctgcgtc gcggccgcca ccgggtccgt cacacggagg     80040
     gtgccgagcg cgccgggagc caccagcgtc ggggcttcag gattcgtgat gccgatgacg     80100
     gcgaccttca cgccgcccac cgtaaagatc tggtagcgct tcaccttggt caggttcgct     80160
     tcaaggtttt cgaggttcgc ggagacgtac tggaatttcg cccggtcaat caggggttgc     80220
     aggccctgaa ttccacggtc gaagttgtga ttcccgaacg tgtcggcatc gaaacccatc     80280
     acgttcattg cctcgatagc gggcacttcg ttgaagaagc tcgacagggg cggtgagcca     80340
     ccgtaggcgt caccaccggt gagggtcagc gtgttggggt ttgcggcgcg gtcctgcttg     80400
     aagtaagcgc tgagcgtagc ggcgcccccg acggtgcgtt gtgtggttcc gctgcctacc     80460
     gtcagcggat caagctgcgc gtgccagtca gagacgttca ggaactggat cgtgaccggg     80520
     tctggtggag cgacactcaa gcaggcggtg aggaggacgg tcagggcggt cagcgggaga     80580
     agccggatcg acatacaacc tcctgaaact ggtgggccgt cacctttcag gctgaactgc     80640
     ctgaagagat caccggaccc ttgtcgggca cgtattcgct cgcttgagcg tacgacacgc     80700
     cgctcacaat ggtgaccatg atcaagggtt tttcagttgg cctgagaggt tagcccaaat     80760
     tgcacaggcc agtggaccag cgtcaggtaa ctgaactgat gatggtaaga atgtatgccg     80820
     gcttgtatgc ctgtttctgc caagccgcga tctagggtgc gaccggcacc gggatgctgg     80880
     gtaacagtca agaggcagat tactcaccga ccgcttcacg tctgaccggg gggtcctttt     80940
     cccttgagcc tgctcagaat ctctcttaac ctcaagattc tgagcgcaat ccgtgtgata     81000
     cggattgcgc tcatttcgtg gcgcgagccc tcaggcacag cgcctgttat ctcacttgac     81060
     gaggccgatg gacttcaaga ccttccgggc acgcgtctgc tcggcggtga ggaaggtgtc     81120
     gaatttctcg ccactcaggt acatatctac ccatttcctc tgtcgcagcg tgtccttcca     81180
     ggctttactg gcatggagct tgtcaaaggt ggcaataagc tgcttccggc gctcggggct     81240
     gatgccagga gccgcgacga cgcctcgcca gttcaacatt tccacgttta gcccctgctc     81300
     gcggaacgtt ggcgcgatga tgccgggaat gcgccgtttg ctggaaatcc ccaacagacg     81360
     cagtttgcct gaattaatat gctcagccat ttcattgtag ccgttgacgc ccgcggccac     81420
     ctggttgccc agcagcgcag tgagtgactc gcctccaccg gagtaagcca catagttcat     81480
     attggcgggg tcgatgccag cagcttcagc cagcagtccg gtcagcatgt ggtccgtgcc     81540
     tcccgcactg ccaccagcga tggcaagtct ggggttggcc ttccaggcag cgacaaactg     81600
     cctgaggttc ttatagggac tggctgcagg gaccacgagc acctcatatt ccccggtcag     81660
     ccgtgcaata ggcgtgacgg tttccagcgt ggctttgctt ttatttgtct cgattgcgcc     81720
     gaccatgatc agccccatgg ccatcaggag gttgttgtca ccctgggcgt tgttgaactg     81780
     cgcgagacca atggtgccgc ccgcaccgga tacgttgaag acctgcacgc tttgggcaag     81840
     tttcgtgtcg tgaagggcag actgaatggc ccgagaggtc tgatcccatc cgccgccggg     81900
     gctggcaggc gccatgatcc ggagaccagt caggggctgt gcagaagcgg aaagggggag     81960
     aaggagaaga gcggcggcga gaagggaaaa tctggtcatg tgatgctcct atgaggcggc     82020
     cgggccgctc agttggttgg cggttggtgt aggggtagaa gatcaggacg tgagagcgag     82080
     gctggaggcc tgcacgtact gtgccgagct ttctccagcg agttttccga agacggcgcc     82140
     ggacatcagg ccggaacccc cgggatagtt ctggtagaag atgcctccga ccatttcacc     82200
     tgccgcgaac aggccaggga tagcctcctg atctgcattc agcacttctc cctgagggct     82260
     gacccgtacg ccgccgaagg cgaaggtgat gccgcacgta accgggaagg cgtagaaggg     82320
     accctgttca acagcaagcg cccagttgct tttgggaggt gtgattccca cggtgccctt     82380
     gccgtctttg acggttggat tgtagtctcc gtcctgcaca gcggcgttgt aggtgccgat     82440
     ggtttccaga aactgttttt gatcgacgtc aaggagcgag gcgagctctt ccagcgtgtc     82500
     cgcctggtag aaggtggctt cttccaggtt gtattcctta cgcagcatcg gccggacctg     82560
     cgagtcaaag atctggtacg cgacgtgccc aggctgcttc aggatttcgc gcccgtattt     82620
     cgcataggtg tagttacgga aatcagcgcc ttcatccaca aagcggagcc ctgatttgtt     82680
     gatcaggaga ccaagagggt aggaatgctt cttgtagatg tcgcccggct tgccgaagtc     82740
     tccaaccttg ggagcgcctg cgtcggtgcc gatggcgtgg cagcccgacc agtctccgta     82800
     gcgctgagct ccgacggcca gggccatgct gatgccgtca cctgtgttga actccgtgcc     82860
     tctgacgatg gcagcgtccc actcctggcc gatgtgctca gcgcgcagct cgcggctggc     82920
     ctcgaaactg ccacacgcca gaacgacgct gcctgcctgt aacgtgatct cctgctcccc     82980
     acgctgcacc agcacaccag tcacccggcc cttgtcggtc agaaggcgag tggctctgga     83040
     ctcgtaccac acctcaatgc ccagttcctc tgcccggacg ttgagtcgtt cgatcaggcc     83100
     gactcccttg ccgtcggttt tgacgggcaa cccaccccag aagtgatact ttccgtcttt     83160
     cagaaaagac tggttgtcat agatcaggtc aaacttcacg ccgtgatccc gcatccaccg     83220
     gatcgtgctg ggtgactgcg tgacgatctg tcgggcgagt tcaggatcac tctggttccc     83280
     agtcacccgc atcaggtcac ccagatagtc cgcttcggag taggacggca tgacgatctg     83340
     ctcagcttcc tcatcgctga tgcgaggaat cacgtcccgg atatcgttga ggtcgttgta     83400
     cgcaaaccgg atggccccat cggtgaagta cgagtttccg ccacgctttc catgtgggcc     83460
     gcgttcaagc accagaacgc gcataccacg ctcacgggcg gaaagcgcgg cgcacagggc     83520
     ggcgtttcca gcacctacca cgacggtgtc aaaagtgtgt tggtcagagg gtgaatcaga     83580
     gttgaggtgc atctgtgctc ctgaagagac cagtctcctg gccaaaataa tgggatgctg     83640
     gaagtatact tctgtataca aagaagtaca atagggacac ccggaggagt gtcggaagca     83700
     caaacactct cctggcagct aagatcaaac cagggacctt ttatggcatt gcctcctttt     83760
     cagatcgaca cctctatctc acttgcagca gggctctacg aagcgctgcg aggtgccatc     83820
     ttgcgaggag aattgaaagc gggtgaaaag cttacggaag tctctctggc cgagcatgtg     83880
     caaatcagcc gcacgcccgt acgtgaggcg ctccgtcacc tgcagcttga tggcctgctg     83940
     gaatcggccg ggcgcagtct gatcgtggct cccgtcaatc tcgacgccat gatggaaatg     84000
     tgcgtagtgc gtgaaaccct cgaaggcctt gcagcgcggc tcgcggcctc ttaccgtggt     84060
     gaagctgatt tgctggcgct tgctgacctg caggaaacga tgtgcgccgc ctctgctgtc     84120
     aatgatgttg cagctgtggt acgtgccaac cacagatttc atgccacgat ctggcatgca     84180
     tcccgcaacc gctatcttgc ccggcagctc caggacttgc gccaggccat tgaacgcctg     84240
     cagacaagta cgcttaactc ctcacaacgc cgggctgaag ctgaacagga gcatgaagag     84300
     atcctcgcgg cgctgcaagc aggagatatg gaatgggcag agcgcgcaac gcggcagcac     84360
     ttccggaacg ctgaattact cagattacgc ctgctccgcc tgaaggcaga cacgagcttc     84420
     tgaggtacgg atcggcgctt tgcgatgcat gtaggccctg gtcaagcagt gcatccaaga     84480
     aggccaggag cctggtgacc tcccccggga gcccgacgcc agttggctcg ccgaacggct     84540
     gcttgacccc tggcagggcg tgctcatgcg catgaacacc acgcgcttgc gggtctcgct     84600
     gcacaatgtc ctgacgttgt atttcgatca ctttctcaag ccttgaccca gcccgcacct     84660
     ggccgcacgc ctgacgtgtt ccgcacctgg cgcatgcgcg gcctcgatgt aacagttcac     84720
     gtcctgggtg tatggcggct ggatgcaggc ggctatcacc catgctggac gtccttcata     84780
     cctaccggtg ggaaattgaa tgatcgttct ctgctctgaa gtcacgcggg ctgaatctgg     84840
     gagccgcgca catgaccgca gtgggctgaa tctccaggct gttcgggttg ctctgcatcg     84900
     cacgggcctg gatggtatgg gtgagcaatg acacgcaggg aaccgcccca ccgactctcg     84960
     acaaacgggg tcgcacggcg cgaagccggg cgaggctcgg atggacccag ctcggtcagg     85020
     ccgcgcggtg ggctcaggac gccttctgga cgcaccttga gctccttcat actcctttgc     85080
     ccgcgccagc tacgcaacaa tctcgaagag tcagctgctg aggtccacgg cataaggtgt     85140
     cagaaaattc tagaaggacc ctcaagcaga agcatttttg cgctgcttcc gacatccagt     85200
     cagggtaggc cccgaacgga cgccagaggg attgcccgag gcttctgcgg tgcggcaggc     85260
     ataagcgtga tccagtgtgg cttcaggagc tccccgtgtt caggttgaac gctatgctgg     85320
     ccaaatgccc gaatcattcg gggcgtccac cgcgccctcc tccctggcgg agcgcctgca     85380
     ggacgtgacc gaagcgcttg ccgccgcgac cacgcccgct gccgtcttca agatcgtact     85440
     ccagcccgct ctggtggcgc tggacgccgt tgcgggagcg gttctgcttg tcagcgacgc     85500
     gggcgaccgc ctggagatcg ccgcgaccca gggccgcgag gacggagcgc agaccatctg     85560
     gcaggacggc ccgctggacg acacggtccc tgccggggac gccctgaagc agcacacgcc     85620
     gcttttcttc gaacatcaag gcgagctgac ggccgtctac cccgaccttg aggaacgcgc     85680
     cggaaccact gccccagtgg ccagcgctgt gctgccgatg ttccttgacg ggcagcccct     85740
     gggcgcgatc gtgctggact tcaaggaacc gcaccacttc acccctgcag aacggcgctt     85800
     tctgcgcacg ctggctgctc agtgcgccgt tgcgctgggc cgcgcccgcc tgtcgggcgc     85860
     cctgcaccgg caggtggaag cccgcacccg tgagctcgaa gaatcccgcg cccgcgcgga     85920
     ggtcctggcc actctcggcg acgccctcca gcgcgcccac tccccggaag acgtggcggt     85980
     tcaggccctg gagcccctcg gtcataccct cggagcaagc agtgtcatgg tcgtgcagtt     86040
     agagcgcggc cgcctgcatg tgccgaccat ctggggtgaa actcttcccg cgatggcggc     86100
     tctgcggacc agcggcaccc cgctgaagga ggccgccctg ctggacaggt gcgcccgcac     86160
     gaagaaggct gggtactacg cggattacga cgcggcgggg ggcgtgctca ccgggttggc     86220
     gacattggcc ttcgcggtgg agcccatcca cgcttccggg gatgatctgg ttggatttct     86280
     ttgcgcgtgg cgcctcccgc ggactgaacc ctggccagcg ggtgaccgcg acctgctgcg     86340
     ccgctctgcg ggcactctcg gtgtggccct tgaacgcgcg gtcaccaccc aggccctgca     86400
     ggagcgaacg gaggcgctcg acgccttcgt ggccttcact gaacgggtgg cgggcgagac     86460
     ggacgtccgt gctctgattg agcacgcggc tgacgtgctg cgggccaccc tgggcgacct     86520
     gggcgtgggg tattacgaac ctgaggatgg gcggtggaag gcgcgggcct ggtcaaacgg     86580
     cattccccgc gaatttgtgg cccggatgca ggcggggttc gagttcagca cgccccggtt     86640
     cgcgcacgcc atccgtgacc agcaaccaca ctttatgcag gaatggaatt cggccagcga     86700
     ggaccttcct ggggcgcgcc gcacgggggc catggccacc tacccgtact ttcagcacgg     86760
     ccggcctacg ggcgtgctct cggcaggatc aatgcagacg ttgggatggt cggagcgtga     86820
     gcaggcgatc atccgggcgg tgggccgcag tctgggtctg gcgatggagg gcacccgcag     86880
     cgcagccgag ctgcggcggg cgtcgcgctt caatgagctg gtgcttaaca gcctcgggga     86940
     gggcgtcacc acgatagacg cccagggccg ctccacgctg gcgaatccag cggccctgaa     87000
     gatgctggga tacacggccg aggacttcat ggggcgcccc cagcatgctc tgattcacca     87060
     ctcgtacccg gatgggtcgc cctttcccag agaagcctgc gaaatctatg ccgcctttgt     87120
     agacgggcag gtgcaccgcg cgaatgacga ggtgttctgg cgcaaggacg ggtcgtcctt     87180
     tccggtggag tacaccagca cgcccatcct gaacgagagc ggggagattg aaggctcggt     87240
     gctggtgttc cgggacgtca ccgaacgcca acgggccgag gccacgctgc ggcaggcgaa     87300
     cgatgaactc cgccggtcta acgcggagct cgagcagttc gcgtacgtcg cgtctcacga     87360
     tctgcaggag cccctgcgga cggtgaccag cttctcacag ctgctggcga agaagtacgc     87420
     cgggcagact gatgcgcggg gacagatgta cgtccggctg atcactgagg gcacccagcg     87480
     catgacgcag cttctgcagg atctgcttgc gttttcccgg gtggcaaaag gcgccgcgga     87540
     ccctgtgcgc gtgaacaccg gcgtgatcct cgcgcaggtc agccaggatc tcgctgcgca     87600
     gattcagcat acgggcgccc agctgcacat cggagaggtt ccggacgtcc tgggcgacgc     87660
     ttcccagttg cgccagctgt tccagaacct gatcggcaac gccctgaagt tcagtcaccc     87720
     ggagcggggg cccgtggtgt gggtgggcgc tgagtgcgat ggcggcctcg tgcgcttccg     87780
     cgtgcaggac aatggcgtcg gcatcgcgcc ggagtatttc gagcgcatct tcacgatctt     87840
     ccagcgcttg cacacccgcg agcagtacga ggggagcggc atcggcctgt ccatcgcccg     87900
     gaagatcgtg gaacggcatg gagggcggat atggctggag agcacgccgg ccctcggcac     87960
     gaccttttat ttcaccctgc cggcagtgga gggcggcgca tgaggtcggt gacgcgggtc     88020
     ctggtggtgg aggatcattt cccggacgcc gtgctgctgg aggaatggct ggagctggca     88080
     gaggttcagt gggaggtggt gcacgtggtg acttttgcgg aggccacctc gcgctggccg     88140
     gacggccgct tcgatgccct gttgctggac ctcgacattc cggatggctt tgggctggac     88200
     ctggtggaac gcggactggc gctggccggt gccgtacctg tggtggtgct aagtggacgg     88260
     gccgatgagg cggtggcggc tggggcagtg ggtctgggcg cgcgggccta cgtggtgaag     88320
     ggaccggcat ctgtgcacga actccgggcc gccctggagg ggcagcggga ttgatgtggt     88380
     tcaggcagcc acacatcggc gtgcgctcag gtgggttgga aacgccccga tggccccgac     88440
     tctctttggg cctgcagctg atgggcgtag gcgaggcagg cgcgaacatc aagttcgtcg     88500
     aggctgggcc ggagctcaaa aagctcttcc agggtgcggc agcgccgcgc gatcctgagc     88560
     acgtccggga cggccacgcc cttgccgcgg acccgcggtc gccgctcgct gccgcgcagt     88620
     tcgatgcgtg ccattagttc cagggttggc gtgaggtcca aatggatcag caggcgtccc     88680
     agcgtcaggg taagcggagg ggtgagcgtg ggtgccgatg tgatgcgggg ggttcgctcc     88740
     agggtgggca ggcgcgcccg gcggggagaa aaagcaaggg taacgtcgtt caaggaggac     88800
     ctttccagga agcgtgaagg ttggactgag gcttgatgcg gaagttagca cgtaaaaatg     88860
     ctgactgtcc ttgcgggagg gtccgtgcaa agtgcggcac tgtcgctcag gaacacctcg     88920
     gttccaggac acttatgttc cgtctgtgct gctaccctcg ccctgggcag ccggctgcgt     88980
     gcctgaagct gggaccggtg ggcggaggca cacggcgcat gggcctcact ccacaagacg     89040
     ctgcgctgac tgaaggactg tggcaattcg tgcgggaagc gtcttcatta cgcctggtcg     89100
     gagagattct gccgttgacc gtttctgccc tgtcagtgtt cctgccagcc taccagctca     89160
     cacagtccac gccagcgggt caggaacccc tgtacagggg cggaccgcag ccacacacag     89220
     tgttccggcc aaggaccaag gtccggcggt ctgtctggag gatgtcggct gctgcgccca     89280
     ggtcatgaac cacgaggctc agggtgtttc gcaggctcgg gtacgacaag gacacgaatt     89340
     ccttctgaac agtgccattc agcgggtggg cgtgtggcgt gcggcgcggc ggcccaggct     89400
     gcttttcagg cggcgggcca ccgcctgcac gcaggctcgg caggtcaatg ggcctgtcac     89460
     ctgaggcgcc tcggcgtaga cctgaggccc gcggccacag agagcctgac cgtcggaaag     89520
     ccgtacgaga tgggtggcgc cgccaggggc cagctggaaa gcgtgcggct cactcaggtg     89580
     gtggcgcgcg gcgatttcag cgcacgcctg gtcgaacggc agcgcggcca ggtcggtgtg     89640
     cgtaggcgtg gcacgggcgc gcagcgcagc ggaagagcgg ggtgcagcca tgctcaggag     89700
     agtagcgcgg ctctgaggcg gagggtggtg ggtcaagtga cgccttgccg aagcagtccg     89760
     ccatgcaggt gaataaccgg ccgggtaacc ctggggccat caccaggcga attcatcctc     89820
     cagcgcgtcg ctgccgtgga accgcgttca gttgtccgct gtgaggacaa tggactgtgc     89880
     catcaacaag gcgcccatcc atggtggcaa taaagttcac gtgtcatccg ctgcccctgt     89940
     cggggcgggg ccaacgattc gcctaccttg tagcgggagg accagagcgt gaccagcaca     90000
     ctcgccgtga caaggagcag gaaggctgag gagcgcagcc aggcgctgct tttgtagatc     90060
     gggagtttca acgggcgctc tctgaccttc ccggcaacga aaagctgggg aaggctatag     90120
     ccgcagctca tcagcgccgg aatcaggccc accagagtgt tagaggcgcc gagttggctg     90180
     gcaagcgggg caagtacgat acctgaattc aggcaggtgt caccaatgga cccgaaccag     90240
     ccgttgatga cgccaagacg gtaattgcgg ttccgcatat cctggagaaa agcgcgggag     90300
     gagcgcagcg cgcgggggag gtgaagcacc agtcaccgtc cttctgaatc caaggcagag     90360
     aggagtgcag gaaagctcca attattttag atttttaagc aaagacactg tacctgcttc     90420
     ccgagcactg cgaagcgcgt atcgcgctgc tgccagtcat gccacgctgc cttcgtgtga     90480
     ggtaatcgta agtcagggac ccgcacactg caggcacctc aatcagaaga acagttcccg     90540
     tgaagcgatt gctcaccaca gtcattctgc tcgccgtgac agcctccgcc caggagggac     90600
     ccgccgtcag ttcaagtctg cttcgcgtgc cgctctccac aggtgccgtc cgcgtggctg     90660
     acgctgcagc cgcccgtgag tttggacagg tcctcaatgg gcttgccagg aaccagaaca     90720
     gcggatgcca gaccagtgag tttctggtgt gggatgacgt ggaccgcgcc gaggagatca     90780
     gcacccacct cgccacccag ttcaacaccg cggcgaggtt aaccgttgtt gatgaaatcc     90840
     atccagaagg ccctgtttcg gtgcgggcta cgtcacttcc accctcattt cagcaggtcg     90900
     cccggcaggc agtcgagaac gcggtatatc gcgtcctggg tactgaagcg gatggcccgt     90960
     gccttgcctg ttttcagcgt actgaccgag cgaagtccca gtgctggagc acaagggtta     91020
     gaaaagtggt ccatccgact ctgattcacg cctggccagc cagaacgcca ggaggagcag     91080
     cagcccgctc aggatggcaa tcaccacgaa gaggccgtgt ggggaaacct cgaagattgc     91140
     ccctgccagg gccgccgccg ggatggcgca cagcaaggtc agggtctgaa ccgcggaata     91200
     caggtcggcc gtaccttctc tgggcagccg gctgaacagc gcggcgtcac ggtaggtctg     91260
     tgtcagaaac gtggcccccc ccagcaaccc gaccacggcc agcatgacgg ccacattgcc     91320
     cgcgggaacg aacagcagga gagccgcgcc cagcaacccc aggacgcgcg tgacgaccag     91380
     cgtgcggccc agcggcaacc tggagagctg agggaggccc acccagtaca gaagcacagt     91440
     cacgaaggca ccgacgaagg gaacgaaaga gagcgtctgg gcactgaact gtagagtttc     91500
     ttgcaggaac aggatctgaa acagactgag ctgctcaata aaaacagtca gcaggtaaaa     91560
     ggcagtcatg cccatcaggc cgggatgtcc ccgcatgcct gccaccatcg ccatggtgtg     91620
     acagatgctc tggccgactc ccagggcccg gtgctgcgcc atggctgcca caccgctttg     91680
     cgtttcctgg gtgatggcgt tgcgccacag gaacatgacg gtcatgccga cgccaccggc     91740
     aatgtagtag gcccgcatgg tcgcggtcac accgtgctgc gcgatgatca gacccacaag     91800
     cggagtcagc agaccacaga ccgtgacaat gaggttgatg atgccgaaca cccgggcccg     91860
     ctgccgctct tcgacgtcct cgatcagcag cagactccag gacagcgcca cgatccgtcc     91920
     gacagcactc agcgccgcag ccacagcgaa cgcggcgaag ctgttcgccg tggcccagac     91980
     gaacatggga atggtccacg agatcaggtc gccgatcagg gtcgtgcgtt tgcgtcccag     92040
     gcgattggtc accggcgcgg ccaccgcctg aaacaggaag gagagggcca gcgtgaccga     92100
     gccgagcagc ccgatctcgg tgctggagag gcccacgctc cgcatgtaga ggggcgcgta     92160
     atagatgacg acggtgccga aaatagccca cagtggctcc atcagtatcg cgttgcgggc     92220
     gttcctgggc aggcccgcga gggctctgag ctgcacgccc cgggacttgt attccagctc     92280
     gtggggactc atgcctggtc gctgttctcg caatcggtcg tttttgtaca ggaagctgcg     92340
     tgcctgagac ggttcactgt ggcagtggag ccgacaacca tctcggactc ccagctggtg     92400
     ggaagatttc cgagcgaccc atccgcactt tcagggttgt cggacagaaa agcgcggctg     92460
     ccgaaggaat accagtcgga cgcaggggga ggaggaactg ttggcatgta tctccaggat     92520
     catatgaagg aagctgaggg tgccgggcat tcaggctcag agcgggtata aaccaatggc     92580
     tggggcgctg tccatctttg caaggagcta aaaatggctg atggagagcc ccgccagaca     92640
     tggtgaaagg gaaacaggcc atcatggccc gtaggctcag cggcagtccg gtgaaaagca     92700
     gcggcaagga ttgggtatgc ttgcgaagcg ccgaacttcc tacatgcggc attgtggtct     92760
     tcggctgcac cgtgaccggg gacgccgtag cctcggcacg caccattgtt caattccccg     92820
     gacatgtttt cgagcgttgc accgtacgcc ttgcaggaca cgccgtttaa tacatgacgc     92880
     gtgggcagtc gagcggtttt caccggtgat cggtccccag gacccgatag tgcagttgtt     92940
     tgaggacaca ggactccatc ggcgcttcac cttccagggc gtgcatggtg catgcactta     93000
     gtaggacttt gtcacttccg atcaagacct gtgtgcgtgc cgaggcttgg aatgcgtacg     93060
     ctaagcaggt gggccaagag gaactgttta aaagactcag agcgggaggc gtgccagccc     93120
     cattgattcc caaactgccg gatgatcggg aaattgatgc gctagaggtt ctgttggaga     93180
     ctcgtcttcc accgtcgtac cgcgcctatt tactgactct ctccgatgtt ctggctggtg     93240
     cctactggcc gttggtaatt catcacgagt tgactggcgg acgactgctc gaccagacgc     93300
     gtgatctccg ggctattggc cttcctcaat ttcttgtgcc atttgagacg agtcaggatg     93360
     gagacgcctt ctgcttcgac acgcgctctg ctggaccaga gtatgcggtg gtgcggtggg     93420
     tgcacgatga cggctcattt gacacctacc gctggcctag cttcattgct tgggttcaag     93480
     acgagtggct ccccactgtg gaggatcaaa aatagaaata acatagtcct aacttcaata     93540
     gacaaagaat caagtgaaat aggagcactc atatgaaagt tcccttggat tccattccag     93600
     ttcatgtgct cctcaacttg atagaagcct gcatgggctg catcgtgggc gagcaccagg     93660
     caattgtcat ctcatacgat gaggttggtc cgcatgtgga acttgtcggg tacttatcat     93720
     cctcgacgga aactgctctt gagcagcatc aagagattgc agacgagctt gaagtccgat     93780
     tgaattattc cggcatcgct gtccgtagtc aggtagttat taatcatcaa ggtgtgttga     93840
     agttatcaga aagcgacagg gtctttttcc ttcgatacgg gttcgaaatc ctcaccttca     93900
     gtcccggaag tggtgtcgat cccacctgaa ccacctcacc gcaatgcgga catcgcccaa     93960
     accaaatttg ttccaacgcc cggctggtgg tacgtctgag ttccggtagg gttggaatct     94020
     cggcagcaac agaacattgt tgctgtcgaa gggtctgcaa aaacatcatg gtcagcagta     94080
     ccagcacgat gtggtgttca aggcctagga gtgaccgacc ctcgaagtgg tccaggccga     94140
     gttcttcctt gctttgcagg tgcagaacct cgcaggccca cctggctttg atgtcgcgaa     94200
     ccacctgagc catggatgta gatggtgcgt gattggtcac gtagtacttg atctcacctc     94260
     cccgccgttt ctctcccacc acccagactg cttcgcctgg aagatgcaac ccccgcttgt     94320
     tcggaaggcc atcggcaatc cggccacgga ccaccagcca gcgggaactc ttcgctcctt     94380
     tgaccgtatg ccagcggtac ggaggaatct catggagcac gtccttgaca ggacgtgcga     94440
     tttcgcttgg gatcgggtgt ttcccgggcc gtcctccagt cttctgtggc ggatcgcgca     94500
     gcgtcacgtc caagctgaag accttctgga tccccacaat gcccaccgcc caagtcaagc     94560
     cacgctggga cagcgcttgc cggaagtcct tgttgatgcc atagcccgca tcggccagga     94620
     ctacccgaaa cgtcacaccg gcgtccagcg cccggtcgag ctcttccatg gcaatttcac     94680
     ccttggatct gtagtgctgg cgtaccactg gtacgccagc accctgacat cgttccggat     94740
     tccctgccca cgacccgggc aggaagagcc gcatactcaa aggggcgaac agggagccat     94800
     ccgacagggt gagggtaacc agcgattggc agttggcgat cttgcccaac gctccgcagt     94860
     actggtatgc aacccctacg cttgcgtctc cgcttttggg caatgccgtg tcgtcaatga     94920
     tcaacacggc atttttaccc ccacaaagtc gttgagcctg ccgtttcagt cggatctcga     94980
     tctgctctgc gtcccaatgg ctgacgttca cgaagtggtg cagacgctgg tacggcatgc     95040
     cgacatgttc agcgattggt tgagtgctct tgcgctccag aggggccagc agtccgcgaa     95100
     catagcgggg caggcatacc cgctgtttgg cattgtccag ggtctccagg tagggggaga     95160
     gaaagcctcg gaaggcacgc tgccagttgt gtgggaccgt catgtctcca gcatcttcca     95220
     cctgggaaac cagcgcctac acgcattcca agagtgacaa agtcgtgtta gcaggtgtat     95280
     gacaaacgca ctggcgcttt catctgggtt tcgcttagta attgaaagcc ttcactgtca     95340
     atgtagaggg gcatgacgtc atgtcttaca tgagcttcat acgcggaacc tgtccgggtt     95400
     ttcgcagcct gctcatctaa gccgagcgga gaatgtggtt caagaacgat tgaagatatt     95460
     gggcgcttga tggcatgctt gtctacctat cgtcaagcgc tcagcttcaa tattgtttgc     95520
     gccattcacg aagctacgtc tttcatgaca cggtcgtagc ccataactgg acaattcgcc     95580
     cgtatttaaa atctctggca tcaagctagt cgtggttgaa tgtggccgtg caccccccgt     95640
     ctacagtaac gatggagcct gtcataaacg agctctcacc agacgcgagg aatatgacag     95700
     cccttgagat ttcatcagcg tgggcctgtc ggccgagagg ttggcgcgct gcattcgctt     95760
     cccggcggtc gtgcgctgcc tgtgcttcct caggcggaag gctggcacgg cgccctccca     95820
     tgtcggtgtc tacgtagcct gggcacacgg cattgacgcg cactccacgc tggccgtaat     95880
     caacggccag ctgccgcgtg aggttcacga ctccgccttt ggaagcgcag taggcaggtg     95940
     cattgggggc tccgatcaga ccgtaggtcg acgcaacatt cacgatgacg cccgaaccac     96000
     tttgcatgag gtgcggcaga gcgtaccggg cacagagaaa gggaccgcgc aggttcacgg     96060
     ccatgatgcg gtcccaggtt tcgaggtcga gctcatgggc gggtgcgttg tcaccgccaa     96120
     ttccagcatt gttgacaagg atgtcaagct gtccgaagcg gtgaatggcc gcctccatga     96180
     gatcgcgaac ttgaacatca ctggcgacgt cacacggaaa aaaagtggcc tcgccgttcg     96240
     ctgcggtgat ggcagccagg gtctgttctg cgccctcggg gtgcacgtca gctataacga     96300
     cctgtgcgcc ttcggcagcg gctgcgagag caatagcgcg accaattcca ctggatcctc     96360
     cagtgacgag cagaacacga tcagagaggc gtccgaccgc acggtcgtgc tcaggttttt     96420
     tcatgtcgcc tactgtacac ggcacaaagc aaatcaaaga tgcgcttggc ggatagactt     96480
     tctgttcatt gggtgttatg ctcatccata acaaccataa caaccataac actaattccg     96540
     cggtcagcat ccatggaggt gcccgaatga atcgattcat ccgaaccacg ctcgctttga     96600
     gtagcatgct cgcgttcact caagctctag gggtcacacg aggtggcgag cttgtctatg     96660
     gacgttatgc agactcgctg ttcctcgatc cggttctaaa cgacgccaat gtcgatatct     96720
     ggatcctcac caacctgtac gacacccttc ttcaacccac cgccgacggc aaaggtgtgc     96780
     agccgggcct cgcctccgcg tacactgttg cccccgatgg aaaaagcatg cggctcaccc     96840
     tgcgtcccgg cctgcggttt gccgatggca gcgctctgac tgcgcaggac gtcaagtggt     96900
     cgctcgaccg cgcccgtaag cccgacaacg gcgcgtggag tggctcgctg gcgtccatca     96960
     gtaacattgt tgccagtggc aacacggtca cactgaatct aaagcagccc gacccgacgc     97020
     ttccagcggc cctcgccacc ttcaacgccg ccatcatgcc gcagaaactg ttcaacgccg     97080
     cgcggggcag caccgaagcg gccaaagcca aagccttcgc cgagaaaccc atcgggtccg     97140
     gaccattcgt gctgagctcc tggaagaagg gatcgtcaat ggtcctgaag cgcaatccgt     97200
     actactggaa gaaaggtgca gacggcaaag ccctgccgta cctgaactcg atccgtttcg     97260
     aaatcattcc cgacgacaac acccgcatcc tcaaactgca ggcgggagag ctccacggag     97320
     cagagttcat cccgctcagc cgggtcgctg aactcaaggc caaccccaag atcaacatgc     97380
     agctgttccc ttccaccaag gtgaacactg ttctgatgaa caaccgtccg aagctcaagg     97440
     acggcaccgc gaaccccctg agtgatgtcc gggtccgtca ggccctgaac tacgctacca     97500
     acaaggaagc tctggttcag attgttacct tcggtaacgg caagccgatg cggtcattca     97560
     tgtccgcgac cacgccgctg ttcgcgccgc aggccagcta cacctacgac ctggcaaaag     97620
     ccaagcagct tctggccgac gctggatacc caaacggttt tgaggtggtc acccttgcca     97680
     caagcggcaa cgcagacgac ctcgcgctgc tcacgacgct gcagcagatg tggggcgcag     97740
     ccggcgtgcg gctgaagatc gagcagcttg acaacgctac caagaccgcc cgctaccggg     97800
     ctgccgactt ccagatgcgc actgccgcct ggacgaacga catcaacgac cccagtcaga     97860
     tcaccagtta cttcgctatc tacgacaaca tccagtcgct gtacaccggc tacaagagcg     97920
     ccgagattga ccgcctcttt gcgcagagcc agcaggaaac caaccctgcg cgccgcgcca     97980
     gtcagtacaa ccagattcag ggcatctaca tgaaagcggc gcccatcgtg ttcctgtatg     98040
     agacgccgta ccctgttgcc ttgtccaaga acgtcaaggg cttcgtgcag atccccctgg     98100
     gcaacaacat cttcgctgca acgtccttag agaagtaaag cacctgacgg ggccgcgcca     98160
     ctttgaccgg tgggcgtggc cccgtcagtt tctggaggaa agtcatgcgc gccacgtatg     98220
     tgatcaagcg gctcctgcag atcattccca cgttcatcgc ggttctgatc ctggtgtttc     98280
     tgctcgtgcg gctgctgccc ggcgacccgg caagcgccat tctcggggac cgtgctacac     98340
     cggaaatcgt ggagcgcaca cggcgcgaac tcgggctcga caagccgctg ccggtgcaat     98400
     tcggcatttt cgtgcagaac ctgcttcgtg gtgatcttgg agaaagcagc agcctgaagg     98460
     tgccggtctt ccggttgatc gtagaacgcc tgcccgtcac gctgttcctt tcggcttacg     98520
     ccgcactcat cgctgtgctt ctcgctgtgc cgctcgcggt gctggcggcc gtgcgccgtg     98580
     acacctgggt cgacagcctt atccgcggtg tcttccaggt ggcgctatca ctgccggtgt     98640
     tctacgtggc gctgcagctg ctcacgctgc tcggggcgaa actcgggtgg ttccccatcg     98700
     ggggatacgg tgacagcctc aaggaccacc tgtaccacct gtttcttccg gccctcacgc     98760
     ttggctttaa cctcgcggcc attctcgtgc gcaccctgcg caactccatt ctggaagtcc     98820
     tgactgcgga atacgttgaa tttgcccgtt ccaaaggtct gcagtcccgg gtggtgatgc     98880
     tgcggcatgt gctgcgcaat gcgttgattt ccaccgtcac gctgctcgga ttaaacatcg     98940
     gtgccctgat cggaggcgcg gtcatcacgg agtcggtttt cgccatcccc ggtgtgggcc     99000
     gcctgatgat cgattccatc ttcggacgcg actacccggt gattcagggc ctcacgctgg     99060
     tgttcgcggt gctggtgtcg ctggtgttcc tgatgactga cctcattcat gcccgccttg     99120
     acccacgcgt ggagcacgca tgaattcgct gctcgcttac gccagacgga ggacgccgtg     99180
     accaccctta ccccagcgac ccctgctgcg gccgcaccac gccggacacg cagacgtcca     99240
     aaacccacgc tggtgatggg tctgctctta ctgctgccca tcctggccgc gacgttcgcg     99300
     ccgggcctca tcgcgcccta cagtcccacg gagttcgact actcggccat tcttaaacct     99360
     cccagcgcaa gccatctgtt cggaacggat aatttcggcc gggatgtgtt cagccgggtg     99420
     gtgtacggca cccgcatcga tatgcagatc gcgctgctga ctacgctttt tcctttcgtg     99480
     ttcggcagtc tgctgggcgc gttcactgga ttcatcggcc gttggccgga catgctggtc     99540
     ggccgcattg cggatctcgt ggtggtgttt ccgttcctgg ttctggttat cgcgatcgtg     99600
     gccgtccttg gaccaggcct gaccaacatg tacatcgccg tgagtgcggt cggttgggtc     99660
     gcgtactggc gcctcgtgcg cggagaggtg ctggcgcaaa aggaagcaga gtacgcccag     99720
     gccgcgcgcg ttctgggttt cagcccctcg cgggtgctgc tcaggcacat ccttccgaat     99780
     gcggtaacgc cagccatcgt ctacctcatg accgacatga gtctgggtat tctgctgggc     99840
     gcttcgcttg ggtacctcgg actcggcgcg cagccaccca cgcccgaatg gggtgtgatg     99900
     gtggcggacg gcaaaaactt catggtcacc gcgtggtgga tttccggctt tcccggcctt     99960
     gccctcaccc tggctggcgt cacgttcagt ctgatcggcg acggcctcgc cgacgccctg    100020
     aggccccgct cgtgaccggt tctccgtctc cggtcctgag tgtccggaac ctgaacgttc    100080
     atattccaac cccgcggggt gaactgcacg cggtgcgcgg tgtcgacttc gatctgcagc    100140
     cgggcgaggt gctcggcctg gtcggcgaga gcggcagcgg caagagcgtc actctgcggg    100200
     ccctgctgca gctgcaccgc aagcccatcc gggtcacggg tgctgttcaa tacgaccggc    100260
     aggatttaat cgggctgtct gaaagccgat tacgaaccat acggggtgca cagataggca    100320
     tgatctttca ggagccgatg accgccctga atccagtgct gaccattggg gagcagatcc    100380
     gcgagaacct gcacgagcac cggggtctgc gggggcgtcc agccgaggac cgcgccgcag    100440
     aactccttga cctggtgggc attcccagcg cccgtacccg cctcaaggac tacccgcacc    100500
     agttctccgg aggtatgcgt caacgcgcca tgatcgccat tgccctcgcg gccgagccgc    100560
     gcgtgctgct ggctgacgag ccgaccaccg cgctggatgt gaccatccag gatcagattc    100620
     tccggctgct cctgcgcctg cgtaagcagc tcggcatgag catcattctg gtgacacacg    100680
     acctgggtgt cgtggcacag acctgtgacc gggtcgccgt gatgtacgcc ggacgcttgg    100740
     tggaaaccgc aggcgtaacc gacctgttcc ggcagccgag gcatgcctac accctcggtc    100800
     tgatgcgcag cctgcccgat atcggtgcgc atcgccgtcc tttgcagcct attccgggtt    100860
     cgccgcctga cctgcgggac atcccgcagg catgcgcgtt cagtccgcgg tgcgcataca    100920
     gcacccaggc ctgcctgggc gcggaacctc cgcttgtgcc tatcgatgac ggacgggcaa    100980
     gcgcctgcgt tcatcacgca gaactgcctg gtgtggctga ggtgaccgca tgacacacga    101040
     accgctgaat tcggagcctc tgctgaacgt cgaaggcctc accaaaacct tccctgtgtg    101100
     tcagggcctg ttggagcgct ggcagggcaa acccgccaag gccgtccgcg cgctgaccga    101160
     cgtgaacctg agcgtacagc ggggcgagac ccttggcctc gtgggggaaa gcggctgtgg    101220
     caaatccacg ctcgcccgct gcctggtgcg gctgcatcag gcggacaagg gaagcgtacg    101280
     gtacgcggga caggaggtgc tcctgttgca gggtgacgcg ctgcggcagt atcaccgccg    101340
     cgtgcagatg atcttccagg accccttctc ctcactcaat ccccgcatga cggtcggaca    101400
     ggccctgcgg gaagtgctta ccgtgcatca gttgcggcct aaggcgcagc acaacgagcg    101460
     ggtacatgaa ctgttgaacc tggtggggct gcctgccgag gctgcaggcc gtcttcctca    101520
     cgaattcagt ggagggcagc gtcagcgtat cggcattgcc cgcgcgctgg cactcgaacc    101580
     agaatgcatc gttgcggacg aacttgtcag tgcccttgac gtgagcgttc aggctcaggt    101640
     ggtgaacctg ctgctggaac tgcaggagaa gcttcacctg acggtgttat tcgtcgcgca    101700
     cgacctgcgc ctcgttcgcc atctctcgca ccgggtggcg gtcatgtacc tcggacgggt    101760
     cgtggaaata gccgccacgc aggatctgtt cgagcagcct gcccatcctt acacacaggc    101820
     tctgctggcg gccgcgccac ttcttgagcc tggccagcgc gcggaagttc ccgccctgac    101880
     cggcgagttg cccagcccac tcaacgtccc cagtggctgt ccgttccgca cgcgatgccc    101940
     gcatgccttc gaccgctgcg tcaccgagcg gcctgaactc tcggagatcc gtcctctgca    102000
     gcaggtcgcg tgtcacctgt acgatccggt ggaccaggaa gtccgcctcc cggttggggt    102060
     gggctgatgc ctcaggaggg agaagcggac acctcgccct tcgtggttga ccggacactc    102120
     agcgtgcctc tcagcgtgca gttgcgtggc cagatcgaat acggcatcgc ctgcggagag    102180
     ctgccgccgg gcgcacggct ccccagcgtc cgcgacctcg tggcgcaaac aggtgtcgca    102240
     cacgtcacgg tcgcgcacgt atacagggat ctggctgcac gggggctgat cgttactgtt    102300
     gctggccggg gcacgttcgt ggcggatccc agttcttcgg gtcccatgca ggatgtcgct    102360
     gcattacgtg ggttgttgaa cgatgtgctg ttccaggctg aacgggacgg cattgaaccg    102420
     gagcgggtcg ttgcgctgtt gcaagccatg atcgcgcgcg gacacacggc gcgcgatgta    102480
     ggagtgcgga ttgtgctcgt cggtgtgttg gatgtcgcca cccgggctta cgctcgggaa    102540
     ctgcaggctc tccttcgccc ggaagaccgt gtgaaagctt gtacgttcat ccaactcgcc    102600
     cagcctgccc tcattcagga ggtgcggagt gcggacatcg ttcttacctt gggccaccgg    102660
     cttgccgagg cgcgagcact gctaccgggc ctggacatcc tcccgatgcg cgttaccgtg    102720
     tcccatgaga cgcgggagca cctcgctgcc ctcgcgccgg acacgcgtct ggcactgatt    102780
     gctaccttcg atgactttct cccgacattc ctgaccggcg tgcaccggta cgcgccgcag    102840
     gttctggacg tccgtgcggc tcacctcgca gagcagaatc tcccggaact gctcgcgtgg    102900
     tgtgacgcag ccgtgtatgc cagcggcgca gacggaatcg tcacagccct caaccctggc    102960
     acgttcgcct tcgagtaccg acatgccgtc cacaggcctg atgcggagcg gacactttta    103020
     ccggtcattg ctcagcaccg cgccctggtg cgcgaaagga aacatcatga aaattgaagc    103080
     gatgaactgg atgcaggtcg aggcttacct cagggaagat gaccgttgcg tcctgccgct    103140
     cgggagcacc gaacaacacg ggtttatgag cctggccgtg gacaacatcc tgccggagcg    103200
     acttgcacaa gaggtcgctg cgccgctcgg tgtgccggtg tttcccaccc tcaattacgg    103260
     cattacaccc tacttccgtg cttaccccgg cagcgtgaca ctgcgtgttc agacgtacct    103320
     gagcgtcgtc cgtgatgtcc tcgacagcct gtatgagcag ggtttccgcc gcattctgat    103380
     cgtcaacggc cacggaggaa attcgcccgc tcagggcttc tcaggcgaat ggtcagcgga    103440
     ccatcccggg acgcaggtgc tgtttcacaa ctggtggaac gcacccagga cctggcagga    103500
     agtgcagcgg atcgacccgg tcgcgtcaca cgcctcctgg atggaaaatt tcccctggac    103560
     ccgcctgccc ggcgtgaccc tgcctgagat tcaaaaaccg atggccgatc tggaccggct    103620
     gaggctcctg tcgcccgctc aactacgcca gacccttggc gacggcaatt acggcgggct    103680
     gtatcagcgc agtgacgagg acatgctggc gttgtgggcg gtggcggtcc aggaaacatc    103740
     aggcctgctg cagaacgggt gggttccggc cagcaggtcg gagcagcaga catgaagctg    103800
     ctgatatggg gagcaggcgc cataggagga acgatcggtg cttacctcgt ccgggccggg    103860
     catgacgtca ctttcgtgga ctgcgccgcg gatcacgtaa agagtatccg cgagggcggc    103920
     ctgcacatcg aggggcccat cgaatcgttt acggtgcacg ccgcggcctt cacgcccggc    103980
     gaggtcacag gccagtggga ccatgtgctg ctgtgcacga aggcgcagga caccgcgagt    104040
     gccgcagggc agctcgctga ccacgtgacg cccgccgggt gcgtcgtgtc ggtccagaat    104100
     gggttgaacc cgcttgtgct gaacgccacc ttcggacagg accgggtgct ggggagcttc    104160
     gtcaatttcg gagcggatta cctcagcccg ggcgtggtgc attacgccgg gcggggcgtg    104220
     gtcgtgatcg gcgagcagga cgggcagctt tcggagcgtg cgcgggccct tcacgcggcc    104280
     ctgcgggatt tcgacagtaa cgccgtgctc agcgcgaaca tgttcgggta tctgtggagc    104340
     aaactcgggt acggtgcgtt gctgttcgcc acagccgtca cgaacgatgg catcgccgac    104400
     gccctggcgc gaccggagga ccggacgctg tatatcgccc tgggacgcga agtgatgcgc    104460
     gtcgctctgg cccaccagat cactccggaa gcctttaatg gtttcaatcc tgccgccttt    104520
     ctccctggcg ccagcgatga catggcccag gccagcatgg atgagatggt ggccttcaac    104580
     cgccggagcg ccaagacaca cagcggcatc tggcgtgacc tcgcggtccg caaacgccgc    104640
     acggaagtgg acgctcaact gggctgggtg gtgcatttcg gtcaggagca cggtcttcca    104700
     acccccatca cggcccgcct cgtcgacttg attcatgaac tcgaaagcgg tcagcgagag    104760
     ctgagccgtg agaacctcgc ggagcttcac gcggtgatcc cggccgtcac cccggcgaca    104820
     tgacagccgt gatagacggc ctgcgggccc tgctgccttc cggtgacctg acatgtgtcg    104880
     tgagcgacgc cctggaccgt ggctgggccc tcagcggcgc cttccgcccc gtctggtccg    104940
     gtgcctgctg cgccggggaa gcggtcaccg tacgcacgtt cggaacggat ctcagcgccg    105000
     tgttcgacgc catctctgtc gccgaaccag ggagtgtcct ggtgatcgac tcgcatggca    105060
     tcacaggcgc cgccttctgg ggggagcgca cgacccgcgc cgcactcgcc cgccgcctcg    105120
     ctggagccgt gatagacggg gggtgccggg acgtgacggc tgtacgtcag ctgggctttc    105180
     cagtattcag tacggccatc acgcccaacg cagggttgcc gggaggacgc ggcgccgtca    105240
     acgttcccat tcaggctgga ggcattcccg tgtcaccagg agatgtcgtc gtggctgacg    105300
     agaacggagt tgtgatcgtg ccgcagcatc tcgcacccgg cacactcgag cgcgtgcggg    105360
     ttctgctcgc tgcggagcag caggtctttg ctcaggctga ccggggcatg gctgtgccac    105420
     cggaaagcac agaaaaaggg atggtttaag gtgaacgaat tccagcaaca gtctgccgaa    105480
     atcaatgacc tgctctgcat cctcaacctg ctgacctggg acacacgcac ccagatgccg    105540
     cccggcggca gccaatccag ggcgcagcag accgcgacgt taagcgggct cgcgcagcag    105600
     cggcttcttg atccagcgtt tgagcatgca gcgcgggcgg cactcagcgc cgcagagccc    105660
     gcgagcgtcc cagctcgtgc ggcccagcag gccatcagcg ccgtccgcgc gctgaaacgg    105720
     gtgccggtcg agctgacccg cgacctcgcc ttgaccaaga gtgccgctca ggacgcctgg    105780
     gcggacgcca gggcccacag cgatttcagc cggttcgcgc cgcacctgac gcgcatggtg    105840
     gacctccagc ggcgactggc ggatgcgctc gggtacgacg ctcatcctta cgacgcactg    105900
     ctcaacctgt acgagccagg actcacggcg gccacgcttc aacccctctt ctcgcagctt    105960
     cgcacgcatc acctgtcact gctgcgcgaa gtccaggcac agccccagcc ccgcctggac    106020
     tttctggagc gcgactacga cgtcgcggcg cagcagatcc tcgcgctgga actcgcgcag    106080
     gccatcgggt acgacctgac gcgtggccgg ctcgatgcgt ccgcgcatcc tttcgagatc    106140
     agctttaccc gggaggacgt gcgcatcacg acccgctatc atccgaattt cctgcccggc    106200
     gcgctgttcg gagtgctgca cgaggcggga cacgcgatgt acgagcaggg cgtctcttcc    106260
     gagctgagcc gcagtgtcct cgcgtcggac ctgctggggc tgtacgccgt gggcggcgcg    106320
     agctacggca cgcacgaaag tcagtcgcgg ttatgggaaa accgggtggg ccggtcccgc    106380
     gcgttctggg accagcacta cccgcgggcc caggcgctgt tctcctcgca actcgcggac    106440
     gtcacggtgg ttgagtttca ccgcgccgtg aaccgggtgc agcccagcct gattcgcgtg    106500
     gaagccgacg aactgaccta cgacctgcac atcatgcttc gggtagatat cgagtcggcg    106560
     cttatcgccg gggacctcaa ggtccaggac ctcccggaga tgtggaatgc acgcatcgag    106620
     tcggacctgg gcctgaaggt gcctgatgac gctcggggcg tcctgcagga cattcactgg    106680
     tcagcgggcc tgtttggctc cttcccgaca tacacagtgg gcaacattat ggcagcccag    106740
     ttttacgagg cggctcacgc agcgcttccc gaccttgagg cgtctctcgc caggggagag    106800
     tacggcccgc tccgcatctg gctgaccgag caggtgtacc agcacggccg gaccttcacc    106860
     ccgcacgaac ttctcgaacg cacaacgggt cgcggcctgg acgcagcgcc ctacctgacc    106920
     tacctgagcg gcaaataccg tgacctgtac ggcgttacgg aaaaggagac ggcatgacat    106980
     tacggtctga tggtctggca ggaaaggttg cagtcgtgac gggcgcaagc agcggcatcg    107040
     gtgcggcgac agcacttgca ctcgcggcgc agggcgcgag tgtggtgctg gtcgcgcggc    107100
     gcgaggaccg ccttcaggac ctggcgcggc aggtgcagag ctccggtggc cacgctgagg    107160
     tggttgtcgc ggatctcgcc gatgaagctc aggcacggct cacggtggag cgcgccgtga    107220
     gcgcattcgg gcgggtggac attctcgtga acaacgccgg actgatgctg ctgggaccgg    107280
     tcaccggcgc tgacacgacc gactggcgcc gcatgatcga cgtgaacctg ctggggctga    107340
     tgtacaccac ccacgcggcc cttccacaca tgcggaccca gggcggcggg catatcgtca    107400
     acatctcctc ggtctccggg cgcggcgcaa gcccgacttc tgccgggtac agcgcctcca    107460
     aatggggcgt cggtggcttc agcgagggcc tgcggcagga agtccggctg gaccgcatcc    107520
     gcgtgacggt gatcgagccg ggcgtcgtgg cgaccgaact gaccgatcac atcactcacc    107580
     aggacaccaa ggtcgcttac gagggccgca ttcagaccat gattcccctg gaagccgagg    107640
     acattgccgc ggctgtcgtg tatgccgtga cgcaaccgga gcgggtcaac gtcaacgaaa    107700
     tcctgatccg cccactcgac cagggttgat gaggcgcgcc catgtttgaa cgaggagatc    107760
     cgcacaagga cggccgtgtc agttgcccgg accgtcacgg cggcacctga tgtgcccgtt    107820
     caaggtggcg cgagggcgca ccctcgctga gggcgggaaa gtcaccgtga agagggccgt    107880
     gagtccattc ccggccggag atttcatcac gtccgtcaac gtcaggctgg ggtgggacac    107940
     gtgcttgact gatctggacc tgcacccggg gcctgttggc agaccagcgc ggcagagcgt    108000
     agcggatgcg taactccgag atcctcttcg cgtccattcc gcaggtggca gcctgctacc    108060
     ggagcggttc cctgtctccc gtcgaggtga ctcgcgcgtg tctggcacgc atcgaggaac    108120
     tcgacccagc gctgaacgcg ttcatttccg ttacagcgga gctggccctt gctcaggcgg    108180
     tgcaagctga aacagaactg cgcagtggaa ccgacagggg accgctgcac ggcattcctg    108240
     tcgcgctcaa ggacctcacg gacaccgcag gagtccgcac cacctgcggc tcccgccttc    108300
     ttgcggatca tgttcctggc caggacgcgg tcgtcacggt gcggctccgg gaagccggcg    108360
     cggtcctgct cggtaaaacg aacctgctgg agttcgcgta cggcagcgtg cacccggatt    108420
     acggccagac gaacaatccc tgggacgtga cccgcacgtc cggcggcagc agtggcggct    108480
     cggccgcggc tgtcgcggct ggcctgtgct tcgcggcatt cggaacagac acaggcggat    108540
     ctatccgcat tcccgcggcc tactgcggcg taaccgggct caaacccacc tatggactgg    108600
     tgcccctcga tggtgttttt cctctgtcct ggtcgctgga tcacggcggt ccgatcgcgc    108660
     gcagcagcgg tgacgccgcc ctgatgcttg ccgccctgac cggaggtccg cacgacgctg    108720
     cgccacgtga cctgcagggc gtccggctgg gagtgctggc agaacacgcc cggggccccg    108780
     acatgcagca gggagtggtg gaagtcttcg accaggcgtg tgacgccctg cgtagggccg    108840
     gagcagttct ggttgaagtg cacattccgc agctcgaccg tatggatacc gcgatgatgc    108900
     atgtgctgct tcccgaagcg agtgccgtac atgcggcgtg gttgcagcag tctcccgggg    108960
     cgtacgcgcc ggacacccgc atgcatctcg aacagggatt cgcggtcagt ggggtagagc    109020
     atgtgcgcgc acagcagtac cgccgcaaac tcgcactcga cttcctcgcg gctctcactg    109080
     acgtcgacgc gatcctctca ccaaccgtgg cgtgggtcgc gccgcacgag gaccccgtcg    109140
     tctcggacaa cgaaggttcc accgaagcgc ggcgcaccgc cccagccaac ctcacaggct    109200
     tcccagcact gagcctcaac gcaggcttct ctgagggtct gccggtcggt ctgcagatca    109260
     cgacccggcc cggtgccgac gccctggccc tctcgcttgg catgagcctc gaagcgctcc    109320
     tggatggcaa ccggatcccg cccctcgggg gcacaccaac gaccgaaagg agaaccccat    109380
     gaattcaccc tgcacctccg cccggccctc gatcttttgt gtgatggtac gcccatgatc    109440
     gtccgtttcg acggccagac cgtcatcgtg acgggcgccg ctcacggctt cggacgggcg    109500
     atcagtctgg cgttcgccac acgcggcgcc aacgtctggg cctgtgacgt gaacgaagct    109560
     gggctgcgcg aaacggagac cctctcagct gaacaaggca ctccattgca ggttcgctcg    109620
     gtcgatgtcg cagaccggga ggcggtgcgc gccctggtac tcgaagcgtc aggaggagag    109680
     cgggtcgatg tcctcgtgaa caacgcaggc ggcgtcctcg gtcaggtcgg ccgccccatt    109740
     gaagagatca gccaggacga ctggcacgcg atcttccggg tgaacctcga cggtgcgttt    109800
     tacttcagtc aggcggtcgc gccactgatg aaggcccggg gcgccgggcg catcatcaac    109860
     atcagcagcg gcgccgggct cggcgtgagt ctcacaggca ttcaggctta cgccagcgcg    109920
     aaagctgcgc agatcgggct gacccggcag ctggcgcacg aactcggcac gtggggcatc    109980
     accgtgaaca acgtcgcgcc gggcttcgtg ttgagcaacc ccaccacgga acggcagtgg    110040
     cagagctacg gcgaagacgg gcaacgccgc ttgatcgaca acattgccct gaaacgcctc    110100
     ggcagcccgg atgacatcgc gcacgccgtc ctgttcttcg cgtccgagta cgccggctgg    110160
     gtcaccgggc agatcctcag cgtggacgga ggaaaatgat ggacgacgtc ctgacctact    110220
     tagaagagca ttatgagcgc cacctggaag acctgcggac gttcgtccgt attccaagcg    110280
     tcagcacgga ggggcagcat gcgcccgatg tgcgccgcgc tgcggaatgg gtggccgcgc    110340
     gcctcagctc cgccggcctc acagacgccc gggtgaccga cacgccaggc cacccggtgg    110400
     tgacggcctc atggacaaat catcccggtg cgccgaccat cctcgtttat ggccactacg    110460
     atgtgcagcc gcccgatccg ctcgaacggt gggacagccc cccattcgaa gctaccgagc    110520
     gggacgggaa catgtacgcc cgcggtgtgt cggacgacaa ggctcccatg ctgattccga    110580
     tccgtgtgac tgaggcgttt ctgcaggcgc gcggggcact cccgatcaac gtcaagttcc    110640
     tgttcgaggg cgaggaggaa atcggcagcc cgaacctcgg ggcgttcgtg cgcgaccacg    110700
     cgcagcagct tcaggcggac ttcgtcctgt cggccgacgg gggtatgtgg cgcgcggacg    110760
     tcccgaccct gaccgtaagc gcgcgcgggc tggtcgcgtt ggagttcacc gtgcgtggcc    110820
     cggggaagga tctgcattcg ggacggcatg gcggcagcct ccacaacccg ctgcatgcga    110880
     tctcacggat ggtcgcgagc ctgcacggtc ccgacggccg ggtgagtgtc gaaggcttct    110940
     atgacgatgt ggtgcccgta tcgcccgcca ttcgggcaga cacggccgcc ctgcctttca    111000
     atgacgaagc gtacctgagg gaggtgggcg cgcctgccac gtttggagag ccaggctaca    111060
     gcacgctgga acgccagtgg taccgtccga cactcgaact gaacgggctg tgggggggat    111120
     acaccggtga gggcgctaaa accgtcctgc caagcgaggc gcacgcaaaa attacctgcc    111180
     gactcgttcc gggtcaggat ccggaccgca tcagggagag gatcgaggct cacctgcggc    111240
     agcacgctcc tcctggggtg acggtcacgt tcgaagagag cagacacgga gcacccgcct    111300
     accgaattcc cccggagcat gtggggttac gggtcgctcg tgaggcaatc cggagcgttt    111360
     acggtcagga tccactgatg gtcggcatgg gcggctcgat ccccatctgc gacacgttcc    111420
     gtgacgcgct cgacatggac accgtgttct tttcgttcgc ggtgggcgac gagaacattc    111480
     atgctccgaa tgagtttttc cgcctcgccc ggtttcagga gggcgcgcgg gcatggacag    111540
     cttatttcga agctctcgcc cgatccgtcg atgctgtggt cacggccacg cggtgacacc    111600
     atgaacaccc tgatccagtc cacgccccca gggacagtcg cgcggggagt gcttgacgcg    111660
     ccactcaata cccgaacacg cgtgccgtac accgtggtac gcggggcaga ggacggtcca    111720
     accctgctgg tgaccgccgg ggtgcatggc gcggagtacg ccagcatcga cgcggcctac    111780
     cagctcacac agaccagtcc gtctgatttg caaggaacgc tggtggttct gcctatggtt    111840
     aatcccagtg cattctggca gcgcagcatc tacgtgaacc ccattgacgg gcgcaacctg    111900
     aaccgcctgt ttccgggtcg tgcgcgagga acttacgccg aacaactggc ttcgtggcta    111960
     cacgaggagt ttctgtcgca agccgatgcg cttatcgacc tgcatggcgg agaccttgtt    112020
     gaggctttga agccgttctc ggtctacgtg cgggaccatg agccgtcacg ccagctggcg    112080
     ctcgcgtttg gattgccgca cctgattgcc agcgacagtc gcggcatgac gtttgaggtg    112140
     acccggacgc atggtgttcc cgccatcatc gctgaggcgg gcggtcaggg cctgcgtagg    112200
     gcggccgacg tcaccctgct ggtgagggga gttcgtcagg gcatgcgtca ccttggcatg    112260
     ctgtcatgcg accttgaaca gtcttctgaa gtcatcgagc acgatgagtt cgcctggctt    112320
     tcggcgccag cttccggctt atggcacccg agagtggcgg ctggggacac agtgtccaaa    112380
     gggcaggaga ttggaacatt gagggacatc aacggaaatg acttgcacac cttcggcgcg    112440
     ccagagagtg gcaccgtttt gttcctcgtg acgagtctcg caatgaacga aggggatccg    112500
     ttgctcggta tcggtgtttc ctctgtccca ccggtctgct gagcagttcg gcgaggcaca    112560
     agaaggagtg ccctgtgctc tgcatccacc atccggttgt tctctggcgt cattacgctt    112620
     cctcgggcct ctggctaagg ctcattcagg ggcgcccggt accgggggta cgacacgggc    112680
     gctctggggt tcttggtgca tactggctgc cgaacgcggc gccggctcag ggtttcgtta    112740
     aaagcctttc gggacgcggg tacacagcat tggaaaagag agcatggcat gcaggtggtc    112800
     gagcggagta gcacgaagct gctggtgatc acgcagcagt aggaccgcac cgggaagctt    112860
     tcgttcgcga actcagcgcg gccaccacag tcctgctgac gcaggtgacc cgcgtgaagt    112920
     gagccccatc agcagaatgt ttccggttca acctcgcgtg atctctctca acgtgtcctg    112980
     ggccctgagc cacccccaga aagggacgcc ctagcgctgg aggcctgttg atcctggggt    113040
     gcagccagtt tagaggcgtg agccggcgta atgcgagcag caggcgctgg aaataatgat    113100
     ggtgtctccc agtgcactcc ccgtgcggga gttgttgtac accagccagt ccgccccctg    113160
     cgggccagca cgcagcagta cacccggccc gtccgggttc gggacccagc gcccacgcag    113220
     taactgctcg cctccggtcg actggacgcg ccagctgtac gttccgtccg cattgatgcg    113280
     caggggtggc aggcgcagcc cgccactgta cacgcggtac acgtcggtgc ccctgacgac    113340
     ggtatttacg gcgaccggga cgttcacgcg ccaatctccc acgaaccagg cggtccagaa    113400
     cggctcgcgg ttcacgccca ccacgaaatt cgcgtcctcg ctgccggtca ctccggtcag    113460
     gttatacccg tacttcgggt cgatgctgcg gatcacgccg cgcgtccagg ttttcccggc    113520
     cgttccgcta tacagcacgc tctggccggg cttgtacttc ccgagtttcg gccaggcggt    113580
     gtgcgccttc ggcggcgcac tcgtcggcgc gcttggtacc gcggtcggtg agggtgtctt    113640
     gacggccggg gcccgtggtg tggctggctc agcggctgtg ctgcgcgggc gcgcgggcgt    113700
     ggtcagcagg gccagtactg cctggtggtt gttgagtttc gcgaggtaag cagcatccca    113760
     gccggcggac gttttcacgc tcagatcagc gccgcgcgcg atcagcaacc gggcaatgtc    113820
     cgtgcaaccg gagtttgcgg ccatcatcag gggtgtgtag ccgccggaat tccgggtatt    113880
     gatgttcaca ccctgtgcga tcagcgcgat tgcctgagcg gtgtcacagt agttggcggc    113940
     gttggagagc tgcatttctg cgaggttctg ctctgccagg gccgcgctgc acatcagcgc    114000
     aatgcacatc caggtccgtg atttcgatag agcgttcacg acattctcct ttccgcagcg    114060
     tccggatcac ggaagcgttc cctgcaggtc gaggcgttgc ttgtcaggca aggtcctctg    114120
     ggatgaagtt acccgagggt accgcccggc ctctgacgaa tcactaacgg atgctgggcg    114180
     tcctaggcgg tcaggaggtg tactttgccg cgaaggccgg tcgccggcgg taccgcattc    114240
     tcccggtcgg ccatgcgcgg agaacggaag gccgtggacg ctgcgcttgg ggatggcggg    114300
     tgcgtcacag caagccatct gtagatcgcg aaggccacgc atggagttga acgggcccta    114360
     tcagactgcc aggaagcttg actcgaatac ctgtggtgtt atagttgaac ataacaacct    114420
     cgcaactggc taccgccttt ataaggaagg caggttctca ggcaccttca tgggcggcct    114480
     cacttccttt cagtctgatg tgtccgtgaa ggaggccgaa tgaatgaagg agtcctaacg    114540
     ccctgtgctg tttttgcagg cgtaacggta aagaattgct gacctgcggg gtgccgaggc    114600
     tgaagttcac aaagaccgtc aaaacggacc cgagcaacat gcatttttct gaacggtcaa    114660
     ctcatttcag atccatgcgc agtcaaacgc cacgatatcc accgagaaca cgtcagtgaa    114720
     accgcggctc gtcgttcgcc tctactaaag gtcctctaac tcgctcacaa ggagtcgaac    114780
     atgcttagca cgagattatc atcgtctttg atcacgctta ctatgcttgc cggaagcatt    114840
     gcgggcgctc aaacccttac ggttggcatg gatgctgacg tggttcggct cgatccagtc    114900
     ttgtcggctg cggctgttga ccgacacgtg ctgtaccagg tatttgaccg ccttgtggat    114960
     gtggacgaaa acctcaaaat cgttccgtcc gtcgccagga gttggaaaat cagctcgaat    115020
     ggcctcacgt acacgctcac gttacggagc ggaattaaat ttcatgatgg cacatccctc    115080
     aatgccgccg ctgtcaagta ctcactggaa cgcagcttga acatggatgg tagcgcgcgg    115140
     aaaaacgaac tttctgcaat caaaagtatc acggcggtga acccaaccac cgttcgcatt    115200
     gacctgcacg cgccatttgg tccgttactc gcgatactta gtgatcgtgc tggcatgatt    115260
     gtttcaccaa ctgcagcggc aaagtctggc gctgacttcg ggcgtgcgcc tgttggcagc    115320
     ggaccgttct catttgtcag ccgaactcag caggacaaca ttactttgaa ctcatacagt    115380
     gagtattgga atggcgcacc gaagatagac aagcttgttt accgaccgtt tcctgacggt    115440
     gacgtacggt acgcgaacct gctgtccgga ggggcgcaag tcatagtggt agatgccaaa    115500
     gacgttgaga agcttgaaag caataacaaa ttcaatgtaa tcagcattcc cacgctggga    115560
     tttcaaggaa tttggctaaa cactacccgc gctcccttta acaataagct ggtacgccag    115620
     gctgtcgctg ccaccattga ccgcaatgct gttgcgcagg tggtttttcg aaacaccgcc    115680
     aagccagccg ctggtccttt tcccccaaac actcctgcgt acagctcaag catcaaggtg    115740
     cctaccccga acattgctga cgctcgaaag aaactcaagc aagccggagt aagtaacctc    115800
     accttcacaa tgatcgccgc caccggcacg actaccgcgc tgcttaccca ggtgtatcaa    115860
     gcaatgatgg ccgaagctgg catcaatatg aagatcgagc tggtcgataa cggtgcgctg    115920
     agcagccgag cgacgagttt caactttgat gcagcgctcc tgaactggag cggtcgaatt    115980
     gaccctgatg gtaatattta tgattgggtc agaacgggcg ggacttacaa ctacggccgt    116040
     tacagtaaca aggaagtgga tgcattgctt gccaaggctc gtgcacaaag ctctatgagt    116100
     gctcgtaaag ccacttataa cgtggcactt ggtaaagtac ttagcgatac gccttatatt    116160
     tgggtctacc accaaagcaa catgtacggt accaccaagg ctgtgagtgg tctgaaatct    116220
     attcctgatg gtatcctccg ctttaaagac gtagtactta aataatgtcg tctttcacgt    116280
     aagcgcttgc tgtactttgg aacaattcag cggtgccctt taggtcagca tctgcggtgc    116340
     tggccttctt gctgaaatat ttttggtctc ttgaggtgga cccatcactt ccccatgtag    116400
     ctttccccat tcttgttcgc cggattgctg gcgataacca ttacgctgtc tacgaaaccc    116460
     cctggggcgt ggactcatgg atatgcttcg atactgtgaa gcgtgctgga gcctgtccac    116520
     gattcgatcc tggagcaact gaagactgaa gtctcccagt acccacgaat ggacgggtac    116580
     taccaacttg agcccgtggt catcggagct ctccgtcaag ggtggaaggg ccagagcgac    116640
     attttcaatg ccctctacga aagcttgggc cctcatagcg ctcttgcggc gtaccagatt    116700
     gcccatccgc ggatacagcc cttcagcgga gagccaccgg gagacgagga ctgcgagtac    116760
     acggctgagg aagcgcttga cgccctgacc tatgaattga agggcgggtt tgagattggt    116820
     cacctcgctg agtacgtgcc ttctgcgaaa gcggccgtat tggccacgca ttttttcgcg    116880
     gtgtttcatg aaccgcgggc attttggggt ctggggtgag gcaatccgat ttacgccttc    116940
     gagcagggcg ttgttctgcg tgacaatgaa cgcgccgaga gcttcttgat gatccaaaat    117000
     aactgagcat agacccactt cagagccgcg gccgaagaca ccatcgccac tggccgtccg    117060
     gccgggctgg agcggaggta ttacgtcagg cccaccgtct tcgcgaacgt gaccaatgac    117120
     atgaccattg cccgtgagga aatcttcggg ccggtcctcg tgattctcgg ctatgactcg    117180
     gtcgagcagg ccgtcgagat tggcaacgac accgagtacg gcctctcggc ctatgtcagc    117240
     ggcgccgatc tcacgcaggt cgcaaggtcg gggccaagct gcgtgccgga caggtggtgc    117300
     tcaacggcgc gtttgatctg atggcgctgt tcggcggcta caagatgagc ggcaacgggc    117360
     gcgagtgggg ggactttgcc ttcagcgagt ttctggagat taaggctctg ctcggctacg    117420
     cgcctcaggc gtagggtttg tctggttgaa ggctcaaatt gacaataggg ctgcaggcac    117480
     gtggacaccg ttcgccggtg cccacgcttc tcgtaccggg tggatttggc gcgaaaatcc    117540
     gttcgtcggt tgacgccgca tccaaccacg tgcaggcgcc ctgcgggcaa caaacgtacg    117600
     gcgtgaacca cgatggggca cctacctgaa cttcaggtga ggggagcagg cttccgatca    117660
     tcaggagcgt gtctgggaag tgacctattt gcggttggat tcaagctcct gacgcggagt    117720
     gtgagagcag ggaaccgctg cacgccgggc tgatcgaaca aaagctttgc aacgggtttt    117780
     tctctgttct ttcgcttgac gagaaccggt gacacactaa tttcatccgc ggtgttcgcg    117840
     gtgacagact cgctgtattc gaacattttc ccggcgacac accggttgtc agggtgcgct    117900
     gccctgggct ctggtggtct tgaggagttc ctcgcgcgag ggcatcggcg cgcggtccac    117960
     tgtgccgtca cggtacttgc cctcgttgcg gtccatctga atgacgcgct gctcagcctc    118020
     aagcccgggg tcaggccggt gaccgcgcga ggacgcgtag ctggcgacga tctcacggta    118080
     aacgggggcc gcgaggtcgg ccccatggta ctcgcccctg gcgccgtgag ccatgatggc    118140
     gatggtgatc tcagggttgg tgctggggta gaagcccgcg taggttgatt cgtagatctc    118200
     gctgctgtac cccccggcgg tggcgaactg ggccgtgccg gtcttgcccc ccaggtcgta    118260
     gccctcgagc agcgcgcggt gcggaatgcc cagctcgatg gtcatgcgca gcatctcgcg    118320
     cacggtgcgg gcggtctcgc tgcgcaccac gcgccggccc gtgcccaccg gatctgcggc    118380
     gttgagccgc ggcgggaggt acacgccgtg gttgcccagc acgttgtacg ccacggccat    118440
     ttgcagcagc gtggtggaca tcccctggcc gaagccgttg gtggtgcgca ccagcgtgtc    118500
     ccagcgctcg atgggacgca gaatcccgtt actggccgtg acgaccggga gttcgggagc    118560
     ggtgccgatg ccgaattgcg agaggcgagc ccggaacttc tcgttggtgt acggctcgac    118620
     aatgtggctg atgccgacgt tcgaggagta acgcagcacg ttctggatcg tcaggcgcgg    118680
     cccgtgcgcc accgagtcgc gaatggtgct gccccacctc ttgcctacgt accgggccat    118740
     gggggtgtca aggacctgat ccggcttgat gatgccgtca tccagggcgg cggccacggt    118800
     tagagacttg atgaccgatc ctggttcgaa ccggtcgata aacgcccggt tgcgccggtt    118860
     gcgcatgggg gtctctttcc acttgccagg atttgagggc ggccagctgg ccacggccag    118920
     gaggcgtccg gttctggttt ccatcacgat ggccgcggcg tactcggcac gctcttccaa    118980
     ggctttcttc tgcagttctg cttcggtcac ggcctgcagg tgggtgtcga tggtcagcgt    119040
     gaggtcctgg ccggccgcca gatggtcctg gtaatcgtgt tccaggcctt cgaggccctc    119100
     gctggcgccc atgaccccga gcagttgccc agccatatcc ccgttggggt acacccgcgt    119160
     ctccttctgg gcgaaggtgc ccgcgtcctt gactaaggtg gcggccagca cccggccatc    119220
     ggcgctcagg atgcgtccgc gtccgctggg ggtgggaagc ttgcgcccct cgcgggtctc    119280
     gaacggtgag agcggggcca tcacgctcgc gtacgagatc gccaggaagc agaaagcaaa    119340
     catgcctatc agcagcatcc agatcgagcg tgatttaatc ttggtttcca tcgtctgccg    119400
     tgaaggatag ctcccgcact ctgtcatcac cgtgacaggg gaagcggtca cgttcacgct    119460
     ccagaacgac gggagcgctg agcgacgagc aacgcgctga gagcgtcccc cggtatcctg    119520
     aggtcgccag gttctttggg cgtttaccta cctgatgatt ttgcgccctt ttacatggag    119580
     caccatggag acagcaccga aactctcccc gctgccgacc tgaccttgca gcgtcaggac    119640
     gctcgaacca cgatagacgg gtacaggtct cgggcgttgt cgtgcaggat acggcgggcg    119700
     gcccaatcgg cttcttgcgg gctcaggtct ccgtccctca ccgtcaggtc aagcgcgtct    119760
     cctagaacgg tgcggcccca gcgggccgcg agccagtaca gttctggcgt ccgctgcgcg    119820
     tcggtgctga acagcacctt ggtgacaggg gcaagatgca gagcctccag cgtggcggtg    119880
     cgcatggccg tcacgctggt gtagggaatt gtgaggccga ggtcgaggta ggcgccgcca    119940
     tacacgctgg cgaggtaccc ggcttcacgc acgtaggggt agcagtgcag catcacgacc    120000
     ttcaggccgc gcagttccgg ggcttccagc acgccgcgca gatgcagtgg actggccagg    120060
     cgcatatcga ggtcggggtc accgtacccg gtgtggaact gcaccggcag gccggtgtca    120120
     acggcgacgc gcaggccggt ccacaccacg ctgtcgatca gcggtttgct gttcacacgg    120180
     ggcacggctc ctggagaggt ttcccgcttc aacaccgtga acgcggcttc cacactgtgt    120240
     gcggtgggcc ggctgatatc gagcccggtg cgatatgcgg caatgctctt gaggcccgcc    120300
     agggtaggcg cgaggtgccg caggtgcgtc tcgagcgcgg tgagaaggcc cgcggcactg    120360
     tcgtgctcag cagcgagcaa tgcgacctcg ctctcgaggc gcaggacacg cctgacggca    120420
     caggggagcc ggtcggcact ctggcggacg ctccacaacc ggtccggcca gacgccgtcg    120480
     tcaatcagca ccgtgtcgat cctggcgtct tgaaacatgt gccgcgccag gtcgccataa    120540
     tcctggttct gccgcgcctc gagcaccgcg tccatggtcg gcgcgcagcc gtagtaggcc    120600
     gccaggtcgc gcatggacct tcggaaaaac agggtgtcgc gcgcgaagtg ctggaggata    120660
     agcggatcgg tcgcttccgt gaagtacggc tcgatcggac cggcgcgcca cagcggttcg    120720
     tgcagcagcg cgtgagcgtg atggtcataa atggggatat cagtgaggtt catatcagta    120780
     cctttccgcg agcagctgaa gctcttcggg gagattcagg tctttcaggg cagtccattc    120840
     agcgcgccgg accgccaggt acgcgcgaga ccgcgcctcc cccagggcgt caagcagcac    120900
     ggtgttgcgc tccagggcgg tgactgcttc atgaagcgac tggggcagca gctcgatacc    120960
     actcgcccgg cgggcctcct cgctcatcag cgccgggtcc ccaaccgcct ccgccggaag    121020
     aggccgttgt tgttcgatgc cgtccagacc ggcagcgatc agtgcgccga gcgcgaggta    121080
     cgggttggcg ctggcatccg acgtcttgag ttcaaaacgg ctgcaggcgt gtcctgcgcg    121140
     gctgacgcgg agcgccgctt cacggttttc gtagccccac gccgtgtacg cgccagccca    121200
     gaagtgcgga cgcaagcgat ggtacgagtt gtgactgggg acgctcaggg cgcacagggc    121260
     cgggaggtga aacagcacgc ccgccaggaa atgctggcct tcacggctga tgccggtcgg    121320
     gtggtgcggg tcggccatgg cgttggctcc gtcgcgccag aggctcagat tgaggtgaca    121380
     tccgcttccg gccacccctt caaacggttt aggcagaaaa ctggccacga ggccgtgcgc    121440
     ttccgccacg ccgcgcgccg tttcacggaa ggtaatctgc tggtctgcag cctgcagcgc    121500
     gtccgagtac cggaccgaga gttcctgctg ccctggtcct gcctccgggt agtagaactc    121560
     gggctgcagt ccctgggctt cgagcgcggc actcaggtcc agcatgaagc gcgcatggcg    121620
     gttgaacccg gacgtgtgcg cgaagacggt ggtgtccgcg ggcgtatagc tgccattgtc    121680
     gcggcggagc aggaaaaatt cgttctcgaa cgcggcgttc acggtcaggc cgaactgcgc    121740
     cgcagcacgg atctgttcac gcagaaaagc gcgtgggcag caatcccacg ggcccgctcc    121800
     caggcgcagg tcgccgagga cctgggcctg ggccggtgcg taaggaagca ccgtcagcgt    121860
     gtcccagtcg ggcaccagac gcacttcccc gaccggcccg aggcccgcgc caggcaccac    121920
     cacgtccgcc atcaccggca gggccagctg agcagcagca ataccgacgc cgtcgggaag    121980
     gccagcgtcg aggagagaga ggtgcgcagc cttggcccgg atcaggttgg cgtggtcggt    122040
     ccacaggatg cgcacgtact gcacgcccgc ttcccgcaac tgctgaatgt tcatgactcc    122100
     tccgtgtctg tgacggcctg accggcagca cggggccaaa gggcaccagc ccggctggcc    122160
     gcctcgccaa ggtgctcgtc gtcagcagtc gagccgcgtg cggtaaggga actgggccgg    122220
     ccgaagggtg gccagggtcc gtcgcttgtg ggaggctggc ccggctggaa gcggctgtgg    122280
     agtggaaacg gccggaactg cgaagaagcc cctggggtgt gggacgtcat tgcggtttcg    122340
     ggacggcgta gtcgttcccc tcgcggattt cctccagcac gatgcaggtc tctacacgtt    122400
     cgataatgga ctgcgcctcg ctgaagcgtt gcagaaattc ccgcagggcc acatggtcgc    122460
     gcacggcgac tttgacaatg gcgtcattcg ttccggttaa ggtgtagcac tccagaactt    122520
     ccggcagcgc gctcacagcg ccgtgcagct cgtccagatt cggtgaggcg aggttgttct    122580
     tgaaatttac cttcagaaag cacatcaggt ccagacccag tttggcgcgg tccaggacga    122640
     tggcagttcg tttgatgacg ccgtcctctc gcaggcgccg cagccgtttg tggacacccg    122700
     tggcggacag accgacctgc cgcccgagtt cggcatggct ggtgtcggca ttgtgctgaa    122760
     ggaggcgaag caggtgcgtg tccgtatcgt ccatgtggtc tcctcgtaga agtgccggat    122820
     tttaaggcac gcgcactgaa caggtcattt gagtgacgat tagtgaccgg agctagggtg    122880
     agggttgttt tttaacacat cacaggagtc gcctcaacct cctcaaccac cgccgggcga    122940
     cgtgaaggag cccctggccc gtccctgcgc gctccgcgga cgagaaacca aaatacaccg    123000
     cagcgatcag aactggaacg aatcgttccg ggtcttgagg tttcggtgat tctgcgttaa    123060
     cattcgccgc aattcgacct atttttttgc cagccggact gctctccggc gtcgtccttg    123120
     acgcggcggt gttcaggacg tcagcaggac cagccccagt aggccacgcc aggatccgaa    123180
     cccgcccgcc cccgcacggc ctcaggagga catcatgatg cgattcaccg cgttgttcgt    123240
     cacggcacta cttggcaccg ccagcgtttc acaggcccaa accggcaccc tgaccgtcgc    123300
     gacggcccag gacccccaga actgggaccc gatcgatacc tttctcatcg cgtggggcac    123360
     cgtggcgcac aacatctacg atggactgat tatccggacc cccgatctga agcttcagcc    123420
     aggcctggcc accaagtgga cctacctgaa cggcggcaaa accctgcggt tcacccttcg    123480
     caaaggcgtc aaatttcata atggcgaacc gttcaacgcc aatgccgtca aattctcctt    123540
     cgaccgcctg ctcggcgctg aaggcaagaa aggcccgcag caagccaact acacgtccat    123600
     caagcaggtc aaagtcgtcg atccctatac ggtggatttt atcctcgcgc agtccgatcc    123660
     ggtgctgctc accaaactgg cggggtacgg cgccatgatc gtgccgccca gatacatcaa    123720
     ggagaagggc gccgcctatt tcgacacgca cccggtaggc accggtccgt ttcagttcgt    123780
     gtcgtacaaa aacggcgagt ccatccgcct tcaggccttt cccggctact ggggcggcaa    123840
     gccgaaagtg gccaacctga ctttccggtt tattgaggaa cccgccaccc gcgtggcaga    123900
     actccagtct ggccgggttg acatcgccac tgcgatcccg gtggcgcagg ccgctaccgt    123960
     caaaggcaac agcaagcttt ccttgcaggc ggtgcccagc cctaccgtgc aggccctgcg    124020
     ttttaacgtc agccacagcc tgaccaagga cgtccgggtg cgccgggcgc tgaaccacgc    124080
     cgtggaccgc gacgccatta tcaagagcat cctccagggc tacgccagcc caatcgcgtc    124140
     tctccagtcg tccaagtcgt atgggtacga cccgaatctc aagccgtacc cgtacgaccc    124200
     tgccaaggcc aaggcgctgc tggctgaagc cggcgtgaag cccggcacgc ccatcggcat    124260
     tgactttatc gggacggacg cagtgttccg cgaggtggcg caggccgttg ccgggttctt    124320
     tcaggcggcc gggttgaaac cggaactgaa gacgtacgag acgaacactt tctacagcga    124380
     catcattccc aaaaacaaga ccagcaacgc gtaccagatg ggctggggcg gatggacgtt    124440
     tgatttcgac aacaccgcat acctgctgta ccacagcaag cagttctgga acccggacta    124500
     cagcaacaaa acccttgacg cgatgctgga caagcagcac accatgagtg accagaagca    124560
     gcgcctcgtg atcctgcgtg acatcgcccg cttcacccac gaacaggcaa ttgacatccc    124620
     gctgtacaac cagcaggacc tgtggggtgt cagcaaacgt gtgcagggct tccaggcgcc    124680
     gagtgacagc ctgctgcacc tgcgcactgt cagtgtgaag tgacgccctg tggcacgcta    124740
     tctgctctcg caactgttcc aggccgcgct ggtggtggtg ttcgtgaccc tggtggtggc    124800
     tgtcatgctc cggttctctg gagacccggc cgtggcgcag ttccaggggg cgtcggcacc    124860
     cacggaagag cagctgaggg aaattcggca ggcaatggga ctggaccgcc cgtttctggt    124920
     gcagtactgg gactttctgt cgggtgttgt gaccggggat ctgggcacca gtttccgcgg    124980
     ggaaacagcc gtccggtctc tgatcgctca ggccatgcct ccgaccatgc tgctcgcctt    125040
     gtgctcgctg gggctctctg tgctgctgtc cctgccgctg gcgattcatg cggccgtgca    125100
     caagggcagc tgggcagacc aggccgtgcg cttcttctct ctgctcggcc tctccttccc    125160
     gaacttctgg ctgggcatca tgctcgccct gatcttcggc gtgaccctgc gctggcttcc    125220
     ggtgtccgga tatgaaagcg ccgcctcgct gatcctgccc agcgtgaccc ttggcctgat    125280
     cctgacttcg accaccgtgc gcctgctgcg cgcttcactg ctggacgtgc tcagtagtca    125340
     gtacgttacc gtggcgcgca gcaaaggcct gtccgaacgg cgcgtgctgt acaaacacgc    125400
     cctgaggaac accgcgattc ctatgatcac gttcgtcggc ctccagtttg gcggactgat    125460
     cggtggggtc gtgatcgtcg agcaggtctt cgcctggccg gggctgggct cactcgcctt    125520
     gcatgccatc tccaaccgcg actatccggt gctgcagggc accgtcacgg ttctggcggt    125580
     tctggtcgtg ctggtcaatc tgctggtcga cctttcttat ggtctgtttg accctcgcgt    125640
     gcggctggag tgatatgact gaccttgctc ccccttccac ccgcgcgcgc gcccggcatg    125700
     ccctgaggcg ctggacgccg gacctggtca tcggactgct gctgaccgga ggcgttctgg    125760
     gcgtggtcct cctcgccaac ctcctgtttc ctgccggcac cgacacaatg gacctgacgg    125820
     cgcgcctcac tcctccggca ctgtccagcg accacccgct gggcactgat cccattggcc    125880
     gcgatgtgct ggcaagggtc gtgtacggcg gacgcatttc cttactggtc ggtgtcgtgt    125940
     cggtgacgct ctcagccctc atcggcatcc tgcttggcct gttcgccgga ttctacggcg    126000
     gcaaactgga cgcctttctg atgcgcctgg cagacattca gctggccttt cccttcatcc    126060
     tgctggccat gactgtgatc gccatcctgg gccccggcct gtggaagctc attgcggtta    126120
     tggtcgcgtc ccagtgggcc cagtacaccc gtctggtgcg cggtcaggtg ctggcgctgc    126180
     gcgaccggga atacgtccag gccgccaatg cgctcggggc cagcaacagc cgcatgatct    126240
     tccggcatat cgttccaaac gccttaggcc ccgtgattgt cctggcgacc ctgaatattg    126300
     ccaacaacat cctgctggaa tccggactga cattcctggg cctgggcgtg gatccgcagg    126360
     tgccgtcctg ggggggcatg ctcgccgacg gccgcaccta ccttcagagc gcgtggtggg    126420
     tgtcggtgtt tcccggcgtg gcaatcacgc tgaccgtgct gggattcaac cttctcggcg    126480
     actggctccg cgaccatctc gatcctcatg ggagacacgc atgacctcag ccccacccgg    126540
     cccgctcacc ccgccccagc aggaccagca ttacgaaccc tccgcgacac gcgggcagag    126600
     acgcgtctgg gaacagcact ttccctggga agggcagcgg ctgatggagc tcctctcggc    126660
     gctgcgcctc gcccatcagc cgcatcacgt tctggcgtac gtgtcggaat caccgcagac    126720
     ccgggcagcg ctgcggacct ccatcgtccg cgccgccgga ccaggttgcg cggcgcgggt    126780
     cagaagtgca tacaagaccg cttacttctg gatcacggag gaagtgcagc cgctctggcg    126840
     ccgggcccag gccgaccgcg tcaccctgac ctatccggtg ctgtcagagg cgccccaagg    126900
     ccgcttcctt caagaagcgt atccacttgc tgccgtgttt gaacgggaag gcgtcgaagc    126960
     cgaatttgtt ccgggacctg ttgggcgtcc ctactaccag gccacgttgt ggaggggcga    127020
     gcgcgaactc tggcacggca cgtgcttcac gccgctgttt caacggcagg ccccagacgg    127080
     ccgaatggtg ctgggcccca ccggttggtt gaccgtccag gccgaagggg cagacgtgct    127140
     tgatcagcgt ctggagacgg acggggaggc tttttgggac tggtacgtcg cgacggtcct    127200
     gcccgctgtg ctcgaactgg ccgaccggcg ggatgacggg ctggtgttcc ggaacctggc    127260
     ggtcacactg cagctgtctg aaccagacct tgccctggat gtcctggacg agcgaatcag    127320
     catgactgaa gccctgaccg aggaggtgta cttcggcacg gtggacgccc tgaagcggca    127380
     cacgtccacg ccgcccggcg cgcgtacgct cactccgggc cgcatcgttc ctgtggctca    127440
     cgctgttcct gggcaggatg gttgggctcg tgtcacgctc acggaatggg ccagctcccc    127500
     ggcggaactt caccggccgg gtgcatctca cagcgtgacg gcggaccccg agtcggtcct    127560
     gcaggaccga cctgcgccgc ccggccagat ctgggccaac gcccgcgccg ctgccgaccg    127620
     tcatcagctg gaatggcatg tgccagccca cagtgtggac ggccggccgg ttcccgcggt    127680
     cctccggtcg acccccggcg ctgcagggag cgtcctgatc actgcaggtc agcacgccaa    127740
     cgaaaccacc gggccggtcg cggccttaaa cctcctctct catcttgccg gcatgcctgt    127800
     gaattttgcc ctgcttccgc tggagaaccc cgacggggca tttctgcacc gcgccctgac    127860
     ccagctggcc cccaatcaca tgcatcacgc cgcgcggtac acgtctctgg gagatgacct    127920
     ggaggcgcgt ctgcgtcagg gggaccgccg ctgggaagcg ggcgcccgcg cgtgggctca    127980
     ggagcaagtc ggcgcgaacc tgcacctcaa cctgcacggg taccccgcgc acgagtgggt    128040
     ccgtccgtac agcggctacg ccccgcacgg ctttgaatca tgggcgctgc cggccggctt    128100
     catcaccatt gtctggtact ggcccggtca tgacaaaccg gcgcggctgc tggctgaagc    128160
     catcgcgcag cgtctccagc aggaaccaga ggtcgtacaa catgctcagg cagccctccg    128220
     ggcgagtacg gcgcatgtcc tgacgccgca ttacgaactg atcggcggcc tcccctttat    128280
     cctcaccgag cagccatcgg cgttgtgccc gcttacagtc atcaccgaag cacctgacga    128340
     aaccatctac ggcgcccgct tccgttcgtg cgttcaggcg cacctcagcg tctgcctggc    128400
     ggcgattggc cacacgctgc gcggagacgg gcagccagag tcctgtacat aacctgcacg    128460
     tcagatcact ggctgttgcc cgcacgcaca gtccggggcc agaacatgca ggtgacgacg    128520
     tccagaggag gttctgctcc ggcgcggtct ccctgaggag gagtcaacca tgcaaccgca    128580
     tgctcacaag atgcaaactc aggagccatg ggagggattt tgttcagtcg aacatggaca    128640
     gctctggtac agggtccatc ctggccccgc gaaccggcct ccggttatcg tgctgcacgg    128700
     tggtcccgga tgccccagca cttacctgca ctcgctgagc gccctggcag acttcaccac    128760
     ggtggtgttc tacgatcagc ttggatgtgg gcggtccacc tcggacgtgc ccatgtcagc    128820
     gctgaccctg gattctttta ctgcggacct ccaggtcctg ctcgatacgc tgcgaatcaa    128880
     atcgtttgtc ctgttgggac attcatttgg tggtctgctc gcgcttcacc atcagcgttg    128940
     ctttccgcat acggccagtg cactgctgct ggccagccca ctggtggcca ccagcgattg    129000
     gatggccgac atggctgtcc tgacgggcgc tctgcccgag ccgtacgcag acgacttgaa    129060
     caaaccgcag gaggacccgg catatgtggc ggctgaagcg cagttttacc gcacctactt    129120
     ctgtcatctg cagccctggc caccagaatt gcaggtcgct gtagagcagc tggcggcatc    129180
     tcctgcttac cacctgatgt gggggccaac cgagtttacg cagaccggca acctggaagg    129240
     agccgactgt tcgggtgtgc tgcgcaccct gcgatgccct gtgctgttca cgtgtggcag    129300
     cgcggatgaa gcgcggccag aaacgttgag gcggtatgcg gacatgtgtg aacgggggca    129360
     gctgaaggtg tttgagggtg gtacccactg cgttcatctc gagcaaccgg acgagttcct    129420
     gcaggtaatt agagagtttt tcgggcatga tagcgccata cagtggatca cttcggttta    129480
     gtggtttgat tcagcaaaac ttagacagtt ttttagatac ccagcacgat aatcatcttc    129540
     gtggtgggta tctgctctgt actagcattt gcgacatcag aatagctgag cttgtatact    129600
     tcttacagcg ttgtaaggtc tgcaaaagtc aagccgtatc attgatttgt actggcaggt    129660
     gcagcagggc tgtcacatca tgcttcgcac tctggtcagt aaattaactc tttcccgtac    129720
     ttggtaattt tcgcagacat gacgtcgtct tgctcgcatc ctgggcatac agtcattact    129780
     gatctcacca ccctccaagg tttgctgtgc tgtcagaagt agctgacact gaaccgtttt    129840
     atatttgcga ttattcacca tccggtgctt cctcgactcc gatacttacg tcctctgttc    129900
     tgtccgctgc agctgcttct tgcagaatct gcgcacactc tccagaatct gatccgccgt    129960
     tttcgtccag ataaagggct tcggatcatc gttgttctgt tgaatgtatc gctcaatcgc    130020
     ggtctccaag tcctgcgtgc tggtgaagct gccccgcctg agctgtcggg tagtgagcag    130080
     cgagaaccaa cactccatca ggttcaacca tgacccactg gtcggcgtga aatgcagctg    130140
     gaagcgcggg tatcccagga gccagtcctg acgcgaccct gcgctacacc gttgccgacc    130200
     ccagttcccg cgtgcgtctc gactgccagc actaaaggct gagccggcca tttctcacgc    130260
     cggcagaacg ctgctgtcag tgttctgcgc cgtcaccatt gcatcttctg gaggatgcgc    130320
     acgagattgg ctgtccccac ccttgaagtt gccacgctgt tgccacgcct ggcctcttag    130380
     gcttttggca ccagattcat cagcgtcaag aggaggacgg ccccagaaac tgatgctccc    130440
     gctcaaactg cctggacgac atcgctcaat acccgctctt ggcggactgg agggacccca    130500
     ccatgacccc cacctcatcc tcgcggcccg gtcgccgagc cctccttatc ctcggtgcag    130560
     ccctggcatc cagtgcgatg gcctggaagc ccagcactca catctacttc gctgagcagg    130620
     ccctcacaga cgcagtcagc gacggccggg tcaccatctg ccgcaccaac tatgaggcag    130680
     gaaccatcgc aggcgactgc cgtgactacg ccgtggaccc tgagatcctg gcggccttgc    130740
     gggcggcccc cgcgcagtac cgcgccgggg tcctgggtcc ggatgcctac ccggacctgc    130800
     tgaccggtca gcaggtcatt cacccggacg agagcctgcc gaagcgcccg gacgcgccag    130860
     ggggagcgaa cagctggctc cagtacctgt gggacagcgc ggcagccgag ggaggcggga    130920
     accggttggc catcaaggcg ttcgtggtgg gttacctcac gcatgcggca ggcgacatgt    130980
     acggtcatac cttcgtgaat gcctacacgg gcggcgagtt cgccctggga ccgaatgcgg    131040
     tgcggcacat cgtactggaa gggtacgtgg ccaaacggac cccccctcct gtggatgcag    131100
     cgggccggcc cgtgaatgag aacagcgtgt cgattgatgg ggtgtcggac ttcatttacc    131160
     ggcggatggt ggatgcccgg cccgggtcgg tactgcgtga tcagttgctc accgggtcgg    131220
     gagcggccac gtcggtgccg cgggtgtact cggatctgcg tgcgggcctg cagcgtgacg    131280
     tggatgaata ttaccggcgc aaggccgact tcgaccgccg gtccgcggac aagctggctg    131340
     cggccgcgcg gtgcaagccc ttggattttg ggtgtagtgc cacgctgctg gtcacgcagg    131400
     ccggggtgat tcaggcggag aaagcagcgt acatggccgt gaatgccgcg ccgattacgt    131460
     acaaggagta ctggatcaag gacattgacg atggactgag ggcctggccg ggcgtgagtc    131520
     atgagctcgc gcgggctctg gtgtacaaca ccggcggtgt ggacacagcg cgggcgcaga    131580
     aggtggcgga acaatacgtc tatgaccacc tgctgtccat gtctggtgct ccggacgcgg    131640
     tgggtggaag cctggggctg atcaacagcg tgctgtccgc gttgttccct gccttcatcc    131700
     gcgaggccgt cgagcagatg aaacgcgacc tcctcaactc gctgctccgg caggctttcg    131760
     ggctgacggt cgaggagctc aaagcatatg tgaccagccc ggaagtgcac tttgaccggg    131820
     tgatggccac gcctggcggt cagaaaacca ccttgcgcca gatgaaccgt ggcgagttgc    131880
     gcattgcgga cgacgggttt gccaatccgt ctgcacgttt cgattaccaa gtgttcccgg    131940
     cgggttacaa caccgtgacc atcagcaagc tggtgctgtt accgcctgcg gagatcaacc    132000
     gtctgcttcg ggacctggga gccacgcagg tactgagtac gcctaacgtc atgctgggct    132060
     tcatccgttc ccttgacggg cacaacgaat ggctcaataa cgctccttac cagcttgcgc    132120
     ctgccataaa ctgtggcgcg tacatccgcc tgttcatgcg ccagactggc gaggcggttc    132180
     gctgcggttc catcattcaa ggtgagccgg tgcagaaggt ggtgccccgc cccgtgcctc    132240
     tcgtccccat cactccacca gggcgctgat ggaagtgggt ctcggcaagc gcaccagcgt    132300
     ctcagcaccg tgagcaatcc cgtgagccaa gccattgccg gccgtccgtt gaagggcaat    132360
     aagaccagca cgccatcaca ggagtggccg acgtcgtggc acccgcaacc tggattgctg    132420
     gagacttcat ggcatggttc gtggcgtacc gtgacgctct gaactttgct tccagaaatg    132480
     ccttcgaatt cgataagtcc agcagtgcgc caaaaatcta taaagcggtg tacagcattt    132540
     tgcgtgaacg gttcagactg ggagcactac tggcctgcac tgctgagcgt caggtcgctg    132600
     cggcgtacag aatacagtgg actaaactta agcagaatca ggaggcgcag aagaagggtc    132660
     attccaagcg cctgtacaaa ggtttggata cggttccaaa gtttgtgtcc agtactcttg    132720
     aatatcagta cgggcgcgac tactcgtgga agaaagatgg tcgagtcagc ctcgggacac    132780
     ttgatggacg cacggtgttg aagtttgagg gctaccagaa gcacctagac ttcgtcaccc    132840
     agggtgctga aaccggcagt gtgcacccgc gtgcagtccc agcaggccgt agacgtgttc    132900
     cttgagagcg tcctggaagc cgtccgcacc ggcaagagtg tcggtctggc tggtctgggg    132960
     accctgagca tccgtgaaac cgccgcccgc actggcgtgc gacccggcac cagcgagcgg    133020
     atccagattc ccgccggcaa gaaggtggcc ttcaaagttg ccaccacgct gcaaggcacc    133080
     ctctcagcta cgttctgctt tattgagtcg gaagtgctgc gtaatctgca cagtcagcgc    133140
     ataccgggct atcatgctca acatcaaagg cggccttcgg gtcgccttct tcttgctgtc    133200
     atgaacaccc caatcatcca tgaagctata gggatattcc ggaacagcaa ggatcactac    133260
     catttagaag gaactctcca ggtccgcact gaacttggtg tgcctgcgga gaccacctgg    133320
     aacgatctcg ttccggggag atgaggagtg aagtatgcct gcaggaaaag tgaaatggtt    133380
     taacgcagag aaaggcttcg gtttcattga aacgcccgga ggtcctgatg tcttcgcgca    133440
     cttcagcgcg atctcgggga gcggcttcaa gaagctgaac gagggtgacg aagtggagtt    133500
     cgagcttgag gagggccagc ggggcaaggg tccgcaagcc aagaacatcg tcgtgacgaa    133560
     ggccgcgcca gccgctgcgt acggcgaccg tccgcaacgc cgcgacgacc gctggtaagc    133620
     ccgagcgtga acaagagagc cggcatcggc tctcttgttg tctgctcttg aaccggagga    133680
     acaccggaat tgaatagggt ctgacgttgc cgcaaagtgg ctcgctgtac ggctcggtgc    133740
     tgctcctggc ctgcttccac ccggtggggc tatgatggtg cgcccaaccc cgcgccctag    133800
     cacagcaggc agcctgcgct ggtccttcag acggaccagt acaacctgtt tcttctgagg    133860
     atctgacttc cggattatgt acggtggacc gtcaggtgag tagtgaagag ctgaggggca    133920
     gcggtcatgt gaccgctgcc cctcaggacc gagaagtgga gaggaacgac cggcgttatc    133980
     gcctgccggc agccgcgatt gcagctccgg ggttgaccag gccgttaccg aagaaattgt    134040
     cgcggccgtt cgggccgagg tcggtggcgg tggcgctcag cagatcgcgc agttcagcgt    134100
     tactcaggcc gggtttcgcg gcccacacaa cggctgcagc gccggcaacg tgtggggtgg    134160
     ccatgctggt gccgttgaag tactcgtagt ccgacgcgta gatggagacg cttccggtca    134220
     cgcttcctgc ctgaactttg gtgagggtcg ccaggccgtc ggcctgcgtg atgcccacca    134280
     ccgggatgct ccgtggcgat cccagggtca cgctgttcaa cgggccggtc gtgttgttgt    134340
     acacgatgac cgcggcagcg tgattggcca cggcgttggc gaccttatcg gcaaaggggc    134400
     acgccccgcg ggagatcagg gcgatcgctc cattcagcgc ggcattgacg gcgttcggtt    134460
     cgcagaaccg gttgccctcg ccaccagcgg ccacgatagg caggtttgac acggtcttcg    134520
     ccgcagcaaa ttcgaagggg ttgacgctct ggtacgtggc gacgcccgcg gcacttgcgc    134580
     tggccgcgag gccagtgccg actggaacgc tcgacaggac ggccacatca ggcgccacaa    134640
     gttcctgttt gctgttgtgg ttgctgaagt ccgccaggtt ccccaggtgg tttaccgcgc    134700
     ccactttgat cacgctgggg tagtccgaag ggtagtgcgg aagcttcacg ccgtcattgc    134760
     ctgctgcagc cacgaccagt gcgccggcat cataggcggc ctggaaggca cgcttctcgg    134820
     ttttgctgcc ctcatccgct ccgagagaca ggttgaccac catgcgttgt tcctttccgc    134880
     cctgggtgac cagctggctg acgcaccagt tgacgccttc aaccacgcct tcggaagtgc    134940
     cgctgccgtc atccccgaga acccgggcga cgtagaggtt cacaccggga gccacgccgc    135000
     cgacgccgtt ggagtccatt ccggagggac ccacgttcga gcccgcgccg aactgcgcga    135060
     aaatcgttcc tgccacgtgc gttccgtgct ggttgacgtc attcagggcc gtagctgaat    135120
     ccttgccgtc acccatgaag ttcttgaagc ccttcagctt tccggcgaat tcagggtgat    135180
     tgccgtcgat gccggtgtca ccgacgcaga ctgcggtgcc tgctcctgtg tgctgctgcg    135240
     tccggaggct ggggaccgcg agggcgatat ccccgtacgt gaattcgccg ctcggctgcc    135300
     agttgacatt gaggcctccc agctgccctc ccggtttgcc gagtgtgttg ctgtcggagg    135360
     tgatgtagtt gtccgcgcgg cgcgtgacag tcagctcaac gtactccacg cttggatctg    135420
     ctgccagctt gttggcctgc gccgctgtca gcgtcgcaga cgccgcttcg atgcgggtga    135480
     aggagcgcct cagttgccca cccaccttgc ggatcgcttc ggtattggtt ccctgaccag    135540
     ccttgaaccc aaccaggtag gttcgcgccg tggtggctgc ctggctgctg acagtggggg    135600
     tgacactgct ggtggggacg ttcgactgtt gtgcgcaggc ggctagggcc agggcgagac    135660
     ccacaaactt gacactacgg gatacgtgca taaggctcct ataaccaggc ccgtctgagt    135720
     agagcccctg gtcagaatga ggtgtgatgg tgattgcggc atcctctccc agtgactgct    135780
     catcatttgt taaaaaccat acgtttccgt gagggtgtcg tgaaggtgac tcgattctga    135840
     gtgcactccc ctgatctgaa ccctcctgag gtgagcaagc gggtggacac gttcctctgt    135900
     gggccgggaa ggaacacccc gctggcagac ggactgcggc agcaactcag aatctggctg    135960
     gggccggtga ccggtcccct gagggcactg ctccttgatt ctccccggtg gggggtatgg    136020
     tggtgcgccc acccagcgct ccagcacagt gaacgcatga cccgagagac ctgcctaccc    136080
     gcccaggaca ccgcatgctg atcagcggcc tcctccagga acgcacggcc ctcggcggtg    136140
     tcagccgtga cttccagagc cgcacactcg cctggatcag caccctcccg gaacctgccc    136200
     atccggccgt tcgcggtacc gtgcgcccgt ggcccgctcg gccctgggtc attggggttg    136260
     tcggccggcc gggacgcttc tggggttaca ggtcaggtgc tccccgctcc tgcggcagac    136320
     tcaggcgggt cttgtcgacc gcctctgtca ccgtgcgtgt ggctggctcc tccttattca    136380
     gtttgcggat ctcccgggcg gtttccttgg aagattcagg cgtccataga ccatgtttgg    136440
     tcatggttgc tttctcctca ggtttcccag ctcggcttga tttcgttttc ttcggagtgc    136500
     gcgctttggt catcttcccc tcctccgcca tttcaccggt tgcttccctg aactaagcag    136560
     ggcaacgccc gctttttccc gggaaactct tcactgttgt gggctttggg cagagaggtg    136620
     aagggcgtgg gtctggcagg cgcagtcctg gagcaaggct tcttaagacg gggcgatctc    136680
     cagggcgtgt gaacgcaggt gtttttacgg gtttcgcgag ccttgctcgc cgcagggccc    136740
     tttgtcttca ggttctgcgt accgtgacca tgcggcggtg ggcgccatgc tcacatagca    136800
     accctgggtc tgctgctttt ccagggtttc aggccgcatg gggtaaccga ccagcctgag    136860
     cgccagcatt cctgagataa gatctcagct ttacgttgac ggctacagtc tgcccctgat    136920
     cacgaagaca tcgggagacg tgcgcacgct tcggcgatag cggtgacatg gcggagatcc    136980
     gtgccgcaac aaccaccaag aaccgtgatc tgcggatgtt cgtgaagaag cttgcggtag    137040
     agttgcccga gttcaagcgg atcgccagca tcaagctcag tcatggcatc caactccttg    137100
     tggctgcagc gcgaagcatt cgctcgcaca ccacgaatac gccttgtcca agcagcgggc    137160
     tcatccagga ctgccgcaaa gtggtcggga tgggcgcagt tcaccatgaa gtaggccgca    137220
     tagtcattgg tcgcctcatc cacagccgtg acagcatcca tgagggagtc acccgtcggc    137280
     aaccgcccat ccgtctccac cgtaaacgag accgacactg gcaggccgac ctccgcagcc    137340
     gccaaggtta taccagtcgc ctcgttgatg ttggtcatgg tgagtgcaga cagcatgtca    137400
     acgccagccg aggcaagcac acggacctgg tgaccgtggt aattggccgc ctctgccacg    137460
     ttcatgatct ggccgggatc gtagccatca ccgcgggggc cgacgcagcc gctgaccaca    137520
     atctcaagtg ggtcggtggc agacttggat cgcaagcggt gcaggagttc gaccgcagcg    137580
     acattaagct ggtcgagtcc acattggtgg agcccaagcg gtgcagccca gtcagggctt    137640
     gcacgccagg tggcgctctc gaggatgaac cccgcgctgt gcctgtgcgc gagttccaga    137700
     taggggcggt aatacgtctc gagtgcttcg cgtccctcta aggttgcgag caggacaact    137760
     gaggagaaca agggaagatc aatgccgcgg ttaaagagaa gatcggtctc caggccgccg    137820
     tcggtgagaa cacggcgcgt gagctgcggg agtggtcctt tcatcttgtc ctccttcagt    137880
     aaggcaggta cagggcagtg cggtgcacga aggtaacaat tcagggtagt tcgttgcccg    137940
     tacatatcca gtgctgctcg tcaggacggc tggatgcgca actgaaactc cttcaactgc    138000
     atctctcgtt gcagcgtttt accttctggc ctcctgtacc agcgttcttt tgtttttgca    138060
     gatgcccttc gcaggcaatc tcagcgctgg cctgatggcg ggtgcgccgg gccgccagct    138120
     cttcagcgct gcggaaccgc tccatcatga aggtgtctgg ggcactggtg agcgtgatgt    138180
     tgccagatga atcggtggaa gagtggagta cagcttctgt gccgcgtgag gtgctgcctg    138240
     gcgaccgggt ggcggtgctg gtggagggcg gaacactggt gggcacgtgg ttacttccgc    138300
     gcctggcggg tctgcgagcc tgccgcccag tcatgtgcgg cctggtgacc gctctcaatc    138360
     gaccgtcgag ctttgtcgtg gcgtcatcag gccgacgccc ttcctgatct cacgtccatg    138420
     accacgggac gctcaccggg cggtccgtgc gtatgctggg tcccgcgtca ccctactcga    138480
     ggtcccctat gttctccctg ctccgcgacc gccgcatcct gatcctgtgg atcggtgaaa    138540
     gcatcaacgc tttcggcaac ggcctcacct tcatcgccct cgcctggttc ctttaccgcc    138600
     tctacccgaa ctcacctgcc ctgtcgggca ccgtcatcgg tgcctggacc gcggcgatgc    138660
     tgctcgggac cgtcagcctc gccggttaca ccgacgtgtg ggaccgccgc cgcattctgc    138720
     aggtggccaa cggcctgagc gccatctgga tcagcctgat tccgctgctg cacggcctgg    138780
     acctgctctc gttcccagcc ctggtcgtca tcgcggcgct gaccggcttc actggcagcg    138840
     tgatcttccc ggcgcagcag gcctcgctgc ccaccttcgt gtccgcagac cggttgcagg    138900
     gcatccaggc cctgttcaac ctgacctgga ccaccagcgg cctgctcgcg cccatcagcg    138960
     ccggcttcct ggtggcgagc atcggcgcac ccggggtgat gtgggtgaac gcggcgagct    139020
     tcgtcgtggc cctgatcgcc tactcgattg tccgctttcc cacagtgacc cgcgctcagg    139080
     acagcgggca gggtctggct gcctggtggg ccaggacccg gtacggcttc gcgttcgtcc    139140
     tcgcgcggcc cccgctctgg gcgacgctgc tgggactggc cagcgtgaac ttcgccatgg    139200
     agccctacgt cgccattttc ctgccccgca tcgctgaccg cctgatggtg ggggtggagc    139260
     tgcccgcggc gctttcctgg gtgcgcgccg acagccgggg tgcgctgggg gtgggcctgc    139320
     tgggctcggt cctcgccctt gcagagcttg gcatggtgat ctggatgggg cgccgcacca    139380
     gccgccaccc cctgaactgg atcgcgctgg gctgcgtcgg tcccgcgctg tgtatcgtcg    139440
     gtgtggcgta cgccccctcg ctggggatgg cgctggttct cgcgctgctg atgggcctgt    139500
     gcttcggacc gctgaacgtg atggtgggga cgatgtttgc ccgcctcacg ccggaggagg    139560
     tgcgcgggcg ggtgtacagc gcccgcatcc tggtgggcca ggggctccgt ccggtggggg    139620
     tgagcctggc ggcagtgctg atgggcgcgg tgggcctcgc gccggcggtg gcggtgctgg    139680
     gtgtgttcgc cgccctcctc accctcgtgg gctacctgcg ggcgcgtggt gcaggggacg    139740
     atgcacaggg agccgccgcc gccgactgat ctgcaggacg ctgagtggag aggcaagacg    139800
     tggcctgcag tcacgtccgt tctgcactgg aggcaccggg tacagtgacc atcggttcat    139860
     tgattactgc ggtgttgcgc ggattttggc gttctcctga acgtggaggg aacactcgta    139920
     tttcatgccg cactctcggc gcctggctta tctcctctct actctgtcgt gaaggagcac    139980
     aaccatgaag atccaacgcg taggaaccca accctcgacc acaggcccag ccgactggtt    140040
     taccggggcg gtccgcatcg atgggctgtt tccggcccat gagcccgccc gcgcggcggg    140100
     caacgccgtc acctttgagc ctggcgcccg cacggcctgg catacccatc ctctcggtca    140160
     gacgctgatt gtcacggctg gcgtgggacg cgtgcagcgt gagggcggcc ccgtcgagga    140220
     gatccgcccg ggggatgtcg tctggtgtga gcctggcgag aagcactggc acggggctgc    140280
     acccaccacc gccatgacgc acattgctct ccaggaggcg ctggacggta aatccgtcga    140340
     gtggctggag cacgtcaccg atgagcagta ccaggctggt gaagcaggat gactggtgca    140400
     agcactgcat cgacatcgac cctcctatgc gccagatcat tcggcgtttt ctgactcgtt    140460
     ccactcgcgt gctccacctg tgacgcgtca aggggaagga catgtcaccg caccccagga    140520
     gaaatgtgtc ctggtcatac gtctcctggg tggtgcgcct ttcacggtga gggtgcgctt    140580
     gtgaagtacg cgagcagggg agacatctgg agacccttgg cgaacgcatg aattcggaag    140640
     aggcatggct cacctggtcg ggcgctgacg ctgatgtgct gccagaggag aggccatctt    140700
     tgtgagtaaa tgcgagaatg tacatgcggt gcctgcgtcc caccctactc ctttccccct    140760
     tctcgctcca ccctccgctt tctttccccg tcctgacgct tcccgactcc agcgcgtgtg    140820
     ctcacgcacg agccagagct catgaatccc cacctgaaat cagtcagtcg tgagcgagat    140880
     tcctgaacca ccgtgaagca gtaccagtcc aggaagcgtt ccgaggcctt gctgaagtgg    140940
     ttgtcccagc cccagctccc agcctgagcg cacgtgcatt cccgcatcct cgcggaattg    141000
     accgatctaa gaccaatcga ccgttcacgc ggatggagca cagaccgtcc cgggggctac    141060
     gccttttcac ggccaacctc tttcgtcctg ccgggaggtc gtcagctcgg ccgtacgccc    141120
     gacgagtggt gcaaatggtt gccctgacgc gccgaggttt gaaattgatc gcctgcgagc    141180
     ctctgtgaac tgccagccgt tatgctgcga tgctggctga tgtgagggtg tcatgatgcc    141240
     ttatgccgcc catgaacgtc agccaggcca agcgccatgt agaagaagct ctcaaccaca    141300
     ctgatctgcc cgcacacgct gaacttcacg tgcagacgag ccagaatccc ggccgcctgg    141360
     tgctgaccat gatcgtcagg aaccctgggg tcacgacagg agggaatttt atcgtttcgg    141420
     aagaggctat tcaggactac ggagcgcagg cagtagaaga tgcatttcag cgcgtgctga    141480
     cggccatcac caacgggaat ctcctggtac tggtcggtga ccctgccgac ctggccgtcc    141540
     tgacctcgca cggatggagt gacggtcacc ctgcacccta cgccgcacac tgaaacaaaa    141600
     gcagcaacac cagaacgccc cgccgtgctg accgagcgtg ttcttgtgct caggttgtcg    141660
     tcacggaaga gagcagattg atgtctcagg ctgtgccagt tcgcaggagc cctgggtatc    141720
     gttcgtacgt ttttgagcgt tagcacctgc ttacctgctt atagcggctg gatgatgttt    141780
     ttcggcgctt ctgcatgggc agatgcaact ggttcggctg gtgctgtggg ggagaacagc    141840
     tgtggataga gcctcatggg ggttgtccga cctgccttct tgcgtagatg caggaacgag    141900
     acgagtcgtg cgataccgct agtttttggg ggaagccacc tgttcccctc aagtcatgag    141960
     gcagtctgag acgcaggagg cggagaagca ggaacgaata caggcggctg cacaacgtgt    142020
     tgtctctggt gaactctcgt gtactcgggc agcagacctt gtcgggattt ggacctggca    142080
     ggtgtgggat gtggttgacc gtatgattca cgactacgat ggcgcggact ctgaggcctt    142140
     tcctggagaa gagagtcaag aagccgataa atcgcgtcgg gatggttgac agcattctgg    142200
     tgttctctta cctcgctccc ttcctggttc actgtgctca cgcttgagca tgctgaactc    142260
     cccagcctcg tttggcgtgg tgcagtctgc agacctctca ggcataggca tgtgcctgtg    142320
     ctgcctggaa gcccgtgatc tgatccggat ggaatgtgcg tgagctgtag ttggtcattc    142380
     gctttaacgc ctctgaacaa aaaaacccca cccgccagcc gcaaaggcca ggaggtgggg    142440
     cttcccgcag ggcgcccctc tcggaacgtc tggtcaaagg ttatgagaca cccgggtcat    142500
     ccggtagtcg ctgatagttc agtccagtct tcgacgatcc ttcagttcgg tggacgacac    142560
     ttcatcaaaa ctgggagaca gttcattcgc aattctccgc tggaggctgg tgcgtcatcc    142620
     tgatctgact gttgcgtggc tgatggcgtc ccggccgcag tgccgggacg cgcgcattcg    142680
     catcaggctg tagccaaggg cggtcccaat ctctgcgaga aggacagggc ggcatccagc    142740
     acgtttttga gggcactcat ttcccggggt gcgtcgaggt aggccgcata caggccatcg    142800
     acttcaggca gcaggtctcc ccggtgggct tccaaggcga agactctggc ttctgctaca    142860
     gcacgtagcg ccgcctggcg catcgcttca aggtcgctca tctcaacagg aaatcgagag    142920
     cgcctgataa ccctctgacc aaagaaagaa gactacgagt caagcgccgt gttcagcgca    142980
     cacaacggca cagagaggtg ctggtccacc tccaggtgat caatcaacac gcattctcaa    143040
     atcatcctgg agacctgcag cctgatctgg atggtacgtg tgcgcgacgg tctcttcaag    143100
     ctgctcgagc gggatgcttg agcgtggaat gacggaactg cggggaaatg gcacgagtgc    143160
     ctccaggcgg tgttcctcgc ttgccggagt tctagggcta ccgggataac cgcatcacgg    143220
     tgtactcccc cagatcaagg ggcttgtccc agcgcacagg ccacgcgtag taccacctcc    143280
     cagcgatgct gactcccaga ggcttgcggt aagggggacg gagcgtgacc tccgtaatgt    143340
     ccagcaacca gcgcgtttcc atggcgacga gtccctggac cgtcacgtcg cgtccttgct    143400
     cgagggtggc ctgctggaat tcttccgggg tcaggatgga gaagtcgaat ggtgtggtta    143460
     ttctcatgtc gtgcaggact gcggtgtgtc cgtcatagga cgctgcgctc tagcagggga    143520
     tgtcgataat gcctacgcgc gggaacgttt tcgaggttat ggggtacacc gtgcgtgtca    143580
     tggggttgag ggtacgccag ggaagcgtga gcacttgctc acgctgggtc cggagcgggg    143640
     tgtgtgggac aggccagggg cgcagaatgc gacgaagtag acgggcgcta gtatattccc    143700
     tcgtgtaccg aaggcagcga aagactcgat attcagtatc tgatgagcgt cctgtccaaa    143760
     gtcaaccccg agtagagtga gtcggaagac gccgaatggt atttgctgag atgtaggcgc    143820
     acactgaaag tggaggcgct gtatgcgtcg cggtccgaca tccgccgtcg tggcgctcac    143880
     cgaacatgaa cgtaccctgc tcactgacct cgttcgcagg cgtaagaccc cacgagcgtt    143940
     gctgatactg agcctgacgc cgccgaaggt caatgccaaa cgggtcgatc ctcgctggaa    144000
     acctgaatat ggcgctgcca ggaagtgcat cgaatctgca ttttccgtgc tggtgggcgc    144060
     tggactgcgc tggggacagg tcaagacgta tctcagccta cgattgaagg tggccctgaa    144120
     cgtcctggcg cacaacctga agtacatcga cctttccccc taacggagtc ctgcctgtct    144180
     ggcacaagcg aaagacacta ttcaagcatc aaaatcagtc gggaagcacc cttccgttcg    144240
     atataccgct ggttggtgaa agcaagagca ggccagaaag gcgtttgcaa catcaggcag    144300
     acttgcggcg aagatcgaaa agccaggcac atggatacac agcagctcat ccgagcctag    144360
     aacgacgctg gacatcccat ccgcctcatc gaggtacgtc agacagtcga tccaggcatc    144420
     catgttgcgg ccgtagaaat cagggaagcc aaaggcttgc atggagacgt catggaacgt    144480
     ttcccagtcc cgaatacgcg aagtgtccaa cgtcccttta gccatgacac cattttggcc    144540
     cgacattcgt gtaggtgccg cacaatctca cgctggggtc aacccctatt cgcggtgaat    144600
     aaggttcgct accgactgac actccgacag ccagatgttc gcgacagcgt ccaaaaaact    144660
     gtttgtagtc ttctgactcg ctccactagg tttatcagat cgggaagcca gcgcgccgca    144720
     ggccaccaaa agccgttgaa aacggttgtt caaccggcgc ttctgaagcc cagctgaaca    144780
     tttcaaccga actgacgcgt ataccctccg aaacaacatc tatcagcact tccggcaccc    144840
     acaccagcag ctgcgccacg cctccctcaa cgtcagcagc cttctcaaac caccctgccg    144900
     gatcgccagt aaatgcatca agggctggcg catagtggac ccagctgtcc cacggtggca    144960
     tatccgaatc aacgtcgaaa aacccagcac tcgcgagccc acaagcgccc tcattgagcg    145020
     tgttgctggg atcgtcgcac aacaaaaacc tgccctatgg caagttcctc agtgtgtcat    145080
     ctggcttcca gccacgttcg cgtagaagtt gactgcgacg tatcgccatc ccttcaacag    145140
     ttcgacgccg gtgagctacc gttgcagcac ttctgaagtt cctcaacgcc ctctccatgt    145200
     tcggccagag tgccgatgcg ttccactccg cccacggaac caagccaccc gtctctgcca    145260
     gatagacctt gtacgtgcgt ggtatggttt cgcctctcag ctcacttgga acgcgaacga    145320
     ccggaggctc gtcaggcaag ggctgccagg gatcgctgag aaactcaagc tcatccgcca    145380
     atggcggatc gccgtaccag aaagcaatat cccgaccagg acggagctca gtactgcgta    145440
     ggcacgaggc aacgtcattc gtctgaacgc gcggtgcgca ccaggccata gtttcgagtg    145500
     cccgcctgac gagatccatc cgtcaagctt actttgaagt cgtgctgttc agaccgcccg    145560
     tcaaccgata ttgactgcta cggtcagcga accacaagat gagcaagaaa cagcacacag    145620
     agcaggcctt caaggactat tccgccataa tttttggaat cgaaacttcg gtcaatgacg    145680
     acagagacga cccgtgcaag ggctgcgcca ccccaagcaa ggcctaccat gagccaggct    145740
     tggggcgaag cgatgatcaa actggcaagg ccaagaacaa agaataagcc accatacgtg    145800
     gctcgcactt cagagacgcc gcgcagacca ttcggcagga tgcctacaaa cgcggcggca    145860
     gtgtgaggcc gcaccaaacc aaacagacct agcccgacgg taataaggcc tgcaatagcg    145920
     gcaagcaaag cagccaaggt catggcacac agggcgggtg agtggtagag atggtgagca    145980
     gcatagccgt cctttcgtgc gcttcaggct accagccttt ggagcgcgtt ttatcggcag    146040
     tctggcgtaa cgggaacgcg gttgcgccca ggatccgtgc agcgtcgcga gtgttgcatg    146100
     gtcattctgg agtgcccggt cagttgaagt tcaggatgta gctggtactc cgccccgccg    146160
     ctgccggatc caccttcaag atgcccttac tcaccagatc gctcaggtct cgcacggcgg    146220
     tcggttggga acagcctgcc agcgccgcgt atttactaga ccgcagcttg ctgttcaggc    146280
     cttcgagcat cttgcccagc accttgatct gacgcccatt gagtaggacg tcccggtaga    146340
     gatcccagaa ggcctgccgg ctgcgcacct tgtccaggac gccttcagcc gactggagcg    146400
     cggcgaacac ctggtcgagg aaccagacga tccagcccgt gatgtccacc ccgccccgct    146460
     gcgtgttctc cagcgcgtcg taatacgccc gccgctcccg ctcgatctgg gccgacatgg    146520
     aatagaagcg ctggctggtt ccgtccgccc gcgccagggc aaggtcggtg atggcccgcg    146580
     cgatacggcc gtttccatcg tcgaacgggt ggatcgtcac gaaccacagg tgggccacag    146640
     cagccctgac gaccgggtca agctgagcgg tgtcgaacca ggtcaggaac cggtccatct    146700
     cgtggggaac acgctctgct gcgggggcct cgaaatggac gcgctgccgg tcgagggggc    146760
     cactcagaac catcatcgga ccctcgcggt cgtcgcgcca ccctccaacg atgatcctcc    146820
     tgaggttgct gcggccagtg ggaaacagcg cactgtgcca gccaaagagc cgttcggcgt    146880
     ccaggggcgc accgaatcgc cccgtggcat ccagcagcat ctcgacgacc ccctcgacgt    146940
     gacgggcagc cgggggaagg ccggccacgt ccatcccaag ccgctgggcg atggaggaac    147000
     gcacctgtgc ggcgtcgagg tgttctcctt cgatctcact ggatttggtg acgtcctgga    147060
     cgaggacgga gaggaccgtt tcctgccgga tgtcgaaccc caggctcgcc atggccgtga    147120
     tcaaggctcc gcgccggaag tgaatgtccg cgagccggac gtcaaaggcc gaggagtccc    147180
     agcggaagtg cggccattcg gagttctgat gggcatacac gggcagcctc gtactcatga    147240
     gtcgattata accgctattc aaatcaaact tgatttgaat aggtctgatt tttcgaatca    147300
     tgcaacgaaa agtcagacag cgagagacgt agcggcgcac cgatcgctcg gagagaaatg    147360
     tgcacccgct cggcagaccg caaaggcacc aaggccggca tccggtacat ccggccgcaa    147420
     gaatcgaagg cataagaaag ctcagcctca tcgaactgcg ttaaggcgta ccgaaacgtt    147480
     tccttcagcc ggcgttgttg ccggaaaggc agagcgttaa aggagggggt gacactttcg    147540
     ttgatgaaac gctcaaatcc ctggatgttg ttcagattga cgcggagcca cttatcctct    147600
     tcggcgtcgg cattgcccca gaggttgggg agccggttac ggttcacaag aatgggtcgc    147660
     tgcgccacca cgacagctta agcttgaaca cgcccgtcct gggaacagat tgaagtcatg    147720
     cgcgaccgca acacgcaaca gtccccatga gcacacgccc tagctgatcg ctaacaacgg    147780
     ccgcgcgtac ctctaccgcc ctgacgacgc cccacaccct gctccccacc tcccggtcac    147840
     gctgctcccc cgccagcacg tccaattctt cgtccccgcc cttaccgtca cggccagcat    147900
     gcggcgcacg ggcgcgacgc cttccacgta cctcgcgcgc ttctctgccc agggccagcg    147960
     ttttgattca ctcgccatcc ccgccctcga ggtcgccgcg ccgatgactc gacccggaag    148020
     gcgcgggtaa atgagcacgt cataaccccg cccgcaacga cctggaatgt acggtggctt    148080
     tcgtggatac aacggattcg tcgcctgaat aatgggtgct ggacggccac acctcggggt    148140
     acgctgccct ccatgagtag ggcttcactc gcacaccaga ggaccacatg tcgctcccga    148200
     tttacctaac agtaaagggc acactaaata gggtgggatt ggggctctgc gcttcggtgg    148260
     agtaccgcaa ctcgtattcc ccaggttcac tgggaagcgt gagctgcccc gggttgccgg    148320
     ctgaggtgta gaagtaattc agataggcgc ccacaggtgc gcccttgcgg acgatggtga    148380
     cgtagtcccc accattgttt ggtccggtcc agcgcacctg aattgtggat cctgccttcg    148440
     cctcccgcgg cgcgaccaga ccataggtgg cagcagacag ccggaccggc acgctgtgga    148500
     gcgttgggtt ggggctctgc gcttcggtgg agtaccggac ctcgtaatcg cccggtgcca    148560
     acggcgtgat taagcgtcct ggattgccgt tcctggtgta gaagtagttg aggtagctgc    148620
     cgactggcgc gcctttgggg acgatggtca cgtaatctcc ggggttgttt ggcccggtcc    148680
     accgcacctc gatctggctg cccgccaccg ccgtggtagg tgcctgcagg ccataggacg    148740
     cggccgacag ggttataggc acgctggcca gcatgcgccc gctgatgtcg ttgttgtacc    148800
     ggatttcgta gtcgcccggc gtcaacggcg tgattaagcg tcctggattg ccgttcctgg    148860
     tgtagaagta gttgaggtag gtgccgactg gcgcgccttt ggggacgatg gtcacgtaat    148920
     ctccggggtt gttcggcccg gtccaccgca cctcaatctg gctgcccgcc gctgcactgc    148980
     caggtcccgc gagcgacacg gaagcccggc gtgcagtgaa cggcgcactc cgacccacaa    149040
     cccgggtact gccgtccgaa ttgaccagca tgtatctcgc ctcaaacacg gtctcttcat    149100
     cctgaacggc caggtctact tgtcctgcgg cacccgacac ctttgaccag tccagatagg    149160
     cggtgtcggg atcttcacgc cgcgccagcg tcacccagtt gttcgtgccg cccggtgcgc    149220
     cgctgtacgt taccgtgacc cggccacccg cgacgggttg ggcgggagca acttgcaact    149280
     gcacggcctg cacggcagcg atattgaaag aaaaccggtt aggtccatcc gtggtgaccg    149340
     tcaatccagc atacgtctgt gttccattgg tggcctccac ctggacggag taggtacctg    149400
     gcgtgagctc cgcacggtac tcgccgccca cggtctgaag cgattcggcc gccgcgcctc    149460
     ctacagtgcg ggtcatgcgg accaccggtc cgcttgtcac tggctgtccg cccgaggtta    149520
     gcgtgacgac cactgggact ttcacctggg cgggcggcgc tactgcctga accgcctgcc    149580
     cgagcgccga ggcgagttcg ccggcgctcc gggtgttgac gaaggtgccc actcccgcaa    149640
     aggaagcctg ggcgcgggcg tccagatcaa tgccaataac gcgcacatca acttccagcc    149700
     cgcgggaccg gaaggcctcc aacgctcctt tcacgtcgcc ctgacaggac tcctgcccgt    149760
     ctgtgaccag cacaacgatc cggcggcctg ctgtggtcgg aaagtcctga gcggcctgtt    149820
     gcaggctgta gacgatcggc gttgctcctt tgggtcgcgc gcctcggacg gcggcaagca    149880
     atgctgaccg gtcaagcccg cgcatgggta ggaccagctt gctgtcctgg caggcaccgg    149940
     ggtccgctgc atttatggcc gcgccgtaga gccgcaggcc cacgttgagg ttcggatcgt    150000
     tcggcagacg tccaataaag tctgtcatga cggcctgtgc ggtggccatc cgcgtgtcgc    150060
     ccccaggaag gcgggaaaac atgcttcccg aagaatccag aatcaactgg atcatggtgg    150120
     gaccgctctg ggcctgacct gctccggatg cagagaggaa cagggcgaga cttagacgcg    150180
     tcaggaagtg atgacgggcg aagcggcgca atgaccacat ggcggtcctc ctgtggcagc    150240
     gttgagcgta ccctccaggt ctcagccgag ggctgggcgc tgcatgaccc cagcttagtg    150300
     gtggggacgg ccgtggcgaa gggtatgacc ggacccgccc ctgagcaacc ggcgagcaat    150360
     cacactccca ttccatcttt taccttcctt ccattccatc ttctgcctcc acccggctcg    150420
     caatcaacca cgctacttct cagctgcagc tagcgtgttg ggcggttttt tccgcttgat    150480
     ctcacctcgg caggcacgcg aactgtgtcc tgcacggcct tcgatcgtgc gggcaatccg    150540
     gcgactgcga caacgtcctt taccgtgaat gccacaccga cattcgcgtt taccggcttc    150600
     tatagcccgg tggataactt tccggccgtc aatgtcgtaa agggtggcgc cgcggttccc    150660
     ctgaagttca gtccgggcgg cgaccagggg atggcgatat tcgccgctgg acacccgaag    150720
     gtcagtgccg tcggctgcgc cagctgggga gctgggaatc ttgtagagga aaccgtggcc    150780
     gccagcgtga gcggactgaa gtacgacgca gcgagtggga tgtataccta tgtgtggaag    150840
     accagccgcg tttcggcaaa gacgtgcccg agtctgacct tacgttttgt ggacggaatg    150900
     gagaaggcag cgctcttcga agcgggagcg gacgaatgtc agggattcgg ctgacatcat    150960
     caccagtggc tcggatccgc ttgaccggcg cgcctccgag ccactggtga tgattgaggg    151020
     ccccggaccg aacagacctc agggaagcgg caccgcttgt atccggttgc aacgctgtgg    151080
     aagccagccg cgcgcgtcag accctcggca tccgccactt gcttcatcaa ggtactcacg    151140
     tgttccggcg cggcgtatgc gcccgtacag ttatatcggc gcgttcccgg ccccccggac    151200
     aatgcagcga aaacccaggt gtgatgtgga cgaatccact tcctgtccct gccgagaagc    151260
     aggccggtac cggaagcagt agttcggtgc gcacaggtgt gacccccctt taatcactcg    151320
     ccgctcacgc gtcccgcccg tgcccgcgcg tgtattcagc ggggtacagc acgacttcac    151380
     gtggcgaatc acatgctggg gctgaaacgg gtcaagggtc cattcccata cgttgccggt    151440
     catgtcgtgc aggccatacc catttgccgg gtacgtaccc accggcgagg ttcgtgggaa    151500
     accgtgcggg tccaggttct cccaggggaa gcggccatgc caggtgttcg ccatcacgcg    151560
     gccctggggg cgctcctcgt cgccccaggc gaacgttgcg ccatgcagac cgccgcgcgc    151620
     ggcgtactcc cattccgctt cgccgggcag cattttgcca gcccacgcgg cgtacgcgag    151680
     agcatcctcg aaagcgacat gcacggccgg gtgtgagtcc tgcccagtca gcgtgctgtg    151740
     tgggccttcc ggctggtgcc agcaggcacc gggcacgtat gcccaccatc cggcatggtc    151800
     atacagcggc acaggcccgg ccggctgctg aaagaccacg ctgcccggca ccaggacatc    151860
     gaggggaacg cccggaaact gagctgggtc aggcgtgcgt tccgccaacg tcacgtatcc    151920
     tgtggcctct acgaaacggc gaaattcggc gttggtcacg gggtgcgggt ccatccagaa    151980
     gccctcaacg tgcacgtggt gcgcggggcg ctcttccggg tagtggtggt cggaccccat    152040
     ctgaaagtca ccgccgggaa tccaaagcat gttttcgcgg gcgggacgaa gcagcatagg    152100
     gttctcgtcg ggcaggagag atggacgtgc gccggatgga tgcggtggcc tacccatctt    152160
     ccagggggta ctgtcgcacg gcgcgcacgg caagatgcat cagaaacacg tagaaggccc    152220
     ccacagccag cagcaccaac tgtcctggca ggctcccgat ggccgcgagc ggtaccaggc    152280
     cagtcagggc agggctccca tccgggccgc gcagcaggtc aagcttggcg atccaggcca    152340
     tcagcaccgc cgcgtagatc cacaggtagt tgcgccgcaa cctccagccg agcgcgtcca    152400
     tgcgagtgat gggactgcgc ggtttggcga gttccgcgat cagcagctgg tgccagccgg    152460
     catcgacctt gtcgcccagc atggctgggt agaagaagcg ctccatgatc cgcacgcggt    152520
     gatgtgtgat ttcgaaggtg cggaagcggc gtgcttcgag gtgcaggaag aagtagttca    152580
     tgaacatcgc aaacaggaac accgcatggt tgttctgtga gctgcccagg gcaaaagatg    152640
     aaaggccggc cgtggtgacg atcgcccagt tggtgctggt gtcaagtcgc gcccggtatg    152700
     cggtcatttt gccgacttcc gcgcggtaca ggtgaatcag gctgttcgcc gagttcgtgg    152760
     aatagctcgc ttcggtgatg ggcgccaggc tcgtggtggc cgcccctccg tgtggcctgg    152820
     acagcggaac ggtcggaagc gcgagcactt cgtccatggt agggggcatg ctgatcagtg    152880
     acatggttgt cggccttttc tgagttggcg tgggacggcg cgcagcctta gtcgtgactg    152940
     gccgggtcca gcaccggcgt ttcggcttcc ttgagcgccg ccaccacacg acggtgcagc    153000
     ggtgaggtta cggcgccctg gagcaggggg tcctgggtgt tgtgcatcca cgcgtgaagg    153060
     cgggcaagaa gggcctgatg caccctgcgg tatgacggct cgtccgcaag attcctgtat    153120
     tccagggggt cgttgtgcag gtcgtacagc tcggtgggtg ggtggtaggc cagcatgggg    153180
     tacaccggat tctcagtgtc gatgcgtggc cgccatgact gcgaggtgtt catgaatgcc    153240
     ggtgcggcgc agaagttgac gatcagtttg tactgctcgg tgcgaatggc gcggcgggga    153300
     tcgtagtaat cgtggaaggt aatttccgag aatacctccg tgcgccctga gggtccggcg    153360
     ccgtccagca cgttgaggaa gctctggccc tgcacgtcgg gggaaacggg gaggtccagc    153420
     agttcaagca gggtgggcac gacatcaacg ttcgacagca ggtcctgctg tacgcgcccg    153480
     ccggcccagc cgcgcgcggg gtagcggacg agaaacgcga tttccaggcc tgggtcatag    153540
     agtgagccct tggcgcgtgg gaaggccagg ccgtggtcgg ttgtaaagat caccagggtg    153600
     tcctgctcga ggtgcaggtc gcgcagggcc tggagcaccc ggccgacaca cgcgtcgagg    153660
     taacgcacgg cgccttgcag ctcggcagtt tccgcgcggg cgcctggcgt gtcgctgagg    153720
     tacgcgggga tggtcagtcc caggctatcg tccggttcga tgtaatcgcc gataaagccg    153780
     aggtagtcac gctcctcgcg aactttgggc gtgaggcggt gcggttcgta gtacccgagt    153840
     tgcaggtaga aggggcgctc ggcgcccgcc tgccgccgaa gtacatcaag ggctcgttcg    153900
     gtcatgacgt cgccaggtgc gtcatcgttg gcggcttcgc cgacggcctc atcgaagccg    153960
     cagcgcgtgg cgacctgggc catgttttcg tgccggagtt cgtggtgcac accgaccagc    154020
     gcagtgtgat agccggcagc gcgcaggatc tgggccaggt gctgctcgcc ggcgtgcagg    154080
     tcccaggcaa aatgggcgtg agtaaggccc atcacgccgt tgttgtgcgg gtagcggccg    154140
     gtgaacagcg ccgcgcgaga gggactgcac tgcggggcaa cgcagaacat ccggtcgaat    154200
     ttcacgccgt ccgaggcgag gccgtcgatg tggggggtgt gtacggtggg aataccgtag    154260
     cagccgagaa acgtgccgag gtcatggcag ttgatcagga ggatattagg acgagggttc    154320
     atgccagggt ctccaagggt accggctcag cctttgacgg cgccgagggt caggccacgc    154380
     acgatgtgcc gctgcgcgaa aatcacaaga atcacggcgg ggatcgtggc gacggtcgcc    154440
     gcagcagcca tttctccgta acggatgctg tactcctgcg cgaaggcggc aatgccgatc    154500
     ggaatggtgg cgctttttgg cgtgctggtg agactcaggg ccagcaggaa gtccttccag    154560
     ctgaagatga acgcgagcag cgaggcggcc gcgatgccgg gacgggtgat gggcaggatg    154620
     atgcgcacca gggtctgcat gcggctgcac ccgtcgatgg cggcggcttc ctcgagttct    154680
     ttgggcactt ctgcgaaaaa gctctgcatg ataaacaccg cgagcggcag gttgatgacg    154740
     gcgtgagcga ttgcgacggc caggatggtg tcgtacaagc cgaatttgcg ggcgatgacg    154800
     taaaacgggc ctgcgaagac gaccggcgga atcagattga ggaacagcag ccaccaggtg    154860
     atgccggtgc gtacgcccgg gttccagcgg aaacgggtga ggctgtacgc gccgagcaca    154920
     cccacgaagg tgacgatggc ggtactgatc acgcccacca tcaggctgtt cagcgcaagg    154980
     cgcaggaagt tactctggct ggggttgaac agcgccgcgt agttgtcggg cgttgccgtg    155040
     aacacgaagt tcatcgcggt gatgtcccgc aggtacttca gtgacgtcag gagggtgtac    155100
     agcagtgggc ccagggtgat gcacactgcg agcagcagca gcgcgctgcg taccaggcgg    155160
     ccgggggtga accgggacag ggagaaagca gcgcgggtca tgaagcgtcc tttcggctgg    155220
     tcagacgggt ttgcatcacg atgaacacga tggccacgag tgcggcgatc accgcgagcg    155280
     ccgagccgta gccgactcgt ccctgctgga agatcagttg ctcgatgtac aggccgacca    155340
     cctgactgga ggtgcctgga cccccgcctg taaggagata gacctcatcg aacactttga    155400
     atgccgccac ggcgcgcagg agggtagcca tgatgatcgt cgcggtcatc agaggtaacg    155460
     tgacccggcg caacacctgc gcttcggttg cgccgtccac gcgggcggct tctttgagtt    155520
     catccgggat ggattccacg ccggccagca ggatcaggaa caggaagctg gtccagtgcc    155580
     acacatcgac gatcattacg gagaacagcg ccaggctggg gtcagcggtc caggtggggc    155640
     cgaggatgcc caccttagcg agcagctggt tgatgacgcc gtagttcacg tcatacatca    155700
     agcgccacat ggtgccgatg gcaataccag gtataaggat gggcaggacg agcaccgggc    155760
     ggtacagcca cgacaagcgg cgggattccg ccacagcgag cgccagaatc agcccgagga    155820
     ttacttcgac gatcacggtg accaccacga acaacagcgt gttgcggaag gcggtggtca    155880
     ccaccgggtc ctgaagcagt tcagcgtagt gtcggccacc tacgttggtc cattgagcga    155940
     cgttgccttc gaagcggacg tcggacacgc tcatgacgat gagctgctgg agggggtaga    156000
     tggtcagggc aagcagcacc agcaccacgg gcagcaacgc ccagtactgg aagtaacggt    156060
     caccgctgcc aagcaaagtg gcgagcaggg gcttggagac gtgaggcttg gatgaccacg    156120
     gttgctttcc gatcatgtgg aggatcctcc cggaaggcca acccccgcgt cagcgggggt    156180
     cggcgggtga cgctcaacgc agcggtttga ccttgtaacc ggcgtcagtg aggatcttgt    156240
     ggatttcgcg cgcggcagcg tcgagcgtcg cgtcggattt cgcgccgccg ctgatcacct    156300
     gcggcaggcg gcggttgagc acttcaataa tctgcgcgga ttcccgcacg cggggttgcg    156360
     ctttgataaa tggtgtgctt tgcgccatgg ctttcatcca cgcgaactgc ttttcgtcac    156420
     ccagttcctc gaagacgtcc tgacggacgg ggatggcccc ggcccgcgcg tagttcatct    156480
     gggctttctt gctggtggcc cactccagga agtccagcgc agccttcttg cgggcggtgg    156540
     gaaggttttg cgggatgccc atcacccaga tgccactcat ggtggcgcgg cgggtggcgg    156600
     tcgcgccggg caccacagtc gcggcaacct tgccgaccac tgaagacact ttggggtcct    156660
     cgaagctggg agcgagtgcg gagaccatca cgcccatcgc caggcgaccg ctggacatca    156720
     gcgcggccat atccgcctgg ccgaggttgg cgtagttgcg cggcccgtat gtctttccga    156780
     ggcgcaccca ggtgtcgagc gccctgctcg ccacgtcctg gctcaggttc acttcccact    156840
     gcttgctgct cgtgtcgtac ttcagcaccg aacccatgta gctgttcaga atgccctggt    156900
     agtcgtaatc gggcggcgac gtgcgcgccg caaacccata catgtttggg gcgtcgtgca    156960
     gcacttttgc ggctttctcc acgtccgccc aggttttcgg cgcagcaaga ccagctttat    157020
     cgaacagatc cttgcggtag tagagcagct ggatgttgcc gttaatgggc agcccgagta    157080
     cttcgccttt tttgttggaa ttcttcaggc gcgcgtccca acgagtggcg taatcgtact    157140
     cgatgatctg cgggtcaagt ttgaaggccg ggtcaatctt tttgagcggg gtgatctgcc    157200
     catcggcgta aaagcgcatg taccactgct cattgaggtt gacgaggtcg aactcactct    157260
     ctttggccgt cacggcgttc tgggtctttt gcagcatgcc ggcaaaggga gtgacgttca    157320
     ggttgacccg ccggcccgtt tccttctggt actgctctac aagagccttg aagccaggga    157380
     accatgggga gtcgttgatg aggatgctga tggcctgagt gttgccctga gcggtgctgt    157440
     tggacaggct gagggtgagc ccggtgagga gggcggtaag cgtgacacgg gtgcgggtgc    157500
     tgttcatttg aactccttgg ggtgagggta tggacgacgc tcaggccggc gtgggcaggg    157560
     tggcgagttg cagggcatgg tgcgcggcgc caagcggcgc agcaatgtca cgactggcgg    157620
     ttgagaagac caggttgagg ttgcggccga ggatgggttg caggtgtgtg cgggtctgat    157680
     gaagcagctg ccggttgagg gattctccgc cttcgatgat gtaaccgccc agcacgacgt    157740
     tcgtgacctc aaagacattc acggcgttgg cgatgccgat ggcgaggaaa cgcaccagtt    157800
     catccacgat gcgcttggcg tgctcgtcac ccaggtgcat gagctgcacg gcgtcgctca    157860
     ggacggcggg atggccgagc tggttgaggg cgctgtgagg gtgctcgtcg tggagttcgc    157920
     gcagcagccg gcggaaagcg cgcgcggagg cgtactcctc caggcagccg tggttgccac    157980
     agacgcagcg ccgaccgtcc ggcacgacgg tggtgtgacc gatcagaccg gcgttcccga    158040
     acatgcccgt gacgggcgtg ccggcgttcg caaggcgcag cccgatgcct tcggcaacat    158100
     cgaagtataa gaatggctgg ttgtgaaaca ccgtatgctg ggctggttcg gcgagggtca    158160
     gcgcatcaat ctggtggatc aggtggacgg ggcgctggag gaccgcggcg agttgctgct    158220
     ggatggggat gtcctgcaag atgtcgatgc gggcgctgcc gatccacaag ccgcgcgtct    158280
     ggtcgatgaa gccggtgacg gcaagtccgc aggtttgcag gtgggtgtcg gcagggatgg    158340
     cagtgtcggc gaagtgctgg atgctgctga gcagggcgtc gataagttgg ggagtctcga    158400
     gggtgaggtc gacggtccac tgcttggtgg tgagggtgtt gccggccagg tccatcaggg    158460
     cggcgcggat gacgggaagc tcggcctcaa tgccgaggat ggtgccagct tgtgcgctgt    158520
     agcggtaaag gatgggcggg cgtccgccgg ttggttcccc gtggcggtag cgctcgatca    158580
     gcccttcatg ttgcaaagca ctgagaactt tcaagatggt gggttggctg ataccggtgc    158640
     ggcggacaag ttcgtctgtg gtgacttctt tggtgttctt gaggacattc agaacggcgt    158700
     tgcggctggc agcggatgac cggctgggac ggtcatgctg ggccacaggg ggattcccgg    158760
     tggtcacagg ttctcctgaa gtgctgagac tttactaaaa tgttttgtaa aagtcaaaca    158820
     aatttcagac accagaatgg ccggccccgg cagagcgcac ccgcgttcgg atggaggaag    158880
     cactcgaacg gaatactgcg gtcgtgttcc aacggacgaa cctgcctccg tcggcgagat    158940
     ctcctggcgc ccggtcatga gttcaacagt ccctcctgcc acgctgaaac cagggaagct    159000
     gtcgcgtcag atggacgccc acaatgactc gcggtgtgcc acagtcgctc atgccaaccc    159060
     gtgatcggtc ccaggtgagg acgtagcatg cccatgagcc ccgacttctt gccccggacc    159120
     ctgctcctgg tcctgctcat ggttcctttc accctgtggc tacgccgcca gggcatgagg    159180
     aggtgggagg agataatcct cgtgatcctt gtcctcgtgg cgttccagct gttgtgggac    159240
     tgggtgctct gggacctgct gacttgaggc cgcgcgaccc tcgttcctgg aagatcatgg    159300
     agaactttcc accttctaaa ggcgtatctg cttcatgctg atcgtgaaga gcaccacagt    159360
     cttcctgaaa cgcttctatg acctcaatgg tgagcagatc ggcacgctga ccatcgcccc    159420
     tgggtaggag gagctcgcaa cggccgcttg aacctggggc acgatgacgt taccaagctt    159480
     gaattgacgg gcaggacgta ccgcctggaa tacgaagtgt ccaacctccg ctcgttctga    159540
     ggaaacgaaa tccggtattt cctgatggat ggcacaacag ttctcgcaac cgctgctgct    159600
     tatcatcaag ataacaagcg caactgggat ctcgagatag acagccggtc atttgaactc    159660
     gtcaatcgca gcagctggca ccggctccgc tttgccctga tgcaggacaa cgctcaggtc    159720
     ggtgaaattc aggaaaccac gcgcctgttc gcggtgacga gaacctacga ggtcagggcc    159780
     ccgcgatcat tcgacccggt gattcaggct tttctctatc accttgcggc agcccgcacg    159840
     tacacatcgt gatcacggac ggaagaaggc gtgaaccagt acggtccttc cgccccgcaa    159900
     cagtgttttc actgcaacga ccaaacgacg gcatgatttg atcacacccc ggttggagga    159960
     gtgatccggt tcatcttgag tctgttgagc gcctgaggag tgcgggtgct gcagggacat    160020
     tcagcactcg cactgatagt caaacccaga aggcggcgct acaacattac tggcaccacc    160080
     ttcgatcacc tcctgcgatt caccattgac tcgcggggtg ccacagtcgc tcatgccaac    160140
     ccgtgtttga tcccaggtga gggcgtgaca tgtagaacgc caccacttcg atgttcccga    160200
     tcagtgcgtc gttgaactcg ctcagctcct cggccggcac ccacaacgcc tggaataccc    160260
     cgaagtgccg gacggcgtga ttgggattgc ggcacaaaag atggaaatcc gtgcgctttc    160320
     tgtgttcaca cccaccgtta cagtgtctgg cgtccggagt ttagggttct gcggtcatgg    160380
     gactgatggt cgcccgaacc tgccgcacgc tgtctgcggg caggccagca gtcctggcat    160440
     gctcatgaac agcttcttcg ttcggtgcca ggtagatgca gtggatggca tcgtcagtga    160500
     cataactttc gacccattgg acgtttgtcc cattctgctg catcctggcc agtacaccgt    160560
     tggagttctg ggacgcgctc ctgagatcat cgccggacaa ctggcccgct ccgggcattt    160620
     tgcgctcgat caaatacttc ggcatgttgg ttctcctcgg ttccaggttt cacgacaggc    160680
     gaccgaacga acgctacgcg gctcaccctt tcagccggtt cccattaagc cgccacaaat    160740
     ggaggtattt aaggcaaggg catgggcaag tacttaatca taggcatgaa ttgttgtcac    160800
     gtcagtaagc ggcatcctag gagtatcagt acggcaattt ttctaccaag gtatcgaacg    160860
     tcacggccag agatctttga ggtcttcggc aaccgcgccc agcaactgct ttcggctggg    160920
     ttccagcata acgaatcgcg ctcagtgccg taagcggcgt aagcgacggc ggcgcccagc    160980
     cctgcggcca ggaccgttac cacttcactc atttgctgat cccaggtaca cgcggcgaat    161040
     ctcgcagccg ggcgacagtt cggttagcag ggcctcgagc gcgtcgccgg cggtggtcag    161100
     gtcctcgggc gtcatcggtg cgagggcgtc aaacagaaag tacgccctcg tcgtatcgtc    161160
     cgtcaggcgg gtacgggtgc cctgccgcca gttccacgcc cggcacgtca cgccggcctc    161220
     gtcggcccag acgacttctc ctggcaccgg atgatcaacg aatgcagcgc cgtccttgtt    161280
     agtctcaaaa ggctccttgc catcggcaac cttcaacgtc accgggccga cgacatggtc    161340
     gaggtcctca ccaccgcagg gcacgacaaa gcggacactt accgcgttat aggcgtctgt    161400
     caggcggttg atggccggca gctccccgcc cttgaccacg cgggtgatca gggcctcagc    161460
     ggagttcatg gttttcttcg gtttcatgcc gaacgcgcgg aacgcgtcct gccaggcggc    161520
     cacgtgcggg tgggcggcca cgggtgaggt catgaacatc tgacgggcgt ggctttcggc    161580
     ctcccggagc agcgcgatgc tgcgctcgtt gctgggaccg ttcgtcaggc cggaagcgag    161640
     caggacgagg ccgtggtagg tcgggaaacg ttcagccacg agtggactga tctgaagcgg    161700
     attggtcatg aagtgatctc caaaattcaa gggcgtgggg ttacttgcgt ttctgccagc    161760
     cgggggaggc ggtgtcgttc ttcgcgggcc agcggtcact cagcccgggc aggtggccct    161820
     gtttgccggt gatgctctca ggcgtgatcg cgtacacgat ggtgccgttc acgcgcggta    161880
     gcgagtcctt ttcccggccc caggagtcct ccggagcgta cttggtcatg aacgcccggt    161940
     agaagcgcac tttctcatcc atgtcctcca cgatgcggat gcggccgaac acaatcacgg    162000
     agcggtacga gacggaggtg tcgcattcca cgtgcccgta cgggaagatc tcgccaggtt    162060
     catctacctc gaaactcacc tgctcgtgga agcgcacatt tgtcaggaat tgcccttcgt    162120
     accgggcggt atgcaggtag acctgcccgc cttgccaggt gaacaggttc ggcacgacgt    162180
     acgggtagcc gtccgggccg agcgtgccgg tgcgcccaca gaaggcggag ctgaggaacg    162240
     cttccgcctc ctcgcgggtc atggctttgt cctgacgttt gagttggccg cgaggcgtgg    162300
     tatcggtcat ggcaggctcc tctgaattag gcggggggct gggcggcatt cgtggacgca    162360
     gccagggcgc tcagggcggg gccactgagg ctgtagtcca cccagacggg attggcctgc    162420
     gcgcccaggc gttcgtagaa gcgctgacct gcttcgttcc agttcgccac cgtccagcgg    162480
     atggatccgc agccccgcgc cgtggcttcc tgggcagccg cgtgcatcag cccctccccg    162540
     acacgctgac cacgcgcgcc ctcggtcacg tagagctcct tcatgtacag cgtcgggctg    162600
     gccgtggcag taaagggaac gatgtagtac accagcatgc cggtcagggt cccgtccgca    162660
     tcggctacca gcgcatgaaa gtcgggcgga tcctgctgaa agccctgatg gagcagaatt    162720
     tcctcggtca ccgcaaacac gtcgatgtac tgttcgaatt cagcgagggc gcgcatcagc    162780
     tcaagaagct gcgggatgtc ctgttctgta gccgggcgga tgatcgtggg catacgcgtc    162840
     atcctgaacg accattggtc agttcggaag atccaattcg caggaaaaat gaccaaccaa    162900
     ttgtgcgtcc ctgttaccgg tgatccgatt gccgggcgtg acgctgcctt aacctgccgg    162960
     gcgacgtagc ggcctggtgg ttcatcacct cgaccagcac ccgggctccc tgccggatct    163020
     gctcgatctc caggcccccg taccccagca ggagcccgcc cggagcattc tgagccacgt    163080
     agaagggagc caggaggctg acgttcactc cccgcgctgc ggactgccgg gccacttcct    163140
     ccgcgttcag gcgtgcgtcc aggtccaggt gaacatgaaa gcctgcttcc aggccgccga    163200
     cccgagccac gtcgcgcgcg ccctccagtt cacgcacgag ggccgcgcgt ttgcgggcgt    163260
     acacccggcg catgcgggcg aggtgccgct ccaggtcccc tgcccgcagg aagatcgcca    163320
     gcgcccgctg gacaggccag gaggtgtggt agtcggcgat ggtcttcagc gcttccagcc    163380
     gctcacgcag caccggaggt gccaccacgt acccgacccg gagggctggc gacagcacct    163440
     tcgagaacgt gcccaggtac accacccgcg agggatccag ggccgccagc gcgggcagtg    163500
     gggcggtgtc gtaccggaat tcaccgtcgt aatcgtcctc gacgatcagg ctgtcgtgcg    163560
     cctgcgccca gtcgagcaag gcgcggcgcc gcggcagcga gagccggctg cccagcggga    163620
     attgatgtga aggcgtggtg tacacgagcg ttggcgcctc tgcccccaca ggcagttcac    163680
     tgacccgcag gccgtcccca tcgacgggca ccggcaggat ccgtgcgccg cgctcacgca    163740
     gcacctgccg cgcgaggcgg tagccgggtt cctcaaaggc cgcgacgtct cctggggcaa    163800
     gcacggcgcg cgccacgagg tggaggccct ggatcgcccc ggacgtaatc accacgtcgt    163860
     cgggaccgca gggcaccccc cgggagcggt gcaggtacgc ggcaatctcg gcgcgcagtt    163920
     cagggtcacc ggctgcctgg gcgtacgcac cgggtaggga ctcttcactc acccggcgcc    163980
     acgcgcgttt ccacgcctcg tccgaaaggg gcgcgaccgc cggttgaccg acccggaagt    164040
     cgatggcgtg cggatctttc gtagccggag cgacatctgg cgtgacaggt gacgcccgca    164100
     accagtgggg cgtgccagcc actggcgtgt gaggagcagg cgcgacaggc gcggcaggga    164160
     ggtccacact gacgtacgtg cccgacccga cctgaccgac caggtagcct tcggtgagca    164220
     ggtcgtcgta ggcggccatg acagcccccc ggctggtgcc gagcaccctg gcgagtgtgc    164280
     gggtgctcgg caggcgctcg ccgggccgca actgtccttg aaggatcgcg tcgcgcagtt    164340
     gagcctggag ttgccgggcc acgggtacgg ccccatccct gtccaggtgc aatggcacgt    164400
     cgatcgtcac gtccagggac caggagggga gagggcggcc atgtccgttc agagtggcac    164460
     tgctcgggtc aacgcatcaa gaggcaggtg aagctggatg acccattcga accggaacaa    164520
     gcgctcgagc agccatgcaa agccagccct gcattaccgc agggctggct tccaccttca    164580
     cccatacggg ggattcactg cccctctcct tgcgcatccc gctgtcatcc gtgtggccgg    164640
     gctatgtggg cgtagcccac gagcaccacg accaaccgtg agcatcgagg tcacgcgctt    164700
     accgggtttg ggtcacctta ctgagaaggg gaggatggtc tggatccagg ccccggcgca    164760
     cggcaaggtg agcagcgaac aggtaaaacg ccactgcact gcctacgggg tccgtgagcg    164820
     catgacctgt agacatcgtc ctcagggtgc tctcggacgc gggcccaatg gtccgaaggt    164880
     ccgatcgagt ggtatgcagt ccttggtaag cttcagccga actgttcgcc gcagcgtcca    164940
     aggaagtgaa cgccaagaca ggcacgcctt ccaccagcag gcgcttggga ccatgactga    165000
     attccgctgc gctaaatgcc gaagcctgaa ttccgcatgt ctccacaagt ttgagagcgg    165060
     cttcctgcgc cacaccaaag tgcatgcctc tggccagaac caccagttgc tgaataaaac    165120
     ggtaccgctc tgccagatca cgcgctcgtt cctccagggc caatatctct ttgagcacct    165180
     caggcagacc agccaaagca aggtcaaggt caaggtcgcc cgacagttgt gccaccacag    165240
     gaagaaacgc cgtcaaactg gccaggtaac tcttggtcgc tgcgaccgcc cgctcctccc    165300
     cgcactgaag gggaagcaca aactcggccg cgtgagcgag cgcactgtct tccacgttca    165360
     ccagtgcaac ggtcaggccg cctcgctgcc gggccatcct gagggtttcc accacatccg    165420
     ggcttgctcc gctctgtgaa acggccagga caagtgctcc ctgtagatca agctgagccc    165480
     catataacgt gtgcacactt ggcccgatgc tggcgaccgg aagcgagagc tgggtctcca    165540
     ggccatattt caggaagctg catgcatgat cactgcttcc tctggcaatc gtcactgcca    165600
     tctttggcgg acgctcccga atggcacaga cgatttcctg gacgcgggac atgttctgga    165660
     cgatctggcg gcggatgact tccggggctt cgcgagtctc ctgaagcatt aaaggagagg    165720
     atgggtgccg ctgagtctga gtcacagtga aatctcctga ccgccgatat agacggcctt    165780
     gatggcaagc tcccggttga gcacgaccag gtctgcccgc agtccttctg aaatttgccc    165840
     gcggtcagtc agtccaactg aggcagccgg tgtggcactc agcatccggc tggcttcggc    165900
     cagggaaact cctgccctga cggcattccg gagtgcggtg tgcatggtca ggacgctgcc    165960
     cgccaacgtc ccgtctgtca gacgcgcctg tccattcttg accaggacgc gctggccgcc    166020
     cagttcgctc tccccatcac ccagccctgt agcccggata gcgtcggtaa ccagcaggac    166080
     ccggtttcgg gcagccgcgt gagccagcag aaatgctgtc gggtgaacat gggcgttatc    166140
     aaggatgatc tccacgaacg tctcagggtt ggtcagcagc gctccaggga cgcccggcaa    166200
     gcgcccttca atgcccccca tcgcgttaaa caggtgcgtg ccggcagtgc gggccccccc    166260
     ggcctgaagc gcgtcgagga gtgcttttac cgtctgggca tcggcccggg tatgaccgat    166320
     tccgatcctg attcctgctg cggtcaactg caaagcagcg tgccagaccc ctggaagttc    166380
     gggcgccagg gtgaccgcgc gcaccacatc cagctccagc acctcagcca gaaggtcagc    166440
     cgtaggttca atcgcgaagg gcggttgcgc tcccaaccgc attggactga tgaacggtcc    166500
     ctccaggtgc gctccaggaa tgtcggcgcc cccatcgaca ccctcttcca tcaccgcctt    166560
     cactgcgcgc agggctccca ccacttcggg ccagggggca gtcatcgtgg tgggcaacaa    166620
     tgtcgtggtg ccgaaccggg catgcgttcg ggccatctcc cgaatacctt tcactccgtc    166680
     catggtgtcc ccgccaccgc ccccatgcac atgcgtatca atgaagcccg gcaggatcaa    166740
     aacatcatcc ggagcgtccg gtgaaggtga aacctgctgc accgtttgag taaacaccac    166800
     tgtcgcggga tggaacgctg caccgttaaa gacccgccca gtgacctgtc ggaccggaag    166860
     gcgtgcttgc cgtgccgaga gtgaccctgt cacaggatct ggcgcctccc gtgttcactg    166920
     atgctcacca agttcgtcag cgtgcggctt ttcccggcaa accgcatctc gccttcgacc    166980
     atcgtgcggg ggggcatggg gattagccgc aggatggaca ggctcgttac actcttgcca    167040
     gatcctccct ccacgccggg catcccgccc ttgttgatat gatatggaag gtgacatcac    167100
     cggcggtgtt gaagttcgtc ttcaggctat ttacagccag tagttcctcg ccctgacggg    167160
     tcatgcggtc atctcctgcc ggatggtcct ggcgtgcaag gccacgccaa gaagaccggc    167220
     atcagcaccg tgagctgctc gggtgagccg taagtcaggc aaagcggcgt tcagcacgaa    167280
     gtgggtccag tcacgcagac ccaggctgcc cccgagtgaa accaggttca ggccgagcag    167340
     gcagtgggcg tcgtggattc ggtctgccag gatctggaaa ggggcagtaa gaagtgtttg    167400
     ggcgtgcacg tcgccttgct cggcagcatc gaacagcgcg cgaacgcttc ccagaggacc    167460
     ggcagcctgt tccaggcctc tcccagagga cgtgacctcc agtgcctgcc cttcagggcc    167520
     acgggcaaag cccagaccga tgtccagacc ttcaggcgct tgtacgaggc gcccgcgcag    167580
     caccagccca ctgccgatgc cggttgagat cgtcagaaac atgaagtggt ctggctttcc    167640
     ggatgcctgc cattcggcaa gggtggccgc cttggcgtcg ttgagcaccg ttactggccg    167700
     gccggtggcg cggctcagaa ggccttctac cgggacggca gtccagccgg gcatcgtcgc    167760
     ctgattgatg gccgtcacac aaccctgatg cacgcggccg gtgcaggcca cagccagcgg    167820
     aacatacggt ggggcgtggc attgattcag gaggctcaaa acttgatcca ggacggcctg    167880
     gggcccctga ctggctggcg tggcggcttc gtgccggtga gtgacggcgc taccctggac    167940
     cactgccacg cgagtggtgg ttccaccgat gtcgacagca aggcaagttc cttcagctgc    168000
     cgtcacggag tgctccggcg aaccaggtgg taatgacatc cggacgggtg atagcgctgc    168060
     cgacgaccac cgcgtgtgcg ccatggcgca tggcacgtgc cgcgtcctgc gggctgttga    168120
     gacgtccctc agcgataaac gtcaaccctc cttcacgaag ctcgtccatg aggagccagt    168180
     ccgccgtggt cagtgctctg ctatgtgggg tgtacccggc cagggtcgtg ccgacgatgt    168240
     ctgcccccgc ctcgtaggcg gcctgggcct cgggaagggt actgatgtcg gccatggcca    168300
     gcgcgccagc ggcgtggatg gtctggacaa ggtgcacgac gctttccggg cgaggacgca    168360
     gggtcgcgtc aaaagcgacg atgtcacttc caagttccgc gaggcgcgcc gcttccgcac    168420
     tggtcggggt gatgtacacg ggggtgtctg ggcggtccgt tttcgtcagc ccgatgatcg    168480
     gaaggtctgt gaccgcgcgc acggccagga cgtcctcgaa gccctggatc cgcagtccgg    168540
     cggcgccgcc ttgctgcgcg gcaagggcga ggcggctgat gatgtggggg tcgcgcagtg    168600
     gacttcccgg gttggcctgg caggagacga tcagcctgcc gcgcaggcgg tcgagaaccg    168660
     cgctcacagc aggccgccct cccgcaggat ggcgcccacg cgttctgttt cctggtcgtt    168720
     caggggcaga ttcggacggt tcatgtggtg gtagggaatc aggcccatca gcttcaaggc    168780
     ggtcttgaag ccgcccacgc ccgaggcgcc tccgctcgtc cgcggcgcac cttgcagcgc    168840
     aatgctgaac agacgaatca agcgttcctg gatctgccgg gctttgaccc agtccccggt    168900
     ccgcgcggtg tcgtagagcg ccacatacgc ggccggatcc acgttcccca aaccaggcac    168960
     gcagccgtgc gctccgacct ggaaggcagt gtccaccatc agttctgagc cggtgaacag    169020
     ccggaagtcc gggtcgttct gacattccag ggccagcagc cggaagttgg tgtcgtcccc    169080
     gctgctgtct ttcagaccct cgatcagccc ctcggcgcgc aatgtcctca aggtggcgcg    169140
     ctccagtttg acgtgtacac acaccggaat gtcgtacgcc atgatgggca gaggcaccgc    169200
     ctgccggatg gcacggaaat gttcgataat ttcggtctgg cttgtccggg cgtagaacgg    169260
     agcagtgacg acgagcccgt ccacacctgc ggcctgcgcg tctcgggcgt gcgcaatgac    169320
     gcggtcggtg gtcgggtcga tgacccccgc gagaagggga acacggcctt gggtctcatc    169380
     aactgcgatt ctcagcactt cgcggcgggc gggcgcgtcc atgaacacga cttcgctggt    169440
     ggagcccagc aggaacagac catggactcc tcccaagagc agatgccgga tgacctggcg    169500
     aagggcggtt tcgtcaacct gatagtcggg agtcaggggg gtaacgaccg gcgggataat    169560
     gccgtgaaag gcctgagcgg cacggatggt ggtcatgtgg gtctccaggt ggggttgggg    169620
     aaagccgttc aaggaaagtg gcgaacttac tggcgggctt tcgggtcgag ggcgtcacgc    169680
     aggccgtcac ccaggaagtt ggtggccagc accgtaagaa caatcagcgc ccctgccggc    169740
     atccattgcc aggggtaggc ttccaggacg gtaatttcac gcgcggtgct cagcaggttc    169800
     ccccagctgg cctgcggagg ttgaacgccg aggcccagga agctcaggcc ggcttccgta    169860
     agaatggcgc tggccacgcc aagactgacg aagaccacca gcacgtcaac ggcgttggga    169920
     agggcatgct tgagcaaaat gcggcggtcc gtggcgccga gggcgttggc tgccgcaatg    169980
     aattccagct cccggacgga gagcagcttg gcccggacca gccgggcggc aagaggccag    170040
     ccgagcaggc cgatgatcac gatggtcttg tcgattccag gcccgatgat ggccgccagg    170100
     gtgagcagca cgataatgct cgggaaagtc atgacaatat cgacgaaacg catgatcacg    170160
     ttgtccaccc agcccccgaa atagcctgcc agggcgccga gaatggtgcc caccacgacg    170220
     gagatgagcg tactgaacag gcccaccatc agggagaccc gaccggcgct gaaggtccgg    170280
     gcgaacacgt cccggccggt cgggtcggtc cccagccagt gccggctgct gggcggctgg    170340
     ttgcgggaca tcaggtcaat gtcgtccggt ttgaacgggg aaaccacggg accaacaaca    170400
     acggccagga caatcaggct gagcagcagc aggccgagga cagccaggcg gtgacggagg    170460
     aagcgtttga aagccagggt ggtgggattc cgcctgattc caggtgcggt gagcgcagtc    170520
     attcgggcac ctccttttag ctgtaccgga tgcgcgggtc gatcgctccg tacagcacgt    170580
     ccgtgatgag gttggcgagg agaatcacgg tggccagtac cagggtggtg cccatgatca    170640
     tgggatagtc ccgggagtcg atcgcgtcca ggtacagctg cccggtgcct ggccaggaga    170700
     agatgctctc gaggaacact gcgccgccga tcaggttggc gacattcgcg ccgatgaccg    170760
     tcacgaccgg aatcaacgcg ttgcgcagta cgtgtttgct gatgaccctg gtgtgcggaa    170820
     cgcccttcgc gctggccgtc cgaacgtaat cctggaacac cacgtccaga acgctggagc    170880
     gtgtgtaacg catcaggacc gcgatgtacg tgacagagag gatcgaggcc ggcagaatca    170940
     ggtgactgag ggtgtccagg acgctgccgt caccgggcgt ctggtacccg ccggcgggga    171000
     accactggag cttgagggcg aagacgtaca tgccgatcaa cccggccaga aaggcggggg    171060
     tagagatgcc caggaatgcg aggaatgtca ggccgttgtc cagcgcggtg tagcgtttca    171120
     cggcagccag aaccccgaag aacaccccga gggcgacgcc gagggtcata cccaggccca    171180
     tcagcatcag ggtgggaggc aggcgacggg cgatctctga tgtgaccggt tcaccgttct    171240
     tgatgcggta cccgaggtct ccctgagcag ctttgccgag ccagcggagg tactggacgg    171300
     gtttcggctg atcgagtcca agttcggtgc ggataatttc gcgttgctgg acgctgatga    171360
     cctgatccgg agggatgtac gcatccatcg gatcgccggg cgtgaattga agcatcgtga    171420
     aaatgatggc ggtgatcacc agcagcagcg ggatggtggt cagcagccgc cgaacaacgt    171480
     aggtgcccat gtgtcgtgcc ctcctcgggg cctggcggcg ggctggacgg gcgtccggtg    171540
     acactcttgg accgtccagc ctgccgcact caggggttta cttgatgtcc cagaggtgag    171600
     cctgatcgtc gtaccggccg ccgccgggcg caggagtcca gacgaagttc acgaggtcct    171660
     tggtggctcc gccgaagcgt tttgcggtcc agagtgtggc ccacggaagc tgctcgttca    171720
     cgagactgca cacgttctgg tacgccttgg tgcgggcggc tacggctgcg gtctcctgcc    171780
     cctgctcgaa cagcttgttc acggctggca ggttgaccct catgcggttg gtgccgttcg    171840
     ggggcatgaa gtccgaatgc aggctggggt agagcgtatc cgggtcaggg ccgttgccga    171900
     ttcccgcgta caccatctgg aaggccgtgc cgttggtgac ctgattgtag gtgggggtgt    171960
     ccaggaagcg tggggtaatt ttgaggccca cttgcgcgaa catctgctgc aaggtcacca    172020
     gaacgtcctt gctgagctgg tcggtgtagt acgtgatgac ttcgatgttc tgactgctgt    172080
     tccatccggc ggcctgaagc agttgccggg ccttggcggg gtcgtaagcg tacttattga    172140
     cgcttttggg cacgtagcgg ctgtttgtga cggggcagta agccagctcc gcgccgccgc    172200
     cgtacagttg tttgatgatg gtgttgcggt cgatggcgtg caacatggcc tgccggacgc    172260
     gaatgtcttt gaactggtcg ctggcgttgt tgaagccgag gtagttggcc acctggctgg    172320
     ggccgctcag aatgctgacg ctgctgccac tgaatgtttt ggtgtcgtcc agggtcaggt    172380
     acgtgaagtc gatgttgccg ctcttcaggg ccaggacagc ggccgcctgc tccttgaagt    172440
     aacggttcac cagccggtca actttgggtt tgcctttgta gtaattgggg ttggctttga    172500
     gttcgacgta ctggtcaggc acgtgacggc tccacatgaa tgggccggtt ccgacgggtt    172560
     cggtacgcca ccaggtggag gtgcgcagtt cccgggcggg gatttttgag agttcgtgct    172620
     gaggcaggat catgaagctg gtcagggcgt cgagcaacgc cgcgttgggc ttgctcaggg    172680
     tcacgacgac cgtccgtgta ttgggagtct ggatgcttcg gatgttgccg aacttcgcag    172740
     cgaatgcgct gccggagtcc gggttgttgg cgagttcaag actgaatttg acgtccttgc    172800
     tggtgaaggg tttgccgtcg tgccatttca cgccgctttg caggataaaa gtgtatttct    172860
     tgccgccgtc cccgaccacc caggagctgg caaggtcacc actgattttc ttgaacccgg    172920
     cgtcatacag cacgagggtg gagtagtact tgttcagcca ggtgaacccg gcggtattgg    172980
     tgagcgggtt gaactgttgc ggtgcgcctc ctgggccttg atcgaaggcg ccagtgatga    173040
     ccttgtcggc ggaggcggtg cccagggtgg tcagggcgag ggtgagggcc agcacggaac    173100
     gcttgatcat ggtgttctcc tgttggggta gaggtcagga tgcgggggtg gagcggacgt    173160
     cagtgacgag cgtggtgtcg gtggatggag cgaggcgttc gttgatctgc tggaagtggg    173220
     cgtgcatggc ctgcgtgacc ttggctggtt ttctctgacg cagggcgtcg acgatggcca    173280
     tgtggtcctg agcggtctgt tcgaggttcc agtgggtggc gccagcgctg ccgtgcagtc    173340
     ggcggaacac ttcccagaac agttcgacga ggcggttgag gaagaggttg tgcagggggc    173400
     ggtagagcac gaggtggaat tcgcggtctt catcctcgaa ggtctcgccg cgcttggctt    173460
     tgtcgatcat ctgctgggcg agacggtgga gctggtcaat ctgttgcggg gtggtgtggc    173520
     tgacgaccat gccgacgagc ccttcttcga gggcagtgcg gacctgcaac aggtcgcgca    173580
     gggatttccc gtcgctggcg aaggagtagg gcaggttttc gaagatgctg tcgaaggtga    173640
     aggctttgac gtacaggcct tcgccttgtc tggcttcgag gatgccgacg gcttccaggg    173700
     tcttcacgcc ttcgcgcagg gacaggcggc tcatgcccat gtctttggcc agctggcttt    173760
     cggaaggaag cagatcgccg ggtcgcaggt ggtgttcttc gatgtagcgt ttgatggcga    173820
     tttgtgcctg gcggtaggcg ggtactttgg tggtcatgcg gcctcctgca tgcgagaggt    173880
     ctgttccgag cgagaacatc agatatctga taggtagatt gagcataagg actgtgacct    173940
     caaacgtcaa gcaccggtca tgggttgcct gatcagcatt catcgcgctc cctcaaggcc    174000
     ttctgcaagg cgaaataacc cgactcaaca cgtgagcagg tgactcagac aggtgctgtt    174060
     tgacagaaca ctatgccccc gatacgatgc tcctgcttct cgtcacttat cagacatcta    174120
     acctcagata actgagctgc ggggtagtgt tccgctcgct ggaggtcctt atgagcagca    174180
     tgtttcggtc tgccgcccag ggcggcgaca gcggtggcga acacggcggc acctatcctg    174240
     acctgccgct gccgctcaca catggcgtgg gcggaatcat cggtacgacc gtttacgctg    174300
     gactgggcac cgccgggcag aaattctttg cactggacct cacgcaaccc aaccgcgtat    174360
     ggaccgaagt ggctgccttt cccgaccctg cgcgtgacca ggctgcggcc gccgtggcaa    174420
     acggaaaact gtacgtgttc ggtggaatcg ggaaaagcac gcctgaggcc accaccgcgg    174480
     tatttcatca ggtccacgtc tatgatccag gtgccaacac ctgggccatg ctgaacaccc    174540
     gcgttccccg ggaaatcgct ggaggcagcg ccgttaccca gggcgaccgg atccttctct    174600
     tcggcggtgt caaccgcacc atcttcgaca ggtactttga ggacatggcg gccgccggaa    174660
     ccgacaagga cagaagagac acagtgacac tcgcgtactt caaccagcga cctcaggact    174720
     accgcttcag ccgggacctt caggcctact ctcccgccac caacacctgg gaatccctgg    174780
     gggttgtgcc cttcgctggt cggactggag ccgccctcca cttagagggc aatatcctga    174840
     ccgtgatgaa tggcgagctc aaacctggcc tccgcacgcc cgctgtccat caaggcgtcg    174900
     tcagcccggc gggcgtcacc tggcgcgcgt tgcctgacct tcccccccca gcggctggcc    174960
     aagtccagga aggtctggcc ggcgcctaca ccgggtgcag tggtggtgcg ctcctgctgg    175020
     ctggaggcac gaacttcccc ggaagtagcg cgcaatttgc ccggggtacc ctttacgccc    175080
     accaagggct gaagaagacc tggcacacca ccgtgtacgc cttacgggga ggccgctgga    175140
     gtatcgccgg ccagctgcca caagctcaag gacacggctt gagcatccag ttcggtgacg    175200
     aggtcctgct gatcggcggg gagcttccag gtggaacagc aagcgcgaaa gtcatctcag    175260
     tgcaggtcaa agacggccaa ctgctgactg cccgctgagg agacagccgt ccctttgtgc    175320
     gcgccggccg ggtgcctggt gctgtcaatg agctgtgggc cctgtgctta acccggtcct    175380
     cgcgcaccct gaccccagga aagtcaggtc gcctgctggc gccgcacgtg gttgccactg    175440
     gtggtcgcat ggttctggaa gagggtgtcg tcccgccttg ggagacgcca ggcgcagatc    175500
     gtgcgactca ccggagatcg tctcgagaca tatggagagt ggtccagcct gcgcgtgctc    175560
     cggcagcaca tgcaaatcct cgctgagcag ggactgctgg agccggtgtt cgagggccat    175620
     agctaccagc tcccgatgga cgcaatcacc gttgaatgaa ggtgccgccc ttcccgaccc    175680
     gtctgccgag tgcactcatc ccatgcagcc ggatgtaacg gtttggtcag tgcgtttcaa    175740
     atctgcgaca ggttggtgat gaaaaaggcg gccaagtggc cgcctttgat gtgaaacagt    175800
     atagcccagg atccacgtat gcgcaacgta tgcattccga ttctcggggc tgaactctga    175860
     aagaccggga tacgcgctcc tgacggtcgc agactcttca gagatcggcg agtttaccag    175920
     ccaggtcatc tgccggcaca tcaacgtacg cccgtgtgtg ttgacgttgg catggcccag    175980
     atggtgtgcc acacgaacaa aatcccgcgt ccgtcggtac aataaggttc cgttgtattt    176040
     ccggaaagca tgaaagcccg cccaggggag accctcctgt tccatcaggc gccgcaggtg    176100
     ataggtcgca ccagaccggt gagcgtaggt gaacaggcgg tcccctttac cctgaccagc    176160
     atgtgcctga agggcgtcga ggaggctgcc ggagatgccg acgatgcggc gcttgcgccc    176220
     tttgccctga acggtcaggc ggcggctggc gaggtccacc tgagtccagg tgagggtcag    176280
     ggcttcctcg atgcgcaatc ccgcatgtgc tgtcagcagg atcagaaccc gcaggtcggt    176340
     gcgctgctcc cgttccgcgg cggccagcgc ccggtgcacc accgtctcgc ggtggggagg    176400
     ccgccgggtg atcgcatcgg tccggtcccg cggctgcatc aggatcggct tcctacacgg    176460
     catccaggtg ctcaatcgcc tgcgtcgcct ggaggaccag gtgcgcggcc tgcataagat    176520
     ggtcgacgag gagcggccgt gtcaggagat cctcacgctg ctcagcggtg tccgcagtgc    176580
     cctggacgcc accggggaaa ccatttttga gcagtacctg ctgagctgcg cggccgagga    176640
     aggggagcct ctgccgacca aggagattgt caaaacagcg cgtctgctgc gctgacggga    176700
     acagcatatg ggaagagtga ggacggccag cagttcgaac actcccccgt cattggttga    176760
     ccacccagtt caagctggct cagcgggtgt gttcgagcag acgctcacgg acgagtggag    176820
     ccacttcctg gccaagcaac tcgatggcgc gcagcatccg ctcatgcgtc atcaccacgt    176880
     tcgtcatctg gaacgtgagg cgcgagacgc cccccagcac ctcattcacg tgcaacacct    176940
     tgtccaccac ctcctgaaca cccccgatca ggtacgcccc ggccggacca cactccgcat    177000
     cgaaccgggc gcgtgacggc gccggccacc cccgttcacg gccgatggtc tcgatcatcc    177060
     gcgcgtaccc cggatagaac gcgtcacgcg cctcctgcga cgtgggagcc acgaaaccaa    177120
     acgcatgaac accgacccgc agcgactccg ctggatgccc ggccgccaga ccagcctgcc    177180
     ggtagagatc caccagcggc cggaaacgcc ggaagctccc gccgatgatc gccaccatca    177240
     agggcagccc gagcgtgccc gcgcgcacga acgattccgg ggtgccgccc acgccaagcc    177300
     agatgggaag cgactcctgc tgcggacgcg ggtaaacgcc ctgaccagtg agcggcgcgc    177360
     gaaaacgccc ctgccagtgc acctgagggt catcgcgaag tttgagcagc aactcgagtt    177420
     tctcggcgaa cagcgcgtcg taatcgtgca ggtcaagccc aaacaagggg taggcttcca    177480
     cgaaggagcc gcgtcccacg acgatctccg cacggccacg cgagagcagg tcgagggtgg    177540
     agaactgctg aaagacccgg acagggtcgt ccgcgctgag gaccgtgacg gcgctgttca    177600
     ggcggatgcc ttgggtgcgc gatgcggcgg cggcgaggat gatggcgggc gcagcatcga    177660
     ggtactcacg gcggtggtgt tcgccgacgc cgaacgagtc gagaccgacc gcgtcggcac    177720
     gttcgatttc ttcgatgagg tggttgaggc ggtctgcgcc tgagagagta aggttggtgt    177780
     cgggatcagt gacggtggcg gcgaacgagt caatgccgat ttccatgatg ggtctcctta    177840
     gacgtggctt tcgccgtgtg ggtgaagggc agcgccgata cgcgcctatc gttcctattt    177900
     cgctgctttg atgtcgtctc agagcggccc cgcttccctc tcccgccgca tgtcatatgc    177960
     ggtcgcgcgg ccgccagtga ggtcaggagt tcactggcgg ccgcgcgacc ggcccggttg    178020
     gcaccgatgg tggacgtgga cggcccgtat cccaccaggt gaatccgggg ctcgctcgcc    178080
     acctgcgtgg ccaggcgtcc ggtcatcacg attccatcct ccgcgtccgg cctgcgcaac    178140
     atcagcggag cgagatgatc aagagaactg cgaaagccgg tacaccacaa aatcacgtcc    178200
     gcatgcactt ctgaaccatt cgcccagcgc acgccatcct cagtgatctc agtgaacatg    178260
     gggtggcggc tcagcacccc ccgcgcccgc atctcttcga ccgcgggggt caccgggagt    178320
     ccagtgacag acacgaccga ttgtggactc aggccggccc ggacccggtc ctctaccagg    178380
     gccacggcgg cgcgggccgc ctgatcatcg aagggtccct cacggaatac tgggggctgg    178440
     cgcgtcaccc aggtggtggt ggtgaccttg gagatctcgc ccagcagctg aagggctgag    178500
     attcccgcgc ccacgatcac gacgtgttga cccgcgaacg cctggggggt ccggtagtcc    178560
     cgggtgtgca gatgctggcc ctgaaagcgc tccgcaccgg ggtactccgg gatatacggg    178620
     gcgtcccagg taccggtggc gttgatcagg ccgcgcgcgg agaattctcc ccggtcggtc    178680
     tccaccctga agcggtcacc gcggcggctc acgaggatga ccttcactgg ccggagcaca    178740
     cgaaggccga aggcttgctc atacgccgcg aaatatcgcg gcaccgcgac cctggcctgc    178800
     acgtgggtct cgccggacgc catgtccgag aagggcaggc ccggcagatc atggatgcgg    178860
     ttgacggtgc tcagggtcag gctcggccag cggaactgcc atgcccctcc aggggccgcc    178920
     gcggcgtcca ggatgacgaa tttcttgcgg ggtacgaggc cggcctgctt gaggtggtag    178980
     gccgcagaaa ggccagcctg accgcccccg atcacgacta tgtcggtttt gagtgccgca    179040
     ccagggggag ccaggcggcc agccggacca ggggtcatat cggggtcatc gtcagtggac    179100
     gctggagcca tgcgtgcagt gggcccgatc ctgagggtaa ggttctggat tccgaaaagg    179160
     gaggcgcacg ctggccgtgc gcctctcctg tccatgatgt ggttgccgta tttaccgacg    179220
     caggtggact tagcgcccgg gtaagggccg acggtggtgg ctgcgcccgt caggccggag    179280
     tcctgagaag gctttactgc gctttgagct tctgggtgat ctcgatctgg cggcgcacct    179340
     gatggcggat ggaggccttg tctgcttcgc tcagcggttc gccgttggcg gtgacgctgg    179400
     cgccgtaggg gttgccgccg gaagcgaaga gcaccggatc ggtgtagccg ggaggcgtca    179460
     ggatggcgcc ccagtgcatg gcggtgatgt acagcgtctg gagcgtggtc tcctgcccgc    179520
     cgtgggggtt ctgcgcgctg gtcatggcgc tgaaggtctt gttggccagg gcgccggtgc    179580
     cccacagtcc acccagcgtg tcgatgtacg cgcggatctg gctggtggcc ccaccgaacc    179640
     gggtggggga gctgaacagg atcgcgtcga cgttctccag gtcagccggc gtggcttcgg    179700
     gaacgtgggc ggtgcgttcc tgctgtgccc tccaggcgtc ctgaccgttc acgacttcct    179760
     ggggagccgt ttcgcgcgcc ttgaccaggc gcacctcggc gccggactcg cgggcggctt    179820
     cagcagccac ttcggccatc tggtggttgg tgccgtaggt cgagtagtac acgatggtca    179880
     tcctgacggg gctgggggtg gtcacggggg actcctgggg cgcatcctgc gcctgcgtgc    179940
     gggggtagag ggctttgagg aggcggtcga ggaacgtcat gggcctgcct ttgaatagag    180000
     gttgaaacgg gggtctggcc ttgcttgcgt acgcactaga acactttaat attaaagtgt    180060
     caagggaaga tccttcgacg tttccactcc gtccctgact ggttcacgca aaacgccgtg    180120
     tcagtaaccc aaaaaaacct actgcaggag acgcaagagc ccttcgagct gctggagctg    180180
     gtcggtggtc agcccggcga actgcgcctc gtggatgtcc accacgactg gaagggcctg    180240
     gttcatcagt gcgctgccct caggggtcag ggacagccgt ttggttcggc ctgccacctc    180300
     ccgccggatc agtccacgac tcagcaggcg ctgcgcgtga tacgtcatat ttccctctgt    180360
     gaacagcatg tgctgagcga gttcctgttg cgtggccccg ggatgcgccc gcaccacggc    180420
     cagcaggtcg aactcggtgg gcgtcagccc gagaggagac agcgcactct caacatcccg    180480
     gatcttgccc tgagtcagac gtatcagacg gcgccacagg cgaatagacg gctgccgcag    180540
     cgcctcgtcc acgtccagtg aggcaggcat ctcggtcacg cgatcactat acgggcgcca    180600
     tgcagtctcg ggacgagccc gccacagcca gctccggggg acagtgaacg acgaagggcg    180660
     aacgccttca ccgtccttgt cttgtgtact ccggacgtac tccacgacag aggccgccca    180720
     ggtgaaggcg gcgggcaggc ctcacctcag ccgtgtggct cttgactgcc ccgcgaatca    180780
     ggagactccc gcgactcgcg cggcataacc tggccgcggc gtgttcaaca ggctgccagg    180840
     ccattttttc ctatgcagca cacgaaccgt gccaccgatg aacaggagat tccagccgac    180900
     ccccatcagc catccgctcg tcacccctac cgtcctgacc cagggagtgc tgctgcctaa    180960
     gccggaatgc tcggtgcgca agcggactac aaagctatat gaccgtgctt gacaggggaa    181020
     gaacatgtaa gtattatcat tacatgttga gcggagatcc acgagcatga acagccacta    181080
     cgcgatggcc gtccacgtgc tggccctgat caacatgtac cccgacagcg cccgcacgtc    181140
     cgaagacatc gctgccagca tcggcaccaa ccccgtcgtg gtgcgcaacg tcatcggcca    181200
     cctgcgccgc gccgggctgc tcgatacgcg ccagggcgtc gccggagccc acctgacccg    181260
     cgcccctcgt gacatcaccc tgctggacgt ctaccgcgcc gtgaacgcgc cagcgtccgt    181320
     atttaagctt cacgaacagc cgaacccacg atgcccggtc ggatcgagaa ttcagggcag    181380
     cctgacccag gtgttcggcg aagcgcaggg ggcgttggaa gcgcatctcg catcgctcac    181440
     cctcgaggat gtgacgggtg acctggcccg gcgtgtcagc tgattttttt acctaacatg    181500
     taagcactcg cgttacacct tctcactcaa ggagtcccca tgaacatcct gctcatcggc    181560
     gccaccggct ttctcggcac ccgcatcctc cacgaagccc tcaaccgcgg tcacaccgtc    181620
     acggccctcg tccgccgcga acacgccctc acccccgccc cgaacctcca cattgaagtt    181680
     gccgacgcca gcctccccag cgacgtcgcc cgcctcgcca ccggcaccga cgccatcatc    181740
     gcgtctgtca gcgcccggaa acccggcgac acccccatcc ccaccaccat ccaggccatc    181800
     gcagacggcg cccgccaggc cggcacgccc cgcctgttcg tggtcggcgg cgccggcagc    181860
     ctcgaagtgg cccctggcgt cgcgctgatg gacgcccctg gcttccccga cgcgtaccgc    181920
     accgaagccg aacagcacgg tcaggcgctg gcctttctgc gtggcagcga cctgaactgg    181980
     acctacctca gccccgccgc tgaaattgca cccggtgaac gcaccggcac cttccgcctg    182040
     ggtggcaacc agttcttcac cgacgccgag gggcgcagct tcatcacggc cgaggactac    182100
     gcggtcgccg tgctcaacga actcgaacac ccccagcacg agcgccagcg cttctccatc    182160
     gcgtactgac cctcacgagg atcctcatgt ctgatctgca cctcctgtat gtcaccgacg    182220
     cctactgcgg ctggtgctgg ggtttcgctc caaccctgag cgccttccac gcgcggcacc    182280
     cccaccttcc cctgcgcctg atctccggcg ggctgttcac cggcgagaag atcgccccca    182340
     tagctgccta cccgcacatt cccggcgcga acgaccgcat cacccacctc actggcgtca    182400
     cgttcggcga cgcgtaccag gcgcgcctcc aggaaggcat cctggtcctg aactccgatg    182460
     acgcggccgc cggcctggcc gcgctgcgcg ccctcgcccc tgaccgggct ctggaagcct    182520
     tccatgccat ccagcatgcg ttctacatgg aagggcagag cctgagtgat ccccgcacct    182580
     accgcgcggt cgcccagacc ctgaatctcg acccggacgc cgccgaagcc gcattccatg    182640
     gcccgcaggc ccgaactgaa gcggcgcagg attaccagct ggcccgcacg ctgggcgtag    182700
     acagttaccc gaccctgctg gcgcaacaag acggacagcg cacggtcctc gcccgtggcg    182760
     cggccaccgt ggaacaggtt gaaacgcgcc tccagcgcgc cttgaaccca gcgacaccct    182820
     gaccatcaat cgtaccaggc agggagggca tgttgccctc cctgcctggt gccgtgatca    182880
     tcacgctggc cctcgtggcc gtcacggcaa acgcgggtgg ccgcatgtca cccctggtgg    182940
     gcctgacgtg gtctccacaa aggctctgag atggccagcc gctacagccg agtactccgc    183000
     cgggaccgca ataccaaatc cagcagacgc cgggcttcag gccggaccac cacatcgctg    183060
     ggcaccacca ccacatacga caccgtcacg ttcagggcct cgatcaacac cggactgacc    183120
     tgccccgcct cgatttccag tctggccacg ctcggcggca gaatggtcac tcccaggcca    183180
     cgcccgacgg cctcgcgcac ggccgtgagg cttcccagtt cgaactggac ggcgggcagc    183240
     acggtggcct cattcagcag acgctcagcg tgccgggcca cggtcgagcc caccatcggc    183300
     cagaggaaga cctcctgggc ggcagccagc aatggtgtag agccccggtc ctccagcggg    183360
     tgcccggccg ggaccaggag acacaggtcc tcagcactga accggtggcc ctccagccca    183420
     gccggtaagg gtccgggtgg ctggacaatc aacgccgcgt cagaggctcc cgaagcgacc    183480
     gcctccatca ggctcgtgga atgcccgctg gtgacccgga cttcgtgccc ggcctcatgg    183540
     gcgccggaca ccaggctgac ggcctgcccg ctgagcgtcc acgacaggcc caggcggagg    183600
     gggcgggtgc gggcctggcg ggtccggagg tgctccgcag caccagagag cgtcgtcgcg    183660
     atcacgcggg cgtaccccag caggtcctgc ccggcttccg tcagcgtgat gccgtacgcc    183720
     gtgcgggtgt agagccgctc gcccaccacg tcctgaagcg ccttgagctg accgctgacg    183780
     gccggctggc tgagccgcag cgcctcggcc gcgcggctga tgttgccgta ctctgccacg    183840
     acactgaacg tcaccaggta gtccggatcc aggcgcatcc acccagcata cgcgggccca    183900
     ctccagtagt tatctgattt tccgataact gaacgcaggt ctgctttctt gttcatgccg    183960
     gagccattcc gtagcgtgag tttagcccgg tgaaaccggc cctgagggag aaaatgacca    184020
     attcaactgc accgacaccc tacgcccgcg acgtcctcgt gagcaccgcc tgggttgccc    184080
     aacaccttgg agaccccacc gtccgcctca tcgaagtgaa tgaggacatc ctgctgtacg    184140
     acaccggtca cctccccggc gccctcaaga tcgactggca gatagacttc tggcaccccg    184200
     tgatgcggga cttcatcacc cccaaggaag tcagcgccct gctgggccgc ctgggcatcc    184260
     gggaatacga ccagatcatc ctgtacggcg acaaaagcaa ctggtgggcc gcctacgcgt    184320
     tctggttcct gtcctacagc ggcgtgcaga acctcaaact aatggacggc gggcgccaga    184380
     agtggatggc tgagggccgc gaagtcacca ccgacgttcc tgaagtcagg ccgacggtgt    184440
     atcccgcgtt gcagtgcgat gaaagcatcc gggcataccg cgaagacgtg ctggcccacc    184500
     ttgacggggt gcaggctggt cgcggcgccc tgcttgacat ccgcagcccc gacgagttct    184560
     ccggcaaggt cacgcacatg gccaactacc cgcaggaagg cgtgctgcgc ggcggccaca    184620
     ttcccggcgc ccgaaatgtt ccgtgggcga aagccgcgaa tgaggacggc accttcaaaa    184680
     gcgtcgaaga gctgcgggcc ctgtacgagg gtgaaggggt caccccggac aaggacgtca    184740
     tcgcgtactg ccgcatcgcg gagcgcagca gccactcctg gttcgccctg acgcagctgc    184800
     tcggctaccc gcgcgtcagg aattacgacg gcagctggac cgaatggggc aacgcggtcg    184860
     ggctccccat cgagaaaact tacgttcctg agtgaacctc cccctcgcgt ggccaccctc    184920
     cgggggagac cagctgacct tcacccgtct ggtgctcttc cctgtggtcc acgccctgaa    184980
     aggagtccgg tgaccgtccc gtccccttcg cctgccgccc gtccctggac cacgtccgcg    185040
     ttgctggccc tgctcgccgt ccttctcctg ctgggcagcg cgtgggctta cgcgcgaatc    185100
     cgcagtccct tcccctatta cggcaccgcg tacaccccgc ccgtggccgc gcagccgttc    185160
     cagggcacgg accacaccgg ccagccctac acgttcacac caggcagtac gggtcgcacg    185220
     accgccgtgt ttttcggatt cacccattgc ccgaacatct gtccgctcag cctggcgtac    185280
     ctcgaaaaag cccggcaggc cctgaccccg caggaacgcc aacagctgga catcgtgctg    185340
     gtcagcgtcg accccgcgcg cgacactccc gagcgccttg gggcgtatgt ggagttcttc    185400
     gggaccgcca ccggcgttca catccctgaa cccgcgctgg ccagaaccgc gcaagcgtac    185460
     ggggtggcgt accagcaggt gaagcttgac ggcggcgccg ggtatcaggt gaatcacacg    185520
     cccgccacgt acctggtcga cgggtctggt accttgcgcg tcctgtggga ctacacccag    185580
     ctcacgcagg tggaccgcgt ggtccgcgat ctccgccacg tcctggagaa cccgctccca    185640
     tgacggcggc accggccaac ctgaatccca ccctgctgga tctgctctcc ctacgctttg    185700
     atcctggagt gtggctgccc atcctggcga tcaccggcgt gtacctctgg catgcgcagc    185760
     gcgcccgccg gtcatgggtg ggacgggccg gctggcctgc ctggaggacc ggactgttcc    185820
     tgctgggcat gctcctgctg ctcgtggcca cgcaatcggc cgccgcgacc gtcacacaga    185880
     gcagtatggc ggtgtacatg gcgcgcctga tggtcctggc ggaagtggtg ccgcccttgc    185940
     tggtgttggg tctgccgcgc acgctgcggc cccaccccga ccgtccgctg ggccgggcgc    186000
     tgagcgtgct gcttgacccc tgggtcgcgc tggcggtgtg gacggccgtc atcacctact    186060
     ggaacgtccc ggcggggttc aacgcttccg tggtgtccaa cacggccgaa gcgctgctgc    186120
     cgaccctgta cctgctcagc agcctgatgg tgtgggcggt cgtgctcaga cccctgccta    186180
     ccgtgcaacc cgccaacatc ggctcccgcg gctggttcgg cctgctcgcg gcactgccga    186240
     tgatggcggt cgcgggcgtg tggctgaatg cgccggacgt gctgtacgcc ccgtacgtgg    186300
     ccgcgttgtg cctgtgggat ctgacgccac tccagaatca gcagctcagc ggctggatca    186360
     tgatgatggc cggcatcccg gcgatgtgcg tagcactgat gcagctcatg gcctggttga    186420
     tccagctggc cgacggcgac gcgaccccta aagcccgtgg gtagatcctg cacccgtgcc    186480
     ctcccggtcg accttcggcg gcacctcgtg aggaccgcgg cgcaccctga actgccctgg    186540
     cggaacctgc tgaccgtctt ggtgctggcg gccgcatttg cctttccgtt tcgggccacc    186600
     ccgggtggag cgtcctcacc cgggatcggt tctgaaacgc tttcgcaggc tgcccctggg    186660
     aatgccaccg gacacgcacc acatgaaccg cgggcgggct ggacgtccgg aaccaacggg    186720
     catccgcatc cccactgtct gttctgcctg acccaggcgt tcgccctggc ggtgggagcg    186780
     ccctgggcag ccggtggaca cctcggcgcg gtgccagcac cccaaccgtc ctggcctgtc    186840
     gttcgcctcc tgacggcccg gcaggcagat gcgcgggcac ctccagcgga ggtctgcacc    186900
     acctgttccc gtcccacgcg cccatttcat caaccaggag ttgtttatgt ccattgtcct    186960
     gcgcgccgcg tccctgctgg ccgctctgct gctgtccgcc gccggtgccc acgccaccat    187020
     ccgcacggaa ggcggcctga ccgaaagcaa ggcaggcgct tctgaaacct accggctgaa    187080
     cgtccccacg gagaaagcca tcagcaccac ccaggtgcgc ctgatcgtgc cggccggcgt    187140
     gaccctcagc cggttccagg tcacgcctgg gtttacccgc accgtgacca ccaatgctgc    187200
     cggcctggtc acggaagtta tctggaaggg ccgcatcggc cccatggaat acgcccggtt    187260
     tttcttccag gcggtcaacc ctgagcagcc gggttccata acctggaagg tgtaccagac    187320
     ctacagtgac gggtccgtgg tggcctggga cgacagtgat cccagccagg ctcctgccag    187380
     cagaaccacc gtcaagtaaa ccgggaggca ccttccccct gccttctcgt cctgccaagg    187440
     agcatcccat gatccgtttc tcgctgctgg ctctcctgct ggccatgccc ggtgcgtcgg    187500
     cgcacacggc cgtcacctca gtcactcctg ccgcgaacac tacggtcgcc gcccccggcg    187560
     cggtcaggat ctcgttcagt gagccggtca acctgcgctt ctcgacgttc aaggtctacc    187620
     cgctcaaggc caccggcacc accctgaccc aggccgcgaa acgcctggca ccggtggccc    187680
     tcgccgcccg cgacgacgcg tccgtccggg ccgacaccgc cccgatactg acggggagag    187740
     ccgcgcgcgt caccctgccg ctgaaaccca acctgccggc cgggccttac ctgatcgtgt    187800
     ggcgggtcct gtcggaagat ggccatccgg tcaccggaca ccaccatttc cacgtgaaat    187860
     gaccgctgga ttcgcgcatt ttctgatgtt tctggctgtg gccgtgctgc tggccgccag    187920
     cctggtgtgg agacggttgg cccctcatgg tctgaccctc cctcgccacc cgttcgcgtg    187980
     gctgggtgcc gggttctggc tgatgctgac tggactcgcg ctgaacgttg ctgccacgct    188040
     gagtgccctt ggattcacga ctcctggtga cgtgatcgac tacctgctga cgactggacc    188100
     aggccgggct gccctggtga ccttattggg cacgacgttg ctgctggtgg cggaggtggg    188160
     tgaatggtcc gccccggtag cccgaagtgg cgccgccgcg ggcgtcaccg tgatgttgtg    188220
     gggcctggcc ggcctggggc atggcgcgga tcatgagagc gtgctggtgc gcgccgcaca    188280
     cgccctgcat agcggggcga tgggcggctg ggtaggcggg atgctgatgc tggtcgtcgg    188340
     acgtccaacc cactggacgc ggatggcccg cgctttctca ccgctggccc tgacgtgtgt    188400
     ggttgtgctg ggtgtgagtg gggtgctgat gggcgtctcc cacgcgggcc cacctggaca    188460
     atggaccgcc agcccgtacg gccgcacgct gctgctcaag ctgttggcgg tgctgggcgt    188520
     gctgacagct gcatggcgcg tgcggcgcca ccggtcagac cgccccgcgg acgtcccctt    188580
     cctggcgttg cgtgtggaac tgggcctgct cctggtggtg ctggtcctca cggctgtact    188640
     ggtgatcagc gcgtccccga cccacggctg atgcccttcc cagggtgcgg gcggcgcgcg    188700
     aggcgcgagc tgcgtgccgg gcggcctgcc ttgttcaaac tcaccagccg gaagctgccg    188760
     ctacgctcag gaactccagt cacgtaaggg catcaccctt ccctggcgca agcagaatcc    188820
     cgggagagcc ggtggacact gcggggcaga ttccacacca gacaaaggtg tcaccgcgtt    188880
     ctggcgggtc gcgaagcgca gcagcctctc ctggctggcc atgacgcagc gtctcgctgg    188940
     acgcgcctgc ctgttatcgg catttccaat aacgttaccc ctgcccgctt tcttgaggcg    189000
     tccggcacct ggcggtaggc tgagcacgtc agaacccgag gtcaggatga tgcgaacgcc    189060
     caccaccacg ccctacgccc acgatgtcct tgttgataca acctggctcg aacagcacct    189120
     tgaagatccc acggtccgca ttcttgaggc cagtgaggac accttgctgt aaggcgctgg    189180
     tcatgtgccg ggcgcggtgc agctggactg ccgggctgac ctgtgggatc cggtcatccg    189240
     cgatttcgtg tctcctgaag ccttcgcggc cctgatgggg cggctgggaa tcacgcctga    189300
     tacgaccgtg gtgctgtacg gcgacaaaag caactggtgg gcgacgtacg ccttctgggt    189360
     cctgcggtac tgcggccatg agcgcgtccg gctggtcaat ggtggccggc agaaactgat    189420
     gaccgacggg ttcgacctga ccgacgagat accagacgtt caaccctgca cctacccggt    189480
     gcaggagcgc aacgaacagc tgcgcatcta ccgggatgaa gtgcagcatc acatccacgc    189540
     agtgcgtgcc ggccgggggg ccctggtcga tgttcgcagt ccggatgaat acgccgggca    189600
     cgtgacgcac atgccggagt acccgcagga aggcgtgctg cgaggcggtc acattccagg    189660
     ggctgtcaat ctgccctggg ccatggcggt caagcacgac ggcaccttca aggccgcaga    189720
     tcagctgcgg cgcatgtacg agaaggcgga cgtcacccct gaccggatgg tggtgacgta    189780
     ctgccgtatt gcggagcgca gcagccacac ctggttcgtc ctgacgcaac tgctcggcta    189840
     tcccgacgtg cggaattacg acggcagctg gaccgagtgg ggcaacgcgg tgggcgtccc    189900
     catcgagact gcacctcgct gaaagaagac tgaactcgaa gctgacgcct gaggtgaagc    189960
     ccacccggtg tcctgacacc tgcccgcggc tgatgggcag aggaggaacg atatggacct    190020
     ggaatcctgg accccgaaag acaaagcccg acgcctggcg gtgctggtcg cgctgtatct    190080
     ctcgacgatg ctgatggtgg tgagtgtgct cgcactcaaa tggccgtggt ttgtggcgcc    190140
     cctggtaggg gccgtcggct acgcagtggc attttatgtg gcctacgcca tcctgcggaa    190200
     cacattccgc aggtaagcgg aggcgtgacg tacccagggc gccaggctcc gaaatgatct    190260
     gaagcgcgtc tcagcgctcc accacgcggt cctcgtcgag gcaaaacggc catcccggcg    190320
     accttgagta cgccgggata cagctggcgg cagtacagcg ccactgaatt ttcttcagcg    190380
     atcacgcgct tcacttcatc gtgcttgctg gggtactcgc gtgccatccg ttctgagtac    190440
     tggacgaagc cttccagggt gttctcgacg tgcgggttct gccggatgta gtttgcgccc    190500
     gcgtaacttc tggtcgggcg ttgctggttg agcatcaggt catggaagga gaggactcgg    190560
     cgcgtgtttc actcgaggat gccagtcatt cagggacctt cagcgggctc aggagtgaac    190620
     aaatggagcc gccctcccag gatgagtggg aaggcgacct ttgcctatgg cctgggcttg    190680
     agatcagtgc ttcagaattt gccgttgccg ttcttccact cgctgcgcgc aggaatggtt    190740
     tcgacggtgt cccagtgctc ggcaatcttg ccattctcca cgcggaagag gtcatagaag    190800
     ctggtgggct tcccgccgag ggtgccctcg ctcatgacga ggacgaagtt accttcaccg    190860
     aggaccttat gaactttggt gtaccgcatg gtgacgccca ctttcgccat cgcgtcgagg    190920
     gccgcgccga ggccgctgag accgtcggca atctgggggt ggtgctggat gtaccggtcg    190980
     ccgtcgaagt aggcggtgag cttgtccatg cggccgtgga cgaggatgtc gtcgacgaag    191040
     cgcgcgacaa gttgtttgtt ccgctgggtg tgctgaaggt cggtggcggt ggtggggccg    191100
     tcaatcatgg tgtgcccgct ggggttgggg cctgtgggag tctgctggac gttgttccag    191160
     tgctcgacga tccggccgtt ctcgaagcgg aagacatcaa tgccgatctt ggggccgaag    191220
     aagttgtagt cggtgtgggt gaagacgtgg ttgccgtcct ggaagacgcg gacggtgttg    191280
     acgcgggcac tgcccgccgg gagggcctgg agcagggcac ggtagcctgt gagaccatcc    191340
     gcagcgccga ggatgtggtg agtgtagttc tgggggttga tcacggcgaa gggggcggag    191400
     gcaccggttt cgatggcttt gaggacgtcg atgacctgtt gcttgggggt gctcatggtg    191460
     gcgctcctgt tcgcgggaga cttgagggcc gcaggcttgg tggatgcggg accgccgcca    191520
     ccgaggacgg cggctgtagc ggtggcgttg aggaggaggg ctgtgatagc cagaaaacgg    191580
     gtcttgttca tgatttcctt tcaaatcttg taatgatttt ctttacaggt ggtgtaaaaa    191640
     aaatcagagg gccagctgga cgagatcagc catgatgtct gcgagggtca ctgtcgcaag    191700
     gtggtcttcc atcgcctgct gcgcgtttcc gaggaccgtt gtcagagccg cctgaatgtt    191760
     cccgccgacc gggcactgcg ggtgaggctg gtcatgcagc ttgaacacaa gttctggtgc    191820
     attgaccgcg tggtaaacgt cgagcagggt gatggcttcg ggcgggcgga tgagccgtgc    191880
     gcctggagag ccttggcggg tatcgagcag tccggccttg cgcaggagac tcataacatt    191940
     acggacgacg acgggattga cgccgacgct ggcggcgatt tcgtcactgg tacgggcgtt    192000
     gtgggggtac aggctgatga gggtgaggat gtggacggcg atggcgtact ggctgttcat    192060
     aaatccctcc ctttcaaacc tgtaacaatt ttaattacaa gaggtgaaat tgtcaagcac    192120
     ttccaaaaat gagcggccag tttcctggac ccgccgcgcg ccggacgtaa cgtgctctgg    192180
     ccaaagcctg gccgttccgg tagcgttctg atgcccgccc ataggtgttc caccatgagg    192240
     gcccgggcct tgagccacgc tcaggggatc gcgctgttga actgatgcgt accggtgcca    192300
     tcattgacgt ctcgccgttc gaccgcagca ggagggatgc aggcacgcac acctgcaaag    192360
     gcccctcgca cgttcacacg caggatcgtg tcgatccatt tatcgctcag gcgatctagg    192420
     tccgcgtgcg gcacgggcgt ggtgaccccg ccaggtcaga tcgtttttcc ctgatgaggg    192480
     actccggtgt cccggttaat gagcaggact gaactcagga gcgcacacgt gtagcagttc    192540
     ggaaacggtc attagcagag tgctacagat agggaatgaa aaaggcggcc aggtggccgc    192600
     ctttgatggt gcacattcta cctcagcata caaggatgca caccggatgc atccggatga    192660
     tcccatcccg agattcggac tgatcagtgc agctggactt cacgctgtgc ctgcaccttc    192720
     aacgcgtagg tcaccgctcc cagcatcgtg gggtcgtaat accgcgctcc aggcccagat    192780
     aggccgccga gtgcagcgcg tgatacgcca cccgtagcgg ttcatcccaa tgcaccatca    192840
     gcttccggta cacgtcctcg cccggcgccg tgagcaagcc ggaccagtga catgtgaaca    192900
     gcacacgcac tgaagagatt ctggtctcaa tgtgagccct tccgccttga cggggggttc    192960
     caagctgcct acaattataa aaactaaaac aaaggttcac taggtgaaac aatggtagaa    193020
     aaagacccag cagtgggttc catccgttcc gtcgaacggg ccttcaccct gcttgatgca    193080
     ctggcccgct ccgaccgccc cctcaccctc actgaactca gcaaccgcac cgacatgtcc    193140
     aaagccacgg tgctccgctt cctggccacc ctcgagcagt gggcccttac ccagaaagtc    193200
     aacaacgggt accagctcaa tgtcggcacc ctgccgctgg cctacgcctt cctgatgaac    193260
     gacagcctga acagggccgc gctgcccgtc ctgcaacgcg tggccctcgc cacccaggaa    193320
     accgtcacga tgtacgtccg cgccggcatg gaacgcgtcg tcgtgcagcg cgtcgaggga    193380
     cgcacaccct tcgcccacac cctgcccgtc ggccagcgcc ttcctctgct gctcggcgcc    193440
     cccggcctgg tactggccgc cgcaatgaaa gccgctgacc gttacgctct gctggaacac    193500
     cacccggaag tggtgctggc cagcggcgaa cggttcgacc ggccagccat ggaagcgcgt    193560
     ctcgatcagg tccaccagca gggctacgcc atcagccgca gcgagcgact ctcccagatc    193620
     ttcgccgtgg ccgcccccgt caagacggcg gatcagaccg tcaaggcggc tgtgggcatc    193680
     actgcgcacg agaaacgcat cacggacgag caggtcgagg tcctgatcga agaagtcatg    193740
     ttcgccagcc gggcgatcgg cgaagcgtcc ggatcctggt ccaccggaca ccaggcctcc    193800
     agccctcaga ccgaagtgac gtcggcccgc agcacgcgcc gtcgtccacg ctgaggcctg    193860
     cccgtggaac acaccatgca gcgataccag caagccgccg ccgtcctctt tttgttcttt    193920
     gccgtgttca tcgtctggca gggcctgaaa ctccagtact acacccccct cggcccgggt    193980
     tcaggctttt tcgctgtctg gctcggcgcc ctcctcggcc tcctcgccct gatgcagctg    194040
     gtccagacca tccgcccggc acgcccggcc accccgccgg tgatggacgc cgacctgaac    194100
     gcgccagcag aagttgaacc cgaacaggtg ctgccggacc gttccggggt tatacgcatc    194160
     gccgccgtaa tcggcgcgct gatcctgacc gctctgctgc tgcccctgct gggctttcag    194220
     atcaccgcct tcatcctgct tatcttcctg ctgctgggac tggaacgcgt tcgccccgtc    194280
     acagccgtga ttatcgccct cgtgttcagc gttggcctgt ttcagcttct gactcgcttc    194340
     ctgagtgttg aactgccgca ctcctccctg gccgtactca agcagctcgg gctgtaagga    194400
     gacccgttat ggaatcattc actgatctgc tgctcggctt cagcgtggcg ttgcgctggg    194460
     agaacctgct ctacgcgctg gtgggctcca tcctcgggac cctcattggc gtcctgcctg    194520
     gtatcggacc ggtggccggc acggccctcc tgatcccttt gaccttcgac atgcctgccg    194580
     tcggcgccat catcatgctg acctcgctgt tctacggcac cgcgtacggc ggcaccatca    194640
     ccagcgtgct gctcaacgtt cccggggagg cggcctccgc cgtcaccgcc atcgacggtc    194700
     accagatggc caaaaaaggt cgagcagggg cggccctcgc catcgccgcc atcggctcgt    194760
     tcgtcggcgg caccgtggcc accatcgcgc tggtgttcgc cgcgggcagc ctcgcccgcc    194820
     tggccctgaa cttcggaccg gtggaattcg ctgccctgac cgtgctgggc ctgtcgctcc    194880
     tgatgggtct ggccggcaag tccctcgtga agggcctgat gatgggtctg ttcggcctgc    194940
     tgctcgccct ggtcggcctc gacccggttc agggtctgcc gcggttcacc ttcggacacc    195000
     ttgaactgct cgatggcctg agctttgtgg cagtggtgat gggtctgttc ggcctgagcg    195060
     agatcatgct cctgatcgaa aaccgcctgc gtcccgtggt ggcgcacgcc atgagttcga    195120
     tgatgctcag ccggcaggat gtccgggact ccacggcccc catcctgcgt ggcagcgtga    195180
     tcggcacggc cctgggcctg gtgccgggca tgaccggctc cgtgtcctcg ctgctttcct    195240
     acgttgttga acgcaagtcc tccaagcacc ccgagcggtt cggcaccggc gccatcgaag    195300
     gcgtcgccgg accggaaacc gccaacaacg cccacgccaa cggcgccctg attcccctgt    195360
     tcaccctggg gatccctgcc tcaccgaccg tcgccgtgct gatgggcgcg ttcctgatga    195420
     aaggtctggt gcctggcccc ctgctcttca cggagcaacc cgagcttgtc tggggtgtta    195480
     ttgccagctt ctacgtcggc aacatcatcc tgctgatcct gaatctcccc ctcatcggca    195540
     tctgggtccg ggtgctgctg atcccgcagg cgatcctgat cgccatcatt ctcgccctgc    195600
     tggttgtcgg cgcgtacacc atcaacaaca gcgtgtttga catctacgtg atgctgattt    195660
     tcggcgtcat cggctacctg ctgcgcaaac ttgactaccc catcgccccg atcattctcg    195720
     cgctggtgct cgggcccctc atggaacgct ccctgcgcca gtcgctggaa ctgtcccagg    195780
     gcagcgcgca gatcttcctg caaagcccca tcgcgctcac cttcctgatt gcagcggcgc    195840
     tggtgctgct ctcacccacc ttccggccgc tcctgacccg ctggcaacgc cgccgcgcct    195900
     agccggcgcc cgcaccctga cctgttcctg cacgtcctgc cgcgtagtcc gaggtttgcg    195960
     tatgacctac accgcccaac atcctccctg aatccctcct cgcctatcgt ccgctcttcc    196020
     tccacatgcc actccccgcc gcccagcgcg gctcccccca gaggtcaccc catgaaaatc    196080
     acccccaagc aaggcctgat gactgccacc gccctcctcg tctccctgag cctgttgtct    196140
     tccaccgctt ccagccagtc gcgtaaggtt acgttcccgg agaaaggcaa gaccattcag    196200
     atcatcgtgg ggttcgccgc tggtggcagc accgacgttg gcgcgcgact gctcgccaaa    196260
     ggcctggaaa aggaactggg cgtaccggtc gtgatcgtaa accgccccgg cgcgggtggt    196320
     cagctcggct acgtcgccct gacgcaggcc aagcccgacg ggtacaccat cgggaacacg    196380
     aacttcccgt ccgccgtggt gacgtacctc gacccagcgc gtcaggccac ctacaaacgc    196440
     aacgatttca tcccgctggc cctgcatgtg gtggaccccg gcctgtttgc cgtccggaaa    196500
     gacagcccgt acaagagcct caaggacgtg atcgcggccg ccaaagccaa ccctggaaag    196560
     atcaccatct ccaccaccgg acttcagacc gatgagcatt tcgcgattct gcaactcgag    196620
     aagatggccg gcgtgaagtt cgccccggtg cacttctcgc agggaattgc ttccgccacc    196680
     accgccctgc tgggtgggaa aattgacgtg ttcgccggga atgtcggtga tctcctcggc    196740
     cagtacaagg ccggtgaggt gcgcatcctg ggcgtgatgg acgaccggcg cagcccgttc    196800
     tacccgaacg tccccacgtt cgccgcgtac ggctacaagc tggagaactc cgcttcacgc    196860
     ggtttcgccg ctccggccgg tacgcccacc gaggtcgtca acgtcctgag caaggccatc    196920
     cagaaggtcg ccagctcaga agcgcacaag caggaaatga agaacttggg cctcaccctg    196980
     cggtacatga ctccggcgaa gtaccgcgct tactggagta cctacgaaac ggatattcag    197040
     gacctgctgc ccctgtcgcg ccagtgaacc aatccgtcat taccgaacga gggctcctat    197100
     gacacagaaa gtacttgtca cgtcaatttt cctccacgct ggtggggagg tcgatcacct    197160
     gctccgggcg gaaggcttcg agcctaccta cgcccccgcg cttacgaagc gcactgaaga    197220
     tgaactcatt ggccttctcg acggcgtgtc cggggcgatc attgccaacg aacccttcac    197280
     ggaccgagtc ctggcagctg ctccggatct gaaagtcatc tcccgcaccg gcgtgggttt    197340
     cgacagcata gacgtggcgg cggccaccca gcgcggcgtc gtggtgtgca acacgcccaa    197400
     cgtcaaccgg tacgcggtcg cggaatggac cctggcgatg atgctcggct gcgcgcgcca    197460
     cgccgtgaag aactggacgg aaatgaatgc cggagggttc aaacggttcg agggcactga    197520
     actgtacggc aagaccctgg gcctggccgg actgggcggc atcggcaagg aggtcgcccg    197580
     gcgggcccac gcgttcggga tgacgctcct ggccgtcgag gagtaccagg atcaggcctt    197640
     cgcggcgcag tacggcgtca cgtatgtcga cctggagacc gcactcgagc agagcgattt    197700
     cctgagcctg cacctgcccc tcaacgccca gacccgtcat ctgatcaacg cggagcgcct    197760
     cgcgcggatg aagcccagcg cgtgcctgat caacacggca cgtggtggcg tcgtggacac    197820
     ggtggccctg gcgcaggccc tgcgtgaagg caccatcgct gctgccgccc tggacgtgtt    197880
     cgaggaagaa cccctgcccg cggacagcca cctgcacgcc ctcgagaacc tgctgatgag    197940
     tccccacgtg ggcggcgtca cgactgaagc ccggcagatg tccggcgtcc gcgccgcgga    198000
     gaacctcatc ctggcgctca aaggtcaggc gcctgcctcg ccggtcaacc cggaagtgat    198060
     tcccacggcc cggtacgcgg tcagcgccac ctgaaggcag gcccgccgct ttccagcttt    198120
     ccagcgggcc tgcgcaccgt catcccaccc gccacgccgt gttctcactc ctaacaacgg    198180
     gcagggcaac ctgccacccg aaaaggacca actgtgctga ttcctgattc cccctacttc    198240
     cagaaccacg tcgagcgaac ttcacctgaa ctcgtcacgc gcgcctcggg cttcgcggct    198300
     tccatcctgg cggacgttgc cggtcgccgc ggaaccatgc atggccgcgt tcgcgcgctg    198360
     gcgccatcca tgcgtgtggc ggggccagcc atcaccgtcg aggtgcgtcc gggggacaac    198420
     ctgatgatcc acgcggccat ggccatcgct cagcccgggg atgtgctggt cattgacggg    198480
     aaaggggacc agacctgcgc gctcatgggc gagatcatga tcagccagtg catggccctc    198540
     ggcttggccg gggtcatcat cgacgccgcg gtgcgcgact cggcagaaat tcaggccctg    198600
     gggttcccag tcttctcggt cgggaccaac ccgaacgggc ccaccaagtt cgtcccgggc    198660
     cgggtcaatc acaccatcag cgcaggcggc gtcacggtcc ggccgggcga tctggtggtg    198720
     gcggacgcgg acggggtctt tgtggccgag cgtgagcagg tggaggcgct gctgccgctg    198780
     gcgcagaaga aagtcgattc ggagtccgcg cggttgcagg acatccgcag cggccgcaac    198840
     ctgaccccag gctggctggc tgcggcactc gcggcggccg gcgtgctgga ggaaaccgcg    198900
     acagcgtagt agggtgccct gaaagcaagc gtcccggatc gtccctgggg tgtgaggcag    198960
     gacctcacac cccaggcttg ttctccgagg ctatcgccgc aggagcggga gagtaaccgg    199020
     agtgtgaatc ttgaggaggg caggcagatg agcccagagg caccacaggg ccatggcccg    199080
     aacgaggttc agctgctcct ctgtcagcgc ctgcgcgcag aggaattgtt ggaggtgaat    199140
     acggtggcgg ttcgccttgg actgcttcct gtggaggtcc aggagcgcat tcacctcggg    199200
     aagcttccgg ccgtgcggat gggcgggaaa ttgtatgtcc agcaggatga tctcacgttc    199260
     tacgttgacc agcttgaaca tccgcccggc ctgatggcag cctggacgtg ggcgaccgct    199320
     acggtgcacc tggcggggac gctggacgac cttcaggaac gcctgccgga gcggctgcgc    199380
     tgcttacgaa aggagcttct cggtccgctc cagccgttcg cggagcgcgt caaggagtac    199440
     ctgaaggggg gaaggtacgg cgcggtggcg ctgcatgtcc ggggtgcgga gcggatggtc    199500
     ctggcttttg agcgggcgca tgggcccctc agcgtcgaga tgcggcacac ggtggcaccg    199560
     cggagcgtca ccagccatcc ctgtgaagat gatcaaccag gttaggtgag cggggctcag    199620
     ggggccgatg acgatggtgc cggcatacgg cgttcagaca gagaacaccg ctgtttcgct    199680
     cttgctcacc tcccggatca ccatgcgcca gtcatccccg cgttctcagt tcaggcacac    199740
     ctagccagaa gtgcgctggc ggggacgcca ttcacgctgg tcgccgctga ggctcagagc    199800
     gagccaggga tggtgcgggt cgttttccac ggaggcatac agggtgtaca gccgaccgtc    199860
     gtccagcgcg ccttcctcct cgcctgacca gtccgacaca acaacttcac ctggatgcag    199920
     cggcaccggc agcgacaggc ggccgaacac ttcgtgacgc cattcggccc acgcctgctc    199980
     cacacgtccg cgaaacgtca tcaggtactg gcgcagcggc gtgtcgtcga gatcagtcag    200040
     ggcaccgccg agggtctcgc ggcggaacac gttcggttca acctgacgct gactcatcac    200100
     gatcaggctg tacgggaggt ttcgttcggt ggcgagatga cgcagcgtat ggagatgcat    200160
     ctgctcatca gcaaaatcac tcaacacgat gtcccgcgcg tagtccggtc ggcgcaggat    200220
     gatcagcccg ttgccgccgt gatgtccgag ccactggcca tctgcggtgt aaaacgcgca    200280
     gtagccgcag cgggcacaca gccgctcaga gtgggtcgcg aaggtcgtca cgatggtcgc    200340
     ctgttcgtca caggtggtat gggcccaacc gggcgtgtcc accagccgag gagcaggcgc    200400
     tggaagagga gcgcccacgc gagcgagttc ctggtggatc agggtggtgt tggcgttcag    200460
     gagcagtcga aggtccatgt ctcgcctctc atcacagcat ggtcttccgg gcagatggag    200520
     tgttttttct ctcatgagag atgtgtctgt ttcaccacat cttgcagatg cagcagagtg    200580
     tgctccgcca ccggcggacg ggatgatgag aagctgggtt cgacgtgttg attttgaatt    200640
     acatctaata tctcttcgat gtaaatcacc ggtctggagg cgcagtaccg gcaacatcac    200700
     tctccccttg cccaccgtcc tacacccacg ccggcccagt accaaagcca cgtcgttgac    200760
     gccaggacac caaagttttt ggcttcagga ccctctctcc agttccattt ctcaagggtg    200820
     aacgctcatg cgcacgtcca gtgagctggg cccggatggg tgtccgtgtg gagctcagga    200880
     acgtgcggcg cacctagatt cgtcatgcct taccgcaggg gcgcgggata agcactcgag    200940
     cgcctgtacc gccagacgat cctgaagacg tgcagcgcgc cttttacgac ccctggggag    201000
     gaactggaat gactgccagg gtgcaccgtg acacgcatac gccccggtcc tgctcatcga    201060
     caatctcgat ctgccacacc tgggtcgtgc gtccctgatg cacgggcgtc gcggtggccg    201120
     tcacgacgcc gctgcggacg gcgcgcaggt ggttggcatt gatctccatt cccacggccg    201180
     tcatgccgcg ctccgcgaca ctcaggtgcg ctcccagact ggcgacagtt tcggccagcg    201240
     ccacactcgc gccgccgtgc agcaccccga acggttgatg cacccgccgc tcgacgggca    201300
     tgcgcgcgac cacccgctcg ccgctcgctt ccagaaactc aatgcccaga tgatctggca    201360
     aggcgccgcg ggcctgttca gtgaactcag caagagacag ggtcatgggg cgctcctctg    201420
     cggacgcagg atcaggcagg tggtggtggc atgagcacac aacctgtcgt ttgcgtccag    201480
     gagtttcgcg tgtgccgtgg ccacctggcg cgacacactc agcacctcgc ccaccgcgcg    201540
     cacctccccc atacccacga gcaggggccg caggtagttc accttgagct caagggtggt    201600
     gtaacccacg cccgccggca gccgggtgtg gatcgcacac ccgagcgcgg aatccagcag    201660
     cgtcgcatac acgccgccat gaacgctgcc gatcgggttg tagtgaaatt cctgcggggt    201720
     catccggaac gtcacccggc cgtcctcgat gtcgtcctca agcgccagcg agaagtcgag    201780
     gctcgccgca atgggtgggc ctgggaactc accgcgcacc atcgcccgca ggtaatccag    201840
     tccgctgata tgccgcgcgg cttcggcacc gaccagtgga tcttcccagg tgtacgtgcg    201900
     aacgcggtcc ccctggagag gcccgttgtg gagcggagta gggggtgaga cggggtctgg    201960
     tgtggtgggg tgggtcatgc tggctcctgg gacagggggc taagcgttcg gcgggtgcgg    202020
     cttgtgaagt ttgagaacaa gggctgctgc gctttggacc acctggtggc atcaggcccg    202080
     ccaccttcgc tatttatatg atacatatca tataaagagc tacctggtgg catctctgac    202140
     gcaggaaccc cgggaccgct gatttcaagg agaaccccac ctcactcgtg catagccgaa    202200
     agaaggagca tcatgctgac ccaccggact gcccgaacat tcgccaccca cgcgttccgc    202260
     ccacaggtga cctgagatgg cccgctaccg cagtgaccat gcccaggaga cacgcgagaa    202320
     aatcctgaat gcggcgaccc tggcctttaa ggcggacggg ctcaacaccg tcggcatcgg    202380
     gcggctgatg ggaaaagcgg gactgacgca cggcgggttc tatgcccact tccccagcaa    202440
     ggacgctctg gtccaggaaa cgctcgcgcg gagccttcag aagactgccc gcaacctcct    202500
     gcaagccgcc accgacactc ccccttacgg cctcggcggc gtcatccgca gttatgtcag    202560
     ccgccagcac cgcgaccggc ccgccgcaga aggcagctgt gtcctgccgg ccctggcggc    202620
     tgaggtcgcc cggcagtcgc ctgacgtccg gcaggcggtc accgagacca ttgcagtcct    202680
     gatcgacgaa ctgagcgcac tctcacaagc gggcgacccc gcagcccagc gggcggaggt    202740
     gcttcccatt ctttccggca tggtgggcgc cattctgctg tcccgcgcgg tatccgaccc    202800
     ggacctcagt gacgccatcc tcaaaaccac ccgcgaccac ctgatgggtc aactcctgcc    202860
     cgggaacgcc catgaccgcg ggtaaccgcc tcatccagcg ctccaccctg atcgcctcca    202920
     gcctggcggt ggtggtggtc atgctcaacg tcgctgccgt gaacccagca ctcccgagcc    202980
     tccagcaggc ctttcagacg agtacgacag acctccagtg ggtggtcaac gtgtacaaca    203040
     ttgtctttgc cgcgctgctg ctcgtgggcg ggctgctcgg ggccaggctg ggatttcgcc    203100
     gcgtcctgct gggggggctg gctcttgggg cgttcggcgc ggtcctgacc gccctggcgc    203160
     cctcgtatgc cgtggtgctg ctggggcggg gaatcactgg cgtgggcgcc tccctggtgc    203220
     aacctgccac tctggttctc ctcactctcg ccttcagcga tcctgcggcc cgcgcccggg    203280
     cgatcgggct gtgggccggc gtatccggac tgggcatcgc cgtgggaccc gtcctggggg    203340
     gtgtgctggt ggacgccttc ggctggacgg cggtgttctg gactctcgtc ctggcaggcg    203400
     cagtcacctg ggccgcttcg ctgtggggaa cccgggagtc cccgcgcttc gcggcgcgtc    203460
     gcgtcgacct gcccggcctc ctcctggttg tcctgacgct gggcagcctg atctacggac    203520
     tcacgcaggg caatgggttg ggctggggtt cacccctggt cctggggtgc ctgctgggcg    203580
     ccggggtctt gttcgcgctt tttctgtggg tggaggggcg cgaacaacac cccctggtcg    203640
     acctgggcct ctttcgcaac ctgaccttta ctgcgtcgaa tctgggcggc ctgctgatct    203700
     ttttcgggcc cttcagcctc ctggttttct tcacgctgct gctccagggt gtcatgcggt    203760
     actcggccac ccgcgccggg ctaatcattg tctttttccc gctcggcgcc gccctgggtt    203820
     ccgtgttggg ggggcacctg accgcccgtc gcggcacccg gctcaccgcc acgctcggcc    203880
     tgggtctgat cgggctggcc acgctggtcc tggtgcgcgt gtccttgagg acgacggggt    203940
     gggacttgtg gtggaacttc gccgtgatgg ggctgggggt gggcctgtcc ctgggggccc    204000
     tcacgacagc ggcgatggcg agcgcgccgc gcgatcagat gagccaggcc tccagcctcc    204060
     tgagcgcgct gcgtcaggtg ggtgccgccc tggggatcgc cctgctgggg gcggtcattg    204120
     cccttcaccc tggtgaggac gaagccgctt tcctgggcgg cctgcgcgac gccctgtggt    204180
     tggctggagg cgtactgctg ctgagtgctc cggcagtctg gtgggcgatg ggccggccgg    204240
     agggggaagg gcggcctgcc gggggcaccc tgacagctcc ggtccaggat gcggcgtcgc    204300
     aggaaggctg acggcatcag agcacgcttg cgggttgaag ggcacggcgc ggcccgtcga    204360
     gtcgcgtgcg ggtgatccgc cggctgagtt ccgcctctgg cgcggaaaat tctgaggcat    204420
     caaatgctcc cggttataca ttcaattctg taggcgttcc tgcctgcatc agccgcatgg    204480
     cgaaggtcac gtcctgattc cgtaataggt ccagttcgac aaccgcgatg aataccggcg    204540
     gcagcccgga cagggtggtc tcccggggcc gagccgcaca aggatcggcc tgctgctccg    204600
     tgacgtacca ggttccgtgt tcagcctggg aaccagcaac acctcacttg caacgcctct    204660
     cctgtccttt ctgcgtcacc actcgtcttc actgcgccca cagcagggcc gtcagtaaga    204720
     accccggatc agggctgaag cgagaccagc acttcatatc cggacacatt ccgcaggagg    204780
     cgcgggtgaa gaacatatgc gggccgtacc cataagatgc gccgccaagg tatggcggcg    204840
     catcttatgg agtaaacctc agaagttgaa cttgtcgatg ttggctttgt cgaacacggt    204900
     gaggggcccg aggatgacca caccatcttt gccgatggtg cgctgcccaa gtttcccggc    204960
     gctgaacttc tcgccttcct tacccgtgat ctggccgctg acgagcgcag ctgcggcgta    205020
     ggaggccagg tacccgagtt cttccgggtt ccacagggca aagccctgta cagttccgtt    205080
     cttcacgaag gcacgcatct ggttcggggt gcccagacca gtcagggcaa ctttgccttt    205140
     gtacgggctg ccggaaaggt agcgggcggc ggcgctgatg ccgaccgtgg tgggggagat    205200
     gacgcccttg aggttcgggt aggcctgcat catgccctgc atttcagtga aggacttctg    205260
     gtcatcgtcg ttgccgtacg cgatcttgac cagtttcatg tccttgtact gaggcttttg    205320
     cagttcttcc tgcatgacct tgatccaggc gttctggtta gtggcgttcg gagtggccga    205380
     caggatggca atttcacctt tgctgccgat ctgcttagcg aggatcttca cctgatcgcg    205440
     ggcgatggtg tccgcgctgg cctgactgac gaacacgtgc cggccaccaa ccgcgacgtc    205500
     actgtcgtac gtaacgactt tgactccctg ctgcatggcg cgcttgaggt acggcaccag    205560
     ggcgttggtg tcgctggcgg acaccacgat ggcgttctgc cgctgggcaa gcagggtatt    205620
     gatgtagctg acctggcttg acgcgcccgc atcggacggc ccgacctgct tgccgacgcc    205680
     ggcgatttcc ttgatggcag cctggccacc tttccaggcg gtggtgaagt acgggttgtt    205740
     gacctgtttg ggcaggaagg cgatggtaat gcctttcttg agggtgccct gagcggtcgc    205800
     gacggcggcg gctccgagcg tgagggtcag ggcggcgagc agaacagtgc ggtgtttcat    205860
     ggttcctcca aagggaagcg gatgggcggg tgaggtggaa agcagggcgc gctgtgcagg    205920
     ggcttcaggg gctcacagcg tgcctccttg gggctgggtg ttaagccgct gctgtcgtgc    205980
     tgttttaaag cgcgccgcta gattcggccc aaggaccgag aggatcagca gcagacccgt    206040
     aacgatggtc aggatttcat tcggcacgtc agcaagggtc agggcgttct gaatgatgcc    206100
     aatcaggaac acggcggcaa tcacgccaat cacgcttccc cgtccgccga agatgctgac    206160
     gccgcccagc agtacggcgg caatcacggc gagttccagg ccagccgcgt tgtccgcccg    206220
     ggcactggag aagcggaagg tgtagatcac ggctgcaaag gcgctcatca ggccggagag    206280
     gatgaacagc agcagtttgg tgcgttcgac ccgcaggccc gcgaaacgcg ccgcaacctc    206340
     gtttgcgccg atcgcgtaga gggaccggcc gaacggtgtg gcatgaagga caacggccgt    206400
     gatgatggcg agaagcacga acgctacggc cggaatcgga atctgcgtgc cgggtaccag    206460
     accgaacccc aggttggtcc agaagggtgg aaaatccgcc actgcgcggt cccccagcag    206520
     cgcgtacgcg aggccccggt acagcgcgag ggtgccaatg gtgaccgcca gcgacggcag    206580
     cccgagccgg gtgaccagcc agccgttcag gaagcctgcg agcgccccca gggtgagggt    206640
     ggcgagaatg gcgaggggca tcggtacctg cgccgcccac aagacgccca gcagggcgct    206700
     gcacatgccg acgatcgacg ccacggacag gtcaatttcg gccgcaatga cgaccagggt    206760
     catggtgagg gcgattaggg cgatctccac cagattcgag gtgaggttcg acaggttcgg    206820
     gccggtcaga aatgcgtcgt gcagggccga gcccatcagc agggccacga cgaccagcgc    206880
     gaggatggtg gattcccagc cgagcaggct gcgtctgggc cggttcggga cgctcatcgg    206940
     tggctccttt cctgcatgac gcgggctgca cgccgcgcca caacaatgtc gatgctgatg    207000
     gcgagcagca gcagcgcgcc ctggatggcc tgctgccaga aggccggggc gcgcagggcc    207060
     accagggcgc tgccaatcac tccgagcagc agcgcgccaa ttccggcgcc agcgatggtg    207120
     ccgacaccgc cggtgatggc cacgccgccc acgacagctg cggcgatcac ctgcaactcc    207180
     agcccggtgc cggcggccgc gtcgactgtg ccgtaccgcg cgaggtacag cacccccgca    207240
     agcccagcga tggcccccga gaggatgaaa ccagtcatga cgcgccggct gacgttgatc    207300
     ccggccaggg aggcggcctc cacgttggat ccgaccgcgt aatactcgcg gcccgcgcgg    207360
     tacgacctca ggtagatgct gaacagcgcc atgaccacga ggaccagcag gactagggac    207420
     ggcaccccca ggacactgct gctcgcgaac gaactgaacg ccgccgggag gttgcttgcc    207480
     gtaatctgcc caccttgaac gacagcgtag tccacgccac ggaacacgta cagcgtcccg    207540
     agggttgcga ccagggccgg cactttcccg tacgcgacca gcaaaccgtt tacggcgccg    207600
     agcagtgcgc cgatgcctac gccggccacg aacgccagcc cgatcggcat gctggggttc    207660
     gcgacaaaaa gcgacccggt gaggaacgca gtcaatccga gggtgctgct gacgctcagg    207720
     tcaacgtgct tcatcagcag gaccagggtc tgcccgacga cgaccaggcc aatgatcgcg    207780
     acgtttaatg ccagatcccg catgctctgc ggagtaagaa agcggggatt gatggccgtg    207840
     gtcatcgcca ccagggccag caggatcaga atcaggctgg cttcccgggc gcggaacaac    207900
     cgggacagga ggttcggagg aggagtgctg gcagttccag gcgtcgacag tccagtcatc    207960
     acgccacacc acccacggcg gtctgccggg cgggagtggg agtgccctgg ccggtggcga    208020
     ggtacatcac ggcttcttcc gaggcgtcct gacggggcag ttcgcccacc agttcgcctt    208080
     cacgcatgac cagaatgcgg tctgccattc ccagcacctc cggaaggtca ctactgatca    208140
     tcaccacggc gagtccttcg gcagcgagct gtgcgagggt gcggtgcact tccgctttgg    208200
     cgccgacgtc cactccgcgg gtgggctcat ccacgatcag gacagctggg ccagtggcaa    208260
     gccatttggc cagcacgacc ttctgctgat tcccgccgga gagcgtgctg accgcgtcgg    208320
     tcaggcggtg ggctttgagc tggagtttgc tggtccagtc gctggccgtc tggtattccc    208380
     gcgcgcggtc catcaggggg ccgcggcgca ggcggccgag gatggccagg gtggcgttgc    208440
     gttcaatgct catgtccatc accaggccct gctgccggcg gtcttccggc accaggccaa    208500
     tcccggcctg catagcggcg ccggtgctgc cggccggtac cgggtgtccc tggacacgaa    208560
     cttctccggc gtcccggggg tcgatgccga agatgacgcg ggccacttcg ctgcggccgg    208620
     cacccaccag gccggccagg ccgacgatct ctccccgccg gacctggaag ctgacatccc    208680
     ggaatacgcc ccggcgggtg aggccgcgga cgtccagggc aatgtcgcct ggcgtgacgg    208740
     gaatcttggg gtagagctcg ctgacgtcac ggccgaccat gccgcggacc acgctgtcga    208800
     tggtgtactc cagggcaggt ccactgctga cccagcggcc gtcacgcatg attgtgaagc    208860
     gctggcattc cgcaaaggct tcctccagcc ggtgagtgat gaacagaacg gctgccccac    208920
     gggcgcgcag ggcgcggaca acgcggaaga gccgttcggt ttcctgaccg gtcagggctg    208980
     cggtcggttc gtccatgatc agcacgcgcg cctggaagga caggggcttt ggcgatctcc    209040
     acgatctgct gatcggcgat ggacaggccc cgcacgggcc gggccggatc gaggggtacg    209100
     ccgaggtcgc ggagaatctc cccaacagtg gaaagcatgg cccgacggtc gatgcgcccg    209160
     ccgcttttca gaggctggcg tcccatcagg acgttctcag caactgtgag gtccgcgaag    209220
     agggtcggtt cctggtaaat gatggcgatg ccggcgtcgc gcgcttcagc ggtgttgtaa    209280
     aaggtgcgcg gctgaccttc gagcagcagt tcccctccgt cggcgcggtg aacaccggcg    209340
     aggatcttta ccagggtgct tttgccggcg ccattctcac cgagcagcgc gtgagcttcg    209400
     ccgccataca gctccaggct gacgtccacg agcgcttgga ccggtccgaa gcttttgctg    209460
     gcgtgatgca gggcaaggat gggctggtca gtcaaggtgg aagacctcct caagttgcaa    209520
     gaagccttcg tcagggtttt ttccattgag ggcttcaaag tagggagcca tggtggcctg    209580
     ccagcgggcg ttcacttcgc gcccagccat gccttgttgg gccgcagcca ggtctggcgt    209640
     ttcgaagtag cccaccagaa gtccgtcgcc gcgcagaaaa agggagtagt tgtgccagcc    209700
     ggtctcgcgc agggcctgga gcatgtccgg ccacacggcc tgatggtgag tcttgtactc    209760
     ggtgaggcgg tcagggcgta cctgcaacag aaagcagaca cggtggagcg gcggtgcagg    209820
     tgtgggcatg gattctccag cgggcggttc ccggttttcg gttggttacg ttgttacagt    209880
     tatctaacat gatcaagcag aaaaatacaa gggcttgtaa tcttctgttc gaatgatgtt    209940
     agatttgggt atgaccaccg acactccaaa agtgagcagt gagcgccagc accagatcct    210000
     gcgccgcgca ctggcggacc gcgtcgtgaa aatcaaggat ctgtccgcgg agctcggagt    210060
     tcacgagatg actgtccggc gcgacatcga ccagctcgcc gaacagggcc tcctcgaacg    210120
     tatccacggc ggcgcgcgca tcgtcgagaa aaccagcgag gaagtcgctc accagctgcg    210180
     cgccaccaag aacaccgaag ccaaagaagc catcgcccgc gccgccctga acctcattga    210240
     ggacggggac gtcgtcgccc tggacgccag caccaccgcc ctggcgctcg cccgccttct    210300
     gcacgcccgc aatgtcagcg ccattgtcag cggactcgac gccgccaacg ttctcgccgc    210360
     aaatggcgtg ccgttcctga tggtcggcgg aaacttccac gctcccgccc gttcgttcgt    210420
     cggcgcgttc ttcatggaca ccatgacccg cctgcacccc gacaaggtct tcttctccgc    210480
     caaggccttc tcgcccgaca ccggcttcac cgaccctcac ctgccggaag tgggcgccaa    210540
     gcagacgctc atccggtccg ccggtaccgt catcgccctg ctggacagca ccaagttcga    210600
     gcggcgcgcc ctggccacca tcgccaccct cgatgaagtt gacgtactga tcacggacca    210660
     gacgccctcc gaacgaaccc tgagcgccct tgaagccgcc gacatccagc tcaccatgac    210720
     gcaggagaca ccatgaacac cagtacgctc ttccaggccc tcgaccagca acgcatcgaa    210780
     acaccctcct gggggtacgg taacagcggc acccgcttca agacgttcac ctctgccggc    210840
     gctgcccgtg acgtgtacga gaagattgaa gacgccgctg aagttcaccg cctcactggc    210900
     atcgcgccta gtgtggccct gcacattccg tgggatgaag tggcggacta cagcgagctg    210960
     cgccggtttg cggaaggacg cggcgtcgct cttggtgcca tcaacccgaa cgtctttcag    211020
     gacgatgcgt acaaactcgg atccatcgcc catccggacg ctggggtccg cgcgcaggca    211080
     gtggatcacc tgctggactg cgtggcgatc atgaagcaga ctggctcccg tgacctgagc    211140
     ctgtggttcg ctgacggcac caactacgcc ggccaggacg atcttcgcgc ccggaaacgt    211200
     cgcgttcggg aagccctcgc gcaggtgcat gacgcgctac cggaaggcag ccgcatgctg    211260
     gtcgaataca aactgttcga acctgccttc tacgccaccg acctgttcga ctggggcgcc    211320
     gcgtacgcgc actgcctggc aatcggtgag aaggctcagg tgctcgtcga cctggggcac    211380
     cacgcgcaga gcgtgaacat cgagcagatc gtcgcgttcc tcctcgacga gggccggctg    211440
     ggaggcttcc acttcaatgc ccgccgctac gcggacgatg acctgatcgt tggcaccacc    211500
     aatccattcg agctgttttg catctacgct gaacttgtcg cggcgcagcg gtcagaagac    211560
     gacctgacgc gttccaccgc gcagaacact gcatacatga tcgaccagag ccacaacatc    211620
     gagccgaaag tcgaagccat ggtgcagagt gttctgaact gccaggacgc gtacgccaaa    211680
     tccctgctga tcgaccggga acgcctcgca gctgcgcagc agaccggcga tgtcctcgag    211740
     gcccaccgca cgctgaccga cgcctttcgc actgacgtcc gccccctgct cgcagactgg    211800
     cggcgcgcac gcggcctgcc cgaagatccc atcgccacgc accgtgccag cgggtaccag    211860
     cagggagccg cgcggaaacg cggcaccgca agcgctggtg gtggatttcc cgtcaagagc    211920
     tgaccctgct gcccctgaag acccgccctc ccatccggct gggtcaggcc tctcacaccc    211980
     cttccccgga ggaccacatg accaccaccc aagccaagac caccatcacc aaccgctgga    212040
     acgacgctga agctccgcag agtgacggcc tggccgcgct gacctaccgc tccaacctcc    212100
     tcggcgccga ccgcacgctg gtgaacatct acggcgggaa caccagcacc aagagcgtcg    212160
     agaaagacca cctcggccgg gacgtgacgg tgctgtgggt gaagggcagc ggctccgaca    212220
     tcgccagcat caccgagaag ggcttcgcgg ggctgaagct cgacgaggtg ctccccttat    212280
     ttgaccgtcc ggagatgacc gacgaggaca tgaccgcgta cctcgaacgc accaccttcg    212340
     aacccggtcg tccacgccag agcatcgaga cattgctgca cgccttcgtg cccgccaagc    212400
     acgtggacca cacccacccg gacgccatca tcgccattgc ctgcaccccg aacggccccg    212460
     acatcatgcg cgagatctac ggcgagcggg ccgcctgggt ggactacatc cgccccggct    212520
     tcaccctcag tcagcagatc ggcgcggccg tacgcaacaa cccgaacctg gaagcggtcg    212580
     ttatgggcaa gcatggcctg gtcacctggg gcgataccgc gaaggagagt tatgaaacga    212640
     ccctgcgcat catcggagaa gcccaggcgt acctggacgc ccgtcaggaa gcccagccgt    212700
     tcggaggcca gcgggtagcc agcctgccgg aagaggcagc aaataccctg cttgccgcag    212760
     tgctgcccgt cctgcgcggc gcgatgaagg gtgcccggcc cgtgatcctg aacgtagacc    212820
     gcagcccgga agtgatggag ttcgtaaact ccaaagctgc cgcggaactg tctcaggtgg    212880
     gtgcggcgtg cccggatcat ctggtgcaca ccaaacgcac cccgctcttc ctgaactgga    212940
     cgcccgagca gggcaaggac gccctcctca ccgccgccag ggacggtgtc gagcagttca    213000
     aagccgagta cgccgcgtac tttgaagaga acaaaggcgc aggcgacgtg atgttcacgc    213060
     ccagcccccg cgtggtgctg atccccgggc tcggcatggt gaacagcgga cccgacgcgc    213120
     agggcgcgga cgtttcccgg caactgtacc tgcgggccat tcaagtgatg aagagtgcca    213180
     gcagcctcgg cgggttcgtc agccttacgg ccgccgaatc ctacgcggtg gagtactggc    213240
     cgctcgaact gtacaaactc gcacagaaac ccgccccgaa ggtgctggaa ggtcacgtgg    213300
     ccctcgtgac cggcgcggcc agcggcatcg gacgcgccat cgcgcggcgc cttgcacagg    213360
     acggtgcaca cgtcgtgatt gccgacctga acgctgaggg aggccagcag gtcgcacagg    213420
     aaattattca ggaacgcggg taccagcggg cggccagtac cggcatgaac gtcaccagcg    213480
     aggaacaggt gcaagccgcg tatcagacgg ccattctcca gtacggcggc gtggatatcg    213540
     tcgtaaacaa cgccggcatc gcgtccagcg cccccatcga ggagaccagc ctggagatgt    213600
     ggaataaaaa ccagagcatc ctgtctaccg gttactttct ggtagcccgc gaagcgttca    213660
     aggtactcaa ggcccagaac accggcggga acctggtgtt catcggcagc aagaacagcc    213720
     tggcggccgg caagaacgcc gcggcgtaca gtaccgccaa agcggcggaa atccacctgg    213780
     cccgctgcct tgccgaagaa ggcggcgctc acggcatccg ggtgaacagc gttctgcccg    213840
     acagcgtcct gtccggctcg gccatctggg acgggaaatg gcgctccgag cgggccgcga    213900
     cctacggcat ccgtgaggat cagctagagg acttctaccg tcagcgcaac accctcaagg    213960
     tcaacatcct gcctgaagac atcgcagaag ccacgttcta cttcgccacg cccgcagcga    214020
     gcaaaacgac tggtggcatc ctgaccgtcg atggtggcgt gccgatcgcg tatgtccgct    214080
     gaggccaccc tgacagacgt gaagcgtcac gtcgcgattg acctcggcgc gtcgagcgga    214140
     cgggtggcac tggggaccgt gcacgccgga aagctcaccg tggaggtcct tcaccgcttc    214200
     ccaaacggcg ggatccccgt gcagggcggg ttgtactggg atgtgctggg cctgtggcgg    214260
     gaaatcctgc atggactcag gctcgcagcg ggtcacggac ccatcgacag tgtgggggtc    214320
     gactcctggg cggtcgatta tgcgctgatc gatgaacacg gcctgctgat tgacggtgtc    214380
     cgtcattatc gcgacgcacg gacggacggc gtgatggacc agctgctcgg cgtgttgccc    214440
     agagacgcgg tgtacgaatt taccggcatt cagttccttc cgttcaatac agcctttcag    214500
     ctggtcgcgc acaggcagca ggcgccgacg cagctggacc gggcgcgcac cctgttgatg    214560
     gtcccggacc tgctgcatta ctggctgaca ggccggcagg tcacagaaat gaccaatgcc    214620
     agcaccacgc agttgtacga ctcgcgtcag acagcatggt ccgagccagt cctgaacgcc    214680
     ttcgggatcc ctgcacacct gttgcctgac gtagttcatc ccggcactga cctgggagcg    214740
     gtgcagcctg atgtggcgcg tgacacgggc ctccacggca cccgggtcat cgcccctgga    214800
     acccatgaca ccgccagtgc tgtcgcggcc gttccggcag acgggaaggg ctgggcctac    214860
     ctctccagcg gcacctggtc cctggtcggc gtcgaaacgg accgcccggt aatcaccccg    214920
     caggccctcg ctctcaacct gaccaacgag gcgggcgtgc acggcacgac ccgcctgctg    214980
     aaaaacgtga tggggttatg gatcgcgcag gaatgctccc gcgcctgggg gaatccctcg    215040
     ttcgctgaac tgtacggcgc agccgcgttg gtcgaagcca atggcccact gattgacccg    215100
     gatgacgtcc ggttcctgcc cccaggcctg gacatgcccg cccgggtcca ggcgtactgc    215160
     gcggaaaccg gccaggtggt ccccagcacg cccgcagaaa tcacccggtg cgtactggaa    215220
     agcctggcct tccgctgcgc ggaggtgctg agtcagctgg aggaggtgac cggtgagtcc    215280
     atccacacct tgcatgtggt gggaggcggg tcccagatcc gctttctcaa ccagctgctg    215340
     gcggacatct ctggacgcac ggtggtggcc gggccagtgg aagcaacgct gctggggaac    215400
     ctgctggttc aggccgaagc gtgcggcagc attccacgcg gcagcatgcg ggaagtcagc    215460
     cgcatctgtg aaatcctcac tacctataca cctgtcaaaa agcgaacggt tacgcagcac    215520
     accatattcg ccgaactgac cacccggcat gccgcttcca cctgactttc cccatttcct    215580
     ctgaggctta acccgtgcga attgacctgt ttatcacctg cctgaatgac gccatgtttc    215640
     cccgcaccgg cgaagccacg gtcaagttgc tggagcgcct cggccatgag gtgcatttca    215700
     acgaccggca gacctgctgc gggcagatgc atttcaattc cgggtatcag ggcgaagcgc    215760
     ttggcctggt ccggcacttc gtagacacat tccaggacgc ggacgtggtc gtggctccga    215820
     gtggttcctg cgtcggtatg gtccgtgacc tgtaccccaa agcggccgaa tgggcaggag    215880
     atcgggagtt gctggacgcg gtcactgccc tcgccccccg ggtgtttgaa ctaagcgagt    215940
     ttctcgtcaa gcaccaaggc atcgaggatg tcggggccta ctacccgcac cgggtgacgt    216000
     accaccagac ctgccacgcc atgcgcgtcc tgcgcgtggg ggacgcaccg ctgcggctgc    216060
     tccagaaggt gcgggggcta agtctggtgg gactgcccgc cgtggagcag tgctgcggtt    216120
     tcgggggcac gttcagcgtg aagaacgccg agaccagcac ggcgatgctg gcagataagg    216180
     tacagaacgt gatgagcacg aaagccgaag cgtgtacggc gggagataac tcctgcctga    216240
     tgcacattgg gggcggcctc agccgcctgc aaagcggcac ccgcaccgtg cacctcgccg    216300
     aaattctggc cagcaccgag caggaagtgt tcgcatgagt gccggtggga tcaaaccggc    216360
     caaacccttc caggacgcgg cgcgggtgac gctcgcgaac ccgcagatgc gccggaacct    216420
     gcgccatgcc accaccacca ttcgtgacaa acggcaacgg gctgtggatg agctgccgga    216480
     ctgggaggcg ctgcgggacg agggggccgc catcaaggac cacgtcatgg cgaacctcag    216540
     cgagtacctg ctggagctcg aagcatcggt caaggcgcgc ggggggcacg tgcactgggc    216600
     tcgtgacgcg gaagaggccc gcgaactggt tgccggaatt gcggcgtccc acggggcccg    216660
     tgagatcatc aaggtcaaga gcatctccac cgatgagatc gagctgaacg ccgccctgga    216720
     gcggcacggc attcacgcca tcgaaacgga cctcgccgaa ctgatcgtgc agcttgctga    216780
     ggatcgcccg agccatattc tggtgccagc cattcaccgc aaccgcgcgg aaatccggga    216840
     tctgttccgc cgcaagctgg gcgcggaatt actgaccgat gagccgaaag tgctggcgga    216900
     agcggcccgg gtatacctgc gggagaaatt tctgaccacg aaggtcgccg tcagtggcgc    216960
     gaactttgcg gtggcagaca gcgggacggt gtgcatcgtg gaatccgagg gcaacggccg    217020
     catgtgcctg accatgccgg acgtgctgat cagcgtgatg ggcatcgaga aggttctgcc    217080
     cacctgggag gacctcgcgg tgtttatgcg cctgctgccc aggagcagca ccgccgagcg    217140
     gatgaacccc tacaccagct tctggtccgg cgtgacttca ggtgatggtc cgcaggagtt    217200
     tcatctggtg ctgctcgaca acggacgcac cgatgtgctt gcagacgagg tgggccggca    217260
     gaccctgcgc tgtatccgct gctcggcgtg cctgaacgtc tgcccagtgt atgaacgcgc    217320
     gggcgggcat gcttacggca gcgtgtaccc cggtccgatt ggcgcgattc tcaccccgca    217380
     actgctgcac ctggaggaca agcacgccaa caccctcccg tgggcgagca cgttgtgcgg    217440
     tgcgtgttac gacgcctgtc cggtgaaaat caacatcccc gaggtgctgt tgtacctgcg    217500
     tggaaagatc accgacgata aacctctgaa ctccgaagca gtggcgttca agaccgctgc    217560
     ctgggtgatg agtgaaccgt tccgtttcga gggcgccctc aaactcgcgc gaaagggtca    217620
     gggcccgctg gtgaaacacg gagccattca tgccctgccg ggaatgctgg ccggctggac    217680
     cgactcgcgt gatctgccgc cgctggctgg gcaatccttc cgggaatggt ggcggacacg    217740
     gccagcgccc gagattcacg cgacggacgg gaacgcgcag gcgagccagg gggaacccat    217800
     tgctccgcaa cgaaccgacg agcagggacc catatgagca gtgaggccag gctcgacatt    217860
     ctgacgcgga tcaaccgcat cggcgcccag gaatcccagt cgttcaagcg tgcgcctctc    217920
     cgaccttcag accgcgccca cgatgttgtt gtggagcagt tcgccaagtt cgccgcggag    217980
     taccgggcca atgttatgcg gctgagcatc gaccaactgc cacaggtgat ttccgaccgg    218040
     ctgtccgccc gcgggagcgc gcgtgtggtc gtgcctcacg atctgcctca ggactggctg    218100
     cccaccagac tcagcgtgac ccgggacaac actgggggga cggacctgac ctccttcgac    218160
     gctgtcatca cggccgccgc tgtgggcatc gcggaaacag gcaccgtggt cctcgatcat    218220
     gggtccgggc agggccggcg tgccctgacg ctggtaccgg atcatcacat ttgtctggtg    218280
     cgcgaacgtc aggtggtgga cagcatcccc gaggccgtcg cgcttctcca gcatgcggtg    218340
     cagcgcggtc agcccctgac gtggatcagt ggaccgagcg ccaccagtga tattgagctt    218400
     agccgcgtcg agggcgtgca cggcccccgc atcctggatc tcctgctggt acgtgatacc    218460
     tgagaccagt ccggctgatc gggcatcttt gcgtacacgc ttccggccga acttgtcggg    218520
     gcactgctgc tgatgttccg cttcgtgaag acggctcgaa ccgcggcgtc cacctcgccg    218580
     tgtttcattc ggtgagtgcc ttcaacaacg cggggttcgg gctgtacccg gacaacatga    218640
     tccgcttcgc cgaggaccct ctggtgctgc tgaccaccag cacccttgtt atcctgggcg    218700
     gtctcggata cctggcagtg ctgggagtcg cgctctacct gcgcgacccg caccggaacc    218760
     gtctgagcct gaacaccatc atcattctgg tgacctcagc ctccctggtc gtgcttagga    218820
     cggtggtcgc gggagagcag cagcatcgtg gcggcggtga ctccgcgctc cggtacaaag    218880
     gtgcgcccac cggacgggcg ggctgcggcc tgagaattgt tcaccagtga agcagtgtcc    218940
     tcatcgtctt tgatgcgttg acggcagtcc tgacagtggg aatgctcgcc gggacgctca    219000
     ttgccaacat taacgacttt gagaccgaat gtcagcgctg tgctcaattg cagagcgtgg    219060
     ttcagttcat gaatgcggcc cgtatcaggt ctgtgttgct cgacgtgtag cctccaccag    219120
     gcagggtgag cacatcctca aaacccatgc ggacctgctg cccccgggcc gatccccagc    219180
     gcagcaatgg ccatgctgtc gcatcctcgc cgtgaaccag gcgtggttca gccacgttcg    219240
     ccgcagaaag caggctcaac aggtgatcag cggtcacgag tgccgcttca acattggtct    219300
     cccaaagcac ttcaatcagc acccggacgc acctgccttg cagcccgctg ctcaaaaaag    219360
     cgttgacatc cgccggtgtg gacacccctg cctcaatccc aacgccacgg tcacgcagtg    219420
     acctcgcgat ctccgtagcc ccggcttccc agaagttgac cgacgcaaag tcaggaagga    219480
     cagaccacgc gcagatagtg ccgacacgac ggttcaggtt ctcgtcgatc tcctgcgttg    219540
     tgctgacccc aatggggagg ccagggcaca ccaggcgaat ggcgctcacg gcgctggcga    219600
     cactcttggc gtcgagggat gggcgaccgc agcttgctcg agggtgaata tgcacggcgc    219660
     tggcaccggc aactcgcgct gcctgtgcgt cccgggcgag ttcatttgcg ccaatgggca    219720
     cggccggatg ctcatccaga cgccggttcc cgttgaggca ggcctggatg aacatgccct    219780
     tagcatacaa agggccaagc ccatcaggac gcatgcctca aacaaagtct gtgggctgat    219840
     tttggtttct caccgcaatc aatggaaccc taacgggcaa gcccctcttg caccagccat    219900
     tgctgcccgg ccgtaatctc ctccggtttg agctccagga tcaagcgggg atcggcctga    219960
     acttcccgca aggcacgaaa caccatgcgc cagttgatgc tgccgtcccc cggcttccag    220020
     tgccggtcga gcagcccgtc agtgtcctga agatgcacgt gtccaagccg ccgacctgct    220080
     tcacggatcc agtggtccgg ggaaggccct cccttggcct gcatcagggc agcgtggccc    220140
     acgtcgatgc tgatctgcac cgtaccactg tcaaacgagc tcaccagggc gagcagcggc    220200
     gccgggttca ggtcacgaat gttctctatc accagcatgc agccgatctg gcgggcctca    220260
     tcgaccacct cgcgtagcgt ctcatgcacc tgttcaagct gatcgtcaag tcctgtgacg    220320
     ccggtgtggg ccaccagcgg atggccgaaa aaatcgaacg ggctgtgtac caccatatgt    220380
     gtcgccccga tttctgacgc catcgccaga ccgccccgca ggcgcgcgct ggtcaggcgg    220440
     cggaccgccg ggtcctgggc catgaccgtc aacccccaga acggaccatg aatgcccaac    220500
     ctaccggtaa agccgtccag atcccggcgg atgttctgcg catgagtacg ccagtcgccg    220560
     tcgagtacta ggtgggatac tgggtcctgg agttccagat cccggccttc ccagagccat    220620
     tcgcggtgcg ccgccaggtg cgcactgggc atagcggcac cgagaagcgg gagggtgtgc    220680
     acagaacgcg cgtgcctggt cgtgggtgcg gttatggtca tgattcacct cgaatgaaaa    220740
     tggggttgct gagcagcagg gtgttctgcc actcccgccc cccggagaaa ccgctctgcg    220800
     gggctcgtgc ataagcttcg agccggtagt agcctggtcc cggattggga tcgagcacct    220860
     cgagctgtac gggtgccgca ctggccgcga ggtcgagatg cgtgtggtac aggccatttt    220920
     tcatgacgaa cagtcgggtc ggatgggcga ggttgcctac ttcgaccagc agccggacac    220980
     ggcacggact cgcgtgcccg cccggcagga ccagttcgcc gcccatgtca gcccgctctc    221040
     cgccacactc ggcggcaaac gtcagttctg ggccgagtga aacgtaggcc cgatgtttcc    221100
     ggaccccgtc gatcaatccg gctggcgtca gattccgggc attgatcacg gtggtgacct    221160
     gaccaagacg gtggcgtccg gccagtggat cgtgcgaatc cgtgccggcc actccagtga    221220
     tgcggtggcc agcacgcagc aggccgtccc agaagattag ttgcgcggca ttgttggggc    221280
     cttcaaggtg atgatagatc tcgaaagccc cgcacaggga ccagtcgaac tcgtggtact    221340
     gccagccgag gctgttcgag aaagcgtgat tcacgcagaa cacaccgccc tgatcccgca    221400
     cgccccgggc tacgtcgttg acggtccatt ccttagcggg atcgtcaacg aacacatcga    221460
     cccacccatt gagcccgtgc aggttggcgt gcccgcggtg accggtcagc tccagcgagt    221520
     gaatcacagc caggtcagga ccagcatggt ggtcgatctc ggcccagccc gccggagtga    221580
     agtgatcggt cagggccacg aagtccagtc cagcgcgccg ggcggccccg gccagctcac    221640
     ccggtgtggg gcgaccgtca ctgtggtgcg tatgggcgtg caactccccc cggtaccacc    221700
     ctgccccggg acgcccgttc acggtgaccg gatcaggaga cgtctgggtt ggcgactctc    221760
     cgaacccggc cgctacggtc agaaagtact ctgcggtttc ctcggtgctt tccacgtcaa    221820
     tctgcgcacg ccatcgtcca ggctcgatga gacccgcgag ggcgccggga gaagcggagt    221880
     gcgctccaaa cgtcagctcg aggtgaatgt cccctacgcc accagggttc attcgagtgc    221940
     cgcggtagtt catggggccg aacaccgaaa ggaacagctg acagcggcgc ttcttatgaa    222000
     accgcaacga gacggtgagg gtcgtggcgc cgtccggtac ctcaaattcg tgatacagat    222060
     acggcacgtg gaggacaggg gaaacctgac cgcggacgct caggaggctt tctgaggtgg    222120
     gggcaatggt cgtcatgggc tccttgcagc cagcgcgctc gttgctgagg cgcgccgggg    222180
     acgactgaaa cctatttgct gtccttgaac aggggcgcgg tgcgctggac caggtccttg    222240
     agggtcgctt caaccggcgc attctgcaag aagattcggt cgagtgactt gatgatttcc    222300
     tgggtgccct gcacgtatcc cgcgctggaa gggcgagggc gggcaaaagg cagctggcgg    222360
     taccccagat ccagtcccgc ggaggtgccc atgtacttgc ggaacacggc cagatcggaa    222420
     gtcgcgcggg tcacgggaac atagttgctt ttcttgatcc aggtgaactg ctgctgcggc    222480
     tgcgccagcc agttgataaa cgcccacgcg gctgcctgac gctctttggt gatgttcttg    222540
     ctgatcgcca gggtcgcgcc acccaccggc accacggcct tcttgtagta cggcagaggc    222600
     gccgtcccga atttgaacgg cacggccgcg gtcagcgacg gccggctggc gacactgttc    222660
     atgaccatag cgacttttcc ggctgcgaaa tcggcattgg tgttgctgtc ttgcagcacg    222720
     gccgtgccgt cgcggaagaa gcccgcccag tgctcgatca cttcccgcgc cttcggctgg    222780
     tccagggcga gccggccgtc cttgatcatc tcaccgccgt tgctccagat ggcgccttcc    222840
     agcacccacg ggaatgaagg cagggcgatg gcggacatgc cggtcgctgc cttgatcttt    222900
     ttggaggctt cacgcaactc ggtgtaggtg cggggaggtt tgctgagccc agccttcttg    222960
     agcagcgccg ggttgtagta caacaccggg ttgctgttgt tccagggcat ggcatacacc    223020
     gcgccgtccg ggcggcccac ctgttttttg aagaccggcc agaagttgtc gaaactcttc    223080
     tgaaacccag gcatggtttt caggttagcc agcgcgccgg actcggcgat gcgcggaacg    223140
     tacgacactt ccagctggag aatgtctgcc gctggctggc ctgcggcgat gcccgcgagg    223200
     gctttttgga cgacaccttc gtaggtgttg gcgaactcgc cgcgtacgac cacgtcattc    223260
     tgagatgcgt tgaactcctt gatcatgctt tcgatggctt tgcccaattc accgcccagg    223320
     ccgtacatca tggtgacctc ggttttggct gaagcggtgc tgccaagcag caggacggtg    223380
     gacagggtga tcagggtacg gtgcatgggt aaatcctcca gaggggggag agggcggcag    223440
     agggaaaaca ttcgcttggg caggagccca ggaagcgtta gcctttgagc ccgctggccg    223500
     cggcactctc gatgaaccat ttctgcgcga gggcgtacac gatcagcacg ggtgcaatga    223560
     caatcacggt cgcggccatg acgagcggca ggttgctgcc ttccaggttc gaaaagctgg    223620
     cgagacccac ctggacagtc cggaattcat ctcggttggt ggcgacaagc ggccagacca    223680
     gggcgttcca ggagccgaga aaggtcagga cccccagcgc gctgacggtc gcgccgttga    223740
     cgggaagcag gacataacac aggtattgaa gggccgtggc gccatcgagc cgggcggctt    223800
     cctccagctc cgcaggggtg cgaaggaagg cctggcgcag caggaacacg ccgaaggcac    223860
     tggctgcaaa cggggcgatc agggcctgat aggagttgat ccagccgaac tcgcggatgg    223920
     taatgaaatt aggaatgagc agggcgtcac ctggaatcat cagggttccc agggcaaaca    223980
     ggaacagcac cggcttgcca ggaaaattca gccgggcgaa cgcgaaggca gccagcgcgc    224040
     tggtgatgac cacgaggatg gtcgtgaggc tggcgatcag cagagagttc agcaggtact    224100
     ggccgaaggg agcgctgttc caggcctcca cgaagttctg ccagacccag gtttcaggca    224160
     gcagcgggcc ggtgtacacc gccttccggc ctttgaaggc ggccagcagc atccacacca    224220
     gcggcatcag gaacaccagg gtcactacca gggacagcaa ttcctgggct gcgcgggtcg    224280
     tccagggcgt tctcactggt aatgcacccg ccgttccgcg acgcgcagat gcaaaaagcc    224340
     cagcagcatc agcagcagga acaacgccac ggacagggcg ctggcgaagc ccatctggaa    224400
     gaacgagaag gcgttctgat agatgtggta gccgagtagg ttcgtgctgc cggccggtcc    224460
     gccctgcgta agcagcagga ccagtccgta tgactgaaag gtgcccacca gcgagataaa    224520
     gaacacgacc atggtggtgg gagcgagcag gggaaccgtg acgtgccggg caatctgcgc    224580
     ccgggtggcc ccgtcgatgg cggcggcctc ttccagctca cgtgagatgg cttgcaggcc    224640
     cgagaggaac agcaccgctg gcaggccgac acctttccac actgcgacca ggatgactga    224700
     cgcaagggca gttctcggat cgctgagcca gcccggcccc ggcagaccga tggcctcgag    224760
     cagccgattg accggtcctg acgcagggtt gagcaggtag tgccacacta cggccgtggc    224820
     ggcgatcgac acaaccaccg gtgtgaagac ggcgccgcgc agcagtccct gaagtcgtgt    224880
     cctggcgctc atcaggaagg cgagcgccat ccccagaacg acttccagga tggtcacacc    224940
     aagggcgaac agcgcggtga tccacaggct cgaccagaac tcccggctgc ctaccatctg    225000
     ctgatagttg tgcaggccga tgaacgacgg gctcgatttg agcatgtccg aatcggtgaa    225060
     gctcaggtag atcacgcgtg ccagagggta gtacgtgaac agcgagaaca ccagcagcgc    225120
     gggaagcagg taagccatgg cccccaggaa gcttcggaat tgcggaacat acagtgggag    225180
     cgtcttcggt tgatgcggca gggccttaac ggttgtcacg ttcacctctg ccggcacctt    225240
     agtcaccgtt catcagctgt ttgcaagtca ccgtgccctg acagaccggc cggggtgatg    225300
     acacccggcg ccgtgtgatg ggcgacaatg gccctgctct ttcctgtgtt ccagcctcag    225360
     gaccgctctg ggtccgctgg ctttggatca ggccgaactg acactggtcc ccgcagcagg    225420
     aggggctggt agaggcggga agtcatccac caccagtgga tgactggcgt cgcgtgtgga    225480
     tacacacggg ggctggaatc cagttcggcg ggccggtctg atagtgggct gatcctggct    225540
     gattaagctc agtcatgcta tttgcttttg accttgacgg caccatcgtc accaaaggaa    225600
     atgtcctgcc tcctgccatc cgcgacgcca tcctggccct acgccaggag ggccaccagg    225660
     tcaccatcct gaccggccgg caccgaaccg gagccaggat ggcacttgat gctctggggg    225720
     tggtgtgcca ttacggcacg tgcaacggtg cgcgcgtgca tgggcacgga gacgagcacc    225780
     acgtggagtt gcatctggag ccggagacgg tcagttacct cctggagcgc ttcacccacg    225840
     attctaaagc tgaattctac ctgtctggtc gcgagcgaat gttcgtccgt gatccagaca    225900
     ccgaccagtg ggcccaggca cgtgtggaag gaagagacct gcggccggcc ggcgattacg    225960
     acggggaacc cgcccataaa ttcattctca tcagtgagca cgccgggcag gtgcaggatg    226020
     aactcgccga acgttttccg gaaaacgcct actacctctg ggagggtcgc tacctggagg    226080
     tgatggcccc aggaggacac aaaggaaatg ccctcgcccg tatcgctcac gagtacggca    226140
     tccaccgctc agaaaccgtc gcgttcgggg atggcccgaa tgacctggag atgctgcggt    226200
     gggcaggccg gtcgatcggg gtgggtcagc tggccgcggg cgtttcagat gtaatcgacg    226260
     agcatgtttc cggcccggat gaactcgggg tcgcccggtg gctgacgcag gagatcctgg    226320
     gccggtccgg gaaacggcag gatcatggaa tacggccgag tatgcctctc aacgctggaa    226380
     actgttcttg aagcgcgggg tggctggaag accgggcgta cccttgtggg cgagacgtga    226440
     ctggggctca cgtggccgaa aggctcggtg gtgagctccc agagccacca ttcctccttc    226500
     acccttctgt ctgctcaaac acaagcacca aagccaggat caacacctcc tgccctgaag    226560
     ccagctctct tcccgtaccc ccgcccgact ggattctccc tgacaccctg cttgggcgtg    226620
     tgctggcgcg ggaagcggga gaggagggag gtgggtgggg atgcctcagg atcagcaggc    226680
     gctgtgcgtt gccgagccga gccgacgctc accatgcaga aattgagtca cggtatcgaa    226740
     atacggttcc ggctcttcca tccatggcag gtgcccgctg tcctcgaaca cctcgagctg    226800
     cgagccctgg atgccgtcat gaatgatgtc agcctgaacc ggcgagcaga taaagtcgtg    226860
     acgccccacc agcaccagcg tgggcaccgt aatttccccc agccggtccc tcaccagaaa    226920
     ccgcccatcc gaagctcccg cagcctgact tgtgaccagc gaaatacggt tcgaccgcgc    226980
     gtactcccgg aacatggcgg ccccctcacc ctccggatca cggaagtaca ggggcgcgat    227040
     tctatgcagg aaaacgctga cgtcctcgtc cgtcttgaga tccagaggcc cactgaacgc    227100
     cttgaccgcc tccgcacacc ggggatcgag cgcaaggact ggtaaggtcc gctgcatgtc    227160
     ctcccccggc tctttcacgc caagctgcgc gtctaccacc accaggtggg acaggtgccg    227220
     cgggtaccgc agagcgtagt tcaacgcgat gtatcccccg tgggaatgcc cgatcaacct    227280
     gatcgtctcc agcccaaggt ggctgcgcag agcgtcaagg tcttctataa aacgcccgac    227340
     attgatgtcc tccggattgg aggggctctg cgagcgacca cttccgcgcg ggtgcaggta    227400
     gaccacggtg aagtggcgtt ccagaggccc gaacgaccgt tcgtacagac ccgcgccgat    227460
     cccccatccg ggaggctgga cgaccagggc ttccccccgt cccgcgaccc ggtatgcgag    227520
     attcagcccg tcggtggtga aggtgtggtc cccaggagtc atggacatgt cgttctcctt    227580
     ggttggttgt gaaagtattt cccgcaggtc ggctggaggg cggatggtct gacctgatcg    227640
     taaaggaaga aatgaaatca cgggtgatca ggaacccaag ggggttgagg gatctgatca    227700
     ggacggtggc ctcatcggat tcgtccattg cggaaaggtc agtcgcttcc gtacggccgt    227760
     caagggtgct gggcggctct ctccgcccct ttccactcct ctgtggctcg cgcaacaggg    227820
     gagaacagcc tggattcctc aggtgcgccg gcatccggcg tcagtccaga cgcaggcggg    227880
     aactcaggca gttcctgcgt tgcgcctgag cttgcgtccg tcgccttcgg cgatcgtcct    227940
     ggcaccctgc ctgggcatgt gctggtgcgg gtgggggaca gaagggggga aggtacagtg    228000
     cggtggcgct gcaaagaggt taaggttctt ctcttccttt cctaccatca cgcctgcacc    228060
     ggcgcaccga gaaacaggcc gcatccattc actttccgag cctctcacac gtagcgtcgg    228120
     tgagtacgcc gttagagatc atccagtatg ctgtgatcat cacatccaag gacggcaccc    228180
     taagacgggc cctgaatgct gctgaggcac gaggtcggat ccacatcccg tacctttctt    228240
     tgaggacatt ccattcaagg acggtttcaa tcatgaaaac ccccgcccct ctgctcaccc    228300
     tggtgctgtg caccttcgcg ctcgcccaac ccggcccgac gggctcatcg agcctgctgc    228360
     gcctgccgct tacgcccggt gccgtgcgcg tcactgaccc tgccgccacc cgagaattcg    228420
     gcctgctgct gaacactgtg gccgccgggc agggcagcgg ttgccagacc agcgaatacc    228480
     tcgcctggaa cgatgcggac cttgccgagc agatcagcga caaccttgcc gcgcaactga    228540
     aagctcgtgc catcagcttc aaagggcttg acgaggagga ggacgaggaa agctactggc    228600
     tgtcgttcct gttgactgaa aagcagaccc gctatgtggg cgtgctgtac ggtgacaatg    228660
     aaagcgtcgt gctgggctgg tgccagctca aagccaaagt aacggttaaa cccgagacgc    228720
     ccgcgcctgc caagcccgcc gtgcctggtc cccccaagcc tgccgttgtt gttcaggctc    228780
     cggcaccagt tcctcagcgc accactggcg cggctttggc gggcgactac gtgtgcctga    228840
     gcggcggcgc accggaactc tcggtggccg gcccggtatc gcaagctcca gtcgatccag    228900
     ccgcagcgca gatccgcagt tacgcgaacg cctccaagta ccgcctgtcc gcgaatggcg    228960
     cctggggcga cttgactttc ggagagaagt acgtcaacca gaaaggctac aagggcacct    229020
     acagaatcct cgcgaacggc gacgtcgacc tgctcagcga cccgggaagc cgtctgtacc    229080
     tcttccggcc cattcctacc acggaccgcc gcctggccct ggtcgaggta caccagcctg    229140
     cggaccgtta caaagcgcaa ttctgcaccc gcgtggattg aagcacgcag ttgggaacac    229200
     ctctgctgcg tctgcctgca caccctcggc agcctgcacc cgagtaacac catgctcagg    229260
     ccgcgcggcg ggttatgctc cgcgcaggag ggcaggaagc atgacgagca aactcgaaca    229320
     actccggacc cattcggtgg tggtcgccga caccggggac ctcaccgcca tcgcgcagtt    229380
     ccgtccacgt gactgcacca cgaatccctc actcatcctg aaaaccgcac aacagccgga    229440
     gtccgctgcc ctggtgcgtg aggtggtggc ccaggctgcg cgggacggcg acgacatcga    229500
     agtcgtgctg gacaagctgg ccgtgcgcat cggggtagaa ctcacccggc tggtgccggg    229560
     cgacgtcagc acggaagtcg acgcgcaact gtcgttcgat acggacgcca tggtcaccaa    229620
     ggcgcgccgc ctgatcgccc tgtacgagac gcagggcgtg ggccgcgaac gggtgctgat    229680
     caagctggct gccacctggg aaggcatccg cgcggccgag gtgctcgaac gtgaaggcat    229740
     ccgctgcaac ctcacgctgg tgttcagcct ggagcaggcc atcgcttgtg cgcaggccgg    229800
     cgcgttcctg atctcaccgt tcgtgggccg gatcaccgat tggtacaaga aggccgaagg    229860
     gcgagacgcc tacccggtag atgaggaccc gggcgtacgc agcgtccgga ccatctacac    229920
     gcacttcaaa acgcacggct accgcacggt ggtgatgggc gcctcattcc ggaatgccgc    229980
     gcaggtcgaa gcgctcgcgg gatgcgaccg ccttaccgta agtcccacgc tgctggcgga    230040
     actcgacgcg gaccacggcc cgctgcatcg gcagctcaat gcacccacgc agcgaaccga    230100
     agatgcgcag gaaccactta ccgaagccgc gttccgctgg gcactggtag acaaccagat    230160
     ggccggtgag aaactcaccg aaggcatccg tcagttccac caggattacc tccaattgca    230220
     caccgacatc gccgcgcaac tgaaggcaca ccctaccccg gcagccgtgc ctgccggctg    230280
     acctgacttt ttgtgatggc cggctctaga tctcttacag gacctggccg ggtcagccgg    230340
     tggactgctt ctggcctcca aggagcccgg cgttctccgt tgccataaag cccagggcat    230400
     gccggaaaca ggcgtcagcg ggcaacaaga accaggaggc cccgaccgca cacgctgtat    230460
     gtagcgtact cgccgccgac attcgctgca gcattcaggt ccacctgggt ggccccctcg    230520
     gcccacgggc aggtgtccgt cacccggtac cagcttttgc cgctgccagg ccacggcagc    230580
     ttgaaatcta cgcctccgga ccagccgtta tacgccacgt agatggcgct cgcggtgtcc    230640
     ccgaactccg tgccgtcgat ccggtacgcc agagcatgat tgtccgcatt cccaaagtag    230700
     ccgctgtccg cgacggtacc atcaggcttg aaccagcgga tctgctccat cacgttcccg    230760
     ttggtgtctg acgaggagta gaagttcgcg ggccggagtg ccgggtggcc cctccggaat    230820
     gaaatcatgt tttgcgtaaa cgatttgaag ttcgtctgat cggtcgtcag cgtcgggttc    230880
     agccagtttc cgctggagtc caggttgtac gcattgttgt tgcactgcac cgaccgcagt    230940
     gtttcgtcac cgccgttgaa catcggcgtc ccagcattca gcatcaggaa cgccatgccg    231000
     tttcgggcag ctttccgctg gtcggcggct actccggcct ggtcccaact gtgattgctg    231060
     tcctctccac cgtctgacgg gccgtacggc cacgcctgtg agttgttctt gctgttgcag    231120
     gcgtacaagt cctttaacgt gaagccgtcg tgggccacca tgaaattcac ggaattccac    231180
     ggcttgcgtc cgtcgtcgcc gtacagatcg ctcgacccgg cgaagcgtgt ggcgagttga    231240
     cccggcgtga cgctctccac acccaggccg ttctgatcct tgcggagcgt gtcacggtaa    231300
     atgccgttcc attccgacca gccggcgggg aagttcccga cctgataaga atttccgccg    231360
     atcgcccacg gttcagcaat caggtcggta ccggcgccgc cagcctccgg gcgtggactg    231420
     agatcacgga caatgcggtt cagggcggtg ctgctgttca gcttgtcgta gttaaagcag    231480
     ccgtgcgtac aggtgttgcc cagcaccgac gccaaatcga accggaatcc gtccacaccc    231540
     agctcagtgc gccagtagtt cagggaattc acgatcaggt tctgggcggc cgggttgaag    231600
     gtgttgtaat tcgcaccgat gccggtattg tcccagaaaa actgccggtc agaagtcagg    231660
     gagtagtacg tggcgttgtc cagtccacgc cacgagtaca gcgtggatgt ggtggcatcc    231720
     gtaccggacc aggtacctcc ctcggccgtg tggttataca cgacgtccac aaacaccttg    231780
     atgccccggt cgtggtacgc cttgaccatc gccttgaatt ccttggtggg gccgccggcg    231840
     ctctgatcac agctgtaccg gcgatctggc gcaaagtaat ttaccgtcat gtacccccag    231900
     tagttgtccc cgctggtgct ggtactggag cggcccgtgg cggtatcggt cgcgtcgttg    231960
     gcgtcattgt ccgtttcctg tacgggcagg aattccacgg ccgtgacgcc aagggcctga    232020
     agggcagatg cccgggctgc cgcgcctgcg taagtgccgg cacacgacac tcccgaatcc    232080
     ccccgggtca ggccgcgcag gtgcacttcg tagatcacgt cgtctttcag cgcgcgggtc    232140
     ggcttggtac cgaagctcgt ggtatctgag gccagcacga tgcctttcga cgccacccgt    232200
     ccggagtcct tggcgcggtg tgtggcgccc gacgcataca ctgcgttgct gtagttaccg    232260
     ctggctggac tgatggggtc gtggctgatt tcgagtgcgt atggatcaat gagcagcttg    232320
     ttggggttaa agcggtttcc tgacgagtcc acgtcgctga caaatccagc cgtggaccct    232380
     ttggtccagc tgctgctgta cggccagttc gggccccagg cacggtagcc gtagtacacg    232440
     gggccggtga tgccgtaggt gctgctgagg gtgctgactg gcaccgtgac cgaccatacg    232500
     ttcgtggtcg tgtttttcgt gagggtgtac cggactttct cgtccgcccc ggcgcgctgc    232560
     gcgtaaaggt tgacttccat gcgggaagcg ttcgcggagt acacgcggaa tgtgatgtga    232620
     gtcgtgccgg tggcagagcc ggtcgagtcg gtgtatcgcg cacccagcga cgtcggactc    232680
     agcgcctgag tgctcaacac cgtgcgggtg gtgtcgggcg tcgtgccaca ggcggtcaca    232740
     agcagggcga gggccagtag agcgacgtga cgcatgcgaa ctcctttttg ctgtcctcgg    232800
     gaagatgccg agggaaagcg ctgggctctc gatgaatgac cggcccgctg gtgtgatgtg    232860
     tgcaacaggt gtagcacgtg aacgccgcgc tgtgtagcgg ggggcattca tcggtcgcag    232920
     gcagagggga ggcccgcttg cgcaaaggtt ttcagtcagc tgcgcgcact tccggctccg    232980
     gtcgatgcag cgggagttca ctcaaccgct gcacgtttac ggtcaccgca cgccccaacc    233040
     gcgttacctg ctcccgcttc aacaggcgtg gtgtcgattt cagcagcaca cgacccgtca    233100
     ccgctgggtc gtcgagcata cacgcgcatg gctcaaccgg ttcatggcag gttagtgatc    233160
     accaattcgg cttgtggccg gcgccagctc cgtcctgcct gatcgcacgg ccgctggagc    233220
     agattcggtg tgacgtggcc ttctccaagg ggagtatcag cacgtaaagc tggcctgatc    233280
     gtgatcaata aataaaatgg ggcggtaggt agtgggggaa gcacaacgca tccccatccc    233340
     ggaagcgcca gcacctggcc ccactcgacc tggaggtgcg tcagacccgc cgcgtctacg    233400
     gcaggagcat ggcccgacca tgaaacaacg cctcgtgatt gacatgggcg aagacggctt    233460
     cgcccatgtc gaatggggtg aacacctcct cgacctccac ctcaaggaac gtctgcatag    233520
     cgtcctctga actggtttca acgccggcac ctttctgacc gctctgcgcg gcgattaggt    233580
     ctgtatggat ttaaggagaa ccggcaggca tcgcctgaca aaggcgcgtc tccgagattc    233640
     ctgtgtattt gtttctcaac atcctgaatg gcttcgctga cgccgctgta cacaggaaac    233700
     gatggttcaa gtttaagccg ggcgcacatg ttggcattgc tgaagtgcga ccgcacgatt    233760
     cttccgccaa gctgtgcacc tcaggtgatt tcgttcatgc acgcccagat gtgatgccat    233820
     gggcccgtaa gctgagactc atgcgatcaa gtcgcgtcct cggcactctc ggctggagca    233880
     ttctgaccct cggtaccctg ggagtggcca acgcataccg cttcgtcatc tccaagcacc    233940
     agctgtcggt gcctggactg tcccggcctg tccggatcgt tcaattgagc gacctgcatt    234000
     atggtttatt cgtcggccgg gccaccgtcg cacgctgggt tgacgcggtt ttaaagcagg    234060
     agccggacct gattgtcatc accggtgatt tcctcgacag cggcgtcgga agccggcggc    234120
     accgaaaact gatggcggaa ctcgcccgcc ttcgtgcgcc gctgggtgtc tacggcgtgt    234180
     ggggcaacca cgattggacc agcctgaaca ccaacgccac gcgaatatca ttcgccgagc    234240
     aattgcgact ccacggcgtg cgactgatca acaatacggg cgttcaggtg cgtgaggacc    234300
     tgtatgtggc gggcgtcgac gactggtggt ttggcacgca ggatctggat gcggcgctcc    234360
     gagggcatac gggaggggct gtggtactgc tgtcacacaa tcccgattac ctcacgcagg    234420
     tgccggcgcg ggttcacctg acgctgagtg ggcatacgca cggcgggcag gtccggcttc    234480
     ccctgttcgg ctccctcaaa cgccgctcga ccctcctcaa cgtgttgagg gggtgggtgc    234540
     gggggccgca cgtggtgcaa tccccagcag agggcacgcc agcgactccc ccggaaggac    234600
     atgcgctggg ttttgtgtca caggggcttg gggtcacagg ggtgccgttc cgtctggcgt    234660
     gccctgcaga agtggtcgtg ctcactctgg tccccgtggg gcaggggccc tcctcaacct    234720
     cacctgtgag aggtgcgccc actgccctgt aaagcaactg accgcctggc gtgaggccga    234780
     cacacgagac cgacctggcg ctgcaccaaa atccaaaacc agtccacgcc caccaactca    234840
     acgccgctcc ccgtgatgcc cgccctgata cgttgtctcc accgtgacca gcggcccgcc    234900
     gcgcgtcacg accagcgacg acaccggctg caccagcgtt ctccccaccc aaccctcatg    234960
     ttacgatgat gttgtttcac tgtgttgatg tcccggttca gacgaacagg agggacgtca    235020
     ctgtggacgg gtgaggagca ccatgagtgt cagcgatgcc ggtgatattc acgtggtcgt    235080
     tcatggacaa caggcgtacc ggggtaagca gggactggac tacacgcctg ggatcagtgc    235140
     cacaagcgtt ggctcacggg cgctgtggtt gggggcggtc accattccgc ctggcggccg    235200
     caccaaagcg catgtccacg aacagcatga atccgcgttc tatctggtca gcggtgagga    235260
     agtagagctt tggatcggga acgccctgga gcatcgtcac cttgcgcatc ctggcgatta    235320
     tctctatatc ccgccgggta ttccccacgt tgccgtaaac cgcacgcctg tgccggcttt    235380
     ctttgtgggc gcacgcactg acccgagcga acaggaaagt gtcgtcatga cgccgaatct    235440
     cgacggcctc gttccatagc acggactttc atcggtctgt ttcaagttca ttgcatcacc    235500
     tggacatggc ctgcagaacg aggaggagcc ttcggcagcg gttatgggcc cgcttgatgg    235560
     aggacggtat ggaattcgaa gtgatttctg ttccttgagt ctcgatttcg attgggcggt    235620
     actcgcacgc cacccggggt ggtggtctta tctttgtgtc tggccagggc gcgttcgacc    235680
     ctgagactgg acgaattgta gacgggggaa ttcgtgaaca gaccagtcag gtattgcgga    235740
     atatcagcct cattctgcaa tccgctgggg cagacctcag cagtgttgtg aaagtcacag    235800
     tgttcctcca cgcgtggaag gacttcgcgg agatgaacga agtgtacgcc tcgtttttcc    235860
     cggccaaagc ccgagcccgc tctacggtcc agggcgagcg gtggccggaa ggttcgctgg    235920
     tggccataga agccatcgcc ctcgtgcctc ctgaacactg aaccagacgg tgcaccctgg    235980
     atgattccgc atgtccgggc gtacctctcc gtcaggaaca agctcgctgc cagatccaac    236040
     ggccacttac ctgcctttcc tgcttccgcg cgagcattgg cttaagaggc aggacagaca    236100
     ggttcacgtg ccgttcttcc catccttcca gctcgcattg gcccgtgctc ttgcgtccgc    236160
     gtgcaaccgc cgcccggcgc accagccgct gcacatcaga gaacgcggct gggatggcga    236220
     acggaggcgg tggggtccca gctggctact ctcggcagcc ctggccatcg ttgttgtgtg    236280
     tagaagctgc agcaggaggc cgggggccgt catttcagga agcaaaaggc ctaaggtaca    236340
     gtcagtcacc tcgaccacgg ccgcgactca gacaggagga tcgtatgacg aacaagcaac    236400
     cgacgccctc atactttgat accacgggcc gggacgaccg gctgagcggg ggcgtcaagc    236460
     tgatccccat cacgacaccg cacggcacct tccgggtgtg gaccaagcgc atcggcaacc    236520
     acccgaccat aaaagtcctg ctcctgcacg gagggccggg agccacacac gaatactttg    236580
     aggcgttcga cagtttcctg cctgctgccg gcatcgagta ctactactac gatcagcttg    236640
     gttcggccta cagcgaccag cctgaccagc ctgagctgtg ggacctctcc cgcttcgttg    236700
     aggaagtgga acaggtgcgc caggccctgg ggctgaccag cgagaacttt tatttattag    236760
     ggcactcatg gggtggcatt ctggccctgg agtacgcctt gcgttatccg cagcacctca    236820
     aaggtctcgt gatctccaac atgatggcca gcattccgca gtacaacacg tacgcgcgcg    236880
     aagtgctgat gcccgccatg gacccggtgg tgctggccga gatccagcaa ctggaggcgg    236940
     ccgggaagca cgatcagccc cgttatatgg aactgctggt gccgcaccac tatgtccatc    237000
     atgtgctgcg gatgccggtc gacgagtggc ccgatccggt caaccggacc tttaaacacc    237060
     tcaatgcctc tatctatgtt ccgcttcagg gtcccagcga actgggtgcc agcggcaaac    237120
     tcgcggattg ggaccgcacg gctgacctga gcagcctcat ggtcccgacg ctggtgatcg    237180
     gcgctcagca tgacaccatg gatccggcgc atatggcgtg gatggcgcaa cagctcccca    237240
     acggccggta cctgcattgt cctgagggca gccatatggc tctgtacgat aatcaggacc    237300
     ggtacttcga aggattgatc acgtttcttg aggacgtgga tcaagcagct cagggacagc    237360
     gctgatcgtg gcggacagtg cctccccagt ccccatttcc gtcggccgcc ttcctctgaa    237420
     ggcactccta cgacctgctc ccggagagcg agcgggtcgg gcaaaacctg atcgcccagg    237480
     ctgggaattg cgccgagcac ctgggccggg cgcacctgga ctgccaccca gaccaaaaca    237540
     gctggcgggc cacagcgcag gaaccgcgac atccgcgaag ctctggggtt tgctacgcct    237600
     caggccgtgg tgggaccaca gtgacgcggc attgcgcttc gagatgatct caacgggctg    237660
     tcgacaccca ctgagacagg gtcgcatggc cctgaccggt cactgtccgt ggggtttttc    237720
     ccgacccctt gccctgctga acggggcgtt cggaatggcc gatctgaagg cccagcagca    237780
     ggggcgttgc acgtttacac tcccagcagg cttccctcac tgcaactact gaccctcagg    237840
     atggttgtgc tgggtgactc gcgacgcgtg gactggttca ccacgccgaa ctcaccacag    237900
     gtacgctgag gaccggtagg tgatttggcg gttgtggccg caacacatgc tttgtaggct    237960
     ccctgcatgc gcttcgagct ggtccctacc ctgaatgaat tgcgttccgt gtacgcgcga    238020
     ccgctggacg cccgacgttt tcaggcatat ctcgacaccg tcatcaatgg agcacaatct    238080
     gccaaagccg tccggttgcc gcccttggtc ctcgcgaacc ccatggccaa agcgcacgtc    238140
     ctcaacgtcc ttgaccaatg gctaacgctc gacgcagaag aaaccgcccg cgctgcgctc    238200
     gaagaagcca acgcgcgctt gctccacgtg gcgtacgacg ccgccgtcaa ggtcgggctg    238260
     actttgctgg atgacgtggc gggcggctgg accaatcgga acatcaatga cgcgatgcgc    238320
     ttccacaccg cgcaggcgtt gaagacatcc gggtgggtga ccgtctgcct gtggacgagc    238380
     gccgttccgc agcgcgccgc gttgcggcag accgtattgg agtgcgctca acgcgccgcg    238440
     ctcgcggcgt gtcacggcga tccgtgcacg ctgctcggca tgatgcgcca agaaggcgct    238500
     gcggccgtct tcgcggagcg cacgcttgaa ttcaacgccg aggagttggc atattcccga    238560
     gcggtgctgg cgccgctctt ggagagcagc catcaaccaa ccgtcctcgc ggcaatgtat    238620
     ggcgatgaag ccgcgcgtga ctgggggtac acgccgcttg gactttccaa tcaggccgga    238680
     tttcaggttg ctttggccga cgcgctcgaa agccaggcac gaccgcccgc gtgaccatgg    238740
     atgcgccctc gatggaagcg tgcgtgggct gcggcgcggt gttgcctcgt gtggagggtc    238800
     ccattcatcg ctacatgacc tccagtcctg cctgctgggc ggctttcact gccctcggaa    238860
     gtgcacagca tctacccacg aacgcgtcct gggaggcgct gctggtggac gcgtacgcag    238920
     ttcagcaccc gggcacgccg tccaaccaag cgatcaattc ggtggcagtt cacttgatgg    238980
     tgctgtacgg cgtgctggtg cgtgggtacg ctcccgatca agcccaacgg ttgcgtcaac    239040
     gcccaggaca gcagacgaaa ggacacaaac acgaacgctt tcactggttg acgccgccgt    239100
     cgtttgcttc ggtcttgacg gtggccgacg tgcagaacgc tggtgacgct caagtgcgcg    239160
     cgcaggtggc agaggcgtgg gtgcgcgacg tttggtcagt ctgggcacag ctgcacgaag    239220
     ggcaggtcgc gtcctggttc gcggcgtaca tggcgttcga ataaggcttc ataaatacgg    239280
     gcgacccaaa ccttggccgg gacagtgcgg ctgcgcttct cgacacgggc agcaaacgca    239340
     aaattactgt gcttcaattt actggcgctc acgttgatgt cgttgggaca ccctgaggta    239400
     tggcgttact gcatgaacgt tggtgtcctc ccacagctcg ggcaaggtat ccctctgacc    239460
     ggaccaaaca agattccgat tgatgccctc acctgcaggg ttgacatgga cccacgggcg    239520
     gtcgggcggc ctctcggctt cggcaaacag gtgcaattct tgctggagtt ggagtctgtg    239580
     gcacaccacc tgtggtttat aaagaatctt cagcagattc tccgacagtc ccagggttga    239640
     tccaatttcg ttttcccggc tggtcattcg ttctggaacg ttgaggagga gaatgcccgc    239700
     atgaagggtg acgtccacct tcgcaaaaac ggacgtgcga gcgggagagc aggcgggtgc    239760
     cctgactggt tcgaggccag tcttccgcta catcttcagg ggcctgatga ggcctatttg    239820
     ttctcctatg ccgttccgtg aaggagctca ccatgccctc ttcaatcacc aacgctgccg    239880
     tccacgaaga acaacgcctc acgctgctcg agcgctgccg gctcatgaac accgcacagg    239940
     agcgctccta cgacctgatc gtcgaagggc tggcccggct ctatggcgtg ccgattgccc    240000
     tgatcacctt cctggatggt cagcggcaat tcatcaaggc caatgtcggc acggacgtgc    240060
     gggagatgcc ggtcacagag tcgttgtgtc agtacaccct ggaatcggac agccccctgg    240120
     tgttgccaga cctgacgcag gactggagat gtcattccca ctccctggtc acgggagacg    240180
     aggagctgcg gttttatgcc ggagctccga tcattgtgga cgggtaccgg ctcggcacgg    240240
     tgtgcatttt tgaccgggtg ccacattccg cgaatgatct ggatgcgtcg ctactggtgc    240300
     acatggcgat gatggtggcc gcgacgatca aagcccgcag tgagaaccct agagctccgg    240360
     tgtcgtaccc ccgataccgg gcacctcaga atgaggccta gccatccctg gcggtcgaag    240420
     cctgggaagg acgtgaggac accagaggat gccggatcgt gactggatgg tcggcgcaaa    240480
     gtacagcacc ccgaggctcg agacgcacct cgaggagctc aggaaccgtc agcagcagct    240540
     tgaggagcac aaggtggctt acctgtcccg cctgctggag taccaggttc tgaaggacga    240600
     acagaaatgg cgaaaagaac acccgaaaga ccgttgagta cccctgcctt cctggctttc    240660
     ggaggcggtt gaagccatgc cgaccccctg ccattacctg ctggtggacg acaacccggc    240720
     cgaccacctc ctggtgcagg aagcgttcga gctgctgggc cccggacact gcctgacgtg    240780
     ggtgcagagt ggccagcagg ccttacagat cctgaatgca ggtacgaccc agccggatgt    240840
     ggtgctgctg gacatcaaca tgccgggcat ggacggcttc gaggtcctgg aagcgatcaa    240900
     gcgggatccc cggctgcgga cgattccggt ggtgatgttg tccacgtcca gtgccggagg    240960
     agatgtcaac cgtgcgtacc gcctgtttgc gagtgcgttc ttagtgaagt cagcgcgttt    241020
     tgacgctttt ctggagcaga ttgaagcctt cctgaactac tggcagacca accgggtctg    241080
     tacgcccgac aggttgctgg cttaaggttt gccaggccag gtgatgcttg tctcagcagg    241140
     cgggaaccgg accggtcgaa catcatcgga ccagcaggcg tgcccacccg catcagtcac    241200
     caggaaatct gacacccgaa agactcaccc cggcccgtta ggtccaagga gcaccccatg    241260
     cataccctgg tgaaaggcct gatcgcagga gcggccggcg tggccgccat gacggttgcc    241320
     gagaagctgg agcagcagtt cacgcgccgc cccaactcgt acgtgcccgc acacaccgcc    241380
     gaacgtctgt tcgggctgag gcaccgtcct gacgaggaac ggttgtggct gaactgggcc    241440
     atgcactggg ggcagggcgt tctgctgggc atggcgcgcg ccaccatggc gcagcgtggg    241500
     ctgcgcggcc cggtcgggtc gttcatgtac atgaatctgc ggctgctgaa cgaccagagc    241560
     cttgagaaca gcaccggggt tggcgcgcca ccctggacgt ggccggtgga cgagcaggtg    241620
     atcgacctgc tgcacaaagg gatctatgcg ttcgtgacgg ggtatgtcgc tgaccgcctg    241680
     attcagggcc caccggggat tccctcagcc cgcaccccgt ggacggccag gccgcaaccg    241740
     ccgaccgcgc cctctgacta atggctgacg tgtattgcgt ggcccgggca gcagggaaga    241800
     gcaggagccg ggtagtggtc gagtcacagc aggtgtcctc atcctctcgg gagacgttct    241860
     gacaccgcgg tcagatgttc acgccagacg tactttcacg cctccggacc cgttatggtg    241920
     aacgaaccgt gcataccact ggcaccgcga ggctccccct gacacggaac ggttgaccct    241980
     ggtgacctcc ctgggggtct tcaggagtgt tccctatggc ccagcagaac cacaacccgg    242040
     ccgggccggc tctcgtattg tccgtttccc tgttgcaggg tcctgcggga gacatatgga    242100
     ggcgcccatc ggtactccgg gagcggcgcc gccacttcag tcagcagggc atcctttgcg    242160
     ccggccagga tcatgcgtct gatcatgggt gggggcaacg gcccttactg ctggcactct    242220
     gcctgggcgt gtgctggcgc cggaaggggt ggggtggcga ataatcgccc gggcacacgt    242280
     cacggtagtt cttgtatcct gccctacatt tctcggttcg tcctttctct gctgtcgtct    242340
     gagcagagag ggagcgaacg gacttcgaag tgcgatgcga agaagagcgc acaccttgcg    242400
     cttggatgat ccgtcctcta ttatttaagt aacttcatta actaattcgc ttgttctgga    242460
     gggtccttga ccaaccccaa tccactgcgc aggaaaaacc gcaccgcgct cctccagctg    242520
     ctgtttcagc acgggcctct gtctaaaacg gcccttgcac aaaacagcgg actctccagc    242580
     gtcaccgtca acgccatcat caatgaattg ctggacgctc aactgctggt ggaaattgga    242640
     aaaacaggag ggaatgccgg tcgcccagcc ggaatcctgg attttcatcc tcagctcagc    242700
     acggtggccg ggatcgacgt tcagcccaag tgtctcagcg tcgtgacctc caacctccgc    242760
     ggtgaagccc ggagccaacg cactctcccc gcggaacctg cttatgtcac tgagtcactg    242820
     ctgaacgcca tcgacgaact tgctcagaca atgccacatg gaccggtagg acacatcgcg    242880
     ctttccgtgc ctgcaccggt caatccgatc accctcaaac ttctggagcc taatagtctt    242940
     ccagaactgg atctgccaca catcatcaac cactgcactg ctcgaggcat caccctcctg    243000
     gcagacaacg atgcgaacct cgcggccgtc gccgaacggg cttacggttg tgcccgcggc    243060
     cacaccaatt tcggcgtcct ggtgactcgc gattccggca tcggcatggg gctggttctt    243120
     gatggacggc tgtttcaggg cgatgacggg caagccggcg aacttgcgct ggcctactgg    243180
     cccctcaacg gcgagcccgt gcccatcgaa caccttccgc ctcgggaaca ggacatcgcc    243240
     atcgcctacc tggtcagtgg caacgcggtc accctcaatc tttcccaact ggtggtgtat    243300
     caggccaatc ccgacccaaa ttcagacctg attcatcgac tgcgccagct tctccctgac    243360
     cggattcccg tctgcgaaag cctcgttgcg gccgaaggtc cagtgctggg cgccctcacg    243420
     atggccgtcg cctcgcacgc cgagcagtta tttaccactc accctacgcc ggcccccgtc    243480
     cctacgccct ctcgtgacgc ctctggaggc tgaaatgaac cgaatccacc gcacgttagc    243540
     cctgctctct ctcgccatga ccacggccgc atcggctgct cccgtgacgc tgaacgccct    243600
     gctgatgaaa caggcggcct acagcgaaca ggacatccgc aacatgacca aggaattcga    243660
     ggccaaaaac ccgaacctga aagtcaatat cgaatttgtt gcctacgaag cgctgcacga    243720
     caagatcgtg gcctcacagg cctccggctc aaacggctac gacgtcgtgc tcttcgacgt    243780
     tatctggccc gccgagttcg cgcagaacgg ctttttgcag gatgtcacca accgcatccc    243840
     caaggcctcc acagaccggg tgatcaaggg tgcctggacc accgtggagt acgacaacaa    243900
     gcgctacggc atgccgtgga ttctcgacac gaagtacctg tactacaaca ccgacatgct    243960
     caaacaggcc ggcatcaagg caccgccgcg gacgtgggaa gaactcctcc agcaggccga    244020
     catcctcaag aaaaagaaaa tcacgcagta tcccatcgtc tggagctggg ctcaggcgga    244080
     agcgctgatc tgcgactaca cgacgctcgt atccgccttt ggaggccagt tctataaagg    244140
     tggtacgcct gcgttcaact ctggtggcgg gcttaaggct ctgacctata tgaccgattc    244200
     cgtcaagcgc ggtctcagca acccgaattc gaaagagtac ctggaagaag acgtccggcg    244260
     cgtgttttct agcggacagg ccgccttcgc cctgaactgg acctacatgt acaacatggc    244320
     gaacgacccg aaagagtcga aggtcgccgg aaaggtcggt gtcgtcgccg ctcccggtgc    244380
     ggccggcatc agcaaggcca gcgccatgaa cggctccatg gcgctgggta tcagcggcaa    244440
     cagccagaag gcggatgacg cgtggaagta catctccttc ctgacttcgc agcccaccca    244500
     gaacaaatac gccaaactca gcctcccgat ctggaaaacg tcctacaccg acccgaaagt    244560
     cgcccaggga cagcagcagc tgattaaagc ggccaacacg gcgctgcccc tgatgtaccc    244620
     ccgcccgacc atcacgcgct accaggagct gtccgtgacc ttgcagaaag ccattcagga    244680
     agcgctgctg ggccgcaaga ccccacaggc tgcgctgaac gacgccgcga agaccgcggc    244740
     ccgcctgcgc tgacatgagg ctccctgtcc tggcgttcag aggacgggga gcccagggcc    244800
     ggccggcgga caaccgcacg gcctggctta tgctggctcc tctgctcacg atcattctcc    244860
     tgatcgtcgg ttatcccctc gttcgcacgc tctacctcag ctttacagcc ggcatcctga    244920
     cggccgtcaa ggtcccgccc cgctgggtcg gttgggagaa ttacacccag gcgctgacca    244980
     accccgagtt cctggcctcc ttgtggaaca gtgcgtactt cacgagcgtt tccgtggggt    245040
     tggaaatgat cctgggcgtc ctggtggccc tgctgcttca ccagcaattc cgcgggcgga    245100
     agttcgttcg cgcactcctg atcctgccct gggccatacc gaccatcgtc aacgccgtca    245160
     tgtggcgctg gattttcaat ccggagttcg gtgcgttcaa tgccctactg acgcagacca    245220
     acgtgctgaa cacctaccag tcatggctgg gtgagcctgg cctcgccatg aatatggtga    245280
     tcctggcgga cgtctggaag aattacccga ttgttgccct gatcgcgttg gccgcacttc    245340
     aaggagtgcc ggacgatgtc tatgaggccg cgtctctgga cggcgccaat gcgtggacgc    245400
     ggttctggcg catcacgttc ccggacattg tgggtcccct gagcgtggcg ctggtgctgc    245460
     gcacgatcga agcgttcaag gtcttcgaca ttgtctttgt catgacccgc ggtggtcccg    245520
     cggactccac caaaaccgcc agcttccatg tgtatcagga gtcgtttacc tatctgcggg    245580
     ccggcagcgg cgcttcctac gcctacatcg tggtgctgat cagcatgctg ctgatcggcg    245640
     cgtatatgtg gcttcttcgc cgtcaggccc agggagcccg aacatgaccc gagtgccgtc    245700
     cgtttcttct cctgccattc gccaaagcac tggccgccgg gcgcccagca tcaaacgtaa    245760
     ccgctggacc gcgcaggtcc tgacctatct cggggtgggc gtgttcgtcc tgagcatcct    245820
     gggccctgtt ctgtggctgc tgatgaccag tgtcagctcc accaatgacc tcaccaccct    245880
     gccgctgcga tggttcccgg cacagctgga tctgtcccgt tacgcgagcc tgctcaccgt    245940
     gacgccgaac tcgccggggg aaacgttcct gtatgcgttg cgaaacagcg ccttcgtggc    246000
     tctcgtgacc acctttctcg ccctcctggt gggcattccg gctgcctaca gcttttcgcg    246060
     cctcccgcag ggacgatccg ggctgctgta cgcgaccatc gccacgtaca tgatgccgcc    246120
     tgtcgcgctg gtcctgccgc tgtacgccat cctcgcgcgg gctgggctgc tcaacaatgt    246180
     ctgggggctg atcctggtgt actgcaccat cgtgatgccc ttcaccacgt ggctgctgaa    246240
     agccaacttt gacggtgtcc ccgtcgatat tgaggagtcc ggtgccatcg acggtctgag    246300
     ccggtggggc attctgacgc ggctgacgat gcctctggcc ctgccaggca tcgtgacctc    246360
     aacgattttc tccatcctgc tggcctggga cgagttcttc tacgctctgc tcttcaccag    246420
     caatattcag gcgaagacgc ttccggtcgc gatttcggac tttacagccg gcaggtcagc    246480
     cgacttcggc ctgattgccg cggctggcgt tcttgcagcc cttccccccg tgcttattgc    246540
     atttgctctt cagcgtggcc tgatgaaagg cctgactgct ggaggtgtca aaggatgatt    246600
     ctgatgaacc tcacccatga atgtaccggt ctgcaactta ttgagcgtga acgcgaacgc    246660
     cagttccgcg acgcgctgga caccctggac agtaaccgcg agatggccag gcaggtggcc    246720
     ggcagtatcc ggcggaccgg gcaggtcctg ctgcttggga tgggagcgag ccatcacgcc    246780
     aacctggtgg cgacggctgc gctgcgcgca ctcggcatcg aagcctttgc gatgccgttg    246840
     agtgaagcgt tgtacgttcc ccttccagag cggccacgca ccgtgctgct gacctcacag    246900
     tccggcgggt ccgttgaggc cgagcgttac ctgcacctgg gccggcaggg cgaggactac    246960
     tttggtctga cgctcaatcc tgacagcctg ctggcctgcg ccgtgccttg cctggtggcg    247020
     gctggaggta gtgagcaggg atttgccgca acgcgctcgt acctgctcac cctcgccctc    247080
     cactcaacga ttgcaaaagc actgggagat gcacaggagg attttcgcgc tgtggtcaag    247140
     gcagcgatgt cgccggacgt cacggcggca gttgatcacc tgcgtcttgc caggtccttt    247200
     gtgttcagcg cccggggagg gctccagggt gtggccgagg tgggcgccct cgggatcctg    247260
     gaactcgccc acgttccggc ctttgcgctg gaaggcgggc agctgcgcca tgggcccatg    247320
     gaggccgtga aagcagatct cggaatgatt ttcttgagag acgctgcaca tagagagctg    247380
     attgacagcc tgatccgggc gtgtcaggag gccggtgtag tcccggtggt tctggacgtt    247440
     tcaggtgagg ccccgcagcc gggtcggata acgatcagtg cgggccgtca tcagggcctt    247500
     gcggcggctg cggcactctg cgagcctctc cagaagctgc tgctcgcggt tgctggccag    247560
     cgcgtcgagc gtgtgggaga gccggtgcgg tcgtcgaaag tgacccggac cgaatgatca    247620
     ccccacacct gctggtgatt ggcggcgtca atatcgacct gctggtcggt cctcaagcgc    247680
     cgtggcccac tccgggcaca gaagtgatcc tggaccacag cgacctgcgg gtcgggggcg    247740
     gtggcggcaa caccgcgctc gctctggagg ccctgagcgt tcccagcgtt ctcgtgggcg    247800
     ggtatggaaa cgacgcgttc gggccgtggc tgcgcgaaaa atttacgggt gtgctgtgcg    247860
     attggcatca gagcgccagc ccgacagggt tatgtgtcgg gatcacccac cccgacggcg    247920
     accggacgtt cttcacgcac atgggtcacc tgggcgacga tccgcccgag cgcgtctacc    247980
     gggccctgga ccgggcaggg ccaggaagca ccgccctgtt tacagcgggg ttcctgatgg    248040
     cgttgtggtt gcctgaatat gaccagttgc tgtcgtacgc gcgtgcacgc ggggtccggg    248100
     tggccctgga taccggttgg ccgcctcccg gttggacgcc cgaggtcagg gccatggtcc    248160
     ggtcatggct cggaaaaacc gacctgctgc tgatcaatga gcttgaagcg acggctctgg    248220
     ccgagacgga tgatgtgtat gcggcaggaa tggtacttct ggagcaactg gcacaggacg    248280
     ctacgctgat tatcaaacgt ggaccttggg gagcagcggc gtgggttggg agtcaacagg    248340
     tggaagtaag tgccccgcag gtgcaggtgg tggacacgat cggtgcgggt gacacgttca    248400
     atgcggcatt tttggccgcc cagtacgacg gcaggtcact tcagaacagc atggcggccg    248460
     ccgtggccta cgcctcgcac tcgatcagta cgcagccgcg aacgtacgca gctacgcttg    248520
     gtgacccgct gcaggatcga ccgaccgagt tgtccaggcc ataaatgcaa ggaagccagc    248580
     gtgagctccg gagagaacct ggagtccatg ctggcttcct tacgcaacgt cccttccctg    248640
     ttggcctcaa tgtgctgagt ttagcgtcag cccaagctca accaggcgtg acctccgcat    248700
     tgattgagcc gaaatacgtt gccttcaata atctcgttgg aatcctcctg gcatcctgcc    248760
     tgggcgtgtg ttggcgcagg aaggggagag cgtgacttcg aacggtccgc gagccgggtt    248820
     gggcgtgcgt cacctggacg gctgggccat tagcacagag cagcagggcc tgggcaaggg    248880
     tcaataatct cctaccggtc gttcgacgat gagccgatgg gaatcgccag cccggtcact    248940
     gtctcaccgc tcccgatagt tcctaccctt gaggcactac cccggtatat ggacacggag    249000
     tacagctccg aggagcggct gccctgtggg gtgaaaaccg cgtaggcgtt gcgcgaactg    249060
     tcaatgtcga agccggcgag ggtagagacg tctactctta gactgctttt ggaaaacaat    249120
     tgcccggtgt tgggcgagac gggcggtgtg gccgatgggt tgccctgctc ggcgagcagc    249180
     tcaaggctgg cgtcaagcaa gtacaaattg gtctgggtgg ccccagcaac cgggttcgtg    249240
     taggcggcag ccaccacatc gggtttccgc ccttgattgc ggtctccggc agcgtaagcc    249300
     aggcggccgt ccacgcctgc gacagcgccg gtatcgggat gtacccgcag atcctggccc    249360
     gtgttactca ctacgcggat gcggtcgacc accgggttaa agtcaaaccc gaaagacgtt    249420
     ccttcgagca ccggcgtgaa gggagcaccg actggtgtcg cggcgccact tgcgaggtcg    249480
     atggtgtaga tgcggctggt cgagcccagc gcatagagcc gaccattggc ggggcgaaaa    249540
     tcaataccca gcacccgctc accgggagcc aggcctgtaa tcggctgagc ctgcacgtcg    249600
     ccgggagtag acgcagaaaa gcgcagcaga cggttcgatg ccgtggtggc gtacatcatg    249660
     ttgctcccgc cgctccacga accgccgtcg ttccaggacc cactgcccca atcgccacca    249720
     ccgaacgatg cggccatcag cggcgctggc gccgtcttcc tgtcagccat cccaccgtca    249780
     gggacagatg cggtcccgca ggcggcgagg gcgataacca tgggaatgga cagaaaacga    249840
     agctgttgca taagggtcct ccttgaagca aatggaatgg acggcctgtt ccggagtctt    249900
     ctggccgccc gtcctgaggg gccagaggaa acgctgatct tctccactcc tagaaacgca    249960
     ccgcgggccg cttgagatgc atccagtcat acgtaaagat caggtgaagc agggcattcc    250020
     agcggaacgc ggcttttcgt tcgtccatcg ctggagcgcg gtatctgccg gcaaggcatt    250080
     ccccgggtac acccgggacg tcaggtgccg gacgccagtc agcgggtggc tggtgggatc    250140
     agcatgactg attccggcgc aacgaccgtg acagcagcgc tcggtgccag atcgcgcctg    250200
     ccttttaatt tcagtagtcc atcgaatcgc atcagcgtgt ggcgcgcccg gtccgccacg    250260
     aaaagggcag aaccatcgaa cgccaccccg accggattgc ccagcagtga cttgggcccg    250320
     cttatccgca accggacagg agcctcgcct gtgagttgcc ggatgcctga aagcaccaga    250380
     attgccccgt cgctatcgaa gttggattgg tcccggtcga tggccgcccc cacatcgacc    250440
     atcaacacgg tgtcctgggc cggaaggtag accaggtcgt gcagattggc tgcggcccgc    250500
     tgcccctgca tggtgggcac gataacgcgg taggagccta gcccccggcc cgccaggtac    250560
     cggtcaaaga cgaccagcgt tccgtcagtt gcgcccacga tcaggcgatc tgccgactcg    250620
     tcgtacgcca gaccccacgg gcggcgcggt ccggcggacg tccggcccag gtccggggtg    250680
     atgaagcgcg gcgctatatc accccgggcg ccgccagcga atactttgag tgtggcgtcg    250740
     ccgaaatccg cgatgatcac caacccggcc cggggtgaca ccacgatgtc cttgggctgc    250800
     ttgagtcctg agcgtggacc actgacccat tgatcacgcg ccgcgtcgaa acgccctgca    250860
     gcgcgtccgg ccaggttcct gatcttcagg aaaccacctg gagccactaa gctgggaccg    250920
     tcgtcaaagg tgatgaaggc gtcgcccgcc gagttgaagt ctacgtattc cagactctgt    250980
     ggagcaccat caatggtgaa ggccagttgg gccgccgaga gatcgggggg ggttcggaac    251040
     acgcggccgg atggggggtc gctcgccacc acaggcctcg ccggcttact gatcaccagc    251100
     agaccggtcg gtgtggtgtg cggcgccgcc tgggccgtca ccagcaatag cgcggttgcc    251160
     agccggcaca gcccacgtcg taagacgagt tgtggtcgaa tcctattttc cattgacagg    251220
     cccccagacc tcagcatagc cacctgacga ccggacaccg tttaccggac ggttatccgg    251280
     acggccgttt gtgccgaccc ggcccgcacc tcaatgcggt tttctcctga cttcaggccg    251340
     agtacagtga acgtgaaacg gccttcagcc accgcggacg accggaggga tcccgaattc    251400
     aggcgatagg cgatggtcgt gacgtcactg ggcgcggtgc cgctcacgat gacctggtgg    251460
     gtggtcacga ccgttccgtc gaggggctga ctgaccgtga gcctgtcagg tgttggggcg    251520
     gccgcaaggt ttacccggct gagtgcgcgg ctgggttgga cgctgccacc gcccggttca    251580
     cgactgaggt acagggccac gaaacgcttc gtttccacct caaagacccc gtcgcgcgat    251640
     acccgcaggg agaccagccg ctcacgaccg ccgggttgcc agtcggcctg agtgtggccc    251700
     caggcctgat acgcctgccc gggcggtaaa gtccggctca cgacgaagag cgcccgctgg    251760
     cctctcatca ggacgctgcc gatcgtctca ccgccagcgc ggagtgggag gcggcggacc    251820
     tcaggatgtg ccagaaaagc gacaaggagg gcgcggtctc cggcagtctg ctgatacatg    251880
     tcgtaggtcc tcaggcctcc tagtgcccca ccgacgagca gcgtcgtaca cgccaccgcc    251940
     agccagccct gcgggaacgg ccacgccgac ctgcgtctct gcgatatgag cggcgtctgc    252000
     gtgcgcaacc gggactcaat ggccgcccag cttccggacg gggccgggtg tacgggcgcc    252060
     gcttccgcaa gggccaccag cgcctctcgc agcgcacgca cctgagcgcg tccagcgggc    252120
     gaatgttcca gctcagcctc aacctgagat tgttcgtccg gactgagcgt accaagcacg    252180
     tactcttcca gccggtcagg agacccggtc atggctgctc cagaaagcgc tccagagcca    252240
     acagggcccg ccgtacccgg cttttcaccg tgcccagtgg taactttgag cgttcggcca    252300
     gttccaggtg agtgtacccg gcgtagaagg agtcgtgcag cagttgacgg tccaatggct    252360
     cgagctgcgc gagcgcctgg gtcaccacgg cgcccaggtg gccgtccacc gaggctgacg    252420
     gcagaggcga gtccagttca tgcacgtccc agtcggcctt ttgtggacgg gcacgcctcg    252480
     cccgcagacg ggacatgcag tcgttgcgcg cgatggtata gacgaaagcg cgcggtgatc    252540
     ccaggtcagc gcggtacgtg cgtgcctgac gatacacttt cagaaacgtg tcctgcatca    252600
     cctcctctgc ctcctcgcgg cttcccagca gctgaagcgc cagtgagaag actttgctcc    252660
     ccatgccgct atacagtgca gcgagagccg cttcgtctcc ctgctgcagg cgacccagca    252720
     gcgcggcctc ctcactggac tccattaaac cgagccacgc gtgcccggcg agccagagtc    252780
     aacccgccac ccaacctgcg ctgcgagtcc atccgtttca atcatcgaaa gccataccct    252840
     tactgtaagg aatcaacgca gtgatgcgcg caggtggcca agaagttcgc aatcgcatta    252900
     agggcagagt gaaaggtctg gagaaacagc gcatgtcggg ctccttgctg agagaactgg    252960
     ccagtacata tgagcggcct tgcatcagta gaaacgcagg aaatcgacgt ttggatgcac    253020
     agcagaatgt acgtgcttag cttcacttgc ccccaatgcc caccttcctc ctcaccttca    253080
     tggcttctga tcccggatga tgcgcaccac gaccctttat gacctaatgg tttatgacaa    253140
     gttcaccgtt cgactcctga agtccggacc ttgcgtaaca catctgatca gaacttcagg    253200
     gcgatgatca tattcactcc atcatctgca gcacgccggg ccaggtcgat atagccatgg    253260
     aatttcagtg cctccaggcc atgcgcgcac agcaccaagg tccgccgcca gctttctgtg    253320
     tatcccggtg cgtttgctga cgtccacggc cagaattttg gccacctcat cagcgtgacc    253380
     ccgcagggcg aaacggcccg cagcgagtac gtccacatcg atctccttca gtggcacagc    253440
     acgccgcacc ggttgcgtgc tgcgggagag tcgcggttaa attcggcgtt cctgattcgc    253500
     ccgatgagcc ctgttatgtc gatgagcagt gctccttgac aggactgtcc tagaaaaagg    253560
     agagccaatg acaactctcc ttttttcttg aggaaaaggg ttgccagccg tcgtcgcgac    253620
     gagcggggcg ttcaccgtca gcaaccatga aagcatcctt cgtcaggacg atgttagagg    253680
     tgcttgtgac cgcctaagct ctgcgcggtg agatcccaga agccgcgttc ctgccaaaag    253740
     cgaatttagg ccattccaat ccaacaggca tgacctgcct ggatcaatct cagcatggtc    253800
     ggcaaattct catgaggggt ggactcgcgg gtggccttac cacaaaaaga ctgcacaaga    253860
     cgacgttccg ttgcccgctc ctgatctgga gaggagccgc gatcatcagt catcctcaca    253920
     gtgatttact gtgactcatt tcttccggtt ttaaagtgct catgcttttc aaagcaataa    253980
     cagatcacgt gacgtgaaaa agtggtttat tcgcttcaca ttgccttgga aagccgacat    254040
     tcaagtagaa caggatccca gtcacataac catcaggatt tctgctttag acagtatgtt    254100
     catcattcat ttcctgttca aggaaaaccg cctcatgtaa caatagaaga cggagtcctt    254160
     gcgtatcttt gaccctgctt aaagcttaaa cgcacaggga ataagcttcc agttaccaag    254220
     caccggttcg tatccggcgt cgaagcctac gaacatcact cgtttccccc gaggcccaac    254280
     atgaaaaaag ctctctttgt tgtactcgcc atgaccgtca cctctgctac tgcggctccc    254340
     ttcgtgtggc ctgctgcctg gactggtgaa ccgaacacgg ccaacaagcg cggcggggaa    254400
     ttccgcagtt acacgatctc ggactataag accatcaacc ctttcaccac cgctgaagcc    254460
     gacagtctca ccgacctgat gaccctccgg accagcggcc tgttcacgca ggacccccgc    254520
     aacgacgagt tcatccccta catggctgag ggaaaaccta ccgtcagcaa tggaaacaag    254580
     cgtttcgtgg tcaagatccg caagggcatg aaattcagcg atggccagcc gatcaccgcc    254640
     gatgactggg tcacgactgc caccattcat aaggacgaca aggtcggcag caacagtcgc    254700
     gacaccttct tcatcaacga caagcctatt acggtcaaga agctcgatac gtacaccctt    254760
     cagttcgact tcccgcaggt gagtgccgga gcctactcgc gcatgaccta tgcgccctgg    254820
     ccagaccatg tcttcggcaa gacatatcgc agtggtggag ccgcggccat caagaagatg    254880
     tggacgctgg gcacgccagc cgacgagatt gtctcacccg gtgcctggac gctggacagc    254940
     taccaggccg gggaacgcgc tgtcctgaag aagaacacct attggggcga gtggaacaag    255000
     gacagccggg gcaatgccct gccttacctt gaccggtact cctcgcgcat tactgctgac    255060
     ctgaacgcgg ctctggccgc gtacctcgcc gggcagatcg ataccttcgg gcccagcaag    255120
     gccgatgaac tggcccagat ccagaaggcc atcagcgcgg gcaacctcaa agccaccctt    255180
     atccccaacg tcagcccgca ggccgacagc tcgtggatcg tcttcaactg gaacagggct    255240
     ggcaatcccg ccaagcagaa gctgttccgc gatgtccgct tccgccgcgc catgagccac    255300
     ctcgccaacc gtcaggctat ggtgaagctc gccctgggcg gcctgggcac cgagacgtac    255360
     tacagcgtgt atcccatctt caaacagcag atcgccgctg gagaaaaggc gaaagccccg    255420
     aaatacccct acaaccctcg cgaagccgcc aggctgctcg ctcaattggg ctacaccaag    255480
     aaaaatgcgc agggttacct ggtcgacaaa gccggcaagg tgctcgaatt caacctcagc    255540
     accaacgccg gtaacaccgt acgcgagcag ctcgggcgtg tcttcgccga cgaagccaag    255600
     aaagtgggtg tgaaagtcaa ctttacgccc atcgatttca acaacctggt caaccagctg    255660
     accgccaagg gtgagagccg ccccttcgat gcgatcctgc tgggcctgtc tggtggcgac    255720
     aatatctggc cgttcgggaa taacgtcgtg ccctgcggcg gttccctgca catgtacaac    255780
     aacaactcca agggcacctg cctgactcca caggagacag agatgacgaa gctttacaac    255840
     cagggcgacg ctgaactgaa cgcggccaag cgcctggcta tcggcggtcg gctcatgaag    255900
     gtcgagtctg aactgcaacc ggttatctat atggtgggtt cgaactatca cgtgacctac    255960
     aacaaccgtg tcggtggcac gcgggaccgc aagcagatgg acgcctacta cggctcccgg    256020
     gaactcccgc ttacgttcat caagtaaggc ccactgaagc tggactgcct gacccgtcat    256080
     ctctcgggct gggcagtcca gcttatgaca tgatgggatc cctccgggca tttgagggtc    256140
     ggcacccgcc acgatcggta agcattgact gcccgtgtaa gccgtgtaag agactctcca    256200
     gtagggcgcg ggcagagccc cacaacgtca ggccagccac gtgtccctcc aggtcgccgc    256260
     aacggagact gctgctggag aggcctgaat ctggcatacc gaggttatgt gagccctatg    256320
     cactgtgctg acaggacgtt tgcagactgc gcagaaaacg aacacgttca acacataggc    256380
     cccggcctcc cccgagcggt aaacatccgc attccacaca cttccaggct gccgcttatt    256440
     taggatttca tcgtggaccg atcttcccgg gcttcacctc tggtttggtc gcggcaggta    256500
     ccccgccggt tgatccctcc tgccgccgat tcgttgtgca ctcctgaacg tgagccaatc    256560
     tcgcatatac ggtgcattat ggtacgacgt gaccgtcccg gcagacgccc cgccgctgtg    256620
     cccggcgtac gcgaatgacg acaacctcaa ccatctgatc gtggtcactt catttacctc    256680
     tctcacttgt gcaatttttg agacccggtc tgtactctgc ggtacgatgt ccatcccaca    256740
     gcactacctg ttgatagatg acagccccac agaccaactc ctggcgcagg aagctttcgc    256800
     acaattacaa ccgagatcca cgctcacatg tgtgtcaagc ggaagagaag ctcttgaact    256860
     cctggaatcc ggtttctcac tgccggacgt gatcctgctg gacatcaaca tgcctgagat    256920
     gaatggctta cagctgctga agttgttaaa agaccagatg ccattgaagg ctatcccggt    256980
     ggtgatgcta agcatttcag gtgcagagga tgacatccag caggcatacc gtctgcacgc    257040
     gagctcgtat ctggtgaaat ccaaagggtt tgatgcgttt ttggagcagg tgaagtcgtt    257100
     ccttcggtac tggcaggcga atcaggtggt gggcgcttca gcgggacgat gatgcacctg    257160
     cctctgacgc agcacatgct ggagatcaga aaggaaagcg caaggctgga gtaccagcag    257220
     caattgctcc ctcacaacaa tcaggggagc ttaagacaac caggcaatcg gatgcgtttc    257280
     cacacgactt cagttgccat tgccgactgt cctggaaccc gacgtcctaa gggtcaggag    257340
     cgtgtcagac cttatattcg ggccttgcaa accatggaag aggatgttcg aatccgacaa    257400
     tgcacgctgt tcgtgatagc actgacgcta tgcaggtcat ccggactgcc ctcgacgcag    257460
     agcaggcagt actttatgcg gtctggaaaa cttttaggac gttcgacttg aatggaccta    257520
     agaaggcagt gtcggccgac ccggaaagca gccagtaaaa gcgggattca ggaggcagat    257580
     gcccgcactg atcgcagcgg gccatcgcct tctggatgaa gagtggaggg ccgcacagag    257640
     tactcctcag tcctcagttt cgcgcacgcc gccttgcagc agcccgcagg aacaacactc    257700
     aagcaccaat agccagctgg gcttcgcaag cgacactttt acctgggcag gccgtcatag    257760
     cgccggcacc cccagggacc tcaacccctc tccactgctg gcccagaacc tgcatcacct    257820
     tctgccgtgt gcacgttaaa tgtcctgcct gccggtatcc atccgtacga ctctgggcat    257880
     aaatctggcg accacgtcca ccagatcagc ctggctggcc atgaccctgt cgatgttttt    257940
     atacgcctgg ggcgcctcat ctacaccgcc gcccatcacc gtgacgtccc gcgcttccag    258000
     gtactccttc acagcgcttc ggctcagctc gcgttccgcc tgcttgcgac ccagcaggcg    258060
     acctgaaccg tgtgacgcgc tctccagagc ctgggtattg cccttccccc gaacgacata    258120
     ccctgggtca gccatactcc cgggaataat cccgagctga ccctgtccgg cgggggtggc    258180
     ccccttgcga tgcacaatga cctcgcgtcc atccggcatc cgctgtttcc aggccaggtt    258240
     gtggctgttg cggacagtca cgaggggttt gactcccagt gctcgtgcga tgcgtgcgtg    258300
     aatcacctca tgattggcca gcgcgtaccg acccgcgaga ttcatagcgg tccagtaagc    258360
     ctggccctca tcccggtcca tgtccagcca ggcaagcttg cgggcgtccg ggtcaaggtc    258420
     tggatgaaga ttctgcgcaa cctgggtgta atgaccagcg acctgggcgc cgaaaccgcg    258480
     cgaaccggag tgggacagaa gggcaatgta ctgtcccggc gccaacccca gatcggcggc    258540
     ctcaagcgtc agggtaccga actccacgaa atgatttcct gacccactgg ttccgagctg    258600
     ctccgccgct ttgttcctta actggcggag caggggaagc tcatgccagg tatcttcatc    258660
     cagcaccgcg tggtctgggc gcagcttgcg ctcccaggca tgccccgcac caaagcgggt    258720
     attgcgacgg aggagacgaa cttcgtcttc acgcgagagg ttggcaaccg gcagcacgct    258780
     cagggccatc gcacatccga tatcgactcc aacggcgtaa gggatcacgg cgtgatccgt    258840
     ggcgagcaca ccccctatag gcagtccgaa cccgacatgc gcgtccggca tcagtgcgcc    258900
     ggcgacgctg attggaagac gcatcgcggt gtccatctgg gcgcgggtgt tctcgtcgat    258960
     caactcagag ccccactcgg tataggacag aggccgctcc cggagcgtgt cgggaaagcg    259020
     ggctgcttga cccagaagtt cccggccgag gtcagcgtag agggggtccc tgatgaacgc    259080
     ctcaggacgg tgcaggacgc gaccgagttc tgctctgatc tcatcgtttg tttggcctgc    259140
     ggtctcccgg tgccgggccg cattcaacgc aaggccgatg gctttgcccg taaagccgag    259200
     tgctgtgatg tcattcccgt tcatagtggc ctgctttttt gtccggaact tctgaaatgc    259260
     gcgtcactct gctggtcgct ggtcgatctc catcaggatg atcaatggac tggtgagagg    259320
     aattatcttt ttgccgcgca gcctccatat cactgtattt atcgaacggt gaaaacggat    259380
     atcttctggc cctctccaac gcttcagcac caaacccaaa ttggggggaa ctgggtagac    259440
     agcctcctca ggtactgcgc actcaatctg cagtcagggc tctgcgatat tcagctagag    259500
     cccaaccatc gtggcaggtg gcaaagcggt gcaggtttcc aggacgcctg aaaggcgacc    259560
     ggggccggca catctcggtg acggctcaga cctgaccacc ctccgacgca ccattgcgct    259620
     atggtgaccg tctatgccgt tgcccgttag cgacaacgcc gaacctccga gttcgactca    259680
     caatcctgca cctctggtac gcaccatcag gcctggtggt gcgccttgac ggctgcgctt    259740
     ccgtttctgg tcatcctgat gatggtggcc ctgaatgcgc tctatgtggc tgcagaattc    259800
     gctaccgtcg gctcacggcg ctcccgcgtg caggaagccg ctgagggtgg ccaccgcaca    259860
     gccgcggacc tgctggacat tctgaaagac cccaagcgcc tcgataccta tgttgccgcc    259920
     tgtcagatcg ggatcaccct cagcagcctg gtcgcgggag cgtatggtca ggcgcagctg    259980
     attcccctcc tgactcccgt cgtcgggccg gtgggtggtc cggtcctggc gactgtgctg    260040
     gtcctggtgt tgatcacggc cctgcaggtg gttctgggtg aattgctgcc caagacagtc    260100
     gcgctgcggt acccggagcg gctggccatg gccaccctgc gtcccataca gttcagcctc    260160
     ttcgtgttcc ggccactcat cagcctcttt aacggcacgg cctttttcct gatgcgggcc    260220
     ttgaagctcc aggtggacca cagccacgct cacgttcatt cccccgaaga gcttgaggac    260280
     ctgtaccggc agagtgcccg cggaggcctg atcgacgcca gtgagcgcaa catggttgcg    260340
     ggggttctga acgtcgaaga ccgggtcgtc cgggagatca tgacaccgcg caccaaactc    260400
     gtcgtcgtgc ctgggcacct taccgtcaga gaagcgcttg cacgcctggc gaacacgccg    260460
     tatacccgct tcccggtcag cggcgacacc cctgatgatg tgaccggcat catccacctg    260520
     cgtcagctgt tcctggcagg tgagagccag ccgggtcgac tggtcagtga tgtggcccgc    260580
     ccgccgttga tcgtggccga gagcatgccg gttccggaac tctggaggcg gctgcgtgaa    260640
     gcgtccaggc acgctgccat tgccgtggac gagtacggtg gcgtggccgg catggccacc    260700
     ctggaagacg ccctggaaga gattttcggg gagatgcaag acgagttcga ccacgaagag    260760
     gaccccatta cggtcgatgg tgaccgggtg ctggtccgcg gtgacgtgct gattgacctg    260820
     ctcaatgacc gcttcgagct ggatttgccc accgatgagg tggataccgt cagcggcctg    260880
     atgtggcacg aactgggccg gctgccgatg gtaggcgacg aggctggcgt gcgaaacctg    260940
     accctgcgcg tcgaggcgat ggaccgccgg gcggtgcagc gggcgagttt catcctgccg    261000
     agaggcacca cggacggcga caccgggagg acggtctgat gcaggatgtc ttcgtccccc    261060
     tcgtggtgat cgtgatcctg gtggtcctca atggcctttt tgtcgctgca gagttcgccc    261120
     tggtggcctc ccgccggtcc cgcctgaaca cactggcaga caccgggaat ccagcagcgc    261180
     gctggctgac ggccgttttc gacgatgaaa ccgggaagga ccgctatatc gccattgcgc    261240
     agttgggcat cacgctggcc tcgatcgggc tgggcatgta cggcgagccc gtgattgcca    261300
     gctggctgta tggaccgttc gagggtgcgg gtctctctta tgcggcggcg catacggccg    261360
     ggttcatcat tgcgctgagc gcgatcacgt tcatgcacgt ggtgttcggg gaaatgattc    261420
     ccaaagccct cgccttgcag gcgccggaag ccgtcagcct gcaggtcaac ccactgatgc    261480
     gtgtcttcgg ctttctcttc cggcccctga tcatcctcct gaacgttctg gcccttgggc    261540
     tgatgcgggc gctgcgcatc cgggagccgg gaaaaaacgc gttcctgtac accagcaagg    261600
     aactcagcat cattacggac gaaagtgccg aaagtgggca gctgggcggc gtacagcggg    261660
     acctgatcca gaacatcttt gcgcttgagg accgcacggc ccaggagctg atgacacccc    261720
     gctccagtct ggaggccctt tccatccatg caccacctga cgaggtcacc cgacggatcg    261780
     ccgggtcgcc gcgcagccgg taccccgtct acgaggacaa tctcgacgaa atcatcgggg    261840
     tattgcacgt caaggacttc attcgcgcac gcgtatcggg cgggtcgcct caactgggcc    261900
     ggctgatccg tccgctgccc agcgtcgcgg cgtccacaag tgccgagcat ctgctcgcgc    261960
     tgttcaagcg cgaacgcctg cacgcagctc tggtggtcga cgagttcggc ggcacccttg    262020
     gcttcgtcac catggatgac ctgatcgagg acgtgatgga ggaggaagac gcggggtcgt    262080
     ccgactgggt gcagacgaac ccggacggct cgctgatcct gaacggcgag gtcacgctga    262140
     gcgaactgcg tgaggaccat ggcctgaatc tgcacagtga ggacgcgacg accattgcag    262200
     ggctgctgct cggggagtat gggacagtgc cggctgcagg aaccaccgtg tttgtgcagg    262260
     gccacgatct gacggctgaa gacgtgcagg gcctcaagat cacccgtgtc cgggttcggc    262320
     ccgtcgcttc tcctgatgag gtcagcacca ccgggacgtc ataggccgac ggtcagtgac    262380
     gacctggaag tcgaccgtga cgttacgccc actcccgtgt atcaacgtaa tctccccaac    262440
     ccatccgcga gaatgcagta ccccgttgat gccctgccga agaagtgatc atggcaggct    262500
     gacgcggtgc ataagcaaac aacggggaca actgacggaa gtgcgatctg cacggccgga    262560
     atctggccca gcctgggcgg ttgacgaggt gtgaataccg ccatggaata gaggaatcaa    262620
     agcggcctcc gggtcgcttt cttctgtatg gtgtctcagg atggcctgca gcaccctcgc    262680
     ctcctgacag ggcaatcagg aattggacgc tgactccagc ggcgcggctc tcacccacac    262740
     accatggact cgcctctaag gggccatttg cgcgggcttc atgagccgaa gcgccgccag    262800
     tgtcccgtgc accccagtct cagcacttcg gtttgcctcc accaggtaca cgtctcctgt    262860
     cagcagggag aatccaccct accccccctt gtgggtaaac cttcctgaat cctggcagat    262920
     catgtcctgc tccgggtcca gctagcctgc tggtatgtcc acgccgagcc cttgcctgct    262980
     ggtgatcgtg ccggggaact gggaagcagt gcccgaaggc gtgcaggaac tcaagcggta    263040
     tatggcgcat gaagtgggtg gcacgctgac agtccagcgc acacctgcac cactgcggtt    263100
     ccccctcgtc ctgcctattg gagtgtggcc gccaggcagt tggcgagtgg cacgccagga    263160
     tattgagctt gtgctgatgt cacaggcgtt tttcagcctg gggtggctgg aagaagtatc    263220
     gtaatccttt tcctccagcc cccacgacct gcacactggt tcccgcttct attcagagcc    263280
     cgcaacaccg caacctgtgc tcaatcagtt gtacggccct gtggcttccc agctggctgc    263340
     cccgcgcggc gtgcagctgc ctcctgcgtt gccagaaggg ccaaccccaa ggtattcaga    263400
     ggtggaccgc ctgtgctcca gcttctgcct gatacgcggc cagaaccaca cgcaaggcct    263460
     ggtacccggc gtgccagtct gctcctgacg agtgctcccg cagcgtacac acgttcagaa    263520
     aatcacggag catcagggcg ttcaggtcgg ttccataccc ggcccagtga cggccctccg    263580
     aattggtgat ggcaagcgac tcggcaaaaa cgtccagcgt ctgcaggccc tgggttccgg    263640
     tgacgtcaag tttgaggtga ccccagcgcg gatacgtgcg tgggcggctc caggatgaat    263700
     ctatggtggc gctggcacca gaggcaaagc gcagcgtcac cagggcagct gcgtccaccc    263760
     gggcatgctc cggcagaacc cactcgggta ccggcacaag ccgggcatat accgtctcca    263820
     cctgctcgcc gaacagatga aacagatcgg ccaggtgaac gatatgatcc attcctgcgc    263880
     cgccacccgc catcagcgga tcactgaacc actggcgctc ccggtcgggg cagacgctgt    263940
     gattcacgcc accataggcg agtatctgtc ccagaccacc ggtcagcacc atgtgccgca    264000
     ggttctgtac ctccggagag aagcgcaccg ggaaggcggt gcggaactcg actcctgcct    264060
     gcaagcaggc ctgattcatg gcgcgggcgt catccagagt gagggcgatg ggtttctcgc    264120
     acagaacgtg tgcgcctgcc tgcgcagcag cctcgaccag aaaacggtgc cgcgccgttt    264180
     cactgcatac gatcacgccg tccggaccgg actccaacaa ctgcgcgaga ggcagatgac    264240
     gcagcccggt ccgggccgcg aattctgcgg cgaggtgagg ggaatcctca ctgaacccta    264300
     gaagctcgac gtgcttacaa ccagtcagcc acgctgcgta ggcgtcggca tgaacatgtg    264360
     cggcccccag aagggcgatg cgggtgggca ttatgcgtcc tccatcccaa cggcctgacc    264420
     actggccagg ctgcgccgga ccgcgtgact cagggccagg gcagcgcggg cgtcctctgg    264480
     ctccaccagg aacggcagac cctcttcaat agcctgatag gcatgcaaga gttcggcggc    264540
     gtagggatcg cccgccaggg ccggaagagc cgcgcccaac tgccgcggct ccggctgtgg    264600
     cccatgcctg cgcagcgccg ccggagcgtc ggaactccac tcgatgacgc ctcgcgtgcc    264660
     ggccaggtcc agcgcagtgc ggaaaacccc cgcgggcgcc gcccacccgc cttcgatcag    264720
     gctgatggct ccgctgatgt gcgagagcgt cacctggacc atcgtgcgcc cgccgtggtg    264780
     gcggcccgcg gcgtagaccg tattcacctc gcccgccacc cagcgcgcaa agtcaagatc    264840
     atggatcatc aggtccaggg gcacgcctcc gctctgggct tcgtccagca gccagcttcc    264900
     gggagcagga ggcgaactga cacggctgag ccgcagcacc cggggaatac cgatatttcc    264960
     tgcctgcacc tgatcccagg ctgcgcggta ctgcgggaag aatctcagga cgtgcgcgac    265020
     aaagagcctc actccggcag tccggcaggc ggccatgatc ctgtccgcct cggcgagggt    265080
     cagcgccaga ggcttctcac agatgacgtg ccggcctgcc cgcgccgcct gcacggccag    265140
     gtcggggtgg gtgggggtgg gggtgcacag gtccacaatg tcgacccggt ccaggagttc    265200
     ttctgtgctg gcacagggac gcaggttgaa ctcacgggcg aacgtgcgcg cgcgctcgtc    265260
     tggggcatat acacaggtga ggacgcccgg gcgggtctgc catccctggg cgtgggttcg    265320
     tcccatcagg cctgtgccaa tcagtccgac actcaggcca ctcatttcag ggcacctccg    265380
     gtaatgccac tgaccagctg acgcgagaag atgatgtaca gcaccaccac aggcacaatg    265440
     gccagcgtca gggccgccag gacggcgttg tagtcgttga cgaactgccc caggaaggcg    265500
     cttgctccga gcacaatggt cttggttttt tctccaggag cgagaatcag aggaaaccac    265560
     aggtcgttcc agatcggaat catactgatc gccgtgaccg cgcccagcgc tggcctgata    265620
     agaggaagcg tcatgccata gatgcggtac tcgctggcgc cgtcaatgcg ggccgcttct    265680
     ttcaggtcgc gcggaacccc gcgcatgaag gacgtgagca cgaagacggc cagtggaatg    265740
     ccctgcgccg tgtacaccag aatcagggcc cagagggtat tgacgaggtg aagactgacc    265800
     atcaggttca gaatgccgat ggtccccagg cggatcggaa ccatgatccc caccgccagg    265860
     tacaggccca gcagagtatt gagccggaac cggtattcgc tgagggcgaa cgccgccatg    265920
     ctgctgagca gcagaatcag ggcgagcgat cccagcgtga ccagcaggct gttcaggaag    265980
     aagagtgaga agttggctga gctggccagc gtgtgatagc cgtcaagggt aaaggtgctg    266040
     gcggtgggca gggcaaaggg atccgagaag atggccaggc ggtccttgaa ggagttgacg    266100
     atgatcagca gtgtcggaag gatggccagc agggtgtaga acatcagcac aaggtgcccg    266160
     agcacctgcc cgcgccggtt gagcagtggc gcagtggacg cgctcacagc tgaacctcgg    266220
     tgatcctgcg ttgccacgcc gtcaggtaga tcagcaaccc ggcgaggatc acaaccagca    266280
     tcacacccgc tacggcagcg cccatgtagg ggtcaccgga ctgcagctgg tatccgaaga    266340
     acgtccggta gaacagcgtt cccaggatgt cggacgcaaa gttcggccct gccagcgcac    266400
     cctgggtgga atagatcagg tcgaaggcat tgaaatttcc cacgaaggtc aacacgctga    266460
     cgatgcctac agtcgggaga ataagtggca gctggatgcg ccggaaaatc gtccaggcgc    266520
     cggccccatc cagccgcgcc gcctcgtaca gctcctccgg aattcgcacc agagcagcca    266580
     gaaacagcag catcggaatg ccaatgttct gccagacact gatcagggaa agagtcggga    266640
     gcgccgtggc cggcaggccc agccacggca ggtcgaactc ctgcaggttg agtggcgtca    266700
     gcagcgccct ttgcacgccc cacgccggat tcagaatcag tttccaggca aaaccgataa    266760
     tcaccacgga cagaattgtc ggagtgaaca gcagggtccg gtacactgcg ctgccccgca    266820
     ggcggaagct gagcagcacg gccagcagca gccccaccgg attctggacc agcatgtgca    266880
     ccgcgaaaaa cacaaagtta tttttcagcg cgttccacat gggctgtgcg tacagctccg    266940
     atcccaggag tttctgatag ttgctcagcc ccacaaacac cgccgacccg tccggtgatc    267000
     tgttgttcag cgaaagccat aacgaggaca ggatcgggta gatcatgaca agggtgtaga    267060
     tcagcagggc gggagccaaa aacaccacca cgtgccaggg aaagggacgg cgtgttcgta    267120
     cgcgcggcag ggatctgtcg gtcatgcagg catccttcag gttcaggaaa aggcccgacc    267180
     agtgaatacc ggttcgggcc ttagttcagt aacgaagagg gaaacggact acgattcctt    267240
     ccaggcaggg caagcaccgt gggttgatct cacatccgcg gctccaggcc ctcgccacgg    267300
     gggtggctgc tttatttgcc cttctgcggt gcgtaccagg aacccaggtt tttctggacc    267360
     aggtcggccg cagctttcgg ggtcatactg ccgttcagaa gctgcgcact gacgttccag    267420
     aggtcgttct cattgttcgg attggcgttg cgcgagagga tctgatacga cgagcggaag    267480
     ctcttggcgc actgggtacg ccacttcagg aactcctgtg caaccgggtc cttgacggtg    267540
     tacttcacgt ttgccagcgg aaagaagccc ggcagcgcgt tggcatacag ggtcgcaaaa    267600
     gcgtccgaag ccacccagtt caggaatgtc ttggccgcct cctggttttt gctggcggcg    267660
     ttgatgccca tgccgatatc ggggtggtcg tcaatcacgc atttcttgcc attgatggag    267720
     tacggagcaa aggcgcccat ctcgagcttg ggattcatct gcctgaaggt gccgatgtcc    267780
     cagctcccgg ccgggtagat cacgccacgt ccctgagcaa acaggttctg tgcgtccggg    267840
     taggccaggg cctggtagcc gttgggcagg tatggcttcc agctggccag ggaggtaaag    267900
     gcctgcagaa atccgccttt gttgtactga gcggtgccgg agatcagtcc cttgcgacct    267960
     ttctcgccgt cccatgctgt gggaccgatg ttctgatagc ccacggtcgc tgcttcccac    268020
     tggtctttgg tccccatcac cagtggagcg tacttgccat tcgctttaat tttggccagc    268080
     gtgctgagaa aagcagcctc ggtttttgga acgctcaggc ccagctccct gaacagggcc    268140
     ttgttataga tgaatccgtg aatgacagac gccatgggga cacagaaggt ggtcttgcca    268200
     tcatcggtgg accacgccgc cttggcgacc ggatcaaagt tattcaggcc tttcaggccg    268260
     ttgaggctga tgacctgttt ggccttgtaa aggtcaagac tcttgtcgaa aggccggcag    268320
     gtgatcaggt ctccggccgt gccggctttg agttttgcat caaggacagc gttgtattcg    268380
     gcgggcgcac tgggggcaaa aaccacctga atgttcgggt gagctttctg gaatgctgga    268440
     atgatgctgt cgcgccagac cttgaggtcg tcgttgcgcc agctttcgat ggtgagagtg    268500
     gttttctgtg cccctgccag actggccagc aacagtagcg aaagtgaaaa gcccaggcgt    268560
     ttcatcgaaa cctcctcaat ccatgtaccg aaggagcgcg ctggccccaa gtgcaaacga    268620
     aaactcagat gtgttgtggt tcgtctacag gtatactccc ggatttagtg ctggtcaaca    268680
     atcacgctgg ccagcagcca atgaactgcg gtcaggaaga gatatcagag ggattgttgg    268740
     gaacaaggtg gccaagcctc ttggcgcaat tggaagccat cgtcagtcct cccgtgccgt    268800
     gcaaagaagg aattgttgac tcgatgcagc ctctaggtca gaccttcata acatctgctg    268860
     caatccgtaa aaaagttagg agttcgacga atcggcataa gggttcagac gaactgatct    268920
     atcccctgga agtgcttggc ctcggcgtct gctcgtgtct cacttcactg aaacctcctg    268980
     agccgcttat gaaacactgt tcacatgacg accataaccg gccgggtagg gggccgctct    269040
     cagggctatg acgtgaacct cggcggaact cctaccgagc ttaaggggcg ggttggcggt    269100
     gtgcatattg gccgtgatct ggtccttcag atcacgagaa cccaggtgag aggacggctc    269160
     ggtggcccga cgattggtca cgacgtcaat ctggcactgg gcaatcacac cctgtccggc    269220
     cgcttgggag gcggaatcct gggcaggaac gtcgacctga cagccagcgg cagcagtgtc    269280
     gccgggcgtt gcggcggact tatgagtggc tttgatgtga tgctgacgat caccgcagat    269340
     ggggtgaaag gacggctggg cggagcgagg attggcgcgg acgtcagcct cacgggcgac    269400
     gcgccacccc tgctgatggc cctcgccgcg acgttggcgt acgacagcct ggtggaggac    269460
     tcgaccgcca ccggcgggta gtgattttca cacgacgccc cgaaattgaa gaggggaaaa    269520
     tagcgataca gacaggcgcg gtccttgcgg ccagtgagaa gagaatgact ggcgcttttg    269580
     agactatctg gcctgttccg cccgcgcgcg gatagtttca aggtcctctt cgatcagcag    269640
     gtcaccgtcg cggtatacac cccgtttagg gttgcatgag gttgtgggcg agtatcgcca    269700
     ggacgacgcg gaagcgcaat gaggttaggg ttttggtttg cacagagcgg atctgagact    269760
     cgaccaattg agaaaacacg gtctcgatgc gtttgcgtaa tctcgggtgg cggttttccc    269820
     gccacccggt gtcgtagcgc gtgtttttct tgggtgggta gatgaacccc agcgcgcagt    269880
     accccttatc cccgattatt tggggtccag cgaagtctac ccagcgtcgg ttaagctcgt    269940
     aggcgacggt cgtgtcgtgc aggttggctg gtcggatgag gtactgcatc acctggccag    270000
     cgggtgagac ccaggcgtgg agtttgaagc cgaagaaatc gccctgggtc ccgaaacccc    270060
     accgcgcacc aggaaatgcg cagcgtttcc ctcgtttcgg acgacacact ggcagtggca    270120
     ttgagtccac cacaacttct gtacagggca aaggtggact gacgagagcc tcaagatgct    270180
     ccaggagacg ttggccgcgt gtgaacgcct gggtgtaact gggaaggttc ggacgatctt    270240
     cgcccaggat gttccaccag atagacgggt acggatgttt gaagacatac cgcgacagga    270300
     gaagcgcgac gaggaacgca tctgtcacct tctggtgtcg gcaactcttc tggtcgctga    270360
     aatgctttct gccccaacgc cagagggtgc ggataacgcg acgacggcct aaactgtggt    270420
     ggagtcggta tctagccata ccgactccat ttttatcgac ctacaggtga tgcagctgcg    270480
     ctgattcagg ccctaaacag ggttacaagg gcgcatcgcg gagccaggaa aatccgtttc    270540
     gaaggtctgg tattgcctgg tgacgtaccg ttcctgttcg agtgttacat ccagaacgcc    270600
     atccttgctg cgttttccgg ggtcggtgac agggtctttc tacaccccaa tgaacgtccc    270660
     gtcgctgaac agctcggcag aaagtttata cgccacgcgc tgcgtgtcgc ggtctacctg    270720
     ctgaagcagt gcgccgccca tgccgaacgc gacgttgggc gggccaaggg gtagctgtct    270780
     gcaacgcgca cccggacctc cggcgcgttg cagacgaagt cacgggaagc aacgatgaag    270840
     agggcgtggc gcaggtcatc gaacgtctac tgctctccag caggagggtc tgatacggca    270900
     cgctcaactg cctctctgtc ggtgaatgcc gtaaatccgg ctggcctggt ggtaaggcac    270960
     cagcacctcg tgggctgtct tccctagggc cttgcgtgcg acatacagct catcctcggc    271020
     agcttctgga tagttgtcct ggacgatatg cctcagaacc ttctcaagcg acgcttcccc    271080
     gaccttcagc aggtacgaga agctcggcat gttccaggtg tgccacgctg tgccgaacag    271140
     gtccgaggat tccggcagga gagacttcgc atcggcgtga cccagccacg cgcgttaagt    271200
     cccgcgccgt acatgtgctg gtgagtggaa cctaggcaga gagggcgttg cacccggcgt    271260
     gccgtgaggc tccaccgggt gcaacgccct gttctggaat aaatcaggcg ggaattattc    271320
     cttgggcacc ttgatggttc cgttgagaat caggcgttgc acggtctgga gctgcttctg    271380
     aagagtagcg ggcaccagag cgcggttgta gctgtccagg gcatattcga cgccgtcgtt    271440
     ttccaggctg aagttgcggt cgcctttgcg ccagggctcg ccgtgcacca tgtcacggat    271500
     ctgggcatag accgcgttgt ccacacgctt gaccatactg gtcaggccat ggttcagggt    271560
     tttactcttg gtatcggtgt ctcccaggtg gttctggtta ctgtctaccc cgataaagaa    271620
     cattgggcgg gtgtcgccgg cgcaggcagc cttgtacccg gcgcttttgg caacgccggc    271680
     gtactggttg tgcttgaagg ccaggtcttt gggcaggtcg gtgcgcttga ggcactgggt    271740
     cttgttgacg tagtcgatga cgcctttacc gctgccgccg gccgcggcga agataatgtc    271800
     ggcaccctgg gctttcatgc tgcccgcgat ggttttggcc ttggcggggt tgttccaggc    271860
     agcgggcgta tcacccacat actgaaccag caccttgcag tcggggcagc tgaacttcac    271920
     gccggctttg aaccctgctt cgaatttctt gatgactgga acgttcatgc ctccgacaaa    271980
     tccgaccacg ccggtgctgc tggtgcgcgc ggcaaggtag ccgaccagaa agctgccttc    272040
     ctgctcacgg aaacgcagtc cagtggtgtt gtctccctcg ggcagatcgt ccaccacggc    272100
     aaagttgctc ttggggtagg ccttggcggc agcggtaatg ccagcattgg caacaaaacc    272160
     cacgccaata atcaggtttt tgcctgcctt gctaaacttg ttgatgcctg ggttcaagtc    272220
     gccattcttg gcaggctcga agatttcaat gtccacgcca aagtcgcgct tggcacgaag    272280
     tgcaccttcg tatgcggcct gattgaaact gcgatcgttt ttgccgccgg cgtcaagaac    272340
     aaggccgaca gtgacttgac tttgtgcgtc ggcaagacta agtgccataa agcaaacaag    272400
     catcatactt tttttcatac atttcagttt attaataata gtgtcacatt taacttactg    272460
     gtcatatgtt caacccatca ccctcgacag ggtgttgggt cattcaacaa caaaggcacc    272520
     actgccattc tatcagtgga tctttattat ttataagttt gtcttgtttc catcacgaac    272580
     ctgtagaaat gcgtttaaag gcgtcatgtt cgaacagttc aatccggacc tgcactctac    272640
     gcagcagcaa cttacgtttc catcactcgc ctgggcagat acgcctggac gctgttattg    272700
     atgcaggagc agccagggaa aaaggcccct tacctccatc aggttgaaac gatccttact    272760
     tgactgcttg acccaaaaga agctgccgtc ctcaccaatc gcagccgtag agtccgggga    272820
     aagaagtgtc gcgtcagctg acagtgtcac ctcaggtaag gatagcgcag cgatactcaa    272880
     aagcagcaca atcatgatgc tcacgtcggg gccgatgaga ctccccagtt tcatcttggt    272940
     catgagtcga tgaaaaagtg attcagactg gtgtacctcc agcaaagaaa atcggagctg    273000
     aaacaccata gaacggcgtc aataatcagc cgccttaaca tggcgtcgct gcacctcatc    273060
     accacaccat ggaaagtggt ggacaggcgc aaactctggc cgacctacca gaaagaaagc    273120
     gcctgacgac aaacgttgac gaacgcgtga cccacctgac gacgtagtcg gaatatcacg    273180
     cggccatgcc ctgaaggtac gtccatcagg gcaatgatcg aatatcactc atgggagcgc    273240
     acggcacgag tcacgtaagc agcccgctgg tgacatgcgg gctgcactct gcactccggg    273300
     cagagggtta ctgaagaggt tgaccgttga ccatcaggcc atgctcactg agcgagacgt    273360
     ccgtgacgat ccggcttcct tctttgataa gcatgccgct cttctcgccc atgttgatca    273420
     gttcaggggc catttccggg ctgggcgcaa ccgtactcag caggtcaata agggcggccc    273480
     tttccgcctc gccgtgcact ttgacgtgca gaaggcccat caacagttca ggattttcgc    273540
     tcacacgcgt ccagtctgtg cccgcaggcg ccttcatgcc gatcagcccg ttcaagcgca    273600
     cttcgtcctg tccagttccc acggagagcc gatcaagaac cagagcgggc ttggctccta    273660
     gcatttcgct gacaatgccg tcgatagtgc ggtcactcag cgtcttgcca ccgcgggtcg    273720
     cctcattgag tttgaccagg gcgctacggt caaggttctt caatgtgagg ttgagcttga    273780
     tgtcctcaat gtcctttccg ccaacagtca gggccttgat accgtaggag accatgctgt    273840
     cgaacgtagt ggcgcttcct ctgctttcgg tacggacatt cagccccttc aaggcgaagt    273900
     cagcaccatc agcaccactg accttgagtt ccgccagagt gatgtttccc ataccatcac    273960
     cgagattgtc agccgcttgg gcagccttca ggtcccactg aacccggccg aagttcatcc    274020
     tcagttcctc gcccgtgacc tgcgcgccgg gccactcccc ggccgtgaaa acctggttgc    274080
     cagcagcacg tacggtccct ccggccggct gccacgccac cgtggtgcct tcatcggtaa    274140
     gggtccctcc cggcacttta aaggtggtcg tgctggtacc accgaactgg acaagcgtgt    274200
     tcaattcgat tttcttgcca ccaaacgctt tatcgagttg cgcctgaagg tcaggctcaa    274260
     acaaaacgtt ggtgatgaca gtggccgcac cgaatcgttt gccttgcgga aagggtccgc    274320
     tataaacccg gctgttgagc gtgatgacca aaggatcttc gctttcaggc aacaccgtga    274380
     tagtggtggt ctgcgtgcct ccgaaggcat tgccctggaa gggaccgctg acaaccgtgg    274440
     ccatgccgga atcattcagg gctttttgcg tgcggctgag ctgggcctgg atatctttct    274500
     gggtctgctg accggcgacc gcggcaatcc cagcgctacc aagaagtagg gctgcactga    274560
     tggcggcgat ttttacaggc tttttcatcg tcattccttc gtcagcgtac gcgccgtgga    274620
     tggcgccgtc taacgatgtt ggggatgggg cttggtgtag caagcactca cggctggctg    274680
     gcagccggct ctggtagcct ggcgcgcctt gtggtgactg gcgaggtcgg atatgtggtg    274740
     gtgtctggtc acctctatga ggcgccgccc aggtttcgcg cgcatgcacg agagatgaac    274800
     gtgactgtgt gggacatcag attttgatcc tccatcctgt gaagccgctt cttcttgctc    274860
     tcttcaatgg tgcgaatatg accgccgaac cagtgattca gcaagggcaa agattgaatc    274920
     tctgaaaggg gagaacgtgt aataaatacc tttggcgaag ggtggactga tggcaaactt    274980
     ccccttattt ggggtcagat gacatacgaa atgggagatg cagtagatgc ccggagtgtt    275040
     tatcaagctt taaggagaac tcaggtcaaa ctgcactgct ccgtgaacaa agttggcgac    275100
     gaatctgctg agcgttggat tgcacgccag tgaacgtact ttaccgtctc gaatcttttg    275160
     cacggtcagg cttgacttgt ggacagccat aagtgccgtt ggggtggcgt aaaccacata    275220
     gtcctgggcg acacagaaac tttgaaggcc tggagtcgag acagagcgca ctgcttttct    275280
     catgagcgca cctctgtgaa gaaacagctt ggttcggctg gccatcacga agccatcctg    275340
     atctggctcg acatcagtga tgacctcatc tgtcagccga actgcctgtt tcgctgtatg    275400
     aacccaaccg cccccagtga tcactgcagg cgcatcacgg aacggaagaa ccgccatgac    275460
     gttgtcgtgg ggcattccat ccaggctttt gatgaggacc tcgtgtcgct tgcctttctc    275520
     atggcgggtc actccccgtt gcccacgctt ataggagaaa gtagccttcc cgatgacagt    275580
     tccaagcggt cggatctcaa ccaccctcaa gtcccggttc aaaatgatgg tgtggtactg    275640
     gccgttcacc aacccgttga tggcaagtcg ctcgtcagcc aggtattgca agcggggagt    275700
     gaacccaaga aaggtggact cgtacggcac acagtgaaaa cgcgtctgct cggtgatgca    275760
     ccaacggaaa cgtccatcca ctgttccgcg ctccaggtac agctgatagg agctgacgcc    275820
     tccgtacagc tcccaacgtt gagtgaacgg cggcaggctc ttatgggtca agactccaac    275880
     gccgccagcc aaggcgagtg agaccagtac gtgagttaca gccaggaagt atgtcaggga    275940
     tagtttcaaa gaagtgcggc agtcacgcgc ttccggatta cgcttctcct cagagagttc    276000
     ctttctcggc acgcgactca tcatgccgcc tggggcgggc gatgaaatgc gacattgagc    276060
     agacgctaag ccatggcagg ggtagccgct actcgtccga gcacaggtcg tgtgactgat    276120
     ggcagaaata tcgccataca ggatgcctct gggctgccaa tgctacgaat aaacgcacag    276180
     atcagtaata aggtagagag gtactccacg ccccgttcac ttgtcaggtc catggttccc    276240
     cagctaatca tcccggccag cgtgctggag gcggtgacgg tattcctgag gtgtgaagcc    276300
     cgtcatagcc cggaacttcc ggctgaaggc gctgtggtcg ctgtaaccgc attcgtgagc    276360
     aatatcggcg accgagcggc ggctctcgcg cagcaggcga agggcggcgt caaaacgcac    276420
     ccgcagcaga aactgcttgg gggtcatgtg gcagaccctc cgcatcagcc gttcaaaact    276480
     gtcctcagac aacccgacct gcgccgcaag tgctgacgtt cgcagaggcc gcgcaaaatg    276540
     ggcatgcata aacgccagtg cctgcgcgac ccgtgcaaag tccgcgtgac gttcactgag    276600
     cggcggtaca tcccgcgaga cccccgcgag gcccacgacc acaccatcgt cgtttaccac    276660
     cggcaactta tgtgtcagac accacagggc ttccccctgc ggtccgacgt acatttccag    276720
     cacgtcccgc aactcgcggc gatgacgcat cgcatagtcg tcctgttcgt taaaccggtg    276780
     gcccggctca ccggtaaata cctccgcagc agtccgcccg agcacatcgc gcttgtgctg    276840
     tgcgccgcaa cgtcttcgca gcgtttcatt cacgctgacg taccgcccct gcacgtcctt    276900
     cacgtaaaag atcagatcag gcacctcatc cagaagcacc tctatcggcc agctgccgtc    276960
     tggagccggc tgcaaccagc gccgaggatc attcataccc gactgttgca cagagctgga    277020
     aaaaaggcca accgttgtgc caaaatccgc aggcggtgga gggctttcac gcaagacacc    277080
     gccaggtgga gggcactacg ctgcaggtat gactcaggcc cactccgtcc caatctctcc    277140
     ggtcagcacg aatcaccgcg aggaggtgtc cgggatcgga ctggcactgg tgtccgccgc    277200
     cgcatcaggg acgctgggag tgtggggcaa actggcaatg ggcctttcgc tcagcacacc    277260
     cacgctgctc acctggcggt tcgggctcac gacgctgctg ctccttgccc tcggctcgtt    277320
     caaggtctcc aggcgtgagc gtgtcaccct gctgctcctg ggcgttctct atgccggcac    277380
     caccgtcgcg tacttcatgg cactgacgcg tatcactgcg agcacatccg cgctgctggt    277440
     gtatgtggcg ccggccttcg tgattctgta cggggtcatg gcacgcgtcc ggcccacacg    277500
     gtggcagctc ggggccttgg cctgcacgct gctgggcctc acagtcgtga tcggcatgcc    277560
     gggtgcggca gacggtgacg tgctgggact gctgttcgga gggctctccg gcgcgctgta    277620
     cggcgcttat ctgtttgcga gtggccgcgt agcgcgtgac gtgcccccgc tcaccctgac    277680
     cgcgcacgtg accctggtgt gcactgcaac gttcatgctg atgggcggcg tgacaggaca    277740
     actggccgta ccggtcatgc tggagcactg gggggtcatt ctcgcgatga tcctgattcc    277800
     cacgctggtc gcgttgccgg cgctggcggg tgccgtgcgc cgcatagggg cagcgcgggt    277860
     cagtttgctg gcgagtacag atccgctgtg ggccgttgca tttgcgacgt tgctgcttgg    277920
     cgaggtgctc gcagtgtcac aggtactggg cggtctgctg atcctggtcg gggctgcatt    277980
     cgcgcagcgg tccgaccggg cagctcccgc tcagtgacca caggtgtgca actgcattcc    278040
     cggtagtgac gcgacattcc gcgtcactac cgtgggcaac tgggcgtgag gtacaggagg    278100
     gtcggccaca cagaggtgcc gcacttgagg agggcatgta gcaggttgtt cccaggtcgt    278160
     ttcgtactaa cagagattag tgctaaaaaa cgtgtgaatc agtcgccaag ggtttgcctc    278220
     ctgggatcag ttggaaccgc ctttctgaag ctctcaggag gaaaatgttt tttgatcgtc    278280
     tggaacaagg tttttcacca ggaaacgcca gtccgcaacg ttttgccctc agcaaagact    278340
     cagattgatc acgggttccg gtgttgaact tcatttttca gagtgtccac actcagccgt    278400
     tcattctccg ttacgtccct gaaaataaga acgctccgtt cctccaggtc cctggctttc    278460
     cgcttatacg cttcggccag ccgctgatca cccgcctggg cgaactcgcg acctgtgttt    278520
     tccagcagca tgaccgcctc ttccatggtg cgcatcgtcc gccagagggt ttcctcaacg    278580
     tgctcagtca cacccaccag cagtgtgtct cccgtgtagg catgaccggt gtgacaacgg    278640
     tagcgcgtaa agcccccttc cttgatctgc accagcacac cgccgcactc cggacaggtc    278700
     tgtggcgtca ctttcccgaa ctccatcacg cccttccgga acgcatgatc actcaacgcg    278760
     atttttactt ctgttttgac ccggtgctgg gtggccggat cgatgtccac ccctgcagca    278820
     tatggaagag gttcagcgac aagctgtacc agcaggtcgc ccaggtcctg acctcgcacg    278880
     gtgtgatcga cctcgacctg gttcagtgca ctggctggca tcgaactatg ttctgcatcc    278940
     tcggggtcct gtacgatagc gataccgccg aactgcttga tggtccacag tcctgaggtc    279000
     ccgtcatcaa gcatgccgct gagaacgacc ccaatgacac cgggtcccgc actataggca    279060
     gctgagcgaa acagcgtgtc tactgctggg cgcacccggt tctccttcgg gcccttcttg    279120
     actcccaggc actcgtcctg aagcagcagg tggtggtcag gaacggcgca gtaaatccgg    279180
     cccggctgga tgggttcgcc gtcctgagca tgaactacag gaaggagccc ggatcggccg    279240
     agaatctcag ggagatggct gggggtgtag ggcgggatgt gagtggtgag gcagacagct    279300
     gctggaaaat cggcagggag attggccacc aggtccatga ggggtttggt tcctcccgcc    279360
     gaagcgccaa tgacaaccaa ccaatacggc agcatttctc actgtgtgtg gctttgcgat    279420
     gagagggatg gtgtgttcct gaagccaact acagcaacgg aaggcctggt gctggtgcca    279480
     gaccgggtct gaaaatagct gcaccggctt tgttgtgcag ccgtcagtgc tatacgcatg    279540
     agcaggtgag gcagcagcac tctgcttgag cttgaaactg ggctgataca aaaaaggcga    279600
     ccaggacgat ctggagcggc ttacccgata acggtatgag ctggtcggtt cacacgaagt    279660
     tgcatagatg caacccttct tctattccct gcatgtcctc acaggcattt cgcatggcct    279720
     gtgtctatag caagtgacaa ctgactggag gcctgcggtg acgagcacaa tgggcgtcat    279780
     gaaacacaag ctttacaacg tagctggtgt ttccttgagg gctgaggcga cttcatcctc    279840
     cacccagatg ccttcagcca cagttgtccc cagggcgaag gagtcactgt cagggagctg    279900
     aacgcggatt acaccaaggg aatcgacttc cagcacttcc aggtcggttc ccggtaccac    279960
     tcccaagctg gccagggccg ccagacgtga ggggtcattt tgagccagcc gtccgacacg    280020
     tacggtttca cctgcccgga cgtccatcag tgaacgtctg gcttcacgcg gcatgactcc    280080
     tgtcagcgaa ggaatgggat caccatgtgg gtcgtgtgtg ggtgcaccca gcgcagcgaa    280140
     cagacgcgcc tcgagggatt ctgaaatatg atgctccaga cggtctgctt cctgatgcag    280200
     ctcttcgagg ggaacgccga gcgaatgatg taaatatgct tcgattatcc ggtgatggcg    280260
     tagaatttcc agtgcgaccg attccccagc agctgtcagc tggacgcctt tatacgcctg    280320
     ataactcacc agttggagct cggccagacg tttgagcatt cccgttacgg aggctgaagt    280380
     gatcccaagc gactgggcaa tatcctgtgt gcccgctttc ccctcccgag aaagaagata    280440
     aatagctttc aggcaatctt ccgactgcgg ggtaagtctc tcgcgcactt ccctatggta    280500
     gctcagtacc agcgctttac gatgcatcaa agagaggcag gaccggggtc ctgctctcct    280560
     ctccctatgc ccgcatattg acggcaattt cactgtcggc gacgccagca ggagccaact    280620
     gtgtgccctg acgccgcaag cgagtgctct tgaggcgggc atccacactc atgctgatgg    280680
     tcttgctcca cccgataaaa agcacaaaga cagcagtata cagaaataga ctgatttcat    280740
     tcatgttacc agagagaaca aaattaatat gcataaacag gcagacaaac aacattggta    280800
     gagtaaacaa gccaatcata atcaaagcgc ctgcaatgac ttgcaccacc ggaatcgtat    280860
     aattaaaaat caggagattt tccatgacca cgattctcag gaagtgctta taaggttcaa    280920
     caacgtttgg cttgtcgagg gcttctaaaa ggtactgacg cagaaaaagt cccggctcac    280980
     tccaccagtg cttctccgtt tccttagtca cgcccgccat gatccatgcc aacccatatg    281040
     cacagcgcag aacaacaaaa aacagaaggg aggcagtgtt gacgactgtc tcaaaattga    281100
     ctcttgggtt gagggtgtgg tgatgaaacg ttcctggggt catggtgttc tccagatggg    281160
     gtgtgcgctc catacatctg ccaggtacgg ctggcagatg gagccacaga agaatgattt    281220
     aaagatttca aaagccgaca gttaataact gcaaataaaa tagttagggt gcccaaaaat    281280
     atcaagtcgt tgcgttcatc agaactttag gttggccggc ctccacgtag caggccggcg    281340
     ggcttttccc cctgagcaaa gccagaggca cttaaacaaa cgtgctgctg gacagccagg    281400
     cactgccccg tgctggagaa cgggtctgca cttaacccgc ctctccagca cggggcaggt    281460
     cgtgagcagg tgaacacact cgattcgagg gaagcgaatt tccctttctg gctcttctgc    281520
     tgatggaagg tctggggtgg gcagcaggag ggataacgga tgtcaatcaa ggacgctttc    281580
     accttgaact tcagtgcgtc acggatcaac ccactgtgca gtgcttgtat tcccctaact    281640
     tcccgtccac ctgaaatgaa atttcttgac ctcgttgaga catgtgcttg cttcctaagt    281700
     acacttcctg agtgcttgtt ccggcattgc cgccgatgta acgacacatg ctgctcgcaa    281760
     atcacgcgag cagcatggcg cgcgagacac ataagccgac ggcgtgaagc atcggccggt    281820
     ttgcgaaact caccagactt acggtcaaga tcctgcagta ctacaaagag gaaaacatcc    281880
     tcaagctggc cgttgtaagt caacaacccg gctcccggtc gtacaccgag acgcagcgta    281940
     agcagatgca tgttctggcg aagcacacat tatgcgggtc ccgctcgcca tattgcagca    282000
     ctccatgctg aatcccacgc ttgagcacca gagcggggtg tacgacagga agaactggca    282060
     actagagcag gattcaggag acgtcagcat ggcctggagt ggctgcaccg tagacgggcc    282120
     tatccctggc cggggcagcc gtacgaggtt acagctgagg taccgccgtc ccacccccgg    282180
     gcatgcgtcc actacgcgac gacttgggag gactctcagc agaacgggat tgggcgttcg    282240
     acgtggccct gtcgttcctg acccggctgg gcgtgaagcc agcaactcct cttctgtcat    282300
     tcggcctgcc gcccaaggaa acgcgaggtg tactgaacgg gttgaagtat acgcgggctt    282360
     cgagatccgc gggcccgtcc tgccggccag caacgtgctg ggggaaagac accatggttc    282420
     aggggtacgg ggtcttgcac gggtccgtct gggcacatct ggcaagtcag accgatgtta    282480
     ctcgaacacc tccagcagga agactgcagg tacttccgaa caggagaatt tttacagcag    282540
     cggctcttcc atgtgggacg gtgggatctc cccgtcgtag gacgccaagt gacggaggtg    282600
     cggtggattg tccagccgga ctgccaggga aacgtcgtcc cgagagtacg accattggtc    282660
     ggtcctacac ctgattaagc actgctgaac gacgtccccc agctcatgaa gagggccttg    282720
     ggacagctct ctcctatgag tccgcaccga cgccttacgc tgaccggaca atgaccctgc    282780
     tctcgtctcc caccgagcct tgcgtgccca cgaccgttta ccacgcagac catggccggc    282840
     tctgtgtatg tccgacgacc gggggcctct atgtgacgat tcagccgtat ggcgcacctg    282900
     cacaaagcat caccatcgac cgcgaacagg tgcttgaatt gatccaccag ttgcaacgag    282960
     agtatccgac tgaatcctga tgggcctatc aaaccgcgcc acatgaatta ccgcctgtcc    283020
     cctctggtcg ctcagggcat gggcacgcgg ttggcctgcc agtagctcag aaaggcttcc    283080
     gcctgctgca cgaaagcgtc gaacccactt gattttacga ggtaggagct cgcgttcagg    283140
     ttataggcct gcgtgatatc cgcgtttgcc ttggaggtgg acagcatcac aaccggaata    283200
     gtgcgcaagg acggctcctg tttcagctgc tccagaacct ggaaccccgt gaggccaggc    283260
     atattgatgt ccagcagaat gacgtccgga cgaacttccc cattcctcaa ctgccggagt    283320
     gcatcctcgc cacttgcggc gcagctgagg gtacatgagg aactgaggtg attgaaggct    283380
     tcttcagcca gcaggcggtc agtgggatca tcgtccacca gcaggtaatg gtagggagcg    283440
     ggcatgcact tgaggataaa gcgccgataa cagttgcgcg tctactcctg ggattcatgc    283500
     aatggggtgg tctctaaccg cgccttgctc tccacaacct gaacttcaag agcatgctga    283560
     acctccgctg acaccactcg ctcctgctcc agacgagtca actgcgccag gttctcgcct    283620
     tcctcgcgct ccagggccga aatcagcgac cgggtggaat cagccttctg ctcgagatcg    283680
     gcacgctgaa cggcatgcgt ccggccgctt tcttccagtt cccgcacgcg gtccagcgct    283740
     tcgctgccca gaacttcgag ttgtgccaga tcacgttccg cctgttcatg ctctgtctgt    283800
     atctgccggg cgtgggcttc tgtgctgacc tgctggagct gggccacctg gccggccgta    283860
     tctgcttcct gaagcgcggt ggtaatgaga tcctggagct gctccatctg ccgctgtacc    283920
     acagcactca gggtatgcag cagggtgccg ctgacatcct ccagaggggt cccccgtacg    283980
     ttttcgaggg tacgttgaat ggcttcccgc aggtcagtgg cggtcttctt ctgctcctga    284040
     ctggaagcaa tgatgccctg gagggtcgca atgtgcagct gcgcttcagg agagcttcct    284100
     cccccagcaa ggtcgcgcaa ctgcgcttgg gtcacgtcaa tgacctgccg cagggacctg    284160
     gtgacaccga tctgctcctt gcctgcgctg atgatctgct cgagcacgtc ccgctgcaca    284220
     aagcctgctg cgcccacatg tcgacgggcg gagttaaaag aggcgttctc agtcacgtcc    284280
     aggagctctg cggctctgtg gtcatcgcgg gggttagtca taacgcagtg tagaggctcc    284340
     ttcattgcag aaggggaggc cccgtggcgc cgtccggtcg agggaaccgg ccagcctgtc    284400
     gttcagcggg gctcccaaag tgcaggcgta aaaaaggaag taactggtga cgacctgcct    284460
     ccccttggat gacgtgtagt tgtggtcaac actcccgcta aatgatcttt attggttcaa    284520
     aatccggctg gttcttgtgg gtagcagatg gccggagagc gtagctttgg aggcagcatt    284580
     cggcaccatg tcaccgaaga ctgccttctg atttcaatct tcatctgata cctgagccgt    284640
     cggcgttgat cttggacgaa tgacgctcac gagcacgccc agggtgacaa tcattacgcc    284700
     cagcacggcg agcgcagaca attcttcccc gagcaggggc acagccgaaa gcgccgcgag    284760
     agcgggcgta agagacgtga tcgtcgtggt gaggttgggg cccaggatct gaagcgcgcg    284820
     ggtgtaggtg atcagcgcga ccacgaccgc aagcaggccc tgatacaccc cctgtatgac    284880
     gacctctgcg agaggggctt caagcagatt cgagtgcccg gacagcaggt acggcggcca    284940
     gtacgtcacc aggcagaaca ccccaatcac cgccgtcgcc tgaaggggtt gcacccgcca    285000
     ccgacgcgca agtactccga aaacagccca cgagaccgac gcacttaaaa acaacaggtc    285060
     gccccgccag gtggtgccgc cgcgtccgag ttcgtccgcc acaagcagcg caacgcctgc    285120
     cgccacaacg gccagaccca gcaggcggcc gcgtgtccag cgctctccga gcaaccacca    285180
     cgccagcgca gcagtgaaga atggaagcat acctggcata aacactgccg cgtgcgctgc    285240
     gggcgcaaaa tgaaaccccg agtacgcgag cagggcgtac cccaaccccg cagtcactcc    285300
     gagagcggcg acctggagca gggtcaatcc accggtgcca tgccgcagca ggtacggcag    285360
     catgaccagg ccggacacgc cgaaccgcag ggcggccacg tcaaaggccg acagggtgcc    285420
     ctgcgcgccc aggcgcgata ccaggatgaa ccccgaccag atcaccacgg taatgagcgc    285480
     gcaggcatac cccacagaac gctctcggga ggcggccgac ctgaccggga ccgtgctcac    285540
     gcggactggt cgactttagc gtggggaggg acggacgggc cgcctctgaa ctgggaggaa    285600
     aggaccaccg gtgccagcct ttgagccgtg ccctctccat acgtgaggtg gctgctgaga    285660
     ttttcgaaca gtgcggtgag gtccatcctg tcttttatgg tctggctttt gccgacggac    285720
     acttcttcgg ggaaggttct tatcgtactg aggcacgccc agcctccagg attgtcggag    285780
     tcatggcggt cggtaccgag acgtgaggat tggacagctt ctgacataag tgcccccagt    285840
     gttgcaccag cgcacggtgt ctgctgtgcg ccaggcctgt gcttgatcac cagtgcgctg    285900
     agcgggagag ttctcagggc aagcggaccg cagaattgac cctacccggg tttgatgcga    285960
     tgccagcagg accaggcagt gcgtgaggtg tgccccaggc tgcctgtgat cctgagcctt    286020
     gtcgcggaca tcagcttgcc cggcctttac ctgctcccag cgggtctgga taaccgctgc    286080
     gcgcccttcc ttcactggcc ccggcggcgg tacccccgga cgtagtcgat gtgcgctgtg    286140
     cggggccacg gcgcatccac cgaggcttcg gtaagctgat gcggcagctc atacaacgtc    286200
     agcatgaact gcatcgggta gctcggtgac tgatggatgg tcctcactgc tacgccatcc    286260
     acgaaaaacg tcagactatc cggtttccag tccaccgcat aggtgtgaaa ctgcgaggcg    286320
     tccatctgga aggtctccgt gtagaactca tcgtacaggg acgtgtctcc gaacggatgc    286380
     acaccatacc ggacttgtgc tgtctcagcc gtcatgtcct gaccaaagac ttcacagata    286440
     cagatttcgc cggattcatg cggctgcgtc tccacgccga tcatccagag agccaccatg    286500
     taacctggaa tcggaactgc ctgaaatctc gtctcaaaat acccatagag tggcgcgtac    286560
     aactgcaggg tcggctgctc ttcacggacg cggaggtccg ggtgaaaccg gtgctgcccg    286620
     atgcagcttc ccaccggccc tgagaaactc cctgtctgca ggcaggacac gcgcagcgct    286680
     ccgtcaatgt caggcagcca cggctcctga tcccgctcga tatgaaggtg gagccctttt    286740
     cctggaaggg tatagcgggc agaagatttc tcccgcgcac tccagtgcgg gagataaaag    286800
     ggaagccaac gatgttcact gagtgttgcg ccctcgaact cttcctgaaa ttcgagttga    286860
     tagctggatc tctcttgcgg ggcgaacggt ccctgatccg gtgagcggaa cgctggcagg    286920
     gcacgactgt catcttccag gatgcgatca ctgtggggcg actcaggctc aaggttcata    286980
     gcatgaagag taatccggag ctcgcctcgt cgcttgtagc aatagaagac gacagcgagt    287040
     tacggctcgg cgtgcacccg ctggcaggac aaggtgctgg gctcgaatca gggcgtggtg    287100
     ggaagcccgc tactttgttg gctcagggct ttgtccactg ctgaagtgcg ctgcaatgac    287160
     ctttttccag cgccgctcgc gactcagcct gctcgcctgc ttttggccgc gcacgtaaaa    287220
     gatgaggcgc gtcacacctc ggccagccag tgcgtcgttg agggaatggc gcaaacttct    287280
     atctggttct caggaactgg gtctacccct ccacctgcgt ctgcctaccc gactttgctg    287340
     gagatcgcgc tgcgcggagg agcgcagctc tgccggggta tcaggttggc ggggaacacc    287400
     tggctggtca cggtgtggcc ttccagaagg gcgatcatgt tccgggcagc tgtgacagcc    287460
     atatcgtgaa ccggctgctc gataactgtg accggagggg tgaccaggga cgtccaggag    287520
     tagttgtcaa acgtcaccag gctgatgtcg tccggaatct tccagccgcg ctcccggatg    287580
     gcgcggaagg cgccgatacc ctgagtgccg gccagggcga tgatggcggt gggtggggtg    287640
     ggcagggcca tcagttcgtg ggtgaggcga aaggccgtct cctcggtgag gagggtgacg    287700
     cgctgatatt ccgggaggac cgtcaggccc agttcggcca tgattgcagg aaaagactga    287760
     ctgcgagtct cgggatgaat cagagggtgg taggtgccaa gagcggcgat gtgccggtgc    287820
     ccaagcgagt gcaggtactg cacagcctgc cttatggcgc ccacgtgatc gacgttgacg    287880
     tggggatacg ggctgcctgg ggggacatag tcgtattcca ggatgtgaac gcctttggat    287940
     acgaggcggt ggatgtaagc gcggctttct ggcccgtagc cgggtcggag caggatgccg    288000
     gcaacacgct gcccgtacag ccgctgaagt tctttgactt cacgggcggc ggtgtattcg    288060
     atttcgctga tgataatcgt gtacccggcc tcgcccaggg tccggctgac ggtccgcgcg    288120
     aattcagcaa agaaaggttc cacgatgctg gccacggtca ggccgatggt tcggctctga    288180
     cctccccgaa gactgccagc acgttgatcc ggctcgtatg ccagtgtctg gacggcggct    288240
     tgaacccggg ccagggtgtc cggcgtaagt ttgtcgggtt cccgcagggc tcgtttggcg    288300
     gtggtaggag agacgccagc gaggcgagcg acgtcttgga tggtggccac ggggccattt    288360
     taggcgcaaa cagggtcgca agatgtgcga attgatggcc acgagttcat cactgcactg    288420
     agtcaaattt ggtgacaggt agacatcagc gtcaggagtg tgtttcaatg atggccacga    288480
     gaccattcaa aaagaagagg gaatccgccc tcccctagca cgaagcgacg ccatgccgat    288540
     cgtccgttcg cctgccgccc tgcgcggttc ccggaggttt ccccatgaag agaattgccc    288600
     tgctcagcct ctcattgttc gccagtgctc aggcagcaac catcaccatc gccacggtca    288660
     ataacccgga catggtgacc atgcagaaac tcacccctga gttcaacaag aagtacccgg    288720
     atatcaacgt gaaatgggtg gtgctgcccg aaaacgaact gcgccagaag atcaccctgg    288780
     atgtggcgag cggcgccggt tccttcgata ttgccaccgt gggggcctac gaagtgccga    288840
     tctgggccaa gaacggctgg ctcaagccgc tgaccccgct gttcagtaaa aacccggcca    288900
     ttgccagcag ctacaagctg aatgacgtcc tgccaggggt gcgcggcgca ctgactgtta    288960
     agggacagct gtacgccgta cccttctacg ccgagagctc catgaccttc tacaacaagg    289020
     acctcttcaa ggccgctggc ctgaccatgc ccgccaaccc tacctggaaa cagattcaga    289080
     gcttcgccgc caaaatccac aatccctcca agggcgtata cggcatctgc ctgcgtggtc    289140
     tgcctggttg gggcgagaac atggctgtgt tttccaccgt agtcaacacg tttggcggcc    289200
     gctggtttga ccagaactgg aatgctcagc tgaactctcc ggcctggaaa aacgccatga    289260
     ccttctacgt ggacaccatc cgcaagtatg gccctcccgg cgctacgtcc aacggcttta    289320
     ccgagaacct caccctgatg agccagggca aatgcggtat gtgggtggac gccaccgtgg    289380
     ccgccggctt cctgagcgac cccagcagca gcaagatcac caagtcggtt ggcttcgccg    289440
     ccgcacctgt gggcaccact ccgcgcggca atgcgtggta ctggagctgg aacctggcca    289500
     ttcccaagag caccaaacag gaggacgccg cgttcaagtt catcacctgg gccaccagcc    289560
     aggagtacat cgccctggtc gccaagacca agggcacctg ggccagcgtg cctcccggca    289620
     cccgcaccag cacctacaac aacgccaact acaagaaggc cgctggagca ttcagcgctc    289680
     aggtgctgag ctccatcagc aaggccgacg tgaacaaggc caccaaggat ccagtgcctt    289740
     acaccggcat ccagtacgtt gctatccccg aattccaggc actgggcacc caggtgggcc    289800
     agtacctcgc cggcgccatc agcggccaga ccactgtcga ccaggccctg aagcaggccc    289860
     aggaagcagc ccagcgggtg gccaaggaag gcggctacca gaagtaacct ccggcgcacc    289920
     ctgctgtggg aggagggagg cagggcacac gtcctcgccc cctcctcccc gctgttgtca    289980
     cgccccgagc aggagaccta tccatgacgg ctatcacgcc ccctacaacc gtgaccacca    290040
     cgtcgccggc tcccaagcgc ggtctgcgcc ttactccctc cgtgctgatc tggccggcga    290100
     tgctgtatct gattctgacc acccaggtgc cgttcttcat gacggtgtac tactcgttct    290160
     tcaggtataa cctcgtcgat cccagcagcc ggccgttcat tggtgtacag aactacgtca    290220
     cgctgctgac cgatccacag aacctgcgca tcctgggcaa caccgtgcta cttgccggcg    290280
     gcagcctgct gctgaccctg attctgggcg gagcgctggc gctgctgctc aaccggcagt    290340
     ttgccggacg ggccctgctg cgcaccctga tgatcagctc cttcctggtg atgccgatcg    290400
     tcaccgctgt catctggaag aacatgctgc tcaacccggt gttcggcttc ttctcctggg    290460
     tggtcgccag cctgggaggt cagccggtcg actggctcgc gcagtacccg atggccagcg    290520
     tgatcgccat ggtcacctgg gagtggacgc ccttcgccat gctgatcctg ctcaccggcc    290580
     tccagagcct gccggacgac cagatcgaag ctgcccggct cgacggcgcc agccccatgc    290640
     aggaattccg gcacatcgtg ctgccgcact ggatgcaggc tatccaggtg gtcgtgctga    290700
     tggaaaccat cgcgctgctt caggtgtacg gtgagatcta cggctccacc tccggaggcc    290760
     ctggcgtggc caccacaaat ttgccttatt tcatctacca gaaggccttt gccgagtaca    290820
     acatcggcct ggcgagcgct gcaggggtca tcacggtcat cctcaccaac atcctggccg    290880
     tgtacctgct caaactcatc aaccgctcga ccagcagccg gggaggctga catgaccgct    290940
     tcacccttta tccgtaacgt cagcgatcgc caccgcgtgc gcaatatcct gctgacggtc    291000
     ctgacgtacc tgctcgccgc ggccttcctg ttcccgctgg tgtggatgtt catggccgcc    291060
     ttcaaaacgg aagcgcaggc attcgccgcg ccgccagtat tcagcttcac gcctatcttc    291120
     gacaacttcg aacgggccct gcccggctac cttcccgcac tgaagaacag cttggttgct    291180
     gcggtcggtt cgaccatcct ggcgttcatc ctgggcctgc cggccgcctt tgcgcttgcg    291240
     gtgtacccga cccgccgcgc ccagggcgtg ctgacctgga tgctgagcac gaagttcatg    291300
     ccagctgtcg gcgtgatcgt gccgctgttc ctgctgttcc gtaacctgca gctgctcgac    291360
     accctgcccg gcctgatcct gatgtacacc accatgaacc tgccgctggt cgtgtggatg    291420
     atgcactcgt acatgaccga gatccccttc gcgatctatg aggccgcgaa ggtggacggc    291480
     gccaccgtgg gccaggagtt cttccggatt gccctgccgc tctcgactcc tggcatggcc    291540
     gctaccgcgc tgttgtgcct gatcttcgcg tggaacgagg tgttcttcgc gctgaacctg    291600
     acgagttccg atgcggcgcc cctgagtgtg tttatcggtt cgttcaaaac cagcatgggt    291660
     ctgttctggg cgcagctgag cgctgcggcc gtcctgacgg tgctgccggt gctgattttc    291720
     ggctgggtcg cccagcgtca gctggtccgt ggtctgagct tcggcgccgt gaagtaaggc    291780
     cgcgtcctgt gcccgctgag ggccagggaa gctgatcccc ggagctccct ggccaaccac    291840
     cttctttccc acatccataa catgcccctg gcccctggcc agatccgacg ttctcacgtt    291900
     cgacggagtc cggagatttt atgacggtca aactgaacgc ctccacgctt gctaccctca    291960
     accgcaacgt cgctgtcccc cagtacgatc cctcacaact gacgtccggc atcgttcact    292020
     tcggggtagg cgcctttcac cgcgctcacc aggccatgta cctcgaccgc ctgctgaaca    292080
     ccggggccgg ctccgaatgg gccatctgcg gcgtcggtct gctgccaggt gacgcccgca    292140
     tgcgggacgt ctttgcggcc caggacaacc tgtataccct cgtcacccgc tcgccggaag    292200
     gacactcaga agcgtgtgtc atcggcgcca tccgcgagta cctgtatgcg ccggacagtc    292260
     cagaagcggt gctggagaaa ctggctgatc cggccacgaa aattgtctcc ctgaccatta    292320
     cagaaggggg gtacggcacc aacaacgcca ccggcgaatt cgatccctcc acaccggagc    292380
     ttcagcacga cctgaccgag ggcgctgttc cccgcactgt cttcgggttt atcaccgagg    292440
     gcctgcgccg gcggcgggaa cgcggccttc tcccctttac ggtgatgtcc tgcgacaaca    292500
     tgcagggcaa cggccatgtc accgcccggg ccttcatcag ctttgcccgc ctgaaaaacc    292560
     cggagctggc ggaatggatc tcacagggag tcgcgttccc caattcgatg gtggaccgca    292620
     tcacgccggt caccaccccc cagatccagc aggacgtagc agaccagtac gggattgacg    292680
     acgcctggcc cgtggtggcc gagtccttca cccagtgggt tctggaagat accttcacgc    292740
     tgggccgccc tcccctcgaa caggtgggag tgcagcttgt gcaggacgta gagccgtacg    292800
     agctgatgaa actccggctg cttaacgcca cccaccaggc catgggtcaa ctgggccttc    292860
     tggccggata cacctacgcg cacgaggtct gccaggatcc cgttttcgtg gactttctgc    292920
     ttggttacat gattgacgaa gccacgccaa cccttcaccc ggtgccgggc gtggacatcg    292980
     ccgcctaccg ggagcagctc attgcccgtt ttgccagcac tgccattcag gacaccctcg    293040
     cccgactggt ggtggacggt tccgaacgca ttccgaaatt tctgcttcca gttgtccgtg    293100
     agcgcctggc ggcaggtggc tccgtgaacc gctcagcgct ggtggtcgct gcctggagcc    293160
     ggtatattgc cgccgcgcat gagggacact atcccgcgct ggttgatccc cgcgctgaat    293220
     ccatcactgg cggcgctgtc agagacgtcc agcacccagg agcttttctc gaactacagg    293280
     acatcttcgg ggacctcgcg cagaatgccc ggttccgcga agcgtacctg accgcgcgaa    293340
     atactttgga cagtcatggt gccctggggg ccattcaggt catggttcag cagcacgcag    293400
     cagcacccgt ccagcccttg tcgccggctt tcacttctcc caaaaccgca accaacctcc    293460
     ccgatgcagg ccagagcaaa ccggtgcatg aggaaacacc atgacctcgt ctgatctcgc    293520
     ctctcacagt gctgcccgtt cttcccgcac cagtgtgctg cacggcattc gtgatctgcg    293580
     ctgggagacc cgcgacgtcg gcgttcctgg tccccgcgaa gtccgcgtgc gcgtgcgccg    293640
     catcggggtc tgcggcagtg acatccacta ctacacccac ggcaggatcg gccagtacgt    293700
     ggtggacgcg cccctaattc tcggccatga agtgatgggc gtcgtcgacg cggtgggcga    293760
     agaggtcacc cgggtcaagg ccggcgaccg ggtcgctctg gaacccggct atccctgccg    293820
     gcgctgcgcc tactgcaaac gcggcgagta caacctctgc ccggacatga ccttcatggc    293880
     cacgccgccc attcacggcg cgctgtcaga gcatgtcctc tggccggatg atttcgtgtt    293940
     tccgttgccg gacagcctga gtgatgacgc gggagcattg atcgagccgc tcgcggtggg    294000
     cgtgtgggcg gcacgcaagg gagcggtcac gccggggcag agcattgcgg tcttcggtgc    294060
     cggcccgatc ggatgcacga cgctgcaagc cgccaaggcc gccggcgcca ccaccctgat    294120
     cgctgtggat ctggaggact tccggctgga cctggcccgt caggtgggcg ccacgcacac    294180
     gatcaacgcc cgccatgagg accccaccca gcgaatccgt gagattaccc gttcagacct    294240
     gcccgagtca catgctggcg tggacgtggc gtttgagaca gcgggaagcc tgcccaccac    294300
     ccgcctgagt ctcgcggcgc cccgccccgg aggctcgacc gtcctggtgg gactgccgcc    294360
     ggaccccgag gtcagcctgg atatcgtgtc cgcggccagc cgggaagtga cgatccgggg    294420
     cgtcttccgg tacgccaact gctaccccgc ggccatcgcc ctcgtggaaa gcggggcggt    294480
     gaacctcgac gcgctggtca cccaccggta cacgttcgat cagacgccgg aagcgttcga    294540
     attcgcggat cgcgagaagc gcaccagcat gaaggtgatg atcgacgttg gctgagtggt    294600
     ccccgtctgc ttctccacga aaggttctga cataaggtgc tcggctgtat ctgactgtaa    294660
     accctcccgc caccgttttc cagcagcatc atcaggcagg cactctggta gtacgatcgc    294720
     ctgcctgtca gccagcatga cgtttgggaa ccactccaca agcgcgaggt tcaagtttgc    294780
     ctgtagaccc taggacaggg aaacatcatg ttagcgccgc gcctcaccga gaatcccggg    294840
     ggattcccaa tggcatctgg acctagtgtg cgtcgaagtg ggcaatcaag cgtttttcgt    294900
     ggccagcgct cgacgaacac aggcacgcgc tgaaccttct ccttaaggca caccgcctgc    294960
     tgaggcagct cattcttttt ccgggcgcct gctggagaac tgcgttgtac caaagatcat    295020
     tcgcactgac cagctatggg gttacggggc agtgctgcgc gagcttcctg tgctccacac    295080
     tgtcgagcac gtccaggtca tcttgacgac cggctgcaac aacctcgtaa aacagtctta    295140
     tcggcccaca cagcagcagc aacgcactac tctcaacttc aatcgacgac tgactcaaga    295200
     atctatagct ctgcacgtca gactttcgaa tcttcactgc gacacctgca ccaccatctg    295260
     tgccgcaatg acgagaagca cccattcagc agcgcttccg tctggcgtga agctgtcaga    295320
     gcccctgctt acgccgcggt tactcgcatt ccagcagcat tcacgtcaat cgaagaacaa    295380
     ccaggctact cgttttgtca tcatcgccag gccgccccaa gcgggcacgt attctgatgg    295440
     ccgatgtcga actatctagg cgcgcagaag gcacggaaaa ttcttggaca cagcgactgg    295500
     catgccgaca ctgtggaggt tggccggtga tcagagacgt agtgaacgag ctggcgcaaa    295560
     tcctcccgga gcgggtgaaa atcagccccg tcagctttac ggtacgtcat tcccagcgga    295620
     gtcactggac ttcctgggga aaccataacg gaccaattct ccttgagctt gctctacgcg    295680
     aagaaattga agcgcgcggg tggtactgga gtgtagagag cactccgaac aacgagtaca    295740
     gtgccgtcat tcacaagggc gtcaagacat ttagtgccta cgcttgtgca tccacgccga    295800
     ctgaggccct cgcctgcgcc ctgatggcag ccctcaaagc tccctgacca ctccgctctt    295860
     cctggcgagt gccctcgtcg cttcccgttc tcccctccct gctccctttg tccccatggg    295920
     tgaagtgacc cccacacctc attccctccc aggggctctc aatgacgctg cccaggggtg    295980
     tgaccgccac cggttatgct gggaacaccc atgacgctcc tccagcgaag gacacaacgg    296040
     tggtaaccgg aagtcaggcc gcgccctccg agggccgcac gacccttccc atgcgcgtgc    296100
     tggaacgcgg cgtctaccgg ggcccgcacg tccactcgat gcggcccatg gtgcgcatcg    296160
     tccttgacct gggcgcgctt gaggcctggc ccacgacccg cctgccggaa ttcacagacg    296220
     ccctgctgga gcagcttcca acgctcaaat cgcatcctgg ttcgtcgcgg caacccggag    296280
     ggttcatccg ccgcctgcag gagggtacgc ggctcgggca ggtcgcgcag cacatcgccc    296340
     tagaactgca gtcgatcgtc ggcgagcgca cccggcacgg caggaccctg cgtgcgcatg    296400
     ggcaaagcgg cctgtacacc gtgatgtata cgtaccggga cgagcatgtc gggttcctgg    296460
     ccgggttcct cgcgcttcgc ctggtggact ccctgttgcc accgcaattg caaggcctcc    296520
     ggaacctcga gaggttgtac cacgaccccg cagagcccgc gctgaccgct gtaccgttcg    296580
     acctggcggc agccatggcg gcccttgaac ggctcgccca ccgcacgtcc cccgatccgg    296640
     ccacagaagc gattgtgcgc gcggcgcgcc ggcgtgacat tccagtgata cacctcgatg    296700
     acggcgaggt gcagctggga tacgggcacc atgcccggct ggtccagcgc agcagcgcag    296760
     gcgatacgcg gcaccctgcc cctggggctg gcatggatgg gaaggaaccg gacctcagcc    296820
     gctcggccgt ggaccccgtc cgaggcgttc agagacaccc gccggcttct gatggtcagc    296880
     tgcgtggagt cgcgaaggcc gtcctcgagc agctgttccc ctcaggcagc cgcagccgca    296940
     ttccaatcct ggccctcaca ggcacgaacg gcaaaagcac cacggcacgg atggtcgcgc    297000
     atatcctggc gcacgctggc catacagtcg gattcacgaa caccagcggg gtgtatgttg    297060
     ccgacaagcg cattcactca ggcgacgcga ccggaccgaa aagtgcgcgt atggtgctgc    297120
     gtcacccggc agtaacagtc gcagtgctgg aaactgctcg gggaggcctg ctgcgtgaag    297180
     gtctgggttt tgaccgtgcg gacgtggggg cggttctgaa cgtgaagtcc gatcacctgg    297240
     gcctgggggg cgtgaatacc gtgcgggacc ttgcgcgggt gaagtcactt gtcgtgcgtg    297300
     tggtggcttc atccggtttg agtgtcctca atgcggatga tcctctgacg ctcgggatgc    297360
     gccgtgtggc gcgcggtcgc attgctctgt tctctataag tggtctggac ggcaataaag    297420
     cgctgcgtga ccacattgat gctggtggcc tcgccgtcgt gtgcgaaccg caggcggacg    297480
     gagatgtcat cgcggtctat gacgggggcg aacgacagag cctgatgcgc gccgccgata    297540
     tcccggccac cctgggcggc ctggcacgtt tcaacgtcga aaacgccctc gcggcggcgg    297600
     caatgtgcct tggcctggac ctcacgctgg aggtgattcg gtccgcgctc acgaccttca    297660
     cgtcgtcatt cgaacagagc ccaggccgcc tgaacgtgca cgatgcgcac ggctttcgcg    297720
     tgatcctcga ttacgcgcat aacccggacg cactggctgc ccagcgcgcc ctgctgcacc    297780
     ggctgcggtc ccctggaggt cgcctgatcg gcatggtgag cgttccggga gaccggcggg    297840
     acgacgatat ccgcgaggtg ggcgaaatcg cggcaggaac attcgacgag ctggtgttcc    297900
     gggagggtcc ggatggacgt ggccgccccc ggggcgagac gatgagtctg atggccgagg    297960
     gtgcccgttc agcgggtttc gcatctgaac gcatccacct ggtgctggag gaatccgacg    298020
     cagtcgacgc gaccctgaac ctggcgcggc caggagatat tgccgtcatc atgcccaccc    298080
     aggtggacgc cgtgtggcag cagatcgtgc ggtatgtacc gcacgaagcc cggtaagggg    298140
     caggtttggc acctcttggt ccgaatctga aagcgccctt cggcctgcag cccgcctcta    298200
     tgaaaggacg cctgacgctc tgtcggcgtc catgtcggcg tgcccgacgg gcctttttca    298260
     gaaggcgtag cgaactgtgc agtaaggcag ttcacggcgc aataacgtcg taaaacgctc    298320
     gaccgccttg cctttcagac cccttcggta ccgaatattc acgcccccgt attccgaccg    298380
     tttggtttcc tgccactgcg gcgtccagag cagctcctca gccttcgggt gccagccgag    298440
     attcacttcg tggaggccaa cgttgtgtgt caggaagatg acctcggcgg ccaactgtgc    298500
     tttcgcttgc ggcgagagga gagcgtcgat ctgacggaac agctcggtat aggcggccgt    298560
     ccaaccctca aaaatcacca cgggtgaaaa attcaggtga acttcgtacc cggcttccac    298620
     aaagtcgttg atggccgtga ggcgctcagg catgggcgac gtgccgatat ccacgacccg    298680
     ggccatggac gccggcatca gggaaaaccg caggcgcgtt cggccctggg ggtcataggt    298740
     cagcaggttc cggttgacgt acttggtggc gaacgaagcc ttggcgttgg gcagaccccg    298800
     gaacagggtc accaggtcaa gcacattgtc cgaaatcagg gcgtcaacgc tcaagtcgct    298860
     gttctcaccc aggtcataga cccacgagtg gggatcaact gaattcggtt ccagtttcgg    298920
     ccccaggcgc tggacatgtt tacgcagcgc cgcgtccaca tcgccgatgt tggcgaaggt    298980
     ggtgatggga ttggcatacc ccttgtgtct gggaacgtag cagtaggcgc aggacagcgc    299040
     gcacccattt gccatccctg gggctatgaa gtctgcactg cggccgttcg gcctcatggt    299100
     cagagtctta cggatgccca gcacgaggac ctgacgtttg atacgcaacc agtccttgac    299160
     caggccggcg ttcccgtgca gcccaggaat gttctggtgc gacgtgacct cgatgcgctg    299220
     ggcgtcagga aaacggttga gaatgtcctg cccccgggac aactgcgctg cctgggggtc    299280
     aacatagatc aggcgaatgt cgagggggaa ccgtgaaggc atgtctcagt agagagcttg    299340
     cgcgatgaaa cgaacgcgag ttggcagacg aagttgctcc ggccactgag gtggcttcag    299400
     ggttcccctg gggtgggtcc aggagcatct catgcctgcg acttcagaag gatgaaaacc    299460
     cagcgatcct cacgtcagtt gctttgcttg ctcttaaaca acagcggcaa gagaagggca    299520
     gttgatcgcc acgacgggca ttttcgccta cgcaagcagc ttgccgccga catactgact    299580
     gcatgcgccg catcacctgg ctcgccctcc tcaccgtttc tcccctggcg ctggcgcaga    299640
     acgctaaggt gccggacttt ctgcaacgaa ttgattctgt ttccagccgg cccttctgcc    299700
     gtacgtatgg ttgccgtccc ctgaaagtca cggtcggacc ccacgagacc tacccctcag    299760
     tcgtactgac gacctcgcgg tatgaaattc agaaaatttt tgggcaattg accatcatcc    299820
     gcatgaccga cgggtacgtc tacgacatgc agctcacggc gagtgcctat ccactggcgg    299880
     aaacacacgc ccaggcgttc tcggcactga cgaaggactt gctgaacctg tcgctgacca    299940
     aggacgagct caacacgtgc ctgaacaacg cccgtaaaga gaaggacctg gggatgtacc    300000
     tcaccctggt ggaccagtgg gcggtggggt gtgcattgat cccgcaggac ggcgggttca    300060
     agagtgtgct cagcatctgg cctattggat gaagcgaact cctctgagtg gcccggggca    300120
     tccggacgca cccaccggga acatgacccg cttgcctcaa tcgaggatgc gtttcaggtg    300180
     caggtagatc tcgaaccagt cctgcttgtc gcgcgggcgc ttgccacgca gttcgatgcg    300240
     ggccagggtg cgtatccagt cgggcgtgag ctgcgcgccc agagccggat cagcgatgag    300300
     gtccgccaga ccttgcggaa gggctccggc ggtctgatcg ccatagaact cgaccccttc    300360
     aagcagatcg tggacagtaa tgccatacgt gcttgctaag gactggagcg tctccaggct    300420
     ggggttggtg cggccgcgct caaggtcact gagatacggg acactgatct gggcggcacc    300480
     ggcaatgtct ttgaggcgta atcctcgttc ctggcggagt tcacggagtc gctcgcaaag    300540
     tttcatatgt cctcagctta aacccttccc tgcgttttgt tgtgagacgg acttgatgtt    300600
     cgcccggttg agggcaagga gtatcatcgg agagcgtcgg cggccgtcca gcgcatcctg    300660
     gtctcgccca cataacggat tccgaccacc gtcccaaacg cactgcccgc ttcacggtat    300720
     acgggctgcc ccttgcggat ggtggtgcac ccgtacgttt cataggcgcg ggccgaggcg    300780
     gtttcgtccc ctgaagacgc caagcgagag aacgtctcaa atccgaggcg cgtagggcag    300840
     gctgtccagc ccgactcgtc gaccgtgatg acgcttgaag ctgcagaagc ctgcggggcg    300900
     ctgtcttcct ggcctggtac ggaacgcaga aatgctccta gaccgaacgc cagcacgatc    300960
     agaatgatgt acaggagcca gctgcctggt ttcgcattgg cgggtgaagt catagcgttc    301020
     aaagtatggg gcagtgctgc cctcagagcg cttcaggcag gtccttctat cggtcctggg    301080
     ggccccattc tccagaaccc gccagttcag gtctgcggac ggcgggaagg ggtgagtgcg    301140
     cggccaggtc gccagaacgg ttcccgatag cgggcttgac aacctatggg ctcccgttgc    301200
     gcagctcctg cctgagtcct tggattccgt gcggcattcg tgtgtcatcg cacagccata    301260
     ccgcacgaat ccggatctcg gctggggcga gacgcggttc aggtgcggac tgggactgct    301320
     gttccagact gaccacctgc tgcgacggat ggcagatcat tacccgtacc ggcagaaccc    301380
     tatctgcgag gcaccgcaca ggtaaacaca gacagtcgcc tgcgtcctga agaacgtttc    301440
     gcccttacgc tgtacgtatg cgttccttga tcctgccagc cttcgtttcg gctcctgccc    301500
     tgggccaggg tccgtctact ggcacagacc tgtccatcat ccacagcatg ggcggcctgg    301560
     catcatgctg attcttgacg ccaggcagat caggcaacga accacctatg gtcgggtggc    301620
     cgaggccatt gcggaccttc tgcgttccga cagtcccccc gtggcgcccc cccggcaggt    301680
     gattcccttg ccctcaggcg gcgccatgct ggtgatgcct gtcgcggatg agcagtgtgc    301740
     tgtggtcaag acggtcacgg ttcacctgga aaatgcgcgc tccggtcgcc cggcgattca    301800
     gggacaggtt cttgtgctcc atgcccggtc tggaacgtct ctggccctgc tggatgggcc    301860
     agccatcaca gctctgcgca ccgcggccgt cagcctgctt gccgcccgga cgtggggcat    301920
     cccagagggg cctctcctga tgattggggc cggtcaacag gcgcaggctc accttgaagc    301980
     cctgaccgag ggcttgccgc cgcgcgacat ctggtgcagt tcagtccgcc ccgaaagcat    302040
     gaatgctctg gttgcgtggg gtgacgaacg gggactccgg atccggctgg ctgcggatct    302100
     ggggcaggtc gtacgggacg ctgcggttat cgtgacagca acgacgagca agtcaccggt    302160
     gattcccgac gtggtgcgtg atgacgtact ggtcttggct gtcggtgcgt tccgcccgga    302220
     tatgcaggag atcccaccaa gcctggtcga gcggtcaaca atcgtggtag atgaccttgc    302280
     tggtgcgcgg catgaagctg gggatctgct ccaggccagg gtcgattgga acaccgtttt    302340
     gacgcttcgt gagctggtac agagcggggc gcccgctcac ggcccgagac tgtttaagag    302400
     cgtcggacac gctttttggg atctagcagc ggccaaactg tgtctgtccc ccgccgcacg    302460
     gcctctttga agccactcgg acttggctcc agctgagaat cacagctgga gcaagtagat    302520
     gtacggccag ggtctggcat ttgaatcgag aaccgggaaa tgttcgaata ttgatgcacc    302580
     caggaacaga ggtgagctat caaattagac ccacttagag aagctgcgcg caaaccattc    302640
     tcagggaagt gcgttcgtag agctatcaga atttcaaaga caaaatcagc cttggcctct    302700
     aaacagtgaa tattattcac aagccgggca gcaaaattgc tgacgtcatc gtatttttct    302760
     ggagaaacag acagtaaccc ttctgttgac cacaagatca tgacactgga tagaaagaag    302820
     gcccagatca ttcagatcaa gatggtgaat ctgcccagaa tttgagtgag ggatgtgctc    302880
     attgcaggcc agctaaggaa gcacaaagtc tccatacaga agaaataagc ttctgccaca    302940
     ctccgcactt cttctgatgt gtttagccgc cgaacgccaa caggtgtttg cggaaaaata    303000
     tcagcactgt cctgaaactg tcagtggcgt caccggaact gcgcggtgac cttcgctgcg    303060
     ggcagggtga aatggaacgc tgctccttca ccttccgtcg actcgaccca gattcgcccg    303120
     tcctgctctt caatactttt cctgacaatc gccaggccca ggccacttcc cggatacacg    303180
     ctggcagcat gaagtcgatg gaaaacctca aaaatctggt cgaagtaggc gggggcaata    303240
     ccaattccat tgtctttcac cgtgaagtga acgaaggccc tttcttgaat ggccgagaca    303300
     cggacccggg gggcacgacc tgtcggctgg aacttcagcg cgttcccaac gagattctgt    303360
     aggatctgcc gaaacagcgt ctcgtcggct ttcacccagg gaaggtgccc gacgctcacg    303420
     tgcgcgttgc gcgcctgaat ggtcgcgtcc aggtttgcca ggacatcctg catcaccagg    303480
     tgagcattga cgtccgtcac cctccgctgc tgccccaact gggcgtatgc cagcaggtca    303540
     tcaatcaatg cgtccatgcg gttggccgct tcaacggtga aggaaatcat ccgatcggct    303600
     ttctcgtcca actgcccgcc gtaccgccgc tggagaagtt gcagttggga gccgatggtt    303660
     cgcaggggcg ccttgaggtc gtgggatgcc acggccgcaa agcgcgtgag ttcagcattg    303720
     cttcgcttca gatcctgcgt gacccgttct acagcctgct ccgcttcccg ctgcgcggtc    303780
     acgtcatgaa gcgcgacgac tgcacccagc ttctctccac caggtccaaa aatggcactg    303840
     ccgctggcgg tcacatacct tcggggcgct ctctcaggag cgatgactat aggctggtca    303900
     cgcacctgtt cgcccgaaag ggcgcggtat aacggcacct cttccacgga cagcggcgtg    303960
     agaccgtcga gctggtacag gccgaagtgc gcgggccatt cgatggggcg aagcggcgcg    304020
     gcgggcaagc caaaaaaccg cgtagaggcg tcgttgaaca gattcacctg gccgtgagcg    304080
     tcacaggcga cgatgccttc ggccagactt tcaagcagcg cacgcaggaa gcggcgctcc    304140
     tgttccaggt ctcgggtacg gtcccgcacc cgcgtttcga gctccaggtt cagacggtga    304200
     agctccgcct ccgccagctt gcgttccgtg atgtttgaaa tgaccgcaat gatgtactgt    304260
     ggctcgccgg tctcagagcg cacgacggtg acccctgaat tggaccagac tatcgtgccg    304320
     tcaccacgca cgtatcgttt ttcgagagta gtggctgcga cctctccgga aaggacccgt    304380
     cctaacgcag caaacgtgtc gttcagatca tccggatgcg tcacgtcctt tacgctcatg    304440
     ccagcaagct gctcctggga gtaccccagg aaggccgccg cagctggatt cacatcgatg    304500
     aacgttccgt ccagagaaat ccgggttacg ccggcaatgg tgtattcgac cagggcacgg    304560
     taacgttcct cacgctcacg aagctgcatc tccgcttcat gtcgttcagt gacgtcctcg    304620
     tgcgtgccga tccattcgac cagttgaccg ttatcgctga gcacaggggt ggcgcgcgcc    304680
     tgcatgaaac ggtactggcc atcgtgacgg cgcaggcggt gctgcacctc gtacaggcac    304740
     tgggtctcta ccgcccgcat ccacgcttgc aggacgtcct tacggtcgtc tgggtgaatg    304800
     gcatccagcc agccccgacc gagctgctgc tccgcgtttt gcccggtaaa gcggctccag    304860
     gatggctgct cgcctgggaa ctcgccgtgt ggagtacagc tccagacgat ctgggcgctg    304920
     gcttgaacga gcgactggaa gcgccgctca ttcatccggg catcctgttt cagctgtgta    304980
     ttgtcgaggg cgctggcggc ctgtgccgca atgatggtag cgagccgctc tgatcgtccg    305040
     ttgaagatgc ctggtcgttc atgactgaaa aagaaccggc caatgacttc accggagcgg    305100
     gaaatggcgg gaatggcaag aaaactgcgc actgccaggg acccctgagg catcgcctca    305160
     cacgcggggg cacgaccgaa ccgtgcgtcc tgggtgatgt cgtcggcgcg caaaatgccc    305220
     cggtcgtcga cctttggtgc gaacgccgag gccatgtggt gcaaaggaga gttgacaaaa    305280
     gtatctttcg gaacgcccga cagggagtac tggggaagct gttcgccccg ctgatccttg    305340
     agggtgtaga tgaatacgcc gcactgagcg caggtcagcc tgacagctgc gtccgtcacg    305400
     gtctgagcaa gcccttcctc gtcgagctgc gcagaaatgg cctcgtttat ctgatcgagt    305460
     gccgtcagca gctcatggtg ctcaacgtca tccgtctgga gcggcgtgag ggtgacaagc    305520
     cattggtcat cgaaaccggt gaggtaggaa aactgagcct gcgcgaggac gcagtcgttc    305580
     ccctgttcaa ggggcagctg aagctcaagt gcgaaggggg cccgtgtgtc ctgcgcgtga    305640
     cgccatgcgt gtgcacctgc gtcctgctgg tgtgccccaa ggaactccgt gaagtgctgg    305700
     cggagtacgg gcatctctgg tagacgaagt tgcacttgat aggccttatt ggcaaaaatg    305760
     attgttccct ggccatctag gatccaggta ggggacggga gagcatcgag gagtgtgccc    305820
     tgcagcggct cgaatccaga gcgattcgag gaagggatca acatgcaggc actattccag    305880
     actttatgtc cggaatgaag acaccatcca ttagataagg agtcgttatt gcatacctac    305940
     cgattcttaa acctcctatc tattctgcgc gctacagagg gtggatcagc tgctggcagg    306000
     cgcagtgcac tgcagcgaag cggtcatcac agatgacggt ttccctagtg gctgagcact    306060
     tcctcaggat ggcgagtcgg gtctgtccaa ccaggccgga cagcgggatc attcgccacg    306120
     aaaaggttgc cggctttggc caacccctca aagcgctgca ggttccttag gctgtcttcg    306180
     ggcaaccgga gtgctgtggc gtcaatcaac agactggcaa gcatcatcat ggaagctggg    306240
     accgctgtgg tcggggtgtt gctgacgggg accaccaggg tctcggtgac gccctccgta    306300
     aagatcagtc ccgagggatc ggtgacgagg atgacctgta cgtcgcgctg ctgcagaaga    306360
     ccgagcatcc gggccaggtc ccctgtcatt cgcgggacgc tgaacagcag cgcacaatcg    306420
     ccagcactgt agtgaacagc ctgcgtgaac agtgaagcgt taaattctgt cgcgcactgg    306480
     acctggggac gcaggcgcga gaggtacaga tgcgtatgga ctgccaggga agtactggct    306540
     gcgcatccag ccaccagaac acttctggat tgggtcagca gttcaacact cctgtgaaat    306600
     gccttggttt caaccaacga ttgcaggctg cgcaggtgga gaatctcctg gttgataagg    306660
     ctggcaagac cgccgttccc ttcgctgtgc cggaaccgct ccagcgggat gttcatgtgc    306720
     aactcgtcaa gcaccattct gccgagtgca tcggtgaagg cggcataaga ggagaaaccc    306780
     agccgcgacg caaaccgcgt cacagtggac tgactggtgc ctgccgcctg cgccagggca    306840
     gtcgtcgtca gcatagggag ctcagcggcg tgttgaagga tgtaaagagc gagccgcctc    306900
     tgggcgccag aaaattctgg cagctcggac tgaagaaatt ggcgaaaacc gttcagattt    306960
     atgaagcctg gtcttgacgt tgacatcgat tgactcctga cgcattctat tcatgttcag    307020
     ccaacttgaa tcgtttcatc catcgccgca ccgagagaag ggggatacct tgctccagtt    307080
     ctaccgtgga tagccgcatg cttgagattt ctgagactcg ttatggaagc aggggaacag    307140
     tgcatcacgc tcacgcccgg cccgctctac ttccttcatg cgtcaccacc gatggtccgg    307200
     tccaccccgg gaccttcctg cggtgaagca gagttccgtt cgcctgaacg ggtgaggggt    307260
     tagccgtgat caagctcaat accttttcga tcaccgcacg atgtgagcac accggacagc    307320
     ttggcgtggc ggtctcgacg gccatcccct gtgtaggaat gctctgcccg ttcgtgcaat    307380
     ccggcgttgg tgccatcgct acgcaatctt tcgtaaatcc gtacctcggc atctgggggc    307440
     tggagaacct ggcgcaaggt cactccgcgg aggccacgct gaaaaagctc agtgaccgtg    307500
     acgacggctt tgatctgcgc cagatcgcca ttgtcgatgc caacggcgag tcagcagcct    307560
     tttccgggaa tcagtgtgac ggctggtatg ggcacctgac cggacgaaac tatgccgtcg    307620
     ccggcaacat gctcactggc ccagagacgc ttgaagccat gcaggcctcg ttttgccagg    307680
     acatggcgtt gccgcttgct gaacgcctgg ttcacgcgct ggctgcgggc caacgggccg    307740
     gcggagataa gcgtgggaag cagtcggcag cgctgagagt gttcagtacc gaacagtatc    307800
     cacttgtgga cctgcgtgta gatgaccacc ctgaccctgt gtctgaactg gaccggatct    307860
     accgggtcgt ggagcgtcag ctgctgcctt tgatggacct gcttcccagc cgcgcttatc    307920
     cagccgggcg gctcgacctg gacgaagcgc gcaggcgcaa tctggtacag gcatcaacgg    307980
     ctccaccact gagccctacc aacaccacct gaaagccggg tgattgtgcc ggcctggtcc    308040
     ggttttcagc ttcacccgac atcattcctg gcgcagtccg ttcaagcttt tccttcatcc    308100
     acccagcgat tcctacagag tgacaaggag tgttatgcgc cataaccgta tgatcggatt    308160
     tgctctcacc atcctgctca gcggtctcag tgtcagcgac gcgcagaccc ggggcggaac    308220
     cctccgcgtc ggtgggcagg cagatattgt cggcctggac cctcacacgg tgtctgcagc    308280
     ctcttccgcc tgggtggccg agcagatcta tgactcgttg cttaccgtga cgcccaccgg    308340
     cgagcccgcc ccgtccatcg cgcagaagtg gactgtgtcg tccgacgggc ggacctatac    308400
     cttcaacctg cgccctaacg tgaaattttc cgatggtaag gcgctgacct ccaaggacgt    308460
     ggtgtactcg ctgaagcgca tcactgaccc caagactgcc tctccacgcc agaacgatct    308520
     tggaaaaatt gcctccatta ctgcaccgaa cgccacgacg gttgtcatca agctcaaaga    308580
     gccctttgct ccgttcctga cgaaggtcgg tggctcgctg atgggcatca tgcccagcgg    308640
     ctatgccgag gccaatgacg tcaacaaaaa gccgatgggc tcaggaccgt tcaagtacgc    308700
     cgcctgggtg ccgggagaca gcgtcaccct ggagcgcaac ccccactatt gggaggctgg    308760
     caaaccgtat ctggacaagg tcatcttcaa agctctcaag gatgacgtta cccggatcac    308820
     caacgtgcag accggcactg tggacctcgc gctcagcgtg ccgcagaacc aggtcgatac    308880
     cctcaagaag tcctcgagca tcaagctcgt cggaggtgcc ggcacctggt acgactatct    308940
     gggcctgaat ctcaccaaga aaccgtttgg caccctcaag gtgcgccagg ccatctcgct    309000
     ggccttgaac cgtgacgtta ttgtccggac cgctctgttc ggcaagggca cgccaataaa    309060
     ctgcggaccg attccgccgt cgcactgggc gtatgccgac tgcaaggtcc aggtggccaa    309120
     ccaggcgcgg gcaaagcagt tgctcagcga ggcaggcttt gcgaatggtt ttgatatgac    309180
     catcaaggtg ggggccgact acaagtcgca ggtcaatatc gctcaatcca ttcaggcgca    309240
     actcaaacct ctcaagatca acgtcaaggt catgccgatg gagtggggct cgttcctgaa    309300
     cgatttcaat aagaaaaatt tcgacgcggt ggtgctcggc tggatcggct cggtggaccc    309360
     cgacgattac ctgtactacc agttccgctc cggcgagaag tttaacgctc agggcttctc    309420
     agacaagacc gtcgaccagc tgcttgacca gggccggcgc accgttgata aggccaagcg    309480
     gcgggaaatc taccgtaagg cgcagcagcg cattgcagag caggttggct acgtcttcct    309540
     gcacatcaac gaccagtacg aagcgttccg gccgaatgtc cagggctacg tgcactactc    309600
     gaccggctcg ctcgaatccc tgaaagacac cttcctcaag aagtaacctg gcttcccgcg    309660
     tgctcgtctt tgccttcaaa cgtctggtgt ccgtgattcc catcttgctg ggaatcacgg    309720
     tcatcgctta cttcctgacc cgcaccattc ctggtgatgt cgttgcagtg atgctgggca    309780
     ccaacgccga ccctgaggtc gcggctcagt tgaggcggaa cctgcgtctg gaccagccaa    309840
     tcatcgtcgg gtacttcgac tggctggctg ccctgttgcg cggggacctg ggggaatcta    309900
     tccgttccgg cctgcccatc ggtcaggacc tgatgacccg gttcggccgc accgcgcagc    309960
     tcaccctggc tgccattgtt ctggccactg cactgagtat tccgcttggc atcctggctg    310020
     ccgtccggcg caaccgggct gcggaccagg tcatcagcat caccgccctg ctcggcatct    310080
     ccgtgcctga cttctggttg ggtacgctgc tgattttgtt tttcgcactc aaacttggct    310140
     ggctgccacc agccgggtac gcctcaccgt cggaagatcc ggcgctgttt ctcaaattgc    310200
     tgattcttcc aaccatcacg cttgcgtttc aggtcatggg tatcctgact cgcttcaccc    310260
     gcggcgccat gctggaagta ctcaaccagg atttcgtccg cacggcgcgc gccaaagggg    310320
     ttgccgaacg ggccgtactc taccgccacg ccctgcgcaa cgccctgatt cctgtgatta    310380
     ccgtgattgg cctgaacatc ggcttcctgc tcagcgggac cattctcgta gagacgatct    310440
     ttggctggcc gggcgtcggc agtctcgcag tgacggcgat caaccagcgc gactatccgg    310500
     tggtccaggc ctgcgtcatg ctgttcgcgc tgaccttcac ggtcgtcaat cttgttgtgg    310560
     acctgcttta cggcgtgatc gacgcaagga ttcgctattc atgaccccca tcaatgccac    310620
     ccctgctgca cccccccgtc tttccgaccg gcggcgtttc ctccgcaagt atctgcagaa    310680
     ccggtcactg atggtaggca ccgtgatttt gctgattatg gctctgtgcg cgctgctggc    310740
     cccctggctc gccccatatg atccggccga acagtacacc gactacgcgc tgcaggggcc    310800
     atcgccccag tttccgctgg gtaccgatat gttcggccgc gatcaactga gccggatcat    310860
     ctatggcacg cgcctgtcgt tcgtggtgag cagcgtctcg gtgggcattg cgctggttct    310920
     cggaacgttg ctgggactga ttgccgtcac cgcgcggggc tgggtcgaca acgtcatcat    310980
     gcgcgtgatg gacgtcctgt ttgccttccc gtttctgctg ctggtcatcg ccatcatggc    311040
     ggcgttcgga accagcctga ccaacgccat gatcgccatc ggcatcgtgt atacgccctc    311100
     gttcgcccgg gtcacgcgcg cagcagccct gaacgtcatg gagcagctgt atatcgaagc    311160
     cagccacagc ttgggggcca gccggtcgcg gctgattttc cggcacatcc tgcccaacat    311220
     ccagggacca ctcatcattc agaccacgct ttcgctggca ttcgccatcc tggcggaagc    311280
     ggcgctgtcc tttctcggtc tgggtgctca gcccccggcg ccgtcctggg gcctgatgct    311340
     gaacgaggga agggatttct tcaatatggc ggactggctg gcgatcttcc ctggcctggc    311400
     catcaccgtg gcggtgctgg gctttaatct gcttggtgac ggcctgcgtg atcttcttga    311460
     cccccggtcc cacagagaaa actgatcttg ctcatggcct gaatgcacag atcgccgtgt    311520
     ccggacatgc ctgacgtttc aagttctggg tggactcagc agctgggact tcgcagccca    311580
     cgttatccag gacacggttc atgaggtaga gcagcacaac cgtctgaaac gaaccgagca    311640
     tctactctgc tgcatgctgc cgggctgtcc accagtcagc ccggctgctc cattgtcggt    311700
     tgtctgacat accagtcttg ctggcctggg gacaaattca ctgtgtcggt ggacgtcatg    311760
     gtcgacagca aaatgaacct gtttttccct acagccccgc ccacctgggg aagaagcaga    311820
     ctagtcgatt cctttgtcct ccgcacctct tgaataagaa tagtcatgtg ttagacttct    311880
     gaataactca attcaaagtc ggcaatagtg gttgtctgca tagaacactg cactctctat    311940
     agcggtgcag tgaaaggcta cctgcagagc catgagccat tgcgcccgcc gtgtcagctc    312000
     agaccgataa ggactaaaca tgaccaccgt aaaagaagcc cagtccgcgc tagatgccca    312060
     ggttattgcc tggcgccgtc acctgcacca acatcccgaa ctgtcttttc aggaacacga    312120
     gacagccaac tatgtggaag cacaattacg gaagatgaag ggattgagta tcacccgtcc    312180
     aaccccaacg agtgtgttgg ccgtgctgcg cggccagggt ggaacaggcc gcaccgtgct    312240
     gctccgggcc gatatggacg cgcttcctat tcaggaaaac actgactttg actttgcttc    312300
     gcggaacgat ggcgtgatgc acgcctgcgg gcacgacggc cacaccgcga tgctcctggg    312360
     cgccgcgcag gtgctttcag aacagcaaga gcagctgcgc ggggaaatcc gcttcatctt    312420
     tcagcacgca gaagaactgt tccccggtgg cgggcagcag gtggtagacg caggcgtcat    312480
     ggatggggtc gatgtcgcgg taggcaccca cctgttctcc ccgattcctg tcgggctcgt    312540
     ggccttaaag tcaggaccgc tgatggctgc tccagacacc ttcgaagtga ccgtcgttgg    312600
     aaaaggtggc catggtgcca tgccgcaaga aaccattgat cccatcgtga tcgcatgtca    312660
     cgttgtgacg gccatgcaat ccattgtttc acgccagcgt gatccgctgg aacccgctgt    312720
     cgtcagcgtg acgaccattc atgcagggac tgcccacaac gtcattccga acacagctgt    312780
     ccttacagga acggtcagaa cgttcgaccc ggccctgaga gagcagatcc cacagctgat    312840
     ggagcgactt gtgcgaggaa tcacggaagc gtttggcgct acatacgaat tcaggtatga    312900
     gcaggggtac cgcgcaacca tcaacgaccc cgcagtgacc gaggttctcc gggaagtggt    312960
     tcaggaaacg gtaggagcac aagccctggt tgaagcacaa ccgacgatgg gaggagaaga    313020
     cttcagcgct tacctcagcc gtgcgcccgg cgcattcatc tttatcggtg cccggaatga    313080
     agaagcaggc attaccgctc cgcatcacca tcctaatttc gcgattgacg aagacgccct    313140
     tgccatcgga gtgaaggtgc ttgtcggagc agcccggcgt ctgtctgccg gtgcctgaca    313200
     gggatgacca tcttgtgcac caactcagga tggtcatccc tgccgggagt cgcagtgagt    313260
     cacgctcaag ctgtggctgc ctccacttcg gtaactgttg gtgcggcgca cttgcgctat    313320
     tctgagtggg ccgcttaatt atgcagtcgg attcagacct ggattacgcc acaccagtgc    313380
     ctgggtggta aaccctcgtc acaatcgcac gaagaggaat ctcacgtcgg tgtccgcctc    313440
     cagattcggc ttcctctcat gcacttttat ccaatcctgt gttcgtgtcc gtcctgacta    313500
     cgttgcaccc taatccctct tccatctgga gaccactatg atcaagaagc tgttatgcac    313560
     tggattgacc ctcgccctga tctccggcac cgccagcgcc agcaccctgg tctttggcgc    313620
     tggcggcgag cctgtctctc tcgattccgg gaccatcacc gacggtaact cttcactggc    313680
     gcaggccctt gtgtacgaca tgctggtccg gttcaagaaa gggacaacaa ccatcacgcc    313740
     gggactggcg accagctgga aggccaacaa ggacgccagc gagtggacct tcaccttgcg    313800
     cccaaacgtg aagttctccg acggcacgcc ctttaatgcg aatgccgtgg tgttcaacgt    313860
     gaaccgctgg tgggatcagg cggcagacgc tggcgcgaag gaacacagca agaccttcac    313920
     ctcatggacg tttatctttg ggggcttcaa gggcgagcag aacagcctgt tgaagagtgt    313980
     gcgtgctgac gggccgaaca aagtcgtctt tacgttgaac cgctcctttg cacccttccc    314040
     cgaagccctc gccaccccct tcttcggaat cgccagcccg gacgccgtca agaaggctgg    314100
     ggcccggtat ggcactcctg ccgccctgcc cgtgggcacc gggccgttca tcatgcagtc    314160
     gtggaagaca ggcgaccgca tcacactggt gcccaacaag ggacactggg gcaagaaagc    314220
     cagctacgac cagcttctcc tgcgcttcct gaaggaccca agcgtccgac tgaacgagct    314280
     caaagccgga accatcgact tcaccaccga tctcaaccct gatcagctca acgtcgtgaa    314340
     ggccgacaag aacctcaacc cggtcatcat tcccggcttc aacgtgggtt tcctcagcct    314400
     gaacctcggg aaccagcacc tgaaaaatga caaggtacgg caggccatca gcatggcgat    314460
     caacaagaaa gccatcgtgg aagccttctg gggtgacctg ggagtttcgg acgccagctt    314520
     tctgccgcct gcgcttggtt gggccaacag caagaaggta ccggccgact acaaattcga    314580
     tccggccgct gccaagaagc tgctggccga agccggttac ccgaacggct tctcgatcga    314640
     cctgtggtac atgcccgtca gccgcccgta cttcccgaca ccgaaaccga ttgccgaagc    314700
     gatggccgca gacctgggag ccatcggcat caaggcgact ctgaagaccg aggactgggc    314760
     caagtacctg gaagaccgca acaagaaacc tggcttcgac atgtacatga tcggctggac    314820
     gggaccctat gccagcccgt acaacttcta caacgtctat tacggcgagg aagcttcggc    314880
     agacagcaac tacggtaacc ccaaactttt ccaactgttg aggaccgctg tcgccaccag    314940
     cagccgctct gcacaggcca aagcgtactc tcagattcac gaaatctcct atgatgccaa    315000
     cgtccgcatt ccgatcgtcc actcccgtcc gctcgctgca gcgcgcacgt acgtcaaagg    315060
     ctgggtcccc agcccgtcgg tcatcacgcc gtttgaagac atcaccatca gcggaaaaaa    315120
     gtaaggcgcg actgaccaaa ggactgttac cggcaacgta gaagacgctc acctccggga    315180
     agggctgcgc tcccaagttc ttaacctcag cctcgtacca tttaccatca gaacgatctg    315240
     catgatctgc gtcgtcaacc aggcgacatc gtgaccgtca gcgatctgct cgttggcggc    315300
     acgatcattc ccggatgaag tgggcagtgc tgggctgttt caactgctct tctggatccg    315360
     caaccaagcc atgaaccgtc acatagccct cccgctggta agcaggaggg ctatgtgacg    315420
     gttcaataga gcacctgaac gttcgtgcct ccctgcgatc tgaacgcggc ccacagctac    315480
     gggcggctct ggtacaagtt gcagcatggg tggccgtgac ccctgagtca cctgcgttcc    315540
     tgatacgcaa ctgtctgctt gaactttatc caggtcatca caagtcagct ccgggccagc    315600
     acctgccggg gcagctgagc ggcagaaggt ctggtgcagc tactcctgat ggtcacctgg    315660
     gtcatggagg gggtaagcca tgctcgtcat gagagcctgc gcgccggcac tggtgtcctg    315720
     ccggacaaac tgcaccacga caggtacttc cgattcaacc aggcaggcgt attccacatc    315780
     cagggggatg gcgcgggggt cgatcaggtc attcacacgt acatgccgga cacgtcggct    315840
     ggccacgcac agcagataag gtccttccgg atcgcggtcg gcatagaaga tactcagctt    315900
     gagttgcgcg tcctggtcac cagtattcag gatgcacaac tggtcataac tggtgtatcg    315960
     cggctcctcg cctgtgctcc tcaagggtat gtgtccggcc ggcacgcacc agatcctgtg    316020
     accataggac ttcatgcccg ctcctcagga gctgcctttg ggcttatctc gtgcagaggc    316080
     acctcgtgga cacggacggc gccttcactg ctctcctgct ctcccaacaa ggcacgcagg    316140
     tagtcattca gaaacatgcc ctgcgggtcc atcctgcccc gcaggagctg aaagtcatcc    316200
     cagtggggat agaggtctcg cagttgggtg ccgcccagcg tatgcttctt cccccagtgc    316260
     gggcgccctc cgtaagcgcg gaagatcgac tcgatgtcct tgaaaaaagg ccagtaggcg    316320
     agtccagcat tctgatgcag ggagatggtc acggaggcac gtcctgaggc gttcccgagc    316380
     caggaatcgt cttgctcgac ggtgcggtac agcacccgcc agccaacatg ctgccgatga    316440
     cgctccagaa ttcggtcccg gacctccagg aaacaagcag ggccagcttc cagaggcacg    316500
     gcgtactcca tctcgtcaaa cttcagggtc cggttgcggg gaagcgcctg ccagcttggc    316560
     gaggtttcct ctttcaccag gcgagcatac ggcagcgctc cttgttcctt tccaggctcg    316620
     ttgagcagcc gcagtttgac ggcgtcactg cggggatacc agtagaaatc gaagttgcgg    316680
     ttatgttcga tcagttcatc cagatgttcc aggcacaggg cagtggttgt gcagaactcc    316740
     tgccgatgca ggtcataggt gggaagaacg cgaagcttga gctgagtgaa gatcccgagc    316800
     gtgcccaggg agacgcgggc cgcacgcagt tggtcgggat gttcgttttc attccattcc    316860
     tgcacttccc cggacgcggt aacgaaacgc acctggatca gagcactcga caggtcgcgc    316920
     aggcgccgtc ccgttccctt ggtgccggtc ccgaacgctc cagcaatgta ctgggtggct    316980
     acgtctccat agttgtgcag ggccaatccc gcctggtaaa gcgcttcccc gacctcacgc    317040
     aaaggcgttc cagcccagac ggtagctgtt tgctcgtcgc cgttgtggtc gatgaggcca    317100
     cgcagatact ccagagagat aagttgctgt ttcgtctgca ttaaagggac ggacgagtga    317160
     ccgtgtccgc acaccctgac ggttgcgcca gccgctgcgc tgctgcgtac cagggatgcc    317220
     agttcctcct ccgagcgggg ccgcgccagt tcatccgcag taaaacggag gctaccggac    317280
     cagttgagaa atgtgaaggg agggcaatcc ggatgcaaat gggacatggc ttctccctgt    317340
     cacgaccctt ctggcccctc gctgtgtccc agcaggacag caaggggccg ggtcgaagaa    317400
     aactcggaca gcagaagtgc gatgccagcc gtaagaggga cggcaataat cgccccaccg    317460
     acgccccaca gccagcccca gaacaccacc gaaaacgcca cgactgtagg tgaaagcttc    317520
     aacctgtcgc cctgccactt cggattcagg aggcttccga cgcccagctg aacgaccgtc    317580
     aaccccagaa ggaccagtgc gccctgcgct gcgccaccga acgcaaaggc aaacaataca    317640
     ggaggcacca cagacaacag cgagccgatg gtgggaaaga attccagaac gaacgtcagt    317700
     actgcccaga cgaaaggaaa aggcaacccc accagggcgc atattcccca ggtcaggacg    317760
     gcagtgatga ggcccgtgac cgtctggacc cacataaact gttcgaactg ccgccccatg    317820
     cgcccaaagg cgtctgtgag ccgtcgaccg cgctcagcgc caaacgcctg gaccaaccgc    317880
     cgacgccagg cgtccgcttc tgccagcagg aggacgagaa acaccagcag cagtccagtc    317940
     aagccgagtg gtgacaggac ggctcgaagg ccgccaaaca ctactcccat cacgttcgat    318000
     ccggacggac tgccagacga caggctgtcc gggagccgga tgccatatcc tttcaaacgc    318060
     tcggcgtatc tgggcaggtc ctgagcgact acatttacag cgtagaccac gctacccaga    318120
     atcagagcaa gaaacgccag aaacagcagg ataatgaggg ccacgctgag ccaccggggc    318180
     agacgttgct caagtcggcg ctgaagaggc cggaagaaca gcgcgatcac agcaccgaac    318240
     accagaggca gcgtagcgtc ctgggtaaca tgaagaccac ccaaggtcag caggacggca    318300
     atagtgacga ttgcaaccgt cgagaccgaa cccatcagca tgactgatgc cgcccctggt    318360
     agacagaaag agtgcctcgc attgatcgca gttcaccata ggactcccaa aaacccattc    318420
     tgaaagcctt gagcaatccg caccagcccg caggaccctg agcctgcttt caaggtgtga    318480
     gccgtcaatc tgtcggaagt gccttccgcg ggtggactgt tcagaagggg tcaacagaga    318540
     tgcaggcacc gccaggtatt caccgatctg ctgcaactgg tctgtggcca caggagttat    318600
     cccaggatga ttcattcgat ctgacttccc acggcattca ggaatgtccg aaccttggga    318660
     ccactcctgc gacattgacg accggcacgg tgtcgcgtgc cctggagaac ggttgcacag    318720
     ggacctaacc ggcagtggcg acctggtaca tgtagtacgc cgcaaaagct gcgaaaaata    318780
     cggccgccaa tgcagtcgca gccaacgcca atcctgatgg ctgaagctcc tgcgggaggg    318840
     cgcggcggtt caggagcagc gtaaggagcg ccacgacagg aatgtgcgcg gcctcgatgg    318900
     ctcctgcgag ctggagcagg gcgaccggct ctccgaacaa caggtaggca ccgataggca    318960
     gggccaccag cagccccacg accacaccgc gccgcatcca tgtacggttg acctcgctgg    319020
     cacgtacgcc gaaaccggtc agcagcgtcc gtacgccacc gctgaacatc cgcgcaaatc    319080
     cgtcctgggc cgacaggatg gtgctactga acgtcaccac tactgccgtt accataaacc    319140
     agaagcccgc cggcccccag acgtctccaa gcagccgtcc cagggtgcgt gccacttcgc    319200
     tctcgtcggg aaccaggcct tcgggacgca acaattccgt tcccagtatc aggaatgcca    319260
     cggcgataat cagggcgccc acaactgcga gcgtattgga cagtgtcagg aatgcaagcc    319320
     agccccgcag ccgactgcgc tccgtgtcag acaggctgtg cgggtctact tcctctgcgg    319380
     cgtacgctgc gccgtagccc cgcgcctgca cccagtaaga gaaccacacc agccctgcgg    319440
     ctcccgccag catgaagccg agccacggca cgacttctgc aaagtccacc cctgcaggaa    319500
     gctgcggcgc caggccacca gcgagtgctc caaggtccgg tgtcacactg atggccgtga    319560
     cgagcaccgc cagagtgatg agcacggcga gccaggtgat cacccgctct acgagcttgt    319620
     actgccccaa cacaatgacg gttcctgcca gaagaacgat cccgatggac caggccgccg    319680
     caccaccaga cgtaaacagc gcgcccgccg tgcctgcggt tcccgcgagc cctgcgacag    319740
     tcgcaacggc cacgacgatc tgcggcacca ggatgaacca cagcgcccaa tgtctggggc    319800
     ccggcaggtt cgcgaagccc cgtagaacat tgccacctgt gcacacggca tatcgcccca    319860
     cctcgcggtt gataaaccac ttgaaggcga cggcaatcag cagcgcccac aacagggtgt    319920
     acccgtactg ggctgcgatg cgtggggtaa acaacagttc tccggatcca gctgcagaca    319980
     tcatccacaa aaagctcggg ccaagccatt tcaggcgttc gcggccctgg ggcgcttccg    320040
     gcacgcggga gtgctcgctg tcaggctgac cgtgagcgcg gtcattcatg acgcgacctt    320100
     tcgtgaccgg aacagataaa gcggtacttt acccgggctg gtctgcccgc agggcgctca    320160
     tgccctggca atgaaggccg aataaacctg aaggtgaggt tgcacggcca tggctcaaac    320220
     cgccaatcgt cctgacgtaa gacatccagg acatgatcac cgtctttcgg caaaaagatt    320280
     ctcagcaggg caggcattct tgccaggact ccctgcgcca ctgaagctgt ccgcctgttc    320340
     ggtccaaatt ctggaggcca ggaaatatcc agagcacgag tggggctgat catagtcgcc    320400
     tctattgccg gaaaaggaca gggtgattgg acagtgtgac agcttggcgc acgacacagg    320460
     agcgatcagt caagcctgaa agctcctgat ctgcgccagg tatagcggaa atacagcacc    320520
     caggctttta ttccttctct actcctgtcc cacctgattt atggtttatc taaagttcgg    320580
     ttgaagtgct atctaccttc catgcaacgc tgatgcctac ggtaggcgca ggggatcacg    320640
     ggaacccaat atttccggtt tacgtgaggt caggcgctcc agtgcattga tcaaccctgg    320700
     tcgagctatc ggcctccatc ctgcacaacc tgggcgagta ggatcaaaga actctgctgt    320760
     actcttccga ggtttcagcc gccatccgga ccgtactcga cctgaaatca tcggcgacct    320820
     gatcacactg cacgcccccg ggccggtgcc cgctacgcca gaaggagagc gcatgacaga    320880
     tcccacgatc ggctttcacg cctcgcacga gcagttcacg ccagccgaac tgctgcggct    320940
     ggtccgcttc gctgagcagg ccggttttgg ggcagggatg tgttccgacc actttcaccc    321000
     ttggaccccg gcgcaaggac agtctggatt tgcctgggcc tggatgggcg ccgctctgca    321060
     ggcgacatcg tggagttttg gagccgtcag tgcaccgggc cagcgctacc acccggctat    321120
     cctggctcag gctgccgcaa ctctggcgca gatgtttcct gaccggttgt ggtgcgccct    321180
     ggggtccgga cagcacctca acgagcacat tacggggcag cgctggccga ccaagaccga    321240
     gcgtaatgaa cggctgctgg aatgcgtaca gattatgcgg gcactctggc gcggtgagac    321300
     cgtgacgcac cggggccacg tggttgttga ggaggcgaag ttatacaccc ttcccgctcg    321360
     cccaccgctg atcgttggtg ccgccctgac accggagacg gcgcgttggg tcgggtcgtg    321420
     ggcggacgcc atgattacgg tatccgcccc ccatgacgaa ctgcgccaga tggtggaggc    321480
     cttccgtgcg gggggtggag acggcaagcc gatgtacctg caggtccatc ttgcctatgc    321540
     acccacctct gaagaggccc tggcggctgc gcatcaacag tggcgcgcaa acgtgtttgg    321600
     cagcccgatc cagtcggagg tcaaaacccc ggagcagtac gaaacgctgg gcagccgtgt    321660
     tcgtccggat gacatgcacg gcgtcgttcg gatttcgtcg gacgttgagc agcacctgac    321720
     ctggctccgg caggacctgg acctgggctt tgaccacctg tatctacatg aaactggccc    321780
     ccatcaggaa cgctttatcg aggtgttcgg tcagcaggtg ctgcctcgcc tgagaggcgg    321840
     cttgacagcg ttcccagcac gccgctctgg tcagagctga gcagtgacgg tgcagcccaa    321900
     agctggtgcc aggacgaagc tcttcaccca tacccagcga tcggggatag agaaagcggg    321960
     aatttatttc acctccgctg ggcgaaaggc attccacagc atctcaaggt gtccggtctg    322020
     gatgtcgaac tgactccctg gccgcagcag ccagttgacc gacagcgcat tgacctgaaa    322080
     accactgaaa tgtcacggcc aggcaagcaa aaccttacgg aacagcgatg gtgacgcgtg    322140
     acgcgtcgcc acgacgagcc ccctccacgc cagatttgtg gccgcaccgg cacatgtggc    322200
     tgtcggcgca gcgtactgcc ggagcttgca cgttcctggc aaggaggtct gggtgattgg    322260
     ggaggggcct gcgacgggag aactcacata ctactcggcg aaccttccag catttacgtc    322320
     cttgaagcgg ctggaaaagg taatcacgcg gcatacgggt ctgtgagaaa tcaatcggaa    322380
     acccaaaact tcgccggtgc ataaggggct tctatgccag aaatgcaacg cgcagcactt    322440
     ccccatcctg gacgacacac tggcaacggc accacttcta ccgcaactcc taaaggcgga    322500
     cgatggcctc gaggtacacc ccctctatca agaagattac agtgggagcc cccgaaatta    322560
     tgcgcaggag aaaaccacga tctggttcgt ttgctcgcaa tcctccattc gcgcatggcg    322620
     gtcactttcc tctttagtcc tgcctctcct gagcgaacga ccccgttctg tagagggact    322680
     cctctactgt ccaggcagtg ggcacgacca gctcgccagg atctgtcccc gccagggcgg    322740
     caaactggat tcggtcctca gtgatctggt agatgttcag ccagggcgta ggggcggtag    322800
     gcccgttaat ctggtcgacc actgccacat ccacaaagtg ctgtccatca aaaagacgca    322860
     ggcccccggc gacgagttga tcgacgaact gctgcgtgtc ctggggggtc atgaatccaa    322920
     ctcgaatgag gtgagcatcc gcgcaggacg acgcgttggg cagaagggca tgaaaggcgt    322980
     caaggcctcc ttgaaaatgg ctttcaattg agctgagtcg cgtgatgact gtaattgctt    323040
     cgacaaggac ggccatgggt ctatgatgcc tgttgcgcac ggcgacggct cacttcgggg    323100
     tccgaacggc gtcgcgggtc agctcgttgg gggactgatt ccatgctcga tcgcccagcg    323160
     ggcaagttcg acgcggttac gcagctcaag cttttccaac acgtgtccaa catgcttgct    323220
     gacagtcccc atactgatgc ccagcacctg cgccactcgc ttgtctgaca ttccagccgc    323280
     cacaagcgcc acgacatccc tctctctgga cgtcaggcct ccctgcgccg ggggagttgc    323340
     tggcgaattc ctctccagcg ggaggtttaa ccagcggtca atctccgtac gaagctcggg    323400
     caaggggagc tgagacccgg cctgccactc ccgctcgaag actccttcgc cgagtgcggc    323460
     gcgcagaagt tgctcctctg caacgaacct cgctttgttc tccggcgatg ggggaaactg    323520
     cgttgttgcc agcacagcgt cccgcgcgcc cgtcaggcga gcagcaaaga ggggctgccc    323580
     aaacacccgc gcaagcgtcg aaaggagcca cagacaagcc cagtcgaaca ttgcgtcttc    323640
     cattcctgct cccagttgcc aggcccggcg gcattcgtcc aaagcagcct gggggcgatc    323700
     ctggcgctgg taaagcacgg cacgccacgc actgtcccac gcaagtgcga acacgtcgcc    323760
     acgccgttca gcgaggtcgc gggccttatc gagaaattcg gaaccatgtg ctgcatctcc    323820
     ctcattgatg tagccagacc ccagattgaa ccaggttgcg tgcagccagt ccaggcgacc    323880
     ataggcctca aagcggaccg ccagatcgag atgcagtcgc cgcgcccctt cagtgtctcc    323940
     tcgcgttccc agaacggccg ccatgccgtc cagggcgaat gcctcccctt cttcgtcgcc    324000
     cagcgccgca tacaggttga agctttcctg gaagtatcgc tcggcatcat ccagccgcgt    324060
     ggtgacacga accgcatgca tcccagcctg gcggaggatc agagcctgca tggctggcgc    324120
     ggcttttgct ccgggcatag cgagcacctg cgtgatccac tccagagcaa agttgttcag    324180
     gcctcttccg cgccagtagt tgaagagccc ctggcaaagg ctgacggcgt cctcgaatcg    324240
     gtcgcggtga atgaaccaac gcagggcagc atgcaggttg ccgtgctcgt ccttgaaccg    324300
     cgccatccac tctgattcaa gcgtttgaat ggactgcctc gcctgcccga ccaggctcag    324360
     gtagaagtgc gcgtgacgct cgcgcacccg ctcagcatcc gggtggctgt ggagttgttc    324420
     ttccgcgaac tcgcggacag gttccagcat ggaccagcgc gcctcgaggt gggccaccgg    324480
     acgaagcagg ctgtgctcca caaggtgaag caagaccgat cgtccgtcct gctggccggt    324540
     gaccgtctcg aacgctgccc gtgtgaagcc ccccacgaat accccgcagg cgatgaacac    324600
     gtcccgttca gcttccgaca gcaggtctgc actccaacgc acggcgtcgc gcagggaccg    324660
     tgcccgctcc ggcacatcac gaggcccgtc cccgagcacc tccagcggct cagccagcca    324720
     ttccaccagg gccgcgagcg gcaatgcgcg taagcgggct gcagcaagct cgatcgccag    324780
     tggaattccg tcaagaagcg tgcacacgtg ttccacctgc gttcggttat cggaggtcac    324840
     ttcaaagttc gggtcaacgg tacgtgcctg ctgcacgaag aaagtcacgg cctcgctctc    324900
     ccctgcaatc ccgtggggca gcgtgagcgg cccgagggca agttcgtgct catcgcgcag    324960
     gtgcagcacc gcccggcttg tcgaaagcac cgtaagattc tcggtgttca caaggagcgt    325020
     cacgagggcc tgcaggccag gcagcaagtg ctcaaggttg tccaggataa gcaaagcccg    325080
     cattgtgcca agcgtttcga taatcccctg gagtggagga atgttctgtg gagcgcgcac    325140
     ggctgtggca atggtcggaa gaagcagcgc ggtgtcccga atgggcgcca gttcgacgaa    325200
     gtacacctgc tcgaagtgag gcgccagaag gcgagcgagt tcgagagcaa ggcgcgtctt    325260
     gccgatgccg cctgggccac gcaggttcag aagccgtaca tctggccgga ggagcagtgc    325320
     ctgcgcaata cgaagttcgg actggcggcc aaccagacgc ggttggcgcc ctcctgctcc    325380
     ccagacgtgg tgacgctccc gcccgtccat acttcagcgt aaatgattga ccccaccctg    325440
     agaaggtggc ttagacgcgt gccagaggca tgctggtcga gcctatgcat ctgtctgaag    325500
     aagcagatga atgaacattt tcacgtgacc aacggcgggt tcagcctgca ctgtcacgat    325560
     cgattcgatc acatgactct ttgcactctg cgactacgga gcgtcaacct gtgtggaaac    325620
     gtcggctccg tttaggcata ccaggcgcgt tgcaatcttt cgccaccgtt agaacggttt    325680
     ttgatcgaca tggctgcaag tcacaagggt caccataaat tccaaaaagg ccgcgcggat    325740
     gcgcagttct gactcaggcg aagcaccgtg gcccggctcg gctggcctca tgcagacgga    325800
     tgaacgcgtg ccccgtccct gtgcaggcag cgcagtccta cacaatttgt tgctcagcag    325860
     ggcttgatgc ggctcaaagc ctggcgaaac cccttgacag cgaagacgta cgtaagctct    325920
     gacatcccga gccgggggat acgcaaggtc acacgcctga ccgcgtgccg gaatgcgtcg    325980
     accaccagct ggtcattttc gaaagccacg gattccaaca gcccttgtcc tgttttggag    326040
     agcatccccg atactttgaa agttttgagt tgttgatcgt cgacctgata caccaccagc    326100
     ggatacaact ccatggcccg ggccgccggt gacacgagcg gattcttgcc gtgaaagtac    326160
     gcctgcaaca cccttgcctc gcaggcaaaa cgcacatagg tcagccctgt ggtgtcattt    326220
     atttcaaaga tgcggaccac tccgcggtta tctgtggtca ccgaatcctg tgccgcgaaa    326280
     tagtccactc tggtaccagg aatgttgatg cctgcggcct cgtgcatgcc ggcgacgatc    326340
     acgcccagca tgaccttgcc ccagacggtg ttcatacggt gagcatagcg gtcccggaca    326400
     gtccgctttt cctgtcatat aacttcaaca gcacggcaaa cccaagccac gatgggtcct    326460
     ttcccgaacc tcgtaaacga ccgcttgcct cggcacccgc cattccacct cactgcggct    326520
     cagttctgag catcaccagc atcgcgcagg gcatatccga ccccgcgaac cgtcctgagt    326580
     acgcccgctc caccaacctc ccgtaatttt gagcgcaggt tcgccatatg cacctccacc    326640
     acgctgcggc ctacatccac cacgcctggc cagagttcgg ccacaatcac gtcccggctg    326700
     tagacccggc ccggcacctc tgcaagcagt cccagcagtt caaactcctt cggagacagc    326760
     cgcacttcac gtccctgata gaggcacacc tgctgttgca ggtagagctt caacgccccc    326820
     acgctcactt ctccagcctg ctggtgcttt cttagctgga cccgcacgcg ggccacgagt    326880
     tcctccggat gaaacggctt ggtgaggtaa tccgacgctc cggcttccag caggcctacc    326940
     ttgctcgcca cagtatccat gccggtcagc accacgatcg gtgtccggct ggtccggcgc    327000
     aggcgccggg caacttctgt accgtgcata tctggtaggc caaggtccag gatcaccagg    327060
     tcaggcgctt cagaacgcgc gcaggtgagt ccggacattc tgtttggtgc tgtgagcaca    327120
     cggtatccgg cgtcttcaat ttcggtcgtg agtatctgtg cgatgtccgg gtcgtcttcg    327180
     atcacgagga tggtctgctg catgcgctcc tcccgcgtgt acagctttat ggtacgaaat    327240
     aacgttccag gcgcaagtgc aggcactcaa gttcggtgag accccgctct tcactgatca    327300
     gacgcgcaat ctgggcaaag ccaccaatgc cgctgtcact gacgccctat cctgcagcat    327360
     gcccgaccca tccgcagggg acgcgattct ttcgtctgcc gccttccctc atctggcctg    327420
     gacaaccggt aggcacggac acctgctctg gagcaatcac gcgtggctca cctacaccgg    327480
     cgcggaggca acccagggaa cggtgtcgtt tgtcgacctg cttcagcctg aggatcagca    327540
     tctcatggct gttcaactcg cgcaacgggt tcctttcgaa ctggagctca ggctgagcga    327600
     caaaggcggc caactgcact ggttccgggt gcatggtcag ccttcaaccc tggatggggg    327660
     ccctgcgtgg gtattcacgg gcgtgaacat cgacgacctt cagcaggagc ggcagcgaag    327720
     cgcccagcta cagagcatga tggacgcgag ctccagctgc atcaagatcc tggacctgga    327780
     ttcccatctg ctctcaatga atgagggcgg catgaccacc atggagatcg acgacttcga    327840
     tgtctgccgt aatctgctgt ggctggactt ctgggaaggc aatacccgca ctatggtcga    327900
     ggacgctctc gaacgcgcgc gccgcggcga gcacgtatcg ttcgaagcca gccggacaac    327960
     attcaaaggc acaccgaaat ggtggcacat cagcatctct ccgctgtatg acaccgaagg    328020
     ccgtgttcat cagctcagtg ccgtgtcccg agacatcacc tcaaccaaag caactcagga    328080
     agccgtggct gccctggatg cctttgtggc cttcagtgag atctcgggcg ccagcacgga    328140
     cgttctgctc cttgcacagc acgccaggga agtccttcag gcgacgctgg gagacgtcac    328200
     tgtcgcgtat tacacgcttg aaggtgacct ttggaagtgc cgggtatggt cggacaacct    328260
     ggctccggaa atcgtggatg tgctgaccgc cggcattccc gtgacggcgc ccagttacgc    328320
     ccaagcgaca cagactctgc agccggtgtt tgtggccggc tggaacgccg aaactcaggg    328380
     cgtgtccagg acagagcagt acaatgcggc agccttttat ccctgtgtgg tggacggccg    328440
     tgctcagggg ctgctggcga tgggcatcca gaagtccgga gacctcaccg agcgggagcg    328500
     ggcggtgttc cgctctgtcg gccgcagcct cacccttgca ctggaacgcg cggacgtggc    328560
     gcagcggatt gacgaccagc gcgctgaact tgaggcgcgt acccgggcac ttgaaggctt    328620
     tgccaccctg accagggacc tgaccttgca accagagcgg gatgcactct tccgccggtc    328680
     gatggaactg gtcttgtcgt tgatccccga aggctacgcg ctgtactacc agccgcatgg    328740
     ggaaaaatgg tgcgccacag ctcaggtcgg ccatgtccga tcagcgccac ttcaggcggc    328800
     catcgaaggc gggttcccgg tgggacagac ccccagcctg gatatcccgt gtcagacaaa    328860
     ggaagcgttg tttcaggacg agtacgactg caccagggac gtggaagcct ccctggtgca    328920
     gcacgtccgc accgtcgcct cactgccggt cgtggtggga gggcacgttc acggcatatt    328980
     cagtgtggca ctgtttgagc cccgcccctg gagcgcggcg gaccgggcgg ttctgaccac    329040
     cacggtgcac agtctgggtc tcgcgctgga aagtgcgcag agcgtggttc acctggctga    329100
     agagcgccga aagctcgagg ctgcaaacga agaactcgag gcattcgcct actcggtctc    329160
     gcatgacctc cggaccccgg tgcggcacat tgtcggtttt gcgactctgc tccgcaagca    329220
     tctcggcacc gggctggacg acaaggcaaa ccgatatctt acggtgatcg acgagggcgc    329280
     cggacgcatg aataccctga tcgacgccat gctggacctg tcacggacgt cccgactgcc    329340
     actgcgcgtc actccggtgg accttgagat cctgatcgac cgggtgaagc tggacctgcg    329400
     gccggatctg gtgggccgcg aggtgtgctg gaaagtcagt ccgttaccgc tggtgatggg    329460
     agatccggac atgctgcttc aggtgatgga gaatctgtta tccaacgcct tgaaatacag    329520
     ccggaaccag aacgtcgcaa caatcgaggt ctgggcagag gaacgagagt gggactgggc    329580
     ggtgttcatc cgcgacaatg gcgcaggctt cgacccccgc tacggagaca agctgttcgg    329640
     agtctttcag agactgcacc gacaggacga gttcgaaggt gttggagtcg ggctcgcaaa    329700
     cgtgcgccgc attattcacc ggcatggagg cgaagtcagt gcggtgggac ttccggggca    329760
     aggagcgacc ttcgggttta ccctgcccaa accgtgagat gtccctgacc agcctggccc    329820
     agatgctcac aaccgtgcca gcccgtgaca gacgcagaaa acttgcctat gaggggcgta    329880
     tttcatgaac caggggaggc cctttgggaa cgatattcag gcctcggctg ccccttgcag    329940
     gctatacccc tgcccccgga ctgtatgaac cagcgggtct ggatgcaagc gcaacaactt    330000
     gcggcggagg ttactgatgt ggacattgac cagtggatca ctctccaggc gaacttctcc    330060
     ccacgctgcg gcagcaaggc gctcgcggga aaagacctgg tgggggtgct gcatcagcac    330120
     agcaagaagt gcacactcct gtttgcttaa ctttacgaat tcatggcctc cacgcacgac    330180
     ccgctcgcgg caatccaggg tgagtgaccc atgggagagc acctccggcg ccctgggctc    330240
     ctccttgctg gtattgccca gcccagccga ctctaaccgt gccagacgcg cctccgccag    330300
     cgccatcagg gcgtctgcgt ccgtagcgtc ttccggcatg cgggcgatac ccacctgcac    330360
     ctgcgctccc ttcagaccac cggaaagacc ctgctgcagt acggcctgaa ggtcatgcat    330420
     gccgtctgtg gaaatcacag cgtactctct gtctccaagt ctgcacgcgg tccggtgttc    330480
     tcctggtccg gtctgcagca tcagcgtcaa ccagcgagcc cactcgctgt ccaggggggc    330540
     accgcgcaca ctcaagcgca ctaaggtcag ctccagggag ttgaggtgcg catggtgaac    330600
     ggctgagtaa agcgtggcct gggttccaag gtggacatcg ggtttgtcat tgcgggccat    330660
     gtcacgccga gcaatgtgct cccagcggga cagcagaata ttcaggcctt gcgcaacggc    330720
     agtgaggagc tgtcggtcct cggggctcca cacaactgcc tctccgccac gggcatatga    330780
     cacgacatgg cgggcacctt ctactgtggt cagggggaga aaggcagcgc tgcccacgcc    330840
     atcacgaatc cagtcagaga atccaggtgc agtgcgcaga ttttcgagga acaccgggaa    330900
     gtccatatca agggtgacat tcgggaggcg cgtccaagcc ggagggtgtt ccccggcaaa    330960
     agcctgaacc gggactgtcc atgagggggc ttcggcgcgc atagactcac cgcgggcgtg    331020
     tagggttacg ctgcaaatat tggttgcctg cgccaccagc gggccagtgg cctgaaggta    331080
     ggcgtcaacg gtcagatcat aggcgaggag ctgtgtcact gccgcaaggt gttgcgcgtg    331140
     atcggccgcg ccggtcattc gggtcagcat ctgcgatttc gccttcgcgt cccgggcaag    331200
     ggtcagttgc gccaggcgca gttccagttc gtccatgacc agcgctgcga ggtcctgcaa    331260
     ggttgaactc tcctcgtcac tcaggccagt ccggggctgc tcgtcgagca ggcatagcgt    331320
     tccgatgctg tatccatcgt gtgtcaccag aggggcccca gcgtaaaagc gcaatccatg    331380
     ttcggccatc accccatgcg aagcaaaccg gtgattctgc ctggcgtctg gcaccaccat    331440
     aacctgagta gactcgatgg ttcggacgca gggagcatgc tcgcgggtca gcgaacctgt    331500
     cttcgtacca aaacacgctt tagcccagat ctgctgttcg tcaatcaggt tgatcatggc    331560
     gtagggaacg ctgaacagac gagccgcaag ggtcgtcagt cggtcaaacg ccggttcagg    331620
     cagggtgtcc accacggcgt atcgcgcgag cacctctatg cgcctgagtt cgttgtccga    331680
     cagcggctcg tacataggac catcgtacgc ggcaggtcat gaccggactc tctcacttca    331740
     gcgcctggcg aacgaacagt cggtctgagg cacagactga ttctctgtcg accagaagtc    331800
     attgaatcga agtatcggtg ccccatgacg ccggtgaaca gatcaattga ggatcaagcc    331860
     accgggtctt ggacataccc ggtcgcaaga aggccagccg acagaaatac catggcttcc    331920
     tcgatgtatg cctccagggg aggcggtggg ctttgaatgg cccaggcggt cgcagagcta    331980
     tagatcccgc tggccattaa cgttgctgtc atatcccggc tgatgcggcg tgaattacag    332040
     cgttgctcag aacctcgtag agcgtcactg accaacgtat tgagctgccg ctgaacttgc    332100
     aggtcaactt gggcatccat ctcacaaggg tgggcgcggc ggtcaagatg tacctgcgcg    332160
     agaaagacgc acacgccctg gaacagccgg cgaacatctt gtatgaacac ctttcccggt    332220
     ggcagggcgt gtgccgtaag cacgctggcg aaatgctttt cgacgagttg cacgaagagt    332280
     tcgtgcttct cccggtaatg cgcatagaag gtggcccggt tgatccccgc acgttctgca    332340
     atgtcgtgaa ctgtgatgga ggaatagggc cgctcgcgca ggagggcctc cagggcttca    332400
     aggatggctt gacgtgtccg cctgacacgc ggatccactc tggcaggcac aggcaacata    332460
     aaaagcctcc tgtcgtttac acgacatttt cccccggttg tgtctggagt aaaccaggca    332520
     taccgctcac tctgtatacg ataagtgttg ctcaagcgcc gctgatcaca cgagtccacc    332580
     ggtgtacacg ccaccacaag gagcgcttta tgacatccag caagatggac gcccgtatca    332640
     ctggggttct gtttatcctc gccacagtct ctgctgtgct tggggttctt ctctatgccc    332700
     cgctgctcaa tgacccggat tttcttcgtt cagggcagtc ccacactcac cgggtgatac    332760
     ttggtgcgct gttcgaattg attctggcaa gcgcggcagt gggaacagcg atcaccctct    332820
     ttccttatgt caagcgccag aacgaaagcc ttgccctagg ctacgtcagt ttcagagtgc    332880
     ttgaggccac cctgatcatc gtcggtgttc tgagcatgct cagttatctg acgctccgaa    332940
     atcaattcat ggcggcgcct gcaccgcacc ttccttcttt ccagacagtg ggtggcctgc    333000
     tcctggcgct gcatgagtgg acgtttctcc tgggccccaa cttcatgctg ggcatcaaca    333060
     ccctgatgtg cgccttcttg cttcatcagt caaggcttgt tccgcgcggc atcgcaaccc    333120
     tcggccttgt cggcggcgcg cttattctca cggcggcggt actggaactc ttcggagtgg    333180
     tccgtcagct gtccccatgg ggtgtcgctc tggcccttcc agttgccgcc tacgagatga    333240
     ttctggccgg atggctgatc acaaaggggt tcagacctac ggcaattcac caccttgaga    333300
     gcggcccgca ggcctccggc agcgctgcgg cacagccaat gcaaaccctg tacgggaccg    333360
     gcaaataacc tgaatccagc ggggggtcag cacagcctcc gaactgggtt ccagatggtt    333420
     cacgctgcat tgacagcgtt gacccactgt tcccgagctg agcacagcca ggtgtagacc    333480
     ttttaagctc tacacctggc tgtgctcacc gactttcctc tccagatctt ccggctgacc    333540
     agtgcacaaa acttccggat cattcaggac gaatagggcc tcaggagcat ctggcctgtt    333600
     ctcaggttag cgggctgctc gtgtcgcgac ctccgcaata ctaggaagtc gcaccaggcc    333660
     acgccagtac gcttcaatgg ttttgacaac acggacaaat tcctcatagg tgctgggttt    333720
     cacgacatag ccgcttgcat acccgtggta ggcccgctga atatcgtccg ggtgatccga    333780
     ggtcgacagg atcatgacgg ggatactccg taattccggc tgctgtttga cgtgcgccag    333840
     gaaatcatgt ccgttcatga ctggcatgtt caggtcaagg accacgagat ccgggtaggt    333900
     ggcattcagg aactggtctt cacggttgag gtattggagg gcctgccgcc cgttctctac    333960
     atgaatgacg tcgacctcag ccacagcgtc tgcgagaaga tcctgaaaca gcgcaacgtc    334020
     tgccagttca tcttctacca acagcagcgt gaaggacttg cgattcatga gcttcaccat    334080
     acactttacg ccctaggcgc taaaattgtt agaaaaggct tcaggttcgt tcatagaccc    334140
     ttatttcctt ttcacgggta cattcacgca gtgttaacgt gagcgggatg gactcctctc    334200
     tgccatgctc ggctacaccg ctgagtccat atccagtcaa gcgtagggac cggagcctgg    334260
     gcatgcactc tcttgaccgc aggaccgggc caagtgctga gaacagacag ctcaggctgg    334320
     cgccggcccc tggagtctgc tcccctcaaa aacagtccgc tggccccagc ttgcggaggc    334380
     ctcgctcccg tcctcatctt gtcaagaccg tttctgagca cagggacaag acccgtgtct    334440
     gacgaacacc tccttgcccc tgcacacctg ggcggtccag ccatcgacgc atcgaattgc    334500
     gcccgcgagc cgattcatat tccaggctcc atacagcccc atggagcgct gctggttctt    334560
     tcggttcatg agatgtgcat cgtgcaggtc agtgccaaca tcccagagtt ttttgaacgt    334620
     cctgctgaga gcctcctcgg acaacctctg gaactcctgg tgaccccaac gtcactgagt    334680
     cccctcaaaa agatgctgac gctggaaggc aggactcaca cttttccggt cacccttttg    334740
     aaaggcctga catacgacgc cacagcgcac ctggcccagg gcgtgctggt ccttgaactt    334800
     gagcgtccga attcccccga ggtcgctgct gacatttacc gcgcgacgca acaggccctg    334860
     accgaactcg actcttcccg agacgtcctg gggctctgtg cgacagcagc ctcgcaggtc    334920
     agggaactca cggggtttga ccgggtcatg atctaccgct ttgctgaaga cggcagcggc    334980
     gaggtcgtcg ctgaggcgcg gcacagcgac atcgcaagct acctcggaca tcgttttcca    335040
     gagtcggaca ttcctcggca agcacgtgcg ctctacctca aaaacctgct gcgcctgact    335100
     gctgacgtca atgctggtgt catacccctt gtcccgctgc tcaatccggt gacgggcgct    335160
     cctcttgaca tgagcctgat ggtattgcgg agcacctcgc ccatgcacgt gcagtacctg    335220
     aaaaatatgg gcgtcacctc gagtctgtct gtttcgatcg ttcaggacgg gcgcctctgg    335280
     ggcctgatcg cctgccacca caccactgcc agagtcattc ctcatcaggt tcgcgcttct    335340
     tgtgagttcc ttggccgcgt tctggccatg caactcgcgg ccaagcggga cgccgagacc    335400
     taccgcttcc gggaaaagct gaagcatcgt catcaacaga ttctgaacgc catgatgtcc    335460
     agccgcctgc cggttgaagc gatcaggcgt cccgaccttg atgtggtggg ctttatgcgg    335520
     gcaagcggat ttgccgttcg tctggccggt caagtggtga cgctgggtga aacgcctgcg    335580
     gagcctgaac ttcaacacct gctgggctgg ctgcgcgagc accacccctc cagttttcac    335640
     acgaataccc tgagtgcctt ccttccggca gccactgctt actcggataa agcaagtgga    335700
     gtgctgggta tgagcgtgtc tggccactgg gaggaatacc tgttgtggtt ccggccagag    335760
     attccccaga cggtaacctg gggcggcaat ccggctaaac cggtgcaatc cggtgaagac    335820
     ggtacggttg acctgacacc tcgggcttct ttcgaggcgt atgtccagca ggtgcggcac    335880
     acggccctgc catggcatcc aggcgaggtc gccgaagccg aaagcatgcg ggatgcattg    335940
     gtggagacga caagcgtgcg cctgaccgcg ctgcaagagc atcatcagca acttcaacgc    336000
     gcacatgatg cccttgggcg gagcaacgca gaactccagc gtcgaaacga ggagttggcg    336060
     cagtttgcgt atgtggcgtc gcatgatctg caagaacccc tgcgtattct cggcacctac    336120
     agcgacattc tcctccaccg gtatcaggga cagctcgacg agcgtgccca agggtatctg    336180
     cggcacattg gcgaacaggt cttccgtgcc cggcagctgg tccgggatgt tctcacgctc    336240
     tcgaatgtga ccgctcaacc ccccctgacg gatgtggatc tgaacagggt gtgggaggac    336300
     atcagcccga cgctcccctg gccagcagat gcccaggtag agtgtgccga ccttccacac    336360
     gtccacgcaa atgttgccca ggttcagcag ctccttacaa atgtgttcgg gaatgccatt    336420
     aagttccgcg cggaccgacc cctccgtatc cgctttaccg gggaacagcg gggggaatgg    336480
     gtgcatctgg cgatccgtga caacgggatt ggcatcgccc aggagcacgc agagcaggtc    336540
     ttcgtcatgt ttcagcgcct ccagagcagg accgatcagc tcactgggaa cggaattgga    336600
     ctggccgtgt gcaagaaggt cgtggagcgt catggcggga acatctggat tgacggtcag    336660
     gtcggcgagg gtacgacggt ctcgtttacc cttcctgccg tgtccaccaa aaccaggagc    336720
     tcgcctcccg taatgacctg aaggttttcc ggcggcgcgg cggcgtgcac cagagtggac    336780
     ggcgcacctg tctctccggc tgctgaggga ggtcaggccg ttcgtaatct tttcttatgt    336840
     cagtctggcg gttcatgacg tggtgcccac ctgtggtcag cgagcaaggc acagggtatg    336900
     cccggactgc cgagcggaac agcagcctgc accttgaggt gctcacggtt cggacccctc    336960
     cacgcggccc ggcagcaaca tggtctctga ggcatgggac cccacgccca ggtgaccgat    337020
     gtctggctat gtccgcgctt caaccgacaa ctttcctgaa gttctgacgc gccggcaccc    337080
     atggagcgct cagtggttgt gtttgggact ggttcctaac gtgaacaaca gttacactaa    337140
     agatggcaaa ttgccatctt tagtgggaat ctttcggaga aaaaatggca accaaaacaa    337200
     attcacgtgt tcagaccctt atccgccacg ctctagacga acaggctgcg cgcgggcatc    337260
     agggagattt acctgaaggg aaagtcacct tgcgtctgca ggccatcgac ctctactggc    337320
     tgtctcagct tgcggtactg atggacgcca gccgcacccg cgccgcctcc caattgctat    337380
     cagccgctat ccgggacgcc gctcacaccg ccggcctgcc taccgaaggc gaacagttcc    337440
     agacgagttt ccaggcgttc ctgaagcagg aattcccaca cgagacgtcc ccgccctctg    337500
     acacctgact ggaggccgca tgccgcacca cacagaactg atttctgccc tcgctgtcgg    337560
     cctgacgctg gctttcttcg gcggcctgct cgcgacccgt cttcacctgc ctcccttgat    337620
     cggctacctc ctcgccggcc tcgctgtcgg gccgttcacc ccgggcttcg tcgccgacgc    337680
     cagcattgcc gcgcagctgt ctgagattgg cgtgatgctt ctgatgttcg gcgttggcct    337740
     ccatttctcc atcagcgacc tgctcgcggt gcgccgcata gccgttcccg gcgcgctcct    337800
     gcgcatcctg accatcaccc tgctgggtgc tggcgtctcg caactgtggg gctggtccat    337860
     gggagaaggc ctggtgtttg gtctggccct ctccgtggcc agcactgtgg tgctgctgcg    337920
     tgcgcttgaa gaacggggaa cgctcgacac caccaacggg aagatcgcgg tggggtggct    337980
     tgtggttgag gatcttgtca tggtcctggc gctggttctg ttgcctgcgc tggccccctt    338040
     gctgtcgggt ggcgagggaa cggtgaatct gggagcgctg ggcatgtccc tggccctcac    338100
     gctgggaaaa atgcttctgt tcgtggtggt catgatgctc gctggccggc gcttcattcc    338160
     atggatgctt gcccgcgtgg ccaggatcgg ctcccgcgaa ctgtttacgc ttgccgtcct    338220
     gggcaccgct ctcggcattg cgtacgtggc cggagcattg tttggcgtgt cgtttgcgtt    338280
     gggagccttc ctggctggtg tggtggccag cgaaagcaaa ttcagtcatc aggtggcgga    338340
     ggacgccctg ccgttccagg atgcgtttgc cgttctcttt ttcgtgtcgg tcggcatgtt    338400
     gttcaatcct gccatcctgc ttcaggcacc gctgctcgtg ctggccacct cactgatcat    338460
     cgtcgtggcg aaaacgctga tcgcgttcct gaccatgcgt ctgctgcgcg cctcctttac    338520
     cacctccctc acggtggcca tctctctggc acagattggg gagttctcgt ttatcctggc    338580
     gacgctgggc cgcgacctga acctgctgag cgttcaggga cagaacctga ttctggcagg    338640
     cgcgatcgtc tcaatcatcc tcaacccctt cctgtttcgc ctgattcctc tggtccagag    338700
     gtggcagcag agaggtgagc ctcagggcac gccacagagt cacccgccgg tcggcctgac    338760
     acggcacgct gtgctgatcg gctacggccg ggttggtcgc atgattgccc agactctcca    338820
     ggcccagcac gtgccgtttg tcgtggtcga gcaggacgaa cgccgcattg atgaactcag    338880
     ggaatcaaac attcctgcta tctacggtga tgcagcccgg acatccgtct tgcaccaggc    338940
     agcgctccgt gacgcccgtg tggtcattat cgccactcct gatgccattc aggctcagtt    339000
     gatcgtggag catgtgcgcc gggtcaatcc ggatgtgtat gtcacggccc ggagtcatga    339060
     cgaacacacc cagcgggccc tgcgtgatct gggggcaagt gatgtcctgt acgcggaaca    339120
     cgaacttggc ctggctatgg gcaaccatgt tctggcggcc ctgcgcccgg cgcatgatgc    339180
     tcccgccagt cgtgccggaa caagctcctg actggcatcg tcctggctcc ggccttgagg    339240
     tcgagactct tttccggcgc cggtcagcac ccactggatt gcaggcgcct gaactgtcac    339300
     cggccacatg aggcagtcac accagaggac tttcgtttga tcgagggtgc tgtctcaggc    339360
     tggtgtcacg ctcatgcctg ccaccttgtg ctgggagttg aggacgtcag ctgcctctgt    339420
     cttgcttgac gacctcagcg ggtccggtcc tgcgtctcat ggagccgtct gccgatgaat    339480
     cctgccaaaa gcgaaagccg caccgggctc aaggacttct gccgtgtcaa agacatcacc    339540
     cacagacgct cttacagcga cacaacctcg ccaacgcatc gctgctcggc caatctcagg    339600
     agatgcccag ccagtgcagt gtcctggaaa gacactcccg tcgagtcgaa cactgtaatt    339660
     tcttctgagt gttcccggcc cggcttcaag cctgcacaca gctcacccag ctctgcgtag    339720
     atgtcctccg gttgtacgag ctgcagggcg accgggcgct gcatttcccc tatggtcagg    339780
     ctctgggcac gccggtctac cacgactttg gccacggcga ccagatatgg atcaagttcc    339840
     tgcttcccgg gagcatcaga acccatggcg ttgatatgcg ttccaggtct gatccactgc    339900
     cgcgagatga tcggttcctc cgccggagtc acagtgacga cgatgtccgc gtcttcgcag    339960
     gcggcctgtc cgtccggcac cgcccgcaca gcgaggcccg gcaggtcggc cgcttccacg    340020
     aatgcctcgg cacgctcggg ggtgcgtgac cagacccgca cttccttcaa cgaccgcact    340080
     tcctgaagag ctcgaagttg cgccagcgcc tgccctcctg tcccgaacag cgccaccacc    340140
     tgagcgtccg ggcgggagag catctgggcc gccacggccc cggcagcggc cgtgcgagcc    340200
     tctgtgatga cgttggcggc cagaagcgcg tgcggttgcc cggtgacagg atcgcccatc    340260
     agcatgactg cgctgtgcgt tggtaggcca cggcgaacat tgtcgggata gtacgatccc    340320
     atcttcagac caaagacctc gtgatgcccg gacagctgca gatgactggt tttaatgctg    340380
     tagcgtccgc cgttcaggga atggccgacc acaggcagca ctgcagcctg accgcgacca    340440
     tctgccgcaa acgcgtcccg gacgatgtct ataacttccc gctcatcgag gagtgagcga    340500
     atcacggtat cgctgaggac cgtcagaggc atcgcaccgt gattcattcc tgttcctctt    340560
     tcaacaggtg cacgagcaga tcacgatcga gattgccgcc actgaggaca gcgacgagtg    340620
     ggccggcggc ttgcagttcc tggcggtgtg agagcgccgc agccagcgtc acggctccac    340680
     tgggttccgt cacaaggcgg gttcgcaggg tggtctcgcg caccgcgcgc cgaagttcgg    340740
     cttcactgac ggtaatgatg tcatccacga atgcctgaac atgaagccag ttcaaatcgc    340800
     ccaggtgctg cacgcgcaga ccatcagcca gggtgcggcc cacctgttcg gccgtgtagg    340860
     tgacgcgctg cccggacttg aagctgtcat gggcgtcggc ggccacctcg ggctccacac    340920
     caatgacgcg cacgtctgga cgctgcagtt tcagcgcggc ggccacaccc gacaacaggc    340980
     ccccgccact caccggaacc aggacggtgt gtacgtcggg caggtcctcc agaatctcga    341040
     gcccgacagt gcccgccccc gcgataatgc gggcatcgtc atatggggga atggggctca    341100
     gcccccgctc tgacgtcagc tccttggccc gggcggcgcg ctcctcactc gcgggcccca    341160
     ccacgatcac gtccgcaccg aacgcccggg tcatgtccag cttcagctgg ggggcattgt    341220
     ctggcatgac gatcacggca gggatcccca gctgttgggc ggcataggcg acagcctgcg    341280
     catggttgcc gctggaatga gcaaccacgc ctcgctgccg ttcgtcttcg gacagcgcaa    341340
     ggagggcgtt gaaggctccg cgcagcttaa atgccccagt aggttgcagg ttctccggtt    341400
     tgacccagaa tccttcgagc ggaaacggga ccagaggagt gcgtacgacg tggccacgga    341460
     tgcgctggtg tgcgctcaac aattcattca aagcgatgag ggaggaaaca gcagttggat    341520
     gcgacatgaa caaacctcgg aaatgatggg gtaagcagac ctgcttggcg gcgacccacg    341580
     aagaataaag ccttgcccgc cgcatatgtc ctgaatgtcc agactctgga taaaatatct    341640
     ttgtgtcaga gacagaagcc gaccatatcc atctcctggc gcagctccag cagatcgccc    341700
     agggacttgc cgagacgttc gcaccattct gtgaggtggt ggtgcacgat ctgacctgcc    341760
     cagaccatgc ggtgatcgcg atccacaaca acctctcggg acgtgaacac catcagcccg    341820
     ccacagagct ggggctggcc cgtattcagg actcccagta cccgcagatc atcaccaatt    341880
     acgccaaccg cttcgccgat ggccgcccag ccaaaagcac gtctatcggc atcaaagact    341940
     cccggggcag ttatgtggcc gcgctttgcc tgaacattga cctgacggtt ttccgcagcc    342000
     tgcaaagcgt cattgaatct ttcgtgcagc tggacaatac agtcagcgtt caggaatccc    342060
     tcgagcccgc gggggcagag cttctccggg cgcacatgga ccagtttgcc gccagacgcg    342120
     gcaccgtacc ccaggctctc aaggttgaag acaggcgaac actcgtgaaa gaactcaaag    342180
     ctggcggcca cctgcaggtg cggcgagcga tggaaatcgt ggcgtctcac cttggggttt    342240
     cgcgggcagc agcctacagc tatgcgaaaa tatcaccggg tgaccagctc aggtcgcgtc    342300
     gaccataact gtttggtggt gaattgtccg gcacagttca aaagcctcat acgtgtgcag    342360
     gcgaaaggta aggctgaagc aaccgcctgg tgtgcgctca cggacatgcc gtccagccgg    342420
     cgtcactttg ccggatgacg ggtcaatggg ctatgtcagc ttgaggttac cgtccacggc    342480
     gcccctctct gaaaaggggc ttgctggcgg atatccgaag aatctcttcc cagcgtttac    342540
     gccgatggag cagatcgttc ctagttgcga gggaatgcag caggcctctg cgcatcgctt    342600
     acggggactg atgagcggcc aaaacgacgt gacggtgctg cgcggagcga ttcaacggtt    342660
     gcagctcatc gaccgggttg aatctaagga cgtgtaaact acagagcttt cataagtgac    342720
     ttcaaaagga cgtcttcaca aggcagtccg agcgtgagcg ctggctcaag tcgaacctca    342780
     gagacgataa accgcgtcga cttagctttc atatcttctg tcgcgtccgg tcagagaata    342840
     ggcaaatgtt tcgcatgcgc ccggctcttg tattgacttc agccctcgtc attgctgcac    342900
     ctctccagag cgcccacgcc acagcccttg agaaagcaaa atttgtcttt caccttggcg    342960
     cagcgtatta cgcattcaac acctgggtct ggaagccata ccgtcagtac aagttccagg    343020
     taggagcacc aaaccagaaa acgaatattg tcaaagccgg cgccgccctt ctgttcgccg    343080
     gctatcaggt aaattcagcc atcaaaatga ccagaaatac ccaggatccc ttcctgaaga    343140
     gcatcggtgg ccttttgccc aacttcagga aatcactcac tgctgttgga aacgatctta    343200
     aacaggggcg cttcaatgag cagggaattc agcaactgaa ccgcagcgcc acgcagctgc    343260
     tcaacgctgc tcagcagcag ggacaaacca tccggcctgt cgctgtgcct atcccaggtt    343320
     tgtaagttct ggcttggagg ggggcagctc ggtactgctt cccttcttcg tttctatctg    343380
     ggcccactcg tgccctgttc ctggatgccg ccatcagaac aataagtatt gtttttcgcc    343440
     gtagaaagta agttgaaata atattcagag aacgaatctg tttttaacgt tcttctggaa    343500
     ccagactctc tggaaacccc gtttagggcc tgaatcaggg cagctggttc acctgtaggt    343560
     caataaaaat ggagtcggta tggctagata ccgactccac cacagtttag gccgtcgtcg    343620
     cgtcatccgc accctctggc gttggggcag aaagcatttc agcgaccata ggagctgccg    343680
     gcatcagaag gtgacagatg cattcctcgt cgcgcttctc ctgtcgcggt atgtcttcaa    343740
     acatccgtac ccgtccatct ggtggaacat cctgagggaa gaccggcccg gtcttcccag    343800
     ttacacccag gcgttcaccc gcggccagcg tctcctggag catcttgagg ctctcgtcag    343860
     tccacctttg ccctgtacag atgtcgtggt ggactccatg ccactcccgg tgtgtcgtcc    343920
     aaaacgaggg aaacgctgcg cgtttcctgg tgcgcggtgg ggctacggga cccagggcga    343980
     tttcttcggc ttcaaactcc acgcctgggt ctcacccgct ggccaagtga tgcagtacct    344040
     catccgacca gccaacctgc acgacacgac cgtcgcctac gagctcaacc gacgctgggc    344100
     ggacttcggc ggaccccgag tgatcgggga taaggggtac tgcgcgttgg ggttcatcta    344160
     tccacccaag aaaaatacgc gctacgacac caggtggcgg gaagaccacc atccgaaatt    344220
     acgtaaacgc atcgaaaccg tgttctctca gttggtggaa gcccaggttc gttccgttca    344280
     gtctaaaacc ctgacctcat tgcggctccg cgtcgtcctg gccgtactcg cccacaacct    344340
     catgcaccgc taaacggggt ctggaagttt ggtcccggtc agaatgatct gggagggcta    344400
     tgctccgttt tcaagcagcg caggaagcat ctgcgctgct ctacacgggg agctggcgcg    344460
     acttcgatgg tgttctcagc ggcttcagaa agcggaaggc ttggcaaacg tgcacagata    344520
     tgcacgaatg gtcggcagaa tcgtcttgct accactcaat tggattgtcg cggcagcagc    344580
     catgtccggt ctgtaacact ggctggaagt caagagaggc ttaaatggta tctgttacag    344640
     attaagcagc tgttccctgc cttgacgttc atgtgacatc tcctgccctc ttcgatttag    344700
     ccataaacac aacaaaactc gtttgcctgg accgatcatg gccagcaaaa acccgtcaat    344760
     gacctgggcg tctctctacc atcaggatgg accgtcaaga tacgcactga ttcattgagt    344820
     gggtttggtc tcgtccggaa cctatcaaat agaatagatc tatgaccgca ctcgaatcgc    344880
     caagcattct ggatcaggtc aaggccctgt cgcatgaaat ccgctacgac ctgatccgcc    344940
     acctggccca gggtgagcga tgcgtctgtg acctggaaga gctgctggag ctaccccagt    345000
     cgaaggtgtc atatcacctt ggtattttga aagatgcgga acttgtccgg tctgagcagc    345060
     gaggaaaaaa cacctattac accctgaagc aagaacagct gtttctactg ggcggaggtc    345120
     tgttaaccga gatatttaca gaccgtgtct ccttgacgga acaaaagaaa tcaatatgct    345180
     gaaggcacga tgacccgagt cctgattctc tgcacccaca acagtgcccg ttcccagatg    345240
     gccgaggcac tgacccgtga ggcggcccgg aaggctggcg ttgaccttga agtctattct    345300
     gccgggactg aagccacctg cgtcaaggac gacgccagaa ccgtcattgc cgaacttgga    345360
     ctgagcctgg acacccacac cagcaagaca ctctttgacg tgcctgaacc tcagaatttc    345420
     gattacgtcg tgaccgtatg tgacagcgcc gccgaagcct gcccggtcta cccgggcaag    345480
     accacccgca ggcattatcc gtttgtcgat ccgagtggcg gcagtctcga ccgctggcgc    345540
     gccgtgcggg accagcttca gacgcagttc gaggcttttg tggcggcgct caaaaatggc    345600
     catcgggttc cggattctta tactgacagt ccggccgtga cggtcgcctg agatgactct    345660
     gcctacgccg gtccctcttt cccgcgccct ggctgcggaa ggcatcggaa ccttcgccct    345720
     ggtgttcttc ggcccaggtg cggcggtggt ccaggcacag acgggagcgc tcgggcatct    345780
     gggtgtcgcg gttgtgttcg gcctgacggt cacggcggtc atcgcagcac ttgcaccgat    345840
     cagcggggcg cacatcaacc cggccgccac cttcgccctc accctcgccg gtaggtttcc    345900
     acgggaacgc gtcctgcctt atgtcgcggc gcagctgctt gccgcggcgc tcgccgggtt    345960
     tgtgctgctg gccctcttcg gaatgaaggg cgacctgggg gtgacggtcc catccggcag    346020
     cgttgcgcag gcatttgttc tggaactgac gctcacgttt ttcctgttgc ttgttgccct    346080
     gcgctccggc ctgccctggg tggtcggagg ggtggtggct ctggaggccg ccatgggcgg    346140
     ccccatgacc ggggcgagca tgaatccggc gcggtctttc ggtccatccc tggccagcgg    346200
     catctggacc gcgcactggc tgtactgggc cgcaccactg atgggcgccg ggctggccgt    346260
     tgctgccaac cattttctta accccaccga accggtcgag acggcgccac atcaggcgca    346320
     ggagttcgtg cctaccgaaa aaccgacatg acgtccccga ccggtaaagc acttctttgt    346380
     tgggccatgg atgcccgctc tttaccgtct gacgctctgc ccggggagca tgaatgcgaa    346440
     tgctgggata taagtgccgg tggacctgaa acgagtgaga ggcaccgggc agagcgtcag    346500
     ccgcacaaca aacacagcct gaaccaggga ctgtggccgg tcgctttccg acaggtacag    346560
     gacatcgtcg gaaccgcgaa catgcgttgc gcgcaggagc agatatgaaa atagcggtgt    346620
     tcggagatgt tcatggcaac cgtttcgcgc tcgaagctgt ggttcaggac atcgaacagc    346680
     accagccgga catgtggctg aacctgggcg accagctctt cggtggggca gacccggtgg    346740
     gggcgtggca ggtccagcag gagctccggg ctaagtacgg cgcgctggaa gtacgtggga    346800
     acacagatga acgacttggg caggacctta ccgaaacaac cgagaagcgg gcgatgcttg    346860
     agtggctgca cagcattctt ccagaagatg ccgcggcgca cgtggcgggc ctgccgacca    346920
     gcgtcactgt ggcggacggc caggtgatcg ctgcacacgg cgcgcccgac agtgcctgga    346980
     cgtacctgct gcttgacggc aaggcctggg cgactaacga cctgatcctg gagcggctag    347040
     gagacaccgg aaaggcgcgc gtggtgatcg ttggacactc tcatcaggag catgtccggc    347100
     agatcggcca ggtgacagtg gtgaatgctg gtgccgtcag ccgccagaag gacggctgtc    347160
     ccctggcccg gtgggtactt ctggaaggtc ataacggtat ctggaatgtt acgttccgca    347220
     gggtcaccta caacgtggag gcagcggcac ggtgggctga gcaacacgcc cacaaaggcg    347280
     cccaggaggc agtacagtta agaaccggtg cgccgcacaa aaaaccctga gcaaccgtgc    347340
     ctgtcggtga tcgtgtcgat cagcctccag ctgacctgat ggctggtgct caccgtgaca    347400
     cggcgacact gcactcaggg cgggggctgg agcggaccag tcctgggcaa gctgaccgaa    347460
     aaggcggcac cttcgcctac agcgcctttc gcccaggcct ggcctccatg ccgcgccatg    347520
     atgcgccgca catttgccag gcccacgccg gtcccctcga actcctcctg cagatgaagg    347580
     cgctggaata caccaaacaa tttgtcggcg taccgggcat cgaagcccac tccattgtcc    347640
     tgaaccgtca agacagtgaa ctccggacgc tcctccgcgc ggacctcaat caccgcgtgt    347700
     tctcgtgtgc gggtgtactt cagcgcgttc gaaatcaggt tcagtaacac ctgccgcatc    347760
     agagcctgat ccgcccacac cttcggcagg gggtccacca gccaggaaat gtcccgcccc    347820
     cggaggtccg gcagcaactc tgcacggaca tccgtcagca gagcccccag gtcgatcagc    347880
     tggatctgca ggggctggcg ggcgctgcgg gacagatcga gcatcgcgtc aatgaggttg    347940
     ttcatccgct gcgccgactg ctcgatcacc gtcaggtagc gggccacctt cgggtccagc    348000
     ggcgtgtcca gcgccttccg gagcaggctg gtgaatccag cgatatggcg cacgggggtt    348060
     ctgagatcgt gactgacgct gtaggcgaac gattcaagct ccttgtttgc ctctcccaga    348120
     gcctgcgtcc gagcattcag ggcatcccga tgctcagtga gctgctgcgt gaaatccgcg    348180
     cgttccagtg caaggctcaa actgcgcatc gtcgtttcga gcagcgcccg gtcgacagcc    348240
     gtccaggcgc gctgatgaaa caaagcgatc acgaacatgc cgacggtgac gccctgcatc    348300
     cggagcggca gggtcgccac ggcctgaatg tgctgcacca tttccttggg gctgtcgctg    348360
     ccgtggacat acgcgtcctg atagaagggc tcatcggtga tcagcggagt agccagactg    348420
     ggcacatcat gagcaaaacc agcgtcgatc agggtctgca gcccttcgtc accgatctcc    348480
     cccacctggg atttcgcacg ccatcgtcct tcttccagct cgtaatacgc cgcgtacccg    348540
     ccaggcagca gagacaacac aatctgctgc gcccttcgta tcagggccac ccggtcggtt    348600
     tccactacca gatccatgga cagttgagcg aaggcttcca gtgcctgatt gcggctctcc    348660
     acttcagcct ggcgagccgc cagggcgtga gtctggtcga cccgctccaa catcagattc    348720
     aggctccgca tcgctgtcgc cagcaaggcg cggtcagagc gggaccatcc ttgatccggg    348780
     gtcagcgcga agctgagcac tccacgccgg tggccaccca ccgtaatggg caagcttgcg    348840
     gttgctctgt ggggggcttc gtcacccgtc aggtccccgg ccgcagggcc aactgcggtc    348900
     tgaaagtaca gttcaccagt actccatgga acagacaggg ctggagcctc atgcagcggc    348960
     agaccagcgt gtaaagcggt ctgcacctcc gggttgccgg gctgtcccac ctgggaacgg    349020
     acgacccacc gagcgtcttc cggctcgtag tactgtgaaa acccgggggc cagcaggccc    349080
     aggatgacct gttgcgtctc gtgaatcaga tgcagcggat cactcagtat gcccaggtca    349140
     tgggtaagtg tcgcgaaggc ctcaaggatc cgggtccggg catcgagttc cgcattctgc    349200
     tcctggagaa cggcagtgag gtccgctgtt cgcagtgcgc ccatcacctg gcctctgagc    349260
     agattcaggt aatcgcggta cggacgatca aaacgtttgc gtgcattgag accgattacg    349320
     aggacgccag ggttggcagc tgcagtactc tcctgcgcca gcggcagaat ggccacctgg    349380
     gtcacaggtt caggccacgg ccccaccgta agtggtgaaa tggactctac tcggacctcg    349440
     gctccgcctc gccatgcttc aggaaggacc gcaaatgtat caaggagtgc cgcatcgagt    349500
     cctgcagccg cctgcagcct cagttcctgg gcatctggga gatacagcag ggtgaacggc    349560
     aggtcatgcg gattgttcaa ctccccctga acaatggcgg aggcgatctg tgacaggtcg    349620
     cttgacccaa gcaggccgga cgcgagagca gccaacgttt cggtgcgccg gatactcaac    349680
     acccgctcgg tggtttcgct gacgctggcc agcattcctt ccacgtgagt ctcgccgtgg    349740
     atgggcgtgt aactgacgtc gaaatagcat tcttccaggt atccgtcgcg gaacagaggc    349800
     accaggatat ccacaaaggc gacgccctcg ccccgctcga gcaccgcatc gaagtaaggc    349860
     ttaaggcctg gatagccgtc atgctcaaaa atgtccgctg tccgccggcc aagcgcgcca    349920
     gggtgcttgt cggcgcccag aatgggtcgg tacgcatcgt tgtaaatggc aatcaggtca    349980
     tgggtccagc cgacatacat gggttgcttg gaggtgagca tcagctcgat gtacgtgcgc    350040
     aggcgcgggg accagtggtc aggcggtccg agggaagtgc tggaccagtc aacctcgcgc    350100
     atcagggcgc ccatctctcc cccgtgttca aaaagtgaac gcccggtcat gagaaggggc    350160
     gcacctggtc aactgtcatg cttcctttta tcaggtaagg aagagcgagg cgcaggaaat    350220
     gagcacagtc atcgttcaca acacggaggc agaagtattg ttgatttcag cgggggtgcc    350280
     tgccctggac aggtaacctg cgtgatccgg taagccgcct tctgagcggg ccaaaagccc    350340
     ggtcatgaaa ccagtacggt cgacagctta tgcactcgcg agaaagcctg gaaagatgac    350400
     cgggcatctg gacccggcgg attggagcct tatagctccc gatggccttc cggcgtgatt    350460
     tctccgggtg tctcgttaca tacccggttc gcctgccagt acttgagaaa tgcatcgatt    350520
     tggcgcagga acgtatcgaa cgcggacgat ttcaccatgt atgaacttgc atgcaggctg    350580
     tacgcttcgc tgatgtcctt tgcggcagca gaggtggaga gcatcaccac cggaatgcgg    350640
     cgcaattttg gctcctgctt gagcagcccc aataactgga agccgctcat tccaggcatg    350700
     ttgatatcca gaagaatcac gtccggcagg gtgggcgtgg aatgcaggaa gttcagggct    350760
     tcctcgccgc tctggacgca tgtcagggtg cagtcgggct gaagttcctc gaacgcttcc    350820
     tgggcgagca gaaggtcagt ggggttgtcg tctaccagca ggtagcggca cggaacggac    350880
     atgtaccctg agaatagagc gtctggagcc gcatgcctgt gcgaaaggtc cccaagcacc    350940
     gcaatgaagg cccggtgtct acccgaaaat gacgtgattc cagcacaagc acattcggtg    351000
     cagcttgttc cactcaggac aatccgttca gtgcctgtaa ggcaggccgg gccgcttcag    351060
     caggcaggtg ccccagcaaa atgagttggg ccaggccgtg cacggtaccc cacattcctg    351120
     cggccacgag atccgggtca ttcggcggaa cgctgccttg cgccatacaa cgctcaatgg    351180
     taaatcggag cagttgctga ttggcctggt gcactgggct cggctggtct gggatgcaga    351240
     ggctcggatc aaaaataaga tggaaagcgt tcgtgtgctg aagtgcaaac tgaatgtatg    351300
     cttcgccgat ggcgaccagc tgatggagcg ggtcgggtcc tgcccgttcg aaagcttcca    351360
     cctgcttttg atagaacgct tccatacacc gctccgcaag agcaagcagg agctgacggc    351420
     gatccgggaa ataatgatac ggcgcagcgt ggctgacgcc tgcatgcttg gcgacctgac    351480
     gcaaactgat atgggcagcc tgctgttctt gaagaaggtc gaatgcagcg gataacagcg    351540
     cttctcgcaa ctgtccgtga tggtagggac gttgctgcgc cgcaggctgg gaacgcagtt    351600
     cccttcgttc caaggcgttt tccgattttg atcttgacac tgtcaacatc atagggcagc    351660
     atggccctgc tggatcttga cgttgtcaag atttaggtgc ccggttctct cgatcgggca    351720
     cctccacctc ttcgtttcgt ctcgaggact ccttatgcgc acccttgtca tcatcggtca    351780
     ccccaatcca aacagctttt gccatgcact ggctcagcag tacatagatg ccgggcgcac    351840
     ttcgggcgcg gagatcagag tgcttgacct ctccacgctc aggttcgacc cctcccttcg    351900
     taatggcttt caaggagcgc aggacctcga atcagaattg caagaagccc aggcgctgct    351960
     gaaatggtgc agtcacctgt gcctgatcta ccccgtctgg tggggctcga ctcccgctgt    352020
     actcaagggt ttttttgacc gtgtgctcct gccgggcttt gcctttaaat accggccgtc    352080
     aggtcttcca gacaaattac tcgctggccg aagcgcgcgt ctgatcgtca ccagtgattc    352140
     acccacctgg tacctcaaat ggatgatgcg agatgcagca attcattctg taaaacacag    352200
     cactctcgct ttctgtggct ttaaagtgcg ggtcagccgg gtggacaatg tccggcaaag    352260
     tagccctgga aagcgcaccc aatggttaaa ccgaatgacc tcggtggcgc tccaggatca    352320
     tcggcactga acaagggggc gcccaagcgc gttgaacgcg aggcagatga cacccacctg    352380
     tctgcgggag aggggagcgc tgaaggctgt ggatcctgaa aggccccgtc tatgcccacc    352440
     ggtcagaccg tgcccaccac cctccaaggc agagggaacc ggcaggaggt gttaccggat    352500
     ccaggctgtg tttccctctt ccacgggcaa ctccgcttct ggacgggccc gccgttgcga    352560
     tcgccgttgg gtctgaaacc atccccagaa ggcgacgccc atcaacagaa cctcggcgag    352620
     atcaccccag gagtacataa gctgtgccgc ggcccggaga ttctcagggg aatctgtcgt    352680
     tcccctaggc cacaacccgg cgtagagcac cttggccaga atggcgtgcg ccgcggtacc    352740
     cagcagaagt acgaccaacc gcgcacggaa cgaggtccgc accgcgaccg gctcgattcc    352800
     tgacaggacc acggcataca ggaacccggc agccaccacg tggcacgcca ccactgtatg    352860
     gagcagagca gagcccagca tgtgggagta cagcggggtg aggtacagca gatacagccc    352920
     ccccacattc agcacgagaa cgctgccggg agacgtgagc agacccatgg aaggccaatg    352980
     cagccacctg atcagccgac gtgcgctgct caccggaagg ctgcgcagca acagcgtaag    353040
     cggccagccc agcgccagcg ccagcggcgc aaacatcccc gagaccagat gttgccgcat    353100
     gtgcgcccgg acggaggtgt gggccagggc gttctgcaag ggtgagaatg cccaggccag    353160
     cagggccaga ccgaggatga aggaagccgt tcggtgcacc ggccaggact gccgtttgcg    353220
     ccgctgccgc gctgccatca tcaggtagag tgcccccagg atcagcagca gtccccaacc    353280
     cagcagtgaa aagacttcag gatccgtggt caggctgtgc cgcgaatgca tcaacggccc    353340
     agcgcagctc ggctggcctg tcggtgaagc accacaccaa gcagcagcag cagcagtcct    353400
     gccagattcc acgtcacgtc gtaggggagc aagggcacgc cgtaccgaat ctggtgcgcg    353460
     tgcagcacct tgtgattgac cagtccgtca aacagctgaa accctccgag accaagaaac    353520
     agtccggcgc ggaagtaggc gggcgcaaag gactgggccc gcaggacatc aaccaggaag    353580
     aagatgccag cgacaatggc catcaattcc gctgcatgca gcaggccgtc gctcaccaat    353640
     ccaagggcgg gcgtcgaacg gtcataaaag tggtgccatc caagaacctg gtggaagatg    353700
     atctcatcca cgccggccat gaacgctatt cccagcagag cgccgctcat tcgggagcgt    353760
     cgtatgttca atctgagccc gggaagcccc ggtgtgaccg gacctgtgtc ccggcgctga    353820
     cttgggggga tgttcataac gacctccttg acggagcaaa caagcgggac cgagaaccac    353880
     ccgctggagt tcagacccgt gcttaacaga ccgcgttccc aggctccgta tccattcatg    353940
     tcttctttat ctggctcaaa cagcgttgga ctggcacaca tgtggataaa tccaggtccg    354000
     tccccaccta ccatgaacca cctatggagc gcgcatatct ggaatactcc gatcccaatg    354060
     gagccgaaca caagttttac gaggtgcttg tggagggttc agaactgacg atccgttacg    354120
     gccgtattgg ttccgaaggt caaaaacagg tcaaaaccct cgcttctccg gaaaaagctg    354180
     tggcagaagc agccaagaaa gtcgccgaaa agcgccggaa agggtatgag gacgccgtcc    354240
     agggcatccg tcagaagcgc tccgttgtcc ggcgtacagt cactgaaagt cgcgtcaccg    354300
     taaagaaagt ggccccagtg ctgtggcgct ttcattctgg cgcacccgcc tacggcattt    354360
     tcgttgattc ccagcacgcc tgggtcggca atgagcgcgg tgaagtctat gcgctgaccc    354420
     tcgacggtga gcccaatctg aaattcaaac ttcctgacgg cgtcaaatgc ctggtacgtg    354480
     atgggcgctg gacgttcgcc ggctgtgacg acggcaacgt atacgacctg agtgggaagc    354540
     ttcccttcat ggcctacgag gtgcataccg aagcctcgct gctgtggctg gacgtcaacc    354600
     agggtgttct gggagtcggc gaccatctgg gcggcgtgta tgccttcgac gccgaaagtg    354660
     accagcagtg ggcgaacgtc tcggaggacg ccaacatgac ctggatggtc cgcgtcgatg    354720
     aggcgggcgt gtatttcgga cacagcagag gtatcggcat gttcgaccgc atgagcggtc    354780
     tgcccgtttg ggagcagaag acgcggggga acgtgctgtt cggttggcag gaaggtgagt    354840
     ctgtgtatgc cggcacctcc gcaagtctgg tgcaacgctt caacaaaacc ggcaggcacg    354900
     aagccgacta ccagtgcgac agcagcgtcc tgtcctgcgc gaccagcagc agtggcaaat    354960
     acgtcttcgc cggggacagc gcaagtgcca tctactgctt tgcggaagat gggacccggt    355020
     tgtggaagct ggggagtggc tgcggcagtg tgctgagcat gcagtacttc caggagcggc    355080
     tgtacctggt caccacgacc gggttcctgg ctgccgtgga tgccagtgcc acagccatcg    355140
     aagtcgccca gcagggcgtc acaccacaga tgcgcgaagt gaaaccagct gcaattgagg    355200
     cgcacacccc gccgacgagc ctgaccctga ccaacgacgt gggtgaaggc attgtgttga    355260
     tctgtacccg ggaagccggg aagttgcgtg tcagggcggc gggtccggag tatcgcccct    355320
     ggaatgtgca gtttccacgt gaccttcgag aggagggagc ccggtacgtg gtcgacgggc    355380
     tgcttgatgc cggcggtttt taccgggtag ttggagaaat acgccggctg aacggtgagt    355440
     gattgcccca aacgacccca ctgacctccc agccgatcgc ccggagtcct gcattggctg    355500
     cgtgaccttc ttcgtggcct ttggaatcac gccgattccc gccgcatata gcctctgggg    355560
     agcctgggac gggtgggcag atgcgcatgt gcgccatgga cagcacagac cttacggcga    355620
     actcgtctgt gtcctggtgc ctatggcaag ctgatacagc tgagaaaaag cgcatgttgc    355680
     tgctggcgat gaccggagcg ggcaaggatc aagagctcac ccctgcattc agacccagca    355740
     tgtccacgaa ctacaggact ctcagcccgg gtgagccgag ggggctcggt gcagagtatg    355800
     tggcccgcga tgatcagtcc ctacgcaggt gcgtgggaaa actcgtagga ccacagctct    355860
     tgactctgac gcatgtgtca gggtttaagt tgagggcgtg gagaagttgc gtatcggtca    355920
     agtagcacaa gccagcggcg tgagtgttcg tgccattcgg cattacgaac agctcgggct    355980
     tctggctgcc acacgcaccg acagtcagta ccgggtgttc cagcctgagg acatcgaccg    356040
     cgtcaagctg attcagctgt ttcttagtgt cggcttcaag cttgaagaga ttaaccgctg    356100
     ggccccctgc tttcaggaag gccgctctga ccgggatacg tccccgcagg agatgcacgc    356160
     cttctacatg cgcaagattg caaacgtcga tatgcagctc gcggccctga aaatcgtacg    356220
     cgacaagctc gccaccgagg cgcgccgtat cgaagagcag gccagggacc tccacctcca    356280
     ccccgaccgc tgacccactt acattccttg cctcacacgg ctcccggccc gccgtgagag    356340
     gtcccctcat ggagcatcta tgcgcctgca actcatccgg aacgctaccc ttcgccttgc    356400
     ctacgctggc accacgcttc tcgttgaccc atttctggcc gatcagttca gcctccccag    356460
     cattgccggg aagagccaga accccacggc agctcttcca gtttccgctg agcacgtcgt    356520
     gcagaacgtt gtactcgtgc tggtgtcgca cctgcatccg gaccatattg accttacgcc    356580
     tccacgcatt ccaacgcagc tgcccctgct aagtcagccc actgacgcag acgctctacg    356640
     cgctgccgga ttcactgacg tgactggcat cagcaatgaa tttcattgga aaggcatctg    356700
     tataactcgc accggtggcg cgcatggtac gggtccagtg ggcgccgcgc tgggagaggt    356760
     aagcggcttc gtgctccagg caccgggcga accgacggtg tacatcgcag gcgacaccat    356820
     ctggaacgac gatgtacgtg ctgccataca agcctttggg ccggaggtaa tcattacgaa    356880
     ttccggcggc gcactgatcc gggacacact gatcattatg gacacggagc agaccctggc    356940
     tgtggccgcc gccgctccgc aagcaacagt aattgccgtg cacctggaag cctacgatca    357000
     cgccccggtc acccgggacc agttgagggc cgctgcatct gaggcaggaa tcaccgaacg    357060
     cgtcctggtt ccggaggacg gtgaaaccat cgaaatctac gttcagtgac cataggattc    357120
     actcgatccc ccaaaagcca agtgtgatgg tgcttgggga acaccggagg tatgtaaatc    357180
     ttgcaaaact cctatggcgt tgaagccact ctattgaaac acgtcactaa ccgacgtatt    357240
     tcaggcctaa gctttcacat atgagcgaga ttcttctgtt tcatcatgtc ctgggtttaa    357300
     cgaagggagt tcacactttt gccgaacatc tgcgtcaggc agggcataca gttcatactc    357360
     ccgatctctt ccaggggcag accttcgcta ccctggacga aggaatccat tatgccgagc    357420
     aggtgggatt taaaacgctg gaagggcgtg cggtgcggat cgccgacgag ctccctcgcc    357480
     atctcgttta cgctggcttc tcgctggggg tcatgccagc gcagaagctg gctcagacca    357540
     ggacaggagc cctaggggcc ttgttctttc atggctgcct gcctcccgag gcctatggag    357600
     cgggttggcc caccgatctg ccggttcaga ttcacgccat ggatgcagac ccttggtttg    357660
     cggaggacaa agaggctgca caggtcgtcg tgcactcggc ctcaaacggg catctgttca    357720
     tgtaccccgg agacaagcac ctctttaccg actgcagtct ggccgcttat gactccggtg    357780
     cgacctcgct cctgatggag cgcgtcctcg ccttcttggc ccggctgtga atgtgacggg    357840
     gttagaaaac caaccggtca ttactgttat tcagtggact cttcccgcgc ctgcgtgaac    357900
     ggcaccgggg gcaaccgtca gactaagagc agccgcactc agcttccctc ttagtccaga    357960
     gcgggttctc cttactttct gcagcgtcaa ctgcttccgg aactctctgg gttctgctga    358020
     agtctgtcga taaccttatc cttgagcgga tccgaactgc tggttgcgtg atcgagtggg    358080
     agctcgccgt cacgcctcca ttccgttccg gtaccaggat acgttcctct tgttttcgga    358140
     ttcactttcc gaatcgcatc cttggccgct cgtgcagtct gggtcaggtt gttcctggca    358200
     ccagggggga tccggtccgc gataccctgg acccgctgct gtacggaagg gttacggcgg    358260
     tacagggcgt atgctccgcc tgccagcaga aaaaggctcc acggcacgtg aaccgacgtc    358320
     tgattggagg gcaggtggcc agcacgttta cgtatggcct caagttggcg cccctgctcc    358380
     ttcgcgtagg atagaagttc agtccactcc tgctcaagtg tggtgggggg ggttaaagct    358440
     tgctgtgtat tcatcagtca cctccatcaa cttgctagcg actgttcccc agtacagcgg    358500
     gcacacccca gcgtatgcat ctgattgtga gggacaaaca aaacctcgaa gcgagttttc    358560
     ggtgaaaaaa tcgataattc tcaaaaggtt aagaagatgt ggaacttgat cacgaggcaa    358620
     tactttggag ccacccttct tgtttcaaca tccagacacc accatgtccc gggcaatacg    358680
     tgtacacagt cgctgttcga tatattcagc gcccttcgaa cacgtaaaaa tcagtgttga    358740
     gcggcggtac ggtttccctt gaggctaccc ctcaacagtg tccaaggccc gctgtgcaat    358800
     ctgaatacct gggcccgcag ctgcacgttg tttcttcggg gaaccaggca tgacaggggt    358860
     tgaaatggag ccttagcccg gcagccgtcc gggccgacca gggcttgccg ctagtccagc    358920
     cctgtacgct gaccgccgac acgtgtgttc cgactcagaa caccttactg ccgagctttg    358980
     cctcccgctt gggggtcagg aaagtggcct ctccgcttgc ggcgcccggc acctggaccc    359040
     cgaggatcag aacctcgctc atggtcttcc ctaccagccg gggttcgaag ttcagcacgc    359100
     ccaccacctg ttgtcccacc aactcctcgg actgatgctg ggtaaaacgg ccaacactga    359160
     cccggcgccc atatttgccg aaatccaccg tcaaccggta ggcctgtttg ggtgcagatt    359220
     cctcgagaac tgcctcaacc acgcggccca ggcgaatatc cagacgcgcc agcgtctctt    359280
     cgtacgaaac ggctgcttta agatccgatg ccatgtgctc ccaccatccc tgttcagcac    359340
     cctaaaaagc aagcccctgc ccacttctcg tatcgcctgg agtccaggac acaagggaca    359400
     cacattttca ccgctgacct gtcgaagtaa acgggtcctg tcaccttccc aatcactcca    359460
     gtacgttcct gcctctttca cctcgatatg gggcggtggt cggggccgat ctttcaggat    359520
     cgctatcatt cgtccaagtc gccatcaggg gagctgacag tgttggtcag gcgccagggc    359580
     cgctgttgcg agctgatcgg atgtgtaaat tcgcagaaat tcgccagtga attgtctgtt    359640
     cccaggaatg gcaccaacac gactgtcgtc tacctacaaa aatgtgcttt tcttcccgct    359700
     gcctggccac ctctgccctc ccgagtttca ccctgagtcc agcgaccact ggaagcgttg    359760
     aactggcggc cgctgtgcgc ggtccagtgc tttcttctga aagaaatgaa agctgtgaaa    359820
     actcatgcgc ttgacaaggc gaccataaag gcgcttaatg cttagcacac agtcaatctt    359880
     ggaagtgatg tagacaccgt aggcacggcc tgctacccac ttggtcatgc gatacggcca    359940
     cctttgttcg ctcgatcgtt gcgctcgcgc ccaggagcgt aaaggagatc taatgaacgc    360000
     aatccgtccc gcgctcaccc tgaccctcgc tctaaccctc accggcgtga cggttgtcgc    360060
     cgtcgcacag actctgccca agctggcgaa aaaatcaact tacaaagtgg ggtttgcgca    360120
     gacagagagt aacaatccct ggcgcattgc gcagacaaag agcatgcaag acgaggccaa    360180
     acgtctgggc catcagcttg tgtatacgga cgcagctggc tcggcagcga aacaggtctc    360240
     ggatgtcgac agcatgatcg cacagcgcgt cgacgccatc ttcctcgccc cacgtgagga    360300
     gaagcctctc gccgcagcgg tgaaaaaggc gcgcgcagca ggtatccctg tcattctgct    360360
     cgaccgcaat gtggaccaga agctcgcaag ggcgggcacc gactacgtca cgtttatcgg    360420
     cagcgacttt atcgaagagg ggcgccgcat cgggaactgg ctggcaaaga acaagaaggg    360480
     tgaagcccgg gtcatccagc tgctgggcac gacaggatcc tcaccggcca atgaccggcg    360540
     taagggcttt gaagatgcaa tcaaggggaa agccgggatt cgcatcctgg catcgcagac    360600
     tggggatttc gcgcgtgaca agggtcgtca ggtcatggag acgctgctgc agtcacatcc    360660
     agatgtcaac gttgtctatg ctcacaacga cgaaatggcg attggagcca tcgctgctct    360720
     cgaagccgcc ggaaagaaac ccggaaaaga cgtcatgatt ctctccatcg acggtggcag    360780
     ggaaatcgtc aagctgattg tcgatggcaa ggtgaactac gttgtggagt gtaatcccaa    360840
     gttcggaccc aaagccttcg agaccctgag caattacgcc gcgggcaaga aaattccagt    360900
     caaactcatc aatcctgacc gcgaatttac tcctgcgaac gcgaaaaaac ttctggccag    360960
     cgcctactga agccgatggc gaggcgttcc gtgagagatt cacggaacgc ccgttcatcg    361020
     cttgtgattt ctgtgaaatg cctccacacg agcgctcaga cagcgtcaat cccagggaac    361080
     gctcaggagc tgatcgtgaa ttgacgccgc catggcggcc ttcttctctg aaggtgagtg    361140
     aacgtggaac aacccccacc cctgctgctg atgcagggca tcagcaaaag cttttcaggc    361200
     gttcctgcgc tgcaggacgc ccacctgcgc atccgcccgg ctgaggttca cgccctgatt    361260
     ggccagaacg gtgccggcaa atccacactg attaaaatcc tgactggagc gtaccggcgt    361320
     gaccagggca aagtcatctt ccgcgggcag gaggtggaat tcacgtcgcc tcagatggcg    361380
     caggcggggg gaatcagcac catttaccag gaagtcaatc tggtgggctt ccgcagcgtc    361440
     accgaaaata tttttctcgg acgcgaactc aaacgggggc tctttctcga ctggcgccgt    361500
     atgaatgccg aggcacgtca ggtcctggaa cgcttcaacg ttcatgttga tgtgaccagc    361560
     ccactcatgt cgcacagcgt cgccgtgcag cagatggtgg ccatcgcccg cgcggtgtcc    361620
     ttcaggagtg aactggtcat catggatgag ccgacgtcct ccctcgacga ccgtgaagtg    361680
     gaaacgctgt tcggagtgat ccgccagctc aaggcagacg gcgtggcggt ggtcttcgtc    361740
     tctcaccgcc ttgacgagct gtacgcggtg tgcgaccgca tcaccatcat gcgtgacggc    361800
     cagacggtcg ctgaagagaa catggcaacc ctcagcaagt tgcagctggt ggccatgatg    361860
     ctgggcaagg acaccagcga gctgcgccag gaaggtgaaa ccgccttcgt caggaccggt    361920
     gatccaaaag gaaaaaccct gcttgacgcc cagcgacttc acaccggaac tgtcctgcag    361980
     ggagcggacg tcagcgtgcg cgctggcgag atcgttgggc ttgctggatt gttgggctca    362040
     ggccgaaccg agacggcgcg cgccatcttc ggggcggacc ctctgctggg cggggagtta    362100
     cacatgggtg accggccagt gcagttccgt tccccacgtg acgcgattcg ggcaggaatt    362160
     ggtttctgct cggaggaccg caagattgaa ggcatcattc ctgacctgtc cgttcgtgag    362220
     aacctgaccc tcgcgctcct tcctgccctg tcacaacggg gcatcattga cccccggcgt    362280
     caggcggaga tcgtggaccg gttcatcaca aagctcggca tcaagacggc cggacccgat    362340
     cagaagatcc gggaactgtc gggcggcaac cagcagaaag tgctgctggg acgctggttg    362400
     tgcatgaacc ctacactgct gattctggac gaacctacgc gcggcatcga cgtcggcgcc    362460
     aagggtgaaa ttcaggcgct gctaagtgaa ctcgcccgtg aaggtctcgg ggtcctgatg    362520
     atcagcagcg aacttgagga attggccgaa ggtgcagacc gggtggtggt catgcgtgac    362580
     ggccggagta tccgggaact gccccgtgag gatctgacgc aagacgccat catggacgcc    362640
     atggcacacg gggccgcagg gcacagtggg ctgccgattg gaggacaggc atgaccggtc    362700
     cggacgggaa ggtcttgacg accacgatgc ctcctgctgg aacgcggaag gagcgccgtg    362760
     ttcccgagct gctggggcca ctcctggcgc tggtcgtcct gctgctgttc aacgctctgt    362820
     ttacgcccaa cttcctgact ccccagactt taaacgtgaa tctgacgcag gtggcgacca    362880
     ccgtgatcgt ggccgtgggc atgacactgg tcatcgcgac cggaggcatc gacctgtcgg    362940
     tgggcgcctt gatggcgatc agcggcgccc tggctcccat gctgtttcta caccctccgt    363000
     tcggtagtcc cgcactgggt ctggccctcg cttttgtgct gccggtgctg gctgcagggg    363060
     cgtttggact gttcaacgga actctggtcg cccggtttaa tattcagccc tttatcgcga    363120
     ctctgatttt gttcatcgca gggcgcggca ttgcgcaggt gatcaccaac gggcagctac    363180
     agacgttcag ccaccccggg tttcagtaca tcggcctcgg acgtcccctt ggtattccat    363240
     ttcaggtgat cctgatggtg ctggtggtcg gactgttcgc ctgggtcatg cggcgtaccg    363300
     tgttcgggcg gcaggttctc gccgtaggag gcaatgaggc cgcagcgcgt cttgccggag    363360
     ttcccgtggg acgggtgaag ctcgcagtct acggcatcac cgggctgctg gccggtctgg    363420
     cgggcctgat cgtgatcgca atcaatgcgt cctccgacgc caaccaggtg ggcctgaata    363480
     tggaactgga cgcgatcgcg gctgtcgccg tcggcggtac ggtcctgacg ggaggacgcg    363540
     cgaccatcat cggcaccctg attggtgcgc tgatcattca gcttattcgc tacaccctgc    363600
     ttgcccgggg cgttccagag gccgtcgccc tggtcgtcaa ggccatcatc atcctggtcg    363660
     cggtgtatat ccagcgccgc tgatccgacc caaggagacc acaccgacgt gacgaccacc    363720
     cccgctcccc tcgcgtctcc cacccgaatc cgcaccgctc aactcctgca acagtacggc    363780
     gtcctggttg ccctgggtct gcttattctg ttcggagccc tccgttatga cggtttcctg    363840
     acgccttata acatctccac tgtcctggcg tacaactcca tgttcgggct gattgcgctt    363900
     ggcatgacct tcgtcatcat gaccggagga attgatctca gcgtgggaag tgtcgcggcc    363960
     cttgcaagtg tggtcgccgc gctgctcagt ccttatggcc tgtggcctgc cttattcggc    364020
     gcggttgccg cagcgacatt gcttgggttg atcaacgggc tgatcattgc gtatctcaag    364080
     atcctgccct ttatcacgac gcttgccatg ctgctggccg cgcgaggact ggccctgatg    364140
     ttttcgaaca atgaatccgt atcggccgac ttcgatcacg ggtttacgac tttcgggcag    364200
     ggcagcattg gcggcgtccc attcactgca atcgttctgt ttggcgcttt tgcggtagga    364260
     atgctggccc tgcgctatac ccggttcgga cgccatgtgc tggccattgg tgggaacgag    364320
     gaggcgtcgc gcctgatggg tctgcctgtc gaacggacgc tggttcttgt gtatgtactc    364380
     tccggtgccc tcgctggcct cgcgggtgtc attctcgcat cgcagttcgg cgcagggcag    364440
     ccaacggagg gcctgggatg ggaacttacc gccatcgcgg ctgtggtcgt tgggggcacc    364500
     ctcttgaccg gtgggagcgg ttcggtcggg tcaaccctgg ttggggtgct gctgctcggc    364560
     atgatcttca acatcctgaa tttcgagaac ggccgcggaa cgatcagcct cagcgcctac    364620
     tggcaatcag tcatccgcgg tgccttcctg ctggtcgtgg tgcttctcca gaaccgactg    364680
     acgcgaggat caaagcccta aattctgcct gtttatcgct caacgccctc tttctctcgc    364740
     cccggaggat tccatgacgc tcagcagtgc aacgaagccc gtgcaagagc agtacgacgt    364800
     gccatcgatc atggcaggca tttacggaga cggcattatc ggcctcaagg gagccttttc    364860
     ccgggagtgg gtcgcgcagc ttggccgcga acttccggag ctgtacacag cagctctggc    364920
     ccgtccgggc ggcgccgtcg ggcgcgggac caaccggcac tatgtggaga ttcaccccga    364980
     ggacatcagc ggctttctgg atctggtgac ccatccgtgg atcgtggcgg tgtgcaccag    365040
     cgtgctgggt ccgaactaca agatcgtcga gatcggcttc gacgtgccca accccggagc    365100
     gaaagatcag ccctggcacc gcgatttccc ggccacctcc gagacactgg tggaccgccg    365160
     cctgaactcg ctggcgttca acctgaccac cgtggatgtc gaagaagaca tgggtccgtt    365220
     cgaaatcgct ccgggcaccc agtgggatga ccccagcgag tatgaccacg gcatgttccc    365280
     gccggtgtcg ctgttccctc ggtatcacgc cctggcacag cgcaagctgc ccaagatggg    365340
     cgacatttcg gcccgcagtg ccctgaccat tcaccgcggc acggcgaatg tcagcaataa    365400
     accgcgtcct gtactggtgc tgggcgtgga cgcgcctggc gctgggcatg acgagaagca    365460
     cgacctgcag ttcacgcggg cgtattacga ggggttgccg caggaggtca aggatcacct    365520
     gatctgccgg gtggtggatg agcttgaacc catcatgcag gggcacacca tcgagggcct    365580
     catgatgggc gacgcctgaa cgcatgcgag agttcaacag cgtcacggcg ttttttggag    365640
     atctggctgt accggggcgg atagaagccc tggaaggtgg ccgggggctg atgcgggtgt    365700
     cgctgaacgg ggcgccggac atcagcgagg gtgcggaggc catattggaa atgcatgatg    365760
     gcgtgcgctt ccgggtggcc gtcaccgaga ggctggacga taccaacgag gtccggatga    365820
     agctcctggc gcgcagctga cccctggatt gagaaaaacg gtaaggtggt gacgacaagg    365880
     taaagatcgt ttcaaaaggt tatgaagatg cttttgcatg ctctggtgcg gacgtaggcc    365940
     ggggattacg aagccttgca gggccgcgcg ggcgcggtcc gcctgccctg agaaggtgcg    366000
     caaggagttt ccgcgcatac agcacgtgtg ggccgacgcc ggggcttccg gagaaattgg    366060
     tcccggcagt caagcagtgt ttggggctgg acgctggaga tcgtcaatca ttccgggcag    366120
     gcaacgggta gacctgcgta cggatcgacc tccgccgccc agtgaagttc cggagcactc    366180
     tgtggtgctg aagcggcagt gggtgtttga gcacccctcc gcctggctgg gccaatcaag    366240
     gcggatgagc cgggatctgc gagtcttgcc tgaaaccttc gacaacctcg tctacgaact    366300
     tatgtctgct tgatggtgcg tcgtctggct gccgcgtgat ggctcagccc taccctgtca    366360
     aaacgccctt taaagcccgt cgagggccag ccggcagcaa ccgtaaccgg acggttgttc    366420
     atccactgcc ggacttttgc agcgttaccc tacacaatgc ggaagtcaga tatcaggttg    366480
     accagagctg caggaggagg cgtagtgtgc cggctggtaa tcagcgtctg cacctgatca    366540
     gcagatgcca accatgcccg gctggttaca ccaagtttac tgtggtccgc caacacgacc    366600
     acggtgcggg cgtacctgac catgcaacgc ttgacttctg cttcctcatg gttggcattc    366660
     gtaatgccgt tcacagcatc aatgccgtta cagccgagaa acaacctgtc tgcatgaacg    366720
     tggcgcaaga tctcgagggc gtacgggctg accagcgaat gctgcaggcg gcgtagggtc    366780
     ccaccggtga cgatgaccct cacatgcggg agcttttcaa gttccagagc aatattcagt    366840
     ccaggcgtta cgacagtcac ctcccgcaag gttggcggca gatgacgcgc cacttcagtc    366900
     gctgtactgc ccacatccag gaagatcgtt tctccatcct gaatgagggc cgcggcggcg    366960
     cgaccaatgc gtcgtttctc agcgcgttgc tgcaactgca tttcttccag cggggcctcc    367020
     attcgtggat caagtggtag gcgggcgccg cctcgggtgc gtcgcaggtg gcctgtatcc    367080
     accagcgcct tcaagtcact cctgaccgtc acttctgaaa ctcccaaaag tggagcaact    367140
     tctgaaacca ggatctctcc ccggctttga atcagggaca gaatttgttg gcggcgttct    367200
     ttgatcaaca acgttcctct cctcagcaat acgccaagag cccatcaggg taaatccgca    367260
     gtgcctggtg cttaaggaag cttaacgtac agcctcaggc ccagcagcgg gagaggagca    367320
     catcgtcttg gtcctgatgt tccacgcgct ggtggacgcg ctggacatgg tgaagcagct    367380
     gatgaatcct gagcgggcca ggcatcagta cgtcgtcctg gtgcttccac gaaacagttt    367440
     atgcaggtgc gccgcatgcg gattgtggat ccgggcccgc ctgcggcggg agatccggaa    367500
     gaacatgcag cttcccaggg gccttttcca accgacactg aatgaagcag ggggctacac    367560
     cctgcgcccg tgaggccgat tacactgccg acgtgagcct gatacccgtg ccgtcgcccg    367620
     ctccacccaa acgcctggcg ggcatcggag tgggagcctt tctactcctt ggcctgctct    367680
     acccgatcct gggtcctgcc ctcccgctcc ttagtgaaca gttcggtctg cgagcaacag    367740
     gtgcctcact gctgctcagc ctgaattcgg caggtgcagt gctcggtgtg atcctggcag    367800
     gcgtgctgtc ggctcggctc acatcacgga accgttcgtt attggcggtt gccaccctgg    367860
     ccgtgggctg cgtggggctt gcgttcgcgc ctacgttcgt gctggccctg ctggcggccc    367920
     tgctgctggg atcgggcttc ggcatgctcg accttacctt gaacgtgtgg ctctcgacca    367980
     gttacggttt acgcagcgct gccatgctca acctgctcag cgccaccttt ggagtgggcg    368040
     cggtgctcgc accgctggct gtgggctttg cagacggcga cttccgcctg cccctgctgg    368100
     gttgcgccgc cttagcgggc ctgctcttgc tttccctgtt cgctctgccg tctgcagcgc    368160
     cggaagtata cactccaacg caaggcctgc agaccgaagt caggagtccc cgcttgatcc    368220
     tgggcggctt catgtgcctc tttctcgcct atgtcgcagt tgagagcggg gtggccagtt    368280
     gggaggtgac gcacctgcga gatacgttgg gcatcactac gggcacggct tcacaactgt    368340
     ccgcactgtt ctgggtgagc ttcacgcttg ggcggctgat ttccgcgccg ctcgcgctgc    368400
     gcgtcgcgcc agctcacctg gtaaccggaa gtctggtcct ggccgcgttc agtcttgccc    368460
     tggcgacgat ccccgccgtg gcaccctacg cgtacaccct gaccgggttg ttcctagccc    368520
     cggtgttcac gactggactg gtgtggctga cccgcgttct gcctggcggc gcggcgccaa    368580
     cctttgtgtt tgccggcgcg tttctcggcc cggtgctgtt ctcgcctgtg gtgggtgcca    368640
     tgcgggacca gtttggccca cctgccattc ccctcaccct gatgggtatc gcacttcttg    368700
     acctggccat cgtgattggg ctccggcgca acctttaaaa gttccggctg tatggggcgc    368760
     tggacccaga gtggccagct ctgcgctgag aaggaaagac ggccagcatc agtgtccttc    368820
     ctttaacccg ggaccagcac gtcacccccg cccagcagaa actgcacgtg cgtatccgca    368880
     gcctgaatgc tgaaagtgct gccgcagggg aatcccgagg caacatcgct tccgatgaac    368940
     tcccctgcta ctgcctgcac gccaggaccg cgaagccgcg gttcaccgcc tggtatcgtc    369000
     aggcagatca tcggcaagga tggcgttgtg atcctcgggc ccctcaccat gttcgacaaa    369060
     gccaacatcg acaagttcaa cttctgaaca aacaaagcga tcaggcggcc acggaggccg    369120
     cctttttatt gccacactga cgccgccatc attggccgat cggtatgggt gtctcagcta    369180
     gccctgaccc tgcttgctca gcagccgctc cagggcagcc accacctccc ggtcaaactg    369240
     ccggccagtc tggcggcgga tttcctccat cgcctcgtcg agagtccacg ccgccttgta    369300
     cggccgctca ctcgtcaacg cgtccaacac atctaccacc gccacgatcc ggccggacac    369360
     cggaatggct tcgccggcca gaccggctgg atacccggcg ccataccaac gttcatggtg    369420
     ggttcgtgcg atctcttcgg ccattttgat cagtggggac gttccaccgc tcagaatgcc    369480
     ggagccgatc atcgggtgcg ttttgatgat gtcaaattct tctggggtga gccggccagg    369540
     cttcaggaga atggagtcac tgatcccaat cttgcctaca tcgtgcatgg gcgccgcccg    369600
     ttcaagcagc tgcacagtgt cgtccggcag gcccagctcg cgggcgacac ctgccgcaat    369660
     ccgtcctacc cgccgcatgt gctcacctgt gtcatcgtcc cgatattccg ctgcgtgtgc    369720
     cagccgctcg agaatctcaa gctgcgcagc ctgcacctcg ctggccagcc gctcgttgtg    369780
     atcgcgaatg gcgtcctgag cagccttctg ctctgtcacg tctgtgattg ttcccacaag    369840
     ccccttcggg tttccatgca cgtcataaaa cggcgtgcgt gtcgatcgga acgagcgcgt    369900
     cggctggccg ggcagggtcg ctgtcacttc gtactggccg cgctgcccgc tcgaaagtac    369960
     agtctcgtca cgttcacgca tgccggcggc cgtatccggt ggcaacaaca cttcgtcggt    370020
     ctgcccgaga atactgctga aggggcgccc cacgagttcg gctcctgaag cgttcaccat    370080
     caggtactca cgagcggtgt tctttacata gatgacgtca gggacgttat caattacctt    370140
     ccgcagcagg gcgtgactgg tatccagagc ctcccgcgtg acctggagct ctgtcaggtc    370200
     tcggaaaaac gccgcaaagt agaccgtgcc gtcgccctga aacggcgtga cggagatttc    370260
     ggtaggaata acagtgccgt cgcgccgccg catagtcacg agcgtacgtt gccgtggaac    370320
     agcctcggtt ccttcacggc ggtaccggtg cagaagcttg agcgtctcat ccgtcaggat    370380
     caacttccgg acgtcctgcg ccagagcttc atcccggcgg tagccaaaca ggcgctccgc    370440
     ttcggggttc cagtctgtga cgcgggcgtg agcgtccacg attaccaccg catccagaga    370500
     agaggtcagg actgcggcat gccgcgcgtc ctgctgctcc cgttgagcca ccccccggcg    370560
     caattcgagt tcgctcacaa cgctgtcggc caggtcctga agaaacgcac attcatcttc    370620
     ggtgagccca atccggggtg cggtatcgag cacacacagt gaacccaccc ggtgcccgtc    370680
     cggtgtgatg agcggcgcgc ccgcgtagaa gcgtatggcg ctgtccccgg tcaccagagg    370740
     aagagaagag aacctgggat cctgcgtcgt gtccggcacg acaagaacgc cgttcatgcc    370800
     cagagtgtgc tggcagaagg acagggagcg gtccatctcg cggaggtcca taccgtaaca    370860
     gcctttggtc cattgggttc ggtcgtcgag caggttaatc aacgcaatcg gagcgttgag    370920
     cagacgggca gcaaggttaa cggtgcgcct gaaggcagct tcaagtggtg cggcgagcag    370980
     gtggtatcgc cagacagcag tcaactgcag gtcttcctcc agtggttgct gatcagaaga    371040
     atccccggag ccacgaatca ttgggatatg gtagagaggt cagcatctca aagaaccaaa    371100
     cagtttcaca aatgcacatt cgcttaagac actttgttca gcagcactcc cctcacgctc    371160
     tggtgcgccg tttgttcgta gggtccgggc cggggacccc aggaacgcat gattgaacgt    371220
     cagcgtgagg agacgtggca cctgaggcca gacccacgtg ctgccatggg ctctgcatga    371280
     cagcgagagc gtagttgttg aatagccctt taccagaagt caggtcaata gagcgtgagg    371340
     ccgcctggac ctatcctcca gagcgttcac gccagccgcg catccaggcc aggctccatc    371400
     caaggaggag gccccagaca ggcgcgctca cgcccagaac cgtgattccg gaagcggtga    371460
     ccaccagggt cagcagagcc gcttcccgcc accgcgcttc agccaccatg gtgccctcac    371520
     gccctacgag cagcggcccc agcagggcca ggcctgccag tccctgcatc agcggtgccg    371580
     ggaaaatact tgccagtccg agcaggcccc cggcggtgag gcccagcact ccgtacccgg    371640
     ccgcgcaact caggccagcc acgtaccgtt tcgccggatc cggatgggcg tcgggaccgg    371700
     tggagatggc agacgtgatc gccgcgagat tcaaggtgat actcccgaat ggggccgcga    371760
     gcagtgcccc gagtccagtc agggacacca ggggccgtgg gggtacgtgc ccgtacccgc    371820
     tggcgctcag gatcgccagg cccggcaggt gctgcgacgc cactgccagc agcacgctgg    371880
     ggatggtgat tgtaagcagg gcgtgcacat caaacactgg tcggatgtag ctcaggtgtc    371940
     cggcagttcc cgagggcaga aacaagccgt ctggcgacgc accagtcaaa atggtggcgg    372000
     tcaagccggc ggtaagagcc aatggcactg cccagcgggg aacgaaggcc cgggccagca    372060
     ggtaggccgc caccatgggg agcagcagtt cgggcgcggt cgggaccgca ctcagaccgc    372120
     gcaggacaaa tggcagcagc atgcccgcca gcagcgcggc ggccagtggt gggggcaggc    372180
     agcgagcaat ccagtcaaac agaccggtca ggccaaggaa ggtaaggatc agcgcagcgg    372240
     ccatcagggc ccccacggcc tcaccgggcg taaagcgggg accttcagca ataaggagcg    372300
     cgaggccagc ggtattccag ccgaggataa tgggagcgcg gtacagcagg ctcaggccgg    372360
     cgcccagaac ggcgagcgtg aggtacatac tggtcaggct gctcacggcc tgatccgcag    372420
     tgaagtgcag ggccgcgaac atctgcacga acagcggaag gttgctggag gcactcacga    372480
     taacggagat caatccggcc gccagcgcgc tgtacggtag ggcacgcata acgttcagtg    372540
     ggttactcat cctggaacct gtgccgccag gcaagccatc cgacgtacaa cgaacggcgc    372600
     accccggata cgtaccgcct gcccggagtc ctgcagggca ccgcccactg cgaacactgc    372660
     gactcgaaag tcatcctgag cctcgtgatg tgggcgttgc gggattcacc agggcgagaa    372720
     tatgccgccg cagctccggc acgtggccat gaatctaacc aggacacaaa cgccagatgc    372780
     aggcatctgt gcctgaggaa gacagccagt gcagctcgtg tgacgcttgc ccgtcgcggc    372840
     aggcgaaata tggtctttcg ggttctcgag aggaccgccc aggtccacgt gcacactggt    372900
     tgtagggtga gagctccgaa gggagcattc gcaatctgtg cgaatgccgt gtcgctccac    372960
     gcgtttgcgg tagtcaaaca tggagcagaa gtcagcatga agcctacggt cttttccaga    373020
     tgtgccgcgc tgtaatggcg tgcctttatg ccgtgaaatc cctcagttcg gtctcgcgtt    373080
     tccctcagtt cggtctcgcc ttctcctcag ttcggtctcg cgttcgcctc aattcggtcg    373140
     cgtgttcgcc tcagttcggt cgcatatcct tttaaggctc cacttgctca tcgctgtgca    373200
     ggacgcatct cttggggcaa cgcgtactgg tcagcctgcg gggtgtgtgc gacccttttg    373260
     aggaattcac gcgacctttc cgaggaaatc atgcgaccct tttgaggcgt tcgtgcgacc    373320
     cttttgagga attcacgcga cccttctgag gaattgggag aagaaagtcg ccggtgagaa    373380
     caggattttt cggggcagaa cggtgccctt gattgacaat caaatcaatt ctttctgttc    373440
     ttgcttgtaa actcagatca aggtggatat ccgaatcaat gagctagacc tgacgcggtc    373500
     aggcatcatc agtgtccatc gagaccttcc agcaacggac accagctggg aagccgagta    373560
     caccctgggc gaagcaatgt accgggttat gggtagtgcg tttcatgggc gaccacacgg    373620
     ccgtgacgcg gacgtcctgc tcgcgttgca gaccgtgttc tttcgtgcgg gatgcccaga    373680
     ttcgaacgcg atcgaactga ccgccgcgca gctgctcgcc ctcagcgggc atgcccgcaa    373740
     cggtaagaac tatgcgtttc tccgggcgtc tttgctgcgg ctgagcagtg tgaagtggac    373800
     catggtacgc acgcagttcg acgagaaaaa gggacgtcat cagggggaaa ccaccacgac    373860
     cggcatcatc gcggagatgc aggtcacgga ccaggcgacc ggatctcagc gcccatttga    373920
     ggggagggag ctgaccgaaa ccagcccgat ccgtatttct ttcgttccga gcttcgccgc    373980
     gtccatccgg gacgggttct tccagatcct tgacggtgaa ctgatgtccc gtctcgggca    374040
     accgcaggca cggagcctgt accgggttct gcaggcgcac cgggtcacct ccggcggatc    374100
     actggccggg gaactggtgt acaaactcag cgactggttc ggtgcgtgcg ggctggaggg    374160
     cgaacgcatc gataacgcca agcggaccct ggaccaggcg cacgaacgcc tgaaaacaga    374220
     gggatacctg cacaccgtgg agtaccaggg ccggggccgc gccgggaaaa ttacgtacac    374280
     gttttcggcg gccccggaac ctgaactggt agaccagttg atggagcggg gcgttacgcg    374340
     ccctgtcgcg gagaccctgg ccgcagatca tccccagcgt gtggttcctg ccttgaaaat    374400
     ggtagacgaa cgcctcggtt caggctggaa gccccgttcc ctggccgcgt ccgtggtaga    374460
     tgccgtgcgt aaccctgcaa agtggggtta cgtggaacct ggggtgccgg tgagcacagt    374520
     gcctgcccgg aaatcccgga aggcggtggt cgttgaggaa gaggcccggg acccccgcga    374580
     gaccatacgg atcctgctcc gcctgaagct gggccgcgca cccaccgaag aagcatccag    374640
     agtcctccag gagcttgatg aggaagcagt cggcgcggtg cgcgaggcgg tgggccgtcc    374700
     aaaagacgaa gcgctcaagt tggttcgtgc cctcttgaac gtggacctgt gactccattt    374760
     cggcagactg gagcgatgga ccggcgatag agtgaattcc tcagttcggt ctcgcttttc    374820
     ctccaggaga tcaacatgac cgatgatggt atcagccaaa tcgccgtgca ggacgcaatg    374880
     tgtgccaggt ggcgcataag ctggagcaga aagtgcgacc cttttgagga attcgggtag    374940
     atctgttcgc ttaccacctc tgagctgcgc aacgcttatg aggtccgagt cctgatgtga    375000
     ggtggcaagg atccctgcga ccaaagtgta aaaatcaaac atccggcatg agctccacga    375060
     ggggacagcc ggtccccaga tcctcttctg ctgttccggc acatcggtct gggcaacctg    375120
     ccttggtggc cgtacagagg ccggcaaccc ggcacgactg atctattgaa gcagccggcg    375180
     ccaacccatg cgtgatacgt caaggtcctg acgcccatga gcactgcagc atccgcgtgg    375240
     ttctgtcatg ggcgatttca aggctcctgc tgaaaaacac aagcagtgat acggggcccg    375300
     ctcctgccgc agataagcca acactccccg gcggtcaggc ctgttccgga accccccacc    375360
     agggaagatc cgcaaacgga taatgggcgt cgttccccga tttcagtgcc gagtagaatt    375420
     cggtaaaggt atacgctggc tgataaccaa gctctctcct ggccttttcg atagaccagt    375480
     acacgtgacc ccatgaacgc agcaattgat caatatcttc gccgcgccgg ttcaccagct    375540
     ctgaaattcc ggggaactga gactccacca aggccctggg atcctgacgc cactgcggca    375600
     actgctccaa ggaaaaggga acagcagcca tgatgttgaa agcgtcgtac agaatcgtgt    375660
     cgttcttcag gccgagcagg aaggcctgag cgacatcccg gtcatctacc ccgcctttga    375720
     gcagccggaa cccgtaccgc acgaagtttt cggggacgaa cattccaagc cggtacgaga    375780
     tggtccggat gtcatgactc cggctgtaga agcccgccaa ctcctctgca agtgttttgg    375840
     tcatcccgta aaagtcaccc ggcaggcagg gcaaatcttc tgtcaccacg gcaaagctgt    375900
     cgtccggtac ggtgacactg gcaccataca cgcccatcgt gctgcacaga aggaccttct    375960
     tgataccgtg cgcccgggca gcctcataga cgtgataggt cccttccata ttgagtttcc    376020
     agaagtcatc cctggaatga ttggaaaggt gaacgccgtg aagggcagct ccatgaacaa    376080
     taacgtcgac accctcggcc gccgcgaaca catccgcttt gctggtggcg tccccttgaa    376140
     tacattggtg gggactctcc aatggccgga agtccatcaa cacgggggta tagccggttt    376200
     ctgccagggc aggtgccagc acccttccca ggtttccacc tgcaccagta atcagtactt    376260
     tcacgcaggc tccttctgag gcccagtcac ggccagccag cctcgttcag gggggtcacg    376320
     atcacttcgt tcagaacgag ctccgggggc gcagcgcaca tccacaccag cagatccgca    376380
     acccggcgcg gcggaagggc cactgtggga gatgcttcag gtgggttctg gtctctgcgc    376440
     tcctgaggat cgaaggtgcc ccagccggtg gccataccac cggggtacac gacacacgca    376500
     cgtatgccgt gaggtctccc ttctgctgcg agcgcctgcg tgaagccggt cagcgcgaat    376560
     ttagatgcgc agtaggcact ggcattcgcc cagccccgtt tgcctgccac ggacgacacg    376620
     ttgatgatcg tgccgcgtcc tgcgcgctgc atgtacggga aagcggcttt ggccagcaga    376680
     aagggagcgc gcaggttgac gttcaggaca cggtcccaat cctcggcact gagatcgacc    376740
     acgggtccag gaacatctgt ggccgcattg ttcacaagaa tgtccaaccc tcctaatgtc    376800
     tgaacggcct gctggaccac gtccactacg gctggccctg aggacaggtc aaccgcgcac    376860
     accagggctc gtctccccat cgcttccact tcctgcgcca ctgactgcag gttgccttcg    376920
     cttcgcgcca gcagaaccag gtcagcgccc gcctgggcga gtgcgaccgc tgtagcgcgg    376980
     cccaggccac tgcttgctcc tgtcacgagg gcaacctgac cggacaacga atccggagcc    377040
     acacggttgt gccctgtcat gctcatgctc ctggagtaac ctgctcgatc tgtcggatat    377100
     cctcttcctc caggaggggc cgggccgatg cctccacgtt ctgctcaacc tgctcggggg    377160
     tcttgccgcc aggaatcgcg acagacaccg cagggtggtt cagcacaaaa cgcagggcca    377220
     gctggcccag gctgcgttcc tgtgacgtca gtgcgctgag ctgctgcacc tgacccagct    377280
     gcgcctgata ccagtcttcc ctgggccagt tgtggcgcac gtcgccttcc ggaaactcgg    377340
     ttccagccgt aaattttcct gtcagcatcc ccatgcgcag cgggccgcgt accaccacac    377400
     caatgccctg ctcaaggcag tacggaagga tgtgctgctc tgccttgcgg ttcagcaggc    377460
     tgtagtcgag ctgcaccaca tccagcgcag caccatgatt gaaatgctgg acatattcga    377520
     agtcgtcggt agagacacca acggcccgga cccggccctc ctgtttcagc cggtcgaagg    377580
     ctgtcaggaa tgcttcggtc tcacgggggt tgttccacca gatgtggtcg aagtagacgt    377640
     caatgtaatc ggtctgcagc cggcgcaggc tctcttcgaa cgcggcgata atcttctccg    377700
     ggcggtcgta gacgggttcc tgattcgggt cgcggtgatg gcccatcaga ccgcccttac    377760
     tggcaacaac gatctggtca cggcggtttt tgatgacctg ggcaaccagg gtctcactgt    377820
     gaccgttgcc gtacacgtct gccgtatcaa taaagttgac tcccagttcc agtgcccgct    377880
     ccatggcgcg gatggaagca gcgtcctcca ccggacccca ggcgtcgcct ccgatggccc    377940
     aggcgccgaa cccgatttcc gaaacttcaa tgcctgtcct gccgagctga cggtagtgca    378000
     tcacttgctc cttttcccga gttgaaatgg tctggaccca ccttagacct tgcgcgatca    378060
     aggattcttg cctgctcaag cagcgtgaag aaaggccaaa ggatcgggcg ccaagcagtt    378120
     cagtctcctg atcgtgctgc gctgtctgac cggaatgtta ggtctggctg ccctccctta    378180
     cttctgaacg gcctctgtac ctttggaccc accaagccag aaccacgtaa tcagtgggga    378240
     ggtatcccca ccccgccgac tgcttctgtt gccctgagca catgctgcgg aggtaaagac    378300
     acactaagtg tttacatcct tcaaatcata agttaggcta tcctaactta tgaagaagat    378360
     gctccctaaa tttttcctga tagccgggtt gatggccctc gtctcccctg ctgcgtcggc    378420
     tggcgaaaaa gttgcaaaag tcagtgagct caagccagtc cagctgaaag gtggaaaggt    378480
     caaagtcacc acgaccatca acatgatcag cgacctggtt cagaacgtcg gtggcaaccg    378540
     cgtgcaggtc accggtctca tgggcccggg agttgaccct cacctgtata aagccagtgc    378600
     ccgagacgtc cggtcaatcc aggacgccca cctgatcttc tacaacggcc tgcatctgga    378660
     aggcaagatg gtcgacctgt tggaaaggag ccctaaagcc gtcgctgtta ctgatgcgat    378720
     tccaagagat ctgctgatta cgcccccggg gggctttatt gggatcgagg ggctgcagga    378780
     cccccacgta tggttcgacg ttcctttgtg gaagcacacc gttcatatcg tccgggacgc    378840
     cttgacgaag gttgacccct ccggcaggaa ggtatatgcg aacaacgccg cgtcctatct    378900
     caagaaactc gatgccctcc accagcgtgt tgacaagatg atgagcagtg ttcccaagcg    378960
     ccagcgggtc ctgatcaccg cacacgatgc cttcagctac ttcggtcggc gatatggcgt    379020
     cgaagtacgc ggaattcagg gaatctcgac agtcgccgaa gccgggacca aggacattca    379080
     ggaccttgcc acgttcatcg tggaccggaa gattcctgct gtctttatcg aaagcagtgt    379140
     gcccaaacgc acggtggaag ctgtcgtgca ggcaacccgg gcccgtggga cgagcctgaa    379200
     gattggcggc gagctcttct ccgacgccgc aggcgcccct ggcaccaggg aaggcacgta    379260
     catcggcatg gtggaacaca acgcaaggac catcagcgac gcgctgcgtg gcaaataaag    379320
     gagccccgac gtgactgcac ctgctcaccc ggcacccctg gctgtccgtg accttaccgt    379380
     ggcctaccgt gaagcgcccg tgttgtggga cattaacctg gagttccctg ccgggcagct    379440
     ctgcgcgatc gtcggcccca acggagcagg gaaaagcacc tttctcaagg ccgtactggg    379500
     cctcatgccc aaagcttccg gaagtatccg gttttttgga gcgccgctgg cccagtcgcg    379560
     ccgccggatc ggttacgtgc cgcaacgcac cagtgtcgac tgggactttc cgaccgacgc    379620
     cctggacgtc gtcaccatgg gtctgtacgg ccggcttggc tggattcgca ggcccggaaa    379680
     gcgcgagcgc gagctggcca tgcaggccct ggaccgcgtc cggatgaccg agtttgctgg    379740
     ccggcagatc tcccagctct ctggaggtca acagcaacgc gtgtttctgg ctcgtgctct    379800
     ggcacaggat gcagacgtgt actttatgga cgaaccgttt gctggcgtgg acgccaccac    379860
     cgagcgggcc attctggacg tgatgcgcga tctgcaggaa caaggcaaga ctgtggtggt    379920
     tgttcaccac gacctggaca ctgtccggga gtactttgac catgtcaccc tgctgaacgt    379980
     cagtctggtg gcgagcggac ccatcgagac gacgttcagc cctgagctgc tccgcaaaac    380040
     ctacggcggg aaggtcgcct tccttcggga gagcgtggcc ggatgaacgt ggagtttctt    380100
     ctgagcgtgt tcacggatta cacgctgcga aatgttgccc tcggcagtgc gctccttggc    380160
     atcactggag ggattgtcgg cgcgttcgct gtactgcgcc gccagagcct gctgggggac    380220
     gcgctgtcac atgccgcgct gcccggtatc gggctggcct ttcttctcag cggtggtaaa    380280
     gcgcccctgt ggctgctgct gggaggagga gccaccgcct ggctcgcggc actggccatg    380340
     atcactgtac tgaggtttac gcgtctcagc gaggacgccg ccctgggcac catgctcgcc    380400
     agcttttttg gttttggaat tgcgctgctg acttttattc agaatggcag caacgccagt    380460
     cagtccggac tcgacaagtt cctgttcggt caggcggcca ccatcgtcgc cgccgacgtc    380520
     atcctgatgg ccatccttgc cgcacttgcc ctgggcgccg tcatgttgct gttcaaggaa    380580
     ttcaagctcg tgtcgtttga tcccgcttac gccgccacgc tcggagtgcc ggctcccctg    380640
     atcgggaccg tgatgacctc tcttgcagtg gtcgcggtca tgatcgggct gcaaagcgtc    380700
     ggcgtggttc tgatggccgc catgctggtt gccccagcgg tcgcggcccg gcaatggacc    380760
     gaccatctgg gaaaaatgct cctgttgagt gccggcttcg gtgccgcgag cggagtcgca    380820
     ggagcactgg tatctgcagc ggtcacgaac ctgcccacag gcccactcgt gatcgtggcc    380880
     atcagtatcc tcatgatctt ttcgcttctg ttcgctcctt tacgtggtct gctttgggcc    380940
     cgcatcagtg cgtcccgccg cgacaggaat ctgagagaaa gtacacgccg gatcgttcca    381000
     ccgctggggc atctgcacga tcagggggta cagcatgagc gctgatctga ttattgtcct    381060
     cacggcatgc ctggtggcgg tagcaggcag cctgctgggt gtctttctgg tcctgcgccg    381120
     cctgagcatg atcagtgacg ccatcagcca ctccgttctg cctggcatcg tggcggcgtt    381180
     ctggttctct ggcggagaca ccgccaccgt tcccgccctc atcggtgccg ccgccatggg    381240
     actgctgacg gtcgtggcgg tcgaagttct ggtgcgaagc ggccgggtca aaaacgacgc    381300
     agcgatcggt gtagtgtttc cgctgctgtt ctcgattggc gtgattctga tctcggtgta    381360
     cttccgtaat gctcaccttg accttgacgc agtgctgtac ggggagatcg cgtatgcacc    381420
     gtttaacctt gtcggcgtct ttggtcagat gctgccagaa tctctggtgc tgatgggcac    381480
     cttgacgctg ctcaacgcag catttgtggg catgtttttc aaggaactgc ggctgtcgac    381540
     ctttgacgcg ggcctggcgg cgtctctggg gttcgctcct ggggtcctgc attacgcgct    381600
     gatgaccttg ctctccttta cgacggtggg cgcttttgag gcagtcggcg ccgtcctgat    381660
     tgtggcgttt gtgatcgtgc ctccggccag cgcctacctg cttacgcgca agctgtcggc    381720
     catgctgggc ctgagcctcg gtataggcgt gatctgcagc gtcgcagggt atttcgtggc    381780
     catggcggtt gacgcgagta tcgccggaat gattgccagt ctgcttggcg ccgtgttttt    381840
     tctgtgcctg ctgctttctc ccctggatgg cgttctcgct accctatacc ggcgcgcacg    381900
     tcagcgcgac tcggttgccg cccgccagct ggtcgcatac tttttcaaga aaggtcggga    381960
     agcctccctg tccgaggtcg cgcaacgctt cgagtggaca cctcgtcaaa caaaacgagc    382020
     ccatcactac gcgcgtaagc aggggtggct gagtcaggac ggcgtcaccg tctccaggac    382080
     cccgccaggg atgggcatgg gccatgcctc ggactgaacg ctgttcgcac gtatcgccag    382140
     cgcagggaaa gtacctcatg cggctgctgt atctccagga gacggcaggt acacacgttg    382200
     tgtccactgg acgcctcgcg caggacctga atgtcaagga ctcgtccgtg actgggatgc    382260
     tcgaaaggct tgctgaggct ggttgggtca tatatatgcc ctaccgtgga gcgcggttga    382320
     gcgagcaggg cttatgtatt gcgcgtgacc tgacctgtac tcatgacaac ctgattgctt    382380
     ttctctgtga gacgctagga tattctcttg caaacgcgga aagtgaagca gagcacttag    382440
     agcatcatgt cagtccggaa tttattcagc ggctgaagat ttggatcaag caaaagaatt    382500
     gaggaggcca gcggcctcct caattctttg actgatcaaa acttccctaa tagcctagct    382560
     catttcataa aactttttta taaaaacccg gaataatcaa gtgagaagtc attgttaata    382620
     atgagagcac agtaaaacat ccaattctct ttctcctgca tataaccaga cagcacagga    382680
     atggtatcca agctgttcct gcaggaggcc agaatgagcc gcattgaacc ccgtaaccgc    382740
     accgcaggtg ccactcctcc ccctcccatt ctgaattccc agggaatagg gcagatcaaa    382800
     tctgaaatga atcttctgga tgcccggttg cttggctggt gggcacaaca cggggtcact    382860
     ttgctgcgtt tgagcctggg gatcatcttc ttctggtttg gagtgcaaaa attcttcccg    382920
     ggcgtgagtt ctgccgaagg tcttgcgacc cggaccatct cggttctgac ctttggtgcg    382980
     gtgcctcctg gcgtaagtct ccccgtgctg gccacctggg agtgcgccat cggcctgggc    383040
     ttgctgacag gccgcttcct taggctgacg ctgctgttac tgttcgcgca gatggctgga    383100
     acttttctcc cgctggtgtt ttttccggag gaaacgtttt ccgtcgtgcc ctgggtgccg    383160
     aacctggaag ggcagtacat catcaagaat ctggtgctgg tctcagccgg actggttgtt    383220
     ggcgcgacag cgcgaggagg caaactcatc atggatgcac gtgctgctca aaccgccgag    383280
     cggacgcaag cgcttcatca gagatttcgc cgccgcttcc atcgtgaacc ctgagcgaca    383340
     tgctgcgcgg taacgaagga cggtcatacg cccgatgacc gtcctcagcc cagactgcga    383400
     aagccagccc accgagaccg gtccgcctga agcgtgaccg gactgccgaa ccgcacagga    383460
     gcccaggtat gcatgacgag ctgaacgcca cgttgtccgc cggagaatct tcgactgagc    383520
     atggcccgac gcgccggaac tttctggcgc tgggtgccgc cgcggcgggt gcgctggcca    383580
     caggatcgtt cggatcggcc cagactgcca catgtatcga cattccggag cggccgacag    383640
     ctaaaagacc tgacccgcaa cccaacccgc gcgtctacag cgataaagag accctgctgg    383700
     ccttccgcaa tcatgggcat ttcgcagagt tccttgacca gccggtcacg ccgctgggca    383760
     tgcattacct gctggttcac ttcgacgtac caaagctgag cgccaacggc tatgagatct    383820
     ccatcggtgg ccgcgtgcgc acgcccaaac gggtgtctct gtccgagatc aaagcgcgca    383880
     agcagataac ggaacccgtg atcatggaat gtgcgggcac cggccgctcg acctttcagc    383940
     cgcgtggcat ctacgtgccg tggttcaagg aggccatcgg gaactatgag tggacgggga    384000
     cccctctgcg tcctcttctg gaagaagctg ggctgctgga tgacgctgtc gaggtcctgt    384060
     ttaccggctg ggatacgggc gtggacctgg gggtcgaaca tgcctttgag cgcagccttc    384120
     cgatcaagga agcgctccgg gacggggtca tgctggcctg ggcccagaat ggccagcctc    384180
     tgctgcctca gcatggcttt cctttgcggc tgatcgtgcc gacgtggtac ggcatggcca    384240
     gcgtgaagtg gctgcgcgcc atcacggtgc tgaaccagcc gttcaaaggt gtggagcagg    384300
     ccaaggtcta ccggtaccag aagagtgcga ccgaccctgg cgttccagtg acagtcaagc    384360
     gggttcactc ggtcatgaag cctcctgggc tggccgacgc catctcgcgc taccgcttcg    384420
     tggcccccgg ccggcacctg ttacaaggga tggcctggtc cggcaccgga gcggtccggc    384480
     gggtggaagt cagtactgac gggggcagaa cctggaaaga cgctcagctc gggcggccag    384540
     ggggcccgta cagctggacg ccctggcgca ccgaatggca ggtgacccaa ccaggtgaat    384600
     atgtgttgtc ctcaagggca acagataccg caggaaatat tcagccgctg agctcggcag    384660
     cgatctggaa ccgtcagggc atgggcggca acgtgatcga acgcatacac gtgatcgtgc    384720
     agccaggtgt gggacggtcg ggcgaccacg tgccctcccg gccacgacag gccgtttccg    384780
     gcgcggacat gcccccacca acaaagtaga agagagacaa gtctcttagg acgggctcgg    384840
     aaaagcgctc agggactcgt gcaaattcct gcggttgaat gcctacaagc cccagggaag    384900
     acgttgatgt tgcatgcaaa actcccagtg ccgccggaac ttgtggtcgc aattgatctt    384960
     gaactgctgc gggtgaacga ccgagcaggt caatattcaa ttccaggttg cctcagtacc    385020
     atgggcctcg caaggactct catgaagtgc tggcagtcgc tcccatagga ggagagtgaa    385080
     aatacagtgt ccatgaacca tcatcgcgag atccgagcaa agacatactc tgaccctcgg    385140
     gcagtggatg taacggaata tccagtgacc cctggggcca ccagacggtg caggataggg    385200
     ccatgactgt tcctgcggcc ctgcccatag gtgacctcgc agccctgact ggagaaacgg    385260
     tcaagtctgt ccggtactgg actgatcttg gactgctgac tgttgggcgg cggcccagcg    385320
     gctaccgggc ttaccccatt gaagctgctg aacagattgc cttcattcgc tctgcccagg    385380
     cggcgggttt caggctcaag gagattcgcc gcattctgag cattcgccag aatggccaga    385440
     aaccctgtgc tcaagtgaaa gaggatctgg aacgtcacct gggagcagtc cgcgtgcaga    385500
     ttgctcaact gcaggccctc gaagcacagt tgcaggcgaa agtcgcctgg gcagacaggc    385560
     atcctgagcc ggactgccac tgcgcaggat gcgtatacct ggaggtgact cccagagctt    385620
     gactctcccc cgtacaggag accttacctt tcaggcatgg cttcttccgg atgctgtgca    385680
     cctgaacccg gcctttcgac cctccctata tgcccaacct gcggcaccac cggcaggact    385740
     gtgaagctga taaccctcaa ggcacttctc aggcctccgg cgctcgccac tctggatccg    385800
     aaccggatct accgtttctg tccgaacagt ggatgtgaag tggtgtattt ctttgatttg    385860
     tttgtttacg tgcgggcaga tgtgaaagta cctgttttcc agaaggatca ggcgaccgac    385920
     acccctgtgt gctattgctt cggccttaca cgtggtgacc tcagcgcggc cacgcagggt    385980
     ggccttccgg aaaccatctc gtccacgatt caggcgcaca tcaaagctgg ccggtgtgga    386040
     tgcgaagtaa acaaccccca ggggaagtgc tgcctcgggg acatttacaa gacgctatcc    386100
     gccttgcagc aggcttcaga acgcagaggg ccaagtcggc tcccttaacc atcatcattc    386160
     tgactcggtg atgctgctgc ggcacggtgc ggcgcgaatt taccagaact gaacacgacc    386220
     ctagtacagt catagtcagc cgaccgggac aggcctctaa agtctctttg cagggtggat    386280
     cggtgcggac ggtccgcaga tcccttgtac caaagacctc ccaacagcac agcgaggaac    386340
     acctatggat atggatatga gcgccatgaa catgttgcca gactggtgga caccagcagc    386400
     ttggatctat ttgatcgcca gcgtcatctc ggccggcttt cttgcatatg acctgtatgt    386460
     ccgcaggcga cgcctgcacg taccggcaat gcgacccgtc tgggtggtca gcgccctgtt    386520
     cctgggccca ctggccattc tgctgtacgc acgctggggc ctggaacttg cagacggccg    386580
     cgcgggttcc acccggatgg cctggatcct gctggccttg ttgcccggcg ctgccgcatc    386640
     gactgtcgct cacctgatag gggtgcctgt ggtgttcggc gctgggtgga ctatcgccgg    386700
     cgatgcgctc tgggcggtgg cgttattcat attgattctc gcgaccctat tgctgtttat    386760
     gtttgatacc gccgccgcaa ccggggagcg tgccaaccat ctcgtcagat tgttcctggg    386820
     cgctttcttc acggtgctgg ccttcgatat cgggatggtc ggctggatgc tgtacctgca    386880
     tggcaatggc ctgatgcagc ccatcactga cgtggtgttt acgacccaga tgcagatcgg    386940
     catgctgttg ggaatgctta cagcgcttcc tgtggctgcg tggcttacac cgaaacctgc    387000
     gtccggtcct caggctttcg tgccgtagcc gaggtgcaac ccctcgatca atctgaaatt    387060
     cgctaaatcc aatggctacg gtgaagacag gcgctgccca acataccagc agcgcctgat    387120
     gcgtcgtgtc cggcatacaa gaatcaagcg cacattggtc agatatggct gagtcaggac    387180
     cgcatctgca cgtatcaact gggatcggga aagagaccag aaatcgggta aatagcggtt    387240
     gagctccgtc ttaccagacg tatgacacgc tttggagtgc ttcacatacg tccgcgccga    387300
     ccgcaatcca gaatgagcag aagctgcccc caccacgtgt acagatgcag ggtgtcgttg    387360
     tcgtgaccgc tgcaagatct gcctcgaaaa ttcagtggaa ttgctgtgta aaaagcgcgc    387420
     ccctcgtcag cgcagacctt gcctgccagg ccgtaagcat tccataggcc cgcttgcccc    387480
     ccgttccgat accgtttccc cttcccaaaa acctgcacat ttggtttcag gaacaacctc    387540
     caggccacgc gtgcatacga ccttcacgtg agcttcccgc acccagatcc ccatcaggct    387600
     gcgtttctct cgagttgcca aacacggtcc tcaacatgaa attggaccgc gaagagacgt    387660
     acctgggcta cggctgcccg caccaggtcg gacaaggggc ctggctgatc gtcgatgtag    387720
     agcagttgca catcaggaga actatgcaca tccaccgcaa ggagattggc gtcaccctcg    387780
     atcacaatct caggcttttc tgcctctaag ccgaaatgaa gcaggcgcgc ggcgagacca    387840
     gatagcaagt cgttcctgcg cgtcttatcc aacaaagtaa tgtgtttgtc gctcgtccat    387900
     cgtccagtgc tttctctcga agaggccaac aggtgacgtt catggttctg ttctcaccca    387960
     cgtagaattg tttggttcac ccacactgtg tccccacagg gtgaggaaga cgattcattg    388020
     aagtgagctg gatttcggac tggcggcgta cttgatcgtc aggtccggaa gcccaccgag    388080
     tgccgccccg ctcagaccac ccagatcatg ggacgccatg aagacgcgcg attcgacttt    388140
     acttcatgac acaggaccgt catggtcaaa cctggtagcg gccaccattt cggtttcatc    388200
     agaagttatg agttacaagt tgccgttcga acgtctgtga ggcgtggggc acaacggcgc    388260
     agctcatttt tatattgtgc tgtgctgcag cccagctgat ccgctgtgtc aaattaggca    388320
     gtcaggctgg gtctggcgaa cttactatgc ggccatgaat caattgcgtt ccccgcttac    388380
     cgggctgggc gttattgcct tcctcggatc gatcatcctg atggccaggc cccagacgca    388440
     actgatgggg ggaccactct tcgggatggt tctggcattg gccctgctgg ttctcgctgg    388500
     gcagttacag gacgccagga gtcatacggc gtctcatctc ctgagcctct gtggtctggt    388560
     cagcctcgct gtctgctttt accgcctcgg ccacaccctc acctggtggt gaacagatgg    388620
     atcagagctg gcgttggaag gtatgccgcc ccatgtggtg ctagatgcgc cgccaattca    388680
     tttctttagg ctcaagattg atctctgatc ttcatcagtc actgcggctc gcctttcctg    388740
     atatatgcca gctgcgattc ctccataatg tggaggatgt ctcctgactt ctggccacgc    388800
     cttttttttg ttctgctgat ctacgtaccg ttcagtctct ggttaagaac tcgggatttt    388860
     cagaactggg agcgtgccgt gctgggtgtt gcagcgatct ttggattgaa cgcgctgttc    388920
     gaagctctgc gcggtactgt gttttaagcc tgacgcactg aggtttgcag agatttctgc    388980
     ttctggtgta ggtgtgcccg gcgaccatgg gctgagcaac tctgataatt accagcccac    389040
     gacatataga acagggtcaa tgcgagtcgc ctagggtaaa aggccaagcg ccataatctg    389100
     tgagcacctt cagcgaacgg tcactatcta agcacccata aaaatccaga tgacaaaacc    389160
     ctcgcctgct ttacctttgt caggccctag cgggggatct attggtgagg gacagaccct    389220
     gaccaccgtt ctgcgaggca cttgaagctc caccttcacg gaaggcggtt ctcgttccgg    389280
     tgggatttgc catagctccc acggacccgg cgacaatcca aaaaatagcg atggtaaacc    389340
     gtaacactgg agaggaaccg ggtatttagc aagtttccag aggcaggaag atgtagtggc    389400
     ttccaaattc ccaaccagtt gcatgggcga ctatcgaaag acccgacggt gagctttccg    389460
     agtacggtat cgtagatatg ttgccagatt gagttaacaa caaaacgact gaatgggcta    389520
     aagtcttaag gccagcagtg tcctgacgcg cttgagggac cgccacatca acaaatgcgc    389580
     ggagaggcgc gctcataaaa actcgaccag acgtgtgata ccggcgcgcg tcttgctttt    389640
     gtcttcatcg ctgacctgta gagattctgc acttaactgc tctccgcctc aaattcgtac    389700
     gatgccagca tgcctatccg ccgctcgctg aagatagcct ggggcattgc gctgactttc    389760
     gcctgcgctt tgatgtttct ggaaccggat gcgatgcatg tggctcaggc cctgctcacc    389820
     ctggtgattc tgagcgccct ttgtgtgctc attcttcatt gttggcgtac aggcgcttat    389880
     cctcttgcga ttgccatgac catctgtggg ttaggggtgc tggcgggtgt cctgatgctg    389940
     ctggtcatca gcttcaccgc ctgatgacat aggacttcca aggctgctgc ccagcagcgt    390000
     cctgatgact gttgacaggc tcgacctgaa ggctatcgtt ttcgtacacc acgcagaatc    390060
     cgccgggtgc catccaggtc tgggtgtgtg ttcagtttgt cttttaactt tgacatgagc    390120
     atcctctaac cacgctttta tacgcgtgaa aggcgactgt agaacgaagg cgggaaggcc    390180
     accagaacgc ctgcccggaa caggtttgac aggttgggtt tattgccttt atcggtgcat    390240
     aggggttgct gagtggtgaa gatctcgggc tcacagcaca tcatgtccgg cgccgcaaac    390300
     tggaggcagc tttggagggg cgcggtctag ctctcccctg ccacaggcca gaggtgcgag    390360
     ggttagcaga tgccagtcat accctttccg gttatgactg gtcaccctga ccttgagcag    390420
     atgtggtgga gcctgtgtca gatagttaca gggctgtgcg agggaaacct actggattgt    390480
     tacagagaaa acgggcaaac ctcccagtgt gttacaggat ggaggtagcc tgtgcgcatc    390540
     gtcgggaccg tgcggagctc cgagcggact tgcgcaggaa gtgtgctgtt tgttcagaga    390600
     gttgcgcgga cgagctcagc tatgcttaaa ccttcgttct tgatttaaat gagaccctct    390660
     ggcacaggat tgctgatagg acggccgcaa ctgcgtcgtg tggaacgtcc atgtcatagg    390720
     gttgcaccag ctgcagcacc tcgtcgtctt cagccatgcg ataaacaggg ccgtgttgtc    390780
     caccgggtcg gtgagggacg ctccatccgg ctcctgggcc atggtggcgt tttcgagcgg    390840
     gccggggcga gttgtgcagg ttcagtcatg tcatggctcc gtaaatctgt ttcatcgctc    390900
     gggtcacggc cgctgcgtcc ggaagtggcc agaagcacta ggccctgctc tgtatgacct    390960
     gcccgagggt gtcggccagc cagcgggcct gctcaggatc aggcacctca aacggcctac    391020
     tcgactcaag ctcctgaggt gtcggaatgt ggttttcagg aacaggccag atgccagccc    391080
     cggggtagtg gccgacacct acctcgtgaa acgccattga gaaagatcat ctgggcgtga    391140
     ggccggctcg ggaaggacga ccgtgtccag cgagaagctc gccgggacca gtgcaccgag    391200
     ccagcgcagc agggcgtcca acgcgacctg atcggtgacc cgacaggcgc cgagcgtccc    391260
     gtcgatgtcc cggacctgtg ctgggtgccg gccagcatac gccatgagcc ggcgtttcag    391320
     gtctgtgtct ccggcgacgt aatccggcgt gccgggtctc acctgccctg tgccctgaag    391380
     gcgttgtaca tgttgtcgaa gaagcgctgc aaccgatcgg cactgctggc cttctggaac    391440
     agcctggccg ttcgagtggc gatgtcctcg gcagccctga agtccaggtt atcttcagcg    391500
     tccaggccga tgttgtacac cggcggcctg agcggcccgc accacatcgt ctggatggag    391560
     gccgccggtg atgacgtcct ggacgcccac ggtgccgtag gtgcggatct cgttgattca    391620
     gccgagcatc tccatcttac taacagatgg gctgacccga atccggctgt agctgcttcc    391680
     ggtgctcacg gcggcacccg cggcagcact cacggcagga atggtcgccc tggcctgcgc    391740
     gacccactcg tcgtaggtca gctccttggg aaaaagctgg ccgacggtgt tacgggtgct    391800
     caggacggag acggtcaggg acgcggccta cagacggaag gtgagggtca tgggatctcc    391860
     ttgttggagg tagaggcggg ggacaggcgg cgctcagggt atcggtgccg ggaccggcac    391920
     tgtcgagcag cacgccgggc cagatgccga atgctcagtc acgccgctaa gcgcaatgtt    391980
     cagcacagcg accgcaacgg aatgccggtg gggcgtgcga cctcatcgag gtcaccgtgt    392040
     gaatgcgcgg aacccactcg tggaatgtga agtggtggtc ctattgggtg ccggcctgag    392100
     cgaaccgggg agcacgcgat ttttttttgt agaccgcaga acaactcgtg ataacggcag    392160
     ccagaccgtc gcgttgttgc cagtccaggc ggcgccgcca gcaggccacg ccattgccgt    392220
     accccagttg ttggcaggaa gtgccacgag ctcccagtgt gcaggagaag agaaagtttg    392280
     gatttggcct tgaggggtcg cctcggagct ggttgatgca gcgaacccac gtcattctct    392340
     atcgtacggc tgcgtcctcc agcacagagc cgtccgggtc gtggactgga gatgcggaat    392400
     cctcctgctt tgtcgtcctg tagtgcctga atccttctgc ttttttgtgc aggatgcgcg    392460
     ggaggacctc cgggcctatc cggcggaatc ctctcgcttt gtcgtcggga atgatgccaa    392520
     tcctcccggt ttgtcgtggg agattgtagg cttattcctg aaacagttcg tcccgtaacg    392580
     actgcacaaa tgcctcgcgc ttcagttggg tcactgcggt gatgccggcg cgcgcctgat    392640
     ccccggcctg cacggtgccc gacgcaaccg catgacgcaa cgcgtcgagt tcagcgacac    392700
     cccagagctt gcggtagtgc gggttaaggt aagcgataag ccgttcggcc gccatttccg    392760
     gacttaagcc ctcgaactgc gcggagtgat cgacttccgg aatcaccagc aaaggatcca    392820
     tccgagccgg tgctgacctc ggggaggcct cctgcgcagg gtaggggtaa tcgtccggat    392880
     gggcaatcag gtgcatcaaa gcggcggcgg gcgatttttt caccaccagc acctgacgtt    392940
     tgaccagaag atcgaagcgg tccatgctgg cgatcaaaaa agcacgaccc ttgtcacgga    393000
     ccaggcgtcg cgccacgccg tcagcgacgc catacccgcg gaaacgccgc gcgagcaccg    393060
     gatcaatcgg actgtagtcc tcggaaaatt cataaagaat cttctgagac cggccgcgcc    393120
     cgctgatcgt gacgttgcgc aggtatccct tcttcttgag ttcctcatgc ggaccattta    393180
     gtgctttaat gactcgccac gcttcatcct gactaggaat cttgcactgg tctgcccagg    393240
     tcaggacgtt gacctccagg tgggtgagag gcatgtcagg ttcatcgact ttgtaccgcg    393300
     cagcatccag aacccggtac agcactcggg tgcggggccg ggtgagtgtt cccatgaact    393360
     ccatatcgag tggtttgacg tacccgctgc gcaggcttgc gacgatatct tcagcgagac    393420
     gtagcgtgat gatggagcgc aggtcaaagg ttgaggcctg gtcaggggtc gagaaggaca    393480
     gccgctcgat aaaatggaaa ctcgcgtggg tccagcgacg attggggaag tcgcgccagc    393540
     cgccagaaat ggtgaatgac gacgtgtgca ggcgttttag tgactcccgg agggaggaaa    393600
     tgtagttccc gttgttgtgc cacccgcata accggatcag ctggcccaca ctcgtcacca    393660
     gtgtgccgtc atctggttct ccctgttcga agtacaggtt gatcagcgcc gccgtcacgt    393720
     cactgtccag accgtgaggc acccggtact tcggcatcgc ttcgcagctc acacggacca    393780
     ggcggtcgcc cgcatcaaac tgcacgtccc agcggtccat gtcgacggta tccagggcca    393840
     cgattagatt cagacccgca aggttcaggt cgtcgtactg tttcttcttc agggaggaag    393900
     cgtcgctgat gattgaagtt tacgtaagcc tgaagagaaa agatattgaa ataaaaaatg    393960
     aatgacatca tcagtacgga cggaaaaaga ctgtccagga aggtgggaat cccagaaacc    394020
     tcctgctatg tcgtaggaaa tcctctcggt atgtcgtcgg aaatgcgacc agaacctcct    394080
     gctttgtcgt gacttgggcc caggagcctc ctgaattgtc gtccacaatc ctcctgctct    394140
     atcgttcgag atcctcctgg tttgtcgttc ttcgctgcga aaacctcctg ctttgtcgtg    394200
     cttctcttca ggaagaacct cctggtctgt cgttcggaat cctcctgctt tgtcgtcggg    394260
     gatcaagccg atcctcctgg tttgtcgtgc tcgacagtga acagccgcgc gtacacttcg    394320
     ggcaggtgag actcggtttt ttggctggtg gattgatacc gacttctggg tggcttcgtc    394380
     ggtgatccgt tatccaggcg aatactgctg aaaaaatcac tcgcgtacac ccttcatgag    394440
     atggtggggt ttggttcaag tcaaaggagt aagcatgatt cgacgaaccg ccttgctcac    394500
     cactttgacc ctcctgatca ccgcctgcca gaccaccccc agcgccttca gcacccctgg    394560
     gtaggccgtg cagcagatcg agctgcagga catgcgatgc gcctcggtag caccatccag    394620
     cgcactatca ggacggacct gtgggcgtag gacttcaagg cgttgcccct caacaagcag    394680
     gctcttcaaa cccttctgaa gctgcgagaa gaagccgtct cccgctttcc catgctgctt    394740
     aaacaggaca ccagaattgc tgaggctacc cagctcacca gccgcagtga acagcgccgc    394800
     gtgaccaata acgtctcgac ctaagcaagc tgcctgggtc aagaccgtca cgttgaacat    394860
     cgataaagga gaaatgtaca gcacctacct tgctcaagag ttgcggggcg gataccgccc    394920
     cacctacacc aaggcttgca ggccgacgcg cacttcagct gcaggcaccg gatcatcgat    394980
     gggcacgggc aatctgcccc ggacctcgcc gagactgaag tggtcacctt caagaccccc    395040
     gccactcccc tggtgaaaac tcagctcagc cgcacagaag ctttcctcca gcagcttgac    395100
     cagagttccg gaaaaaactc tccgccgcac tttgagagga cggggacatc gtcacccgca    395160
     gaaaataatc ctgcttattc aagggtccgc gcttagcgcc cagaacctcc agaccctcgc    395220
     catcagggcc ctgac