(data stored in ACNUC7421 zone)

EMBL: CP001120

ID   CP001120; SV 1; circular; genomic DNA; STD; PRO; 4888768 BP.
XX
AC   CP001120; ABEM01000000-ABEM01000049;
XX
PR   Project:PRJNA20045;
XX
DT   25-JUL-2008 (Rel. 96, Created)
DT   15-MAY-2014 (Rel. 120, Last updated, Version 6)
XX
DE   Salmonella enterica subsp. enterica serovar Heidelberg str. SL476, complete
DE   genome.
XX
KW   .
XX
OS   Salmonella enterica subsp. enterica serovar Heidelberg str. SL476
OC   Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales;
OC   Enterobacteriaceae; Salmonella.
XX
RN   [1]
RP   1-4888768
RX   DOI; 10.1128/JB.00297-11.
RX   PUBMED; 21602358.
RA   Fricke W.F., Mammel M.K., McDermott P.F., Tartera C., White D.G.,
RA   Leclerc J.E., Ravel J., Cebula T.A.;
RT   "Comparative genomics of 28 Salmonella enterica isolates: evidence for
RT   CRISPR-mediated adaptive sublineage evolution";
RL   J. Bacteriol. 193(14):3556-3568(2011).
XX
RN   [2]
RP   1-4888768
RA   Ravel J., Fricke W.F., White D., McDermott P., Mammel M., Rosovitz M.,
RA   Leclerc J., Cebula T., Sebastian Y.;
RT   ;
RL   Submitted (16-JUL-2008) to the INSDC.
RL   J. Craig Venter Institute, 9704 Medical Center Drive, Rockville, MD 20850,
RL   USA
XX
DR   MD5; 2ffa773a1de007bf6bfe2e21adb01b7e.
DR   BioSample; SAMN02604067.
DR   EnsemblGenomes-Gn; EBG00001249638.
DR   EnsemblGenomes-Gn; EBG00001249639.
DR   EnsemblGenomes-Gn; EBG00001249640.
DR   EnsemblGenomes-Gn; EBG00001249641.
DR   EnsemblGenomes-Gn; EBG00001249642.
DR   EnsemblGenomes-Gn; EBG00001249643.
DR   EnsemblGenomes-Gn; EBG00001249644.
DR   EnsemblGenomes-Gn; EBG00001249645.
DR   EnsemblGenomes-Gn; EBG00001249646.
DR   EnsemblGenomes-Gn; EBG00001249647.
DR   EnsemblGenomes-Gn; EBG00001249648.
DR   EnsemblGenomes-Gn; EBG00001249649.
DR   EnsemblGenomes-Gn; EBG00001249650.
DR   EnsemblGenomes-Gn; EBG00001249651.
DR   EnsemblGenomes-Gn; EBG00001249652.
DR   EnsemblGenomes-Gn; EBG00001249653.
DR   EnsemblGenomes-Gn; EBG00001249654.
DR   EnsemblGenomes-Gn; EBG00001249655.
DR   EnsemblGenomes-Gn; EBG00001249656.
DR   EnsemblGenomes-Gn; EBG00001249657.
DR   EnsemblGenomes-Gn; EBG00001249658.
DR   EnsemblGenomes-Gn; EBG00001249659.
DR   EnsemblGenomes-Gn; EBG00001249660.
DR   EnsemblGenomes-Gn; EBG00001249661.
DR   EnsemblGenomes-Gn; EBG00001249662.
DR   EnsemblGenomes-Gn; EBG00001249663.
DR   EnsemblGenomes-Gn; EBG00001249664.
DR   EnsemblGenomes-Gn; EBG00001249665.
DR   EnsemblGenomes-Gn; EBG00001249666.
DR   EnsemblGenomes-Gn; EBG00001249667.
DR   EnsemblGenomes-Gn; EBG00001249668.
DR   EnsemblGenomes-Gn; EBG00001249669.
DR   EnsemblGenomes-Gn; EBG00001249670.
DR   EnsemblGenomes-Gn; EBG00001249671.
DR   EnsemblGenomes-Gn; EBG00001249672.
DR   EnsemblGenomes-Gn; EBG00001249673.
DR   EnsemblGenomes-Gn; EBG00001249674.
DR   EnsemblGenomes-Gn; EBG00001249675.
DR   EnsemblGenomes-Gn; EBG00001249676.
DR   EnsemblGenomes-Gn; EBG00001249677.
DR   EnsemblGenomes-Gn; EBG00001249678.
DR   EnsemblGenomes-Gn; EBG00001249679.
DR   EnsemblGenomes-Gn; EBG00001249680.
DR   EnsemblGenomes-Gn; EBG00001249681.
DR   EnsemblGenomes-Gn; EBG00001249682.
DR   EnsemblGenomes-Gn; EBG00001249683.
DR   EnsemblGenomes-Gn; EBG00001249684.
DR   EnsemblGenomes-Gn; EBG00001249685.
DR   EnsemblGenomes-Gn; EBG00001249686.
DR   EnsemblGenomes-Gn; EBG00001249687.
DR   EnsemblGenomes-Gn; EBG00001249688.
DR   EnsemblGenomes-Gn; EBG00001249689.
DR   EnsemblGenomes-Gn; EBG00001249690.
DR   EnsemblGenomes-Gn; EBG00001249691.
DR   EnsemblGenomes-Gn; EBG00001249692.
DR   EnsemblGenomes-Gn; EBG00001249693.
DR   EnsemblGenomes-Gn; EBG00001249694.
DR   EnsemblGenomes-Gn; EBG00001249695.
DR   EnsemblGenomes-Gn; EBG00001249696.
DR   EnsemblGenomes-Gn; EBG00001249697.
DR   EnsemblGenomes-Gn; EBG00001249698.
DR   EnsemblGenomes-Gn; EBG00001249699.
DR   EnsemblGenomes-Gn; EBG00001249700.
DR   EnsemblGenomes-Gn; EBG00001249701.
DR   EnsemblGenomes-Gn; EBG00001249702.
DR   EnsemblGenomes-Gn; EBG00001249703.
DR   EnsemblGenomes-Gn; EBG00001249704.
DR   EnsemblGenomes-Gn; EBG00001249705.
DR   EnsemblGenomes-Gn; EBG00001249706.
DR   EnsemblGenomes-Gn; EBG00001249707.
DR   EnsemblGenomes-Gn; EBG00001249708.
DR   EnsemblGenomes-Gn; EBG00001249709.
DR   EnsemblGenomes-Gn; EBG00001249710.
DR   EnsemblGenomes-Gn; EBG00001249711.
DR   EnsemblGenomes-Gn; EBG00001249712.
DR   EnsemblGenomes-Gn; EBG00001249713.
DR   EnsemblGenomes-Gn; EBG00001249714.
DR   EnsemblGenomes-Gn; EBG00001249715.
DR   EnsemblGenomes-Gn; EBG00001249716.
DR   EnsemblGenomes-Gn; EBG00001249717.
DR   EnsemblGenomes-Gn; EBG00001249718.
DR   EnsemblGenomes-Gn; EBG00001249719.
DR   EnsemblGenomes-Gn; EBG00001249720.
DR   EnsemblGenomes-Gn; EBG00001249721.
DR   EnsemblGenomes-Gn; EBG00001249722.
DR   EnsemblGenomes-Gn; EBG00001249723.
DR   EnsemblGenomes-Gn; EBG00001249724.
DR   EnsemblGenomes-Gn; EBG00001249725.
DR   EnsemblGenomes-Gn; EBG00001249726.
DR   EnsemblGenomes-Gn; EBG00001249727.
DR   EnsemblGenomes-Gn; EBG00001249728.
DR   EnsemblGenomes-Gn; EBG00001249729.
DR   EnsemblGenomes-Gn; EBG00001249730.
DR   EnsemblGenomes-Gn; EBG00001249731.
DR   EnsemblGenomes-Gn; EBG00001249732.
DR   EnsemblGenomes-Gn; EBG00001249733.
DR   EnsemblGenomes-Gn; EBG00001249734.
DR   EnsemblGenomes-Gn; EBG00001249735.
DR   EnsemblGenomes-Gn; EBG00001249736.
DR   EnsemblGenomes-Gn; EBG00001249737.
DR   EnsemblGenomes-Gn; EBG00001249738.
DR   EnsemblGenomes-Gn; EBG00001249739.
DR   EnsemblGenomes-Gn; EBG00001249740.
DR   EnsemblGenomes-Gn; EBG00001249741.
DR   EnsemblGenomes-Gn; EBG00001249742.
DR   EnsemblGenomes-Gn; EBG00001249743.
DR   EnsemblGenomes-Gn; EBG00001249744.
DR   EnsemblGenomes-Gn; EBG00001249745.
DR   EnsemblGenomes-Gn; EBG00001249746.
DR   EnsemblGenomes-Gn; EBG00001249747.
DR   EnsemblGenomes-Gn; EBG00001249748.
DR   EnsemblGenomes-Gn; EBG00001249749.
DR   EnsemblGenomes-Gn; EBG00001249750.
DR   EnsemblGenomes-Gn; EBG00001249751.
DR   EnsemblGenomes-Gn; EBG00001249752.
DR   EnsemblGenomes-Gn; EBG00001249753.
DR   EnsemblGenomes-Gn; EBG00001249754.
DR   EnsemblGenomes-Gn; EBG00001249755.
DR   EnsemblGenomes-Gn; EBG00001249756.
DR   EnsemblGenomes-Gn; EBG00001249757.
DR   EnsemblGenomes-Gn; EBG00001249758.
DR   EnsemblGenomes-Gn; EBG00001249759.
DR   EnsemblGenomes-Gn; EBG00001249760.
DR   EnsemblGenomes-Gn; EBG00001249761.
DR   EnsemblGenomes-Gn; EBG00001249762.
DR   EnsemblGenomes-Gn; EBG00001249763.
DR   EnsemblGenomes-Gn; EBG00001249764.
DR   EnsemblGenomes-Gn; EBG00001249765.
DR   EnsemblGenomes-Gn; EBG00001249766.
DR   EnsemblGenomes-Gn; EBG00001249767.
DR   EnsemblGenomes-Gn; EBG00001249768.
DR   EnsemblGenomes-Gn; EBG00001249769.
DR   EnsemblGenomes-Gn; EBG00001249770.
DR   EnsemblGenomes-Gn; EBG00001249771.
DR   EnsemblGenomes-Gn; EBG00001249772.
DR   EnsemblGenomes-Gn; EBG00001249773.
DR   EnsemblGenomes-Gn; EBG00001249774.
DR   EnsemblGenomes-Gn; EBG00001249775.
DR   EnsemblGenomes-Gn; EBG00001249776.
DR   EnsemblGenomes-Gn; EBG00001249777.
DR   EnsemblGenomes-Gn; EBG00001249778.
DR   EnsemblGenomes-Gn; EBG00001249779.
DR   EnsemblGenomes-Gn; EBG00001249780.
DR   EnsemblGenomes-Gn; EBG00001249781.
DR   EnsemblGenomes-Gn; EBG00001249782.
DR   EnsemblGenomes-Gn; EBG00001249783.
DR   EnsemblGenomes-Gn; EBG00001249784.
DR   EnsemblGenomes-Gn; EBG00001249785.
DR   EnsemblGenomes-Gn; EBG00001249786.
DR   EnsemblGenomes-Gn; EBG00001249787.
DR   EnsemblGenomes-Gn; EBG00001249788.
DR   EnsemblGenomes-Gn; EBG00001249789.
DR   EnsemblGenomes-Gn; EBG00001249790.
DR   EnsemblGenomes-Gn; EBG00001249791.
DR   EnsemblGenomes-Gn; EBG00001249792.
DR   EnsemblGenomes-Gn; EBG00001249793.
DR   EnsemblGenomes-Gn; EBG00001249794.
DR   EnsemblGenomes-Gn; EBG00001249795.
DR   EnsemblGenomes-Gn; EBG00001249796.
DR   EnsemblGenomes-Gn; EBG00001249797.
DR   EnsemblGenomes-Gn; EBG00001249798.
DR   EnsemblGenomes-Gn; EBG00001249799.
DR   EnsemblGenomes-Gn; EBG00001249800.
DR   EnsemblGenomes-Gn; EBG00001249801.
DR   EnsemblGenomes-Gn; EBG00001249802.
DR   EnsemblGenomes-Gn; EBG00001249803.
DR   EnsemblGenomes-Gn; EBG00001249804.
DR   EnsemblGenomes-Gn; EBG00001249805.
DR   EnsemblGenomes-Gn; EBG00001249806.
DR   EnsemblGenomes-Gn; EBG00001249807.
DR   EnsemblGenomes-Gn; EBG00001249808.
DR   EnsemblGenomes-Gn; EBG00001249809.
DR   EnsemblGenomes-Gn; EBG00001249810.
DR   EnsemblGenomes-Gn; EBG00001249811.
DR   EnsemblGenomes-Gn; EBG00001249812.
DR   EnsemblGenomes-Gn; EBG00001249813.
DR   EnsemblGenomes-Gn; EBG00001249814.
DR   EnsemblGenomes-Gn; EBG00001249815.
DR   EnsemblGenomes-Gn; EBG00001249816.
DR   EnsemblGenomes-Gn; EBG00001249817.
DR   EnsemblGenomes-Gn; EBG00001249818.
DR   EnsemblGenomes-Gn; EBG00001249819.
DR   EnsemblGenomes-Gn; EBG00001249820.
DR   EnsemblGenomes-Gn; EBG00001249821.
DR   EnsemblGenomes-Gn; EBG00001249822.
DR   EnsemblGenomes-Gn; EBG00001249823.
DR   EnsemblGenomes-Gn; EBG00001249824.
DR   EnsemblGenomes-Gn; EBG00001249825.
DR   EnsemblGenomes-Gn; EBG00001249826.
DR   EnsemblGenomes-Gn; EBG00001249827.
DR   EnsemblGenomes-Gn; EBG00001249828.
DR   EnsemblGenomes-Gn; EBG00001249829.
DR   EnsemblGenomes-Gn; EBG00001249830.
DR   EnsemblGenomes-Gn; EBG00001249831.
DR   EnsemblGenomes-Gn; EBG00001249832.
DR   EnsemblGenomes-Gn; EBG00001249833.
DR   EnsemblGenomes-Gn; EBG00001249834.
DR   EnsemblGenomes-Gn; EBG00001249835.
DR   EnsemblGenomes-Gn; EBG00001249836.
DR   EnsemblGenomes-Gn; EBG00001249837.
DR   EnsemblGenomes-Gn; EBG00001249838.
DR   EnsemblGenomes-Gn; EBG00001249839.
DR   EnsemblGenomes-Gn; EBG00001249840.
DR   EnsemblGenomes-Gn; EBG00001249841.
DR   EnsemblGenomes-Gn; EBG00001249842.
DR   EnsemblGenomes-Gn; EBG00001249843.
DR   EnsemblGenomes-Gn; EBG00001249844.
DR   EnsemblGenomes-Gn; EBG00001249845.
DR   EnsemblGenomes-Gn; EBG00001249846.
DR   EnsemblGenomes-Gn; EBG00001249847.
DR   EnsemblGenomes-Gn; EBG00001249848.
DR   EnsemblGenomes-Gn; EBG00001249849.
DR   EnsemblGenomes-Gn; EBG00001249850.
DR   EnsemblGenomes-Gn; EBG00001249851.
DR   EnsemblGenomes-Gn; EBG00001249852.
DR   EnsemblGenomes-Gn; EBG00001249853.
DR   EnsemblGenomes-Gn; EBG00001249854.
DR   EnsemblGenomes-Gn; EBG00001249855.
DR   EnsemblGenomes-Gn; EBG00001249856.
DR   EnsemblGenomes-Gn; EBG00001249857.
DR   EnsemblGenomes-Gn; EBG00001249858.
DR   EnsemblGenomes-Gn; EBG00001249859.
DR   EnsemblGenomes-Gn; EBG00001249860.
DR   EnsemblGenomes-Gn; EBG00001249861.
DR   EnsemblGenomes-Gn; EBG00001249862.
DR   EnsemblGenomes-Gn; EBG00001249863.
DR   EnsemblGenomes-Gn; EBG00001249864.
DR   EnsemblGenomes-Gn; EBG00001249865.
DR   EnsemblGenomes-Gn; EBG00001249866.
DR   EnsemblGenomes-Gn; EBG00001249867.
DR   EnsemblGenomes-Gn; EBG00001249868.
DR   EnsemblGenomes-Gn; EBG00001249869.
DR   EnsemblGenomes-Gn; EBG00001249870.
DR   EnsemblGenomes-Gn; EBG00001249871.
DR   EnsemblGenomes-Gn; EBG00001249872.
DR   EnsemblGenomes-Gn; EBG00001249873.
DR   EnsemblGenomes-Gn; EBG00001249874.
DR   EnsemblGenomes-Gn; EBG00001249875.
DR   EnsemblGenomes-Gn; EBG00001249876.
DR   EnsemblGenomes-Gn; EBG00001249877.
DR   EnsemblGenomes-Gn; EBG00001249878.
DR   EnsemblGenomes-Gn; EBG00001249879.
DR   EnsemblGenomes-Gn; SeHA_C0118.
DR   EnsemblGenomes-Gn; SeHA_C0253.
DR   EnsemblGenomes-Gn; SeHA_C0288.
DR   EnsemblGenomes-Gn; SeHA_C0289.
DR   EnsemblGenomes-Gn; SeHA_C0290.
DR   EnsemblGenomes-Gn; SeHA_C0291.
DR   EnsemblGenomes-Gn; SeHA_C0292.
DR   EnsemblGenomes-Gn; SeHA_C0303.
DR   EnsemblGenomes-Gn; SeHA_C0365.
DR   EnsemblGenomes-Gn; SeHA_C0378.
DR   EnsemblGenomes-Gn; SeHA_C0570.
DR   EnsemblGenomes-Gn; SeHA_C0603.
DR   EnsemblGenomes-Gn; SeHA_C0664.
DR   EnsemblGenomes-Gn; SeHA_C0670.
DR   EnsemblGenomes-Gn; SeHA_C0782.
DR   EnsemblGenomes-Gn; SeHA_C0791.
DR   EnsemblGenomes-Gn; SeHA_C0792.
DR   EnsemblGenomes-Gn; SeHA_C0793.
DR   EnsemblGenomes-Gn; SeHA_C0794.
DR   EnsemblGenomes-Gn; SeHA_C0795.
DR   EnsemblGenomes-Gn; SeHA_C0796.
DR   EnsemblGenomes-Gn; SeHA_C0798.
DR   EnsemblGenomes-Gn; SeHA_C0878.
DR   EnsemblGenomes-Gn; SeHA_C0879.
DR   EnsemblGenomes-Gn; SeHA_C0880.
DR   EnsemblGenomes-Gn; SeHA_C0881.
DR   EnsemblGenomes-Gn; SeHA_C0882.
DR   EnsemblGenomes-Gn; SeHA_C1003.
DR   EnsemblGenomes-Gn; SeHA_C1049.
DR   EnsemblGenomes-Gn; SeHA_C1195.
DR   EnsemblGenomes-Gn; SeHA_C1244.
DR   EnsemblGenomes-Gn; SeHA_C1302.
DR   EnsemblGenomes-Gn; SeHA_C1364.
DR   EnsemblGenomes-Gn; SeHA_C1365.
DR   EnsemblGenomes-Gn; SeHA_C1382.
DR   EnsemblGenomes-Gn; SeHA_C1397.
DR   EnsemblGenomes-Gn; SeHA_C1494.
DR   EnsemblGenomes-Gn; SeHA_C1499.
DR   EnsemblGenomes-Gn; SeHA_C1556.
DR   EnsemblGenomes-Gn; SeHA_C1557.
DR   EnsemblGenomes-Gn; SeHA_C1818.
DR   EnsemblGenomes-Gn; SeHA_C1832.
DR   EnsemblGenomes-Gn; SeHA_C1839.
DR   EnsemblGenomes-Gn; SeHA_C1947.
DR   EnsemblGenomes-Gn; SeHA_C1948.
DR   EnsemblGenomes-Gn; SeHA_C1949.
DR   EnsemblGenomes-Gn; SeHA_C1950.
DR   EnsemblGenomes-Gn; SeHA_C1951.
DR   EnsemblGenomes-Gn; SeHA_C1952.
DR   EnsemblGenomes-Gn; SeHA_C1953.
DR   EnsemblGenomes-Gn; SeHA_C2017.
DR   EnsemblGenomes-Gn; SeHA_C2085.
DR   EnsemblGenomes-Gn; SeHA_C2086.
DR   EnsemblGenomes-Gn; SeHA_C2157.
DR   EnsemblGenomes-Gn; SeHA_C2158.
DR   EnsemblGenomes-Gn; SeHA_C2159.
DR   EnsemblGenomes-Gn; SeHA_C2202.
DR   EnsemblGenomes-Gn; SeHA_C2218.
DR   EnsemblGenomes-Gn; SeHA_C2220.
DR   EnsemblGenomes-Gn; SeHA_C2222.
DR   EnsemblGenomes-Gn; SeHA_C2234.
DR   EnsemblGenomes-Gn; SeHA_C2236.
DR   EnsemblGenomes-Gn; SeHA_C2354.
DR   EnsemblGenomes-Gn; SeHA_C2366.
DR   EnsemblGenomes-Gn; SeHA_C2466.
DR   EnsemblGenomes-Gn; SeHA_C2508.
DR   EnsemblGenomes-Gn; SeHA_C2637.
DR   EnsemblGenomes-Gn; SeHA_C2669.
DR   EnsemblGenomes-Gn; SeHA_C2670.
DR   EnsemblGenomes-Gn; SeHA_C2674.
DR   EnsemblGenomes-Gn; SeHA_C2675.
DR   EnsemblGenomes-Gn; SeHA_C2676.
DR   EnsemblGenomes-Gn; SeHA_C2677.
DR   EnsemblGenomes-Gn; SeHA_C2780.
DR   EnsemblGenomes-Gn; SeHA_C2796.
DR   EnsemblGenomes-Gn; SeHA_C2828.
DR   EnsemblGenomes-Gn; SeHA_C2829.
DR   EnsemblGenomes-Gn; SeHA_C2872.
DR   EnsemblGenomes-Gn; SeHA_C2874.
DR   EnsemblGenomes-Gn; SeHA_C2875.
DR   EnsemblGenomes-Gn; SeHA_C2910.
DR   EnsemblGenomes-Gn; SeHA_C3002.
DR   EnsemblGenomes-Gn; SeHA_C3007.
DR   EnsemblGenomes-Gn; SeHA_C3008.
DR   EnsemblGenomes-Gn; SeHA_C3009.
DR   EnsemblGenomes-Gn; SeHA_C3010.
DR   EnsemblGenomes-Gn; SeHA_C3011.
DR   EnsemblGenomes-Gn; SeHA_C3173.
DR   EnsemblGenomes-Gn; SeHA_C3193.
DR   EnsemblGenomes-Gn; SeHA_C3201.
DR   EnsemblGenomes-Gn; SeHA_C3202.
DR   EnsemblGenomes-Gn; SeHA_C3224.
DR   EnsemblGenomes-Gn; SeHA_C3225.
DR   EnsemblGenomes-Gn; SeHA_C3267.
DR   EnsemblGenomes-Gn; SeHA_C3294.
DR   EnsemblGenomes-Gn; SeHA_C3296.
DR   EnsemblGenomes-Gn; SeHA_C3358.
DR   EnsemblGenomes-Gn; SeHA_C3453.
DR   EnsemblGenomes-Gn; SeHA_C3467.
DR   EnsemblGenomes-Gn; SeHA_C3544.
DR   EnsemblGenomes-Gn; SeHA_C3576.
DR   EnsemblGenomes-Gn; SeHA_C3584.
DR   EnsemblGenomes-Gn; SeHA_C3587.
DR   EnsemblGenomes-Gn; SeHA_C3625.
DR   EnsemblGenomes-Gn; SeHA_C3694.
DR   EnsemblGenomes-Gn; SeHA_C3695.
DR   EnsemblGenomes-Gn; SeHA_C3696.
DR   EnsemblGenomes-Gn; SeHA_C3698.
DR   EnsemblGenomes-Gn; SeHA_C3699.
DR   EnsemblGenomes-Gn; SeHA_C3700.
DR   EnsemblGenomes-Gn; SeHA_C3855.
DR   EnsemblGenomes-Gn; SeHA_C3955.
DR   EnsemblGenomes-Gn; SeHA_C3956.
DR   EnsemblGenomes-Gn; SeHA_C4077.
DR   EnsemblGenomes-Gn; SeHA_C4222.
DR   EnsemblGenomes-Gn; SeHA_C4223.
DR   EnsemblGenomes-Gn; SeHA_C4224.
DR   EnsemblGenomes-Gn; SeHA_C4226.
DR   EnsemblGenomes-Gn; SeHA_C4227.
DR   EnsemblGenomes-Gn; SeHA_C4228.
DR   EnsemblGenomes-Gn; SeHA_C4260.
DR   EnsemblGenomes-Gn; SeHA_C4261.
DR   EnsemblGenomes-Gn; SeHA_C4262.
DR   EnsemblGenomes-Gn; SeHA_C4263.
DR   EnsemblGenomes-Gn; SeHA_C4264.
DR   EnsemblGenomes-Gn; SeHA_C4314.
DR   EnsemblGenomes-Gn; SeHA_C4315.
DR   EnsemblGenomes-Gn; SeHA_C4316.
DR   EnsemblGenomes-Gn; SeHA_C4317.
DR   EnsemblGenomes-Gn; SeHA_C4318.
DR   EnsemblGenomes-Gn; SeHA_C4328.
DR   EnsemblGenomes-Gn; SeHA_C4330.
DR   EnsemblGenomes-Gn; SeHA_C4452.
DR   EnsemblGenomes-Gn; SeHA_C4461.
DR   EnsemblGenomes-Gn; SeHA_C4462.
DR   EnsemblGenomes-Gn; SeHA_C4463.
DR   EnsemblGenomes-Gn; SeHA_C4464.
DR   EnsemblGenomes-Gn; SeHA_C4466.
DR   EnsemblGenomes-Gn; SeHA_C4470.
DR   EnsemblGenomes-Gn; SeHA_C4471.
DR   EnsemblGenomes-Gn; SeHA_C4473.
DR   EnsemblGenomes-Gn; SeHA_C4474.
DR   EnsemblGenomes-Gn; SeHA_C4482.
DR   EnsemblGenomes-Gn; SeHA_C4509.
DR   EnsemblGenomes-Gn; SeHA_C4510.
DR   EnsemblGenomes-Gn; SeHA_C4512.
DR   EnsemblGenomes-Gn; SeHA_C4717.
DR   EnsemblGenomes-Gn; SeHA_C4739.
DR   EnsemblGenomes-Gn; SeHA_C4770.
DR   EnsemblGenomes-Gn; SeHA_C4771.
DR   EnsemblGenomes-Gn; SeHA_C4772.
DR   EnsemblGenomes-Gn; SeHA_C4891.
DR   EnsemblGenomes-Gn; SeHA_C4961.
DR   EnsemblGenomes-Gn; SeHA_C4962.
DR   EnsemblGenomes-Gn; SeHA_C4963.
DR   EnsemblGenomes-Tr; EBT00001595299.
DR   EnsemblGenomes-Tr; EBT00001595300.
DR   EnsemblGenomes-Tr; EBT00001595301.
DR   EnsemblGenomes-Tr; EBT00001595302.
DR   EnsemblGenomes-Tr; EBT00001595303.
DR   EnsemblGenomes-Tr; EBT00001595304.
DR   EnsemblGenomes-Tr; EBT00001595305.
DR   EnsemblGenomes-Tr; EBT00001595306.
DR   EnsemblGenomes-Tr; EBT00001595307.
DR   EnsemblGenomes-Tr; EBT00001595308.
DR   EnsemblGenomes-Tr; EBT00001595309.
DR   EnsemblGenomes-Tr; EBT00001595310.
DR   EnsemblGenomes-Tr; EBT00001595311.
DR   EnsemblGenomes-Tr; EBT00001595312.
DR   EnsemblGenomes-Tr; EBT00001595313.
DR   EnsemblGenomes-Tr; EBT00001595314.
DR   EnsemblGenomes-Tr; EBT00001595315.
DR   EnsemblGenomes-Tr; EBT00001595316.
DR   EnsemblGenomes-Tr; EBT00001595317.
DR   EnsemblGenomes-Tr; EBT00001595318.
DR   EnsemblGenomes-Tr; EBT00001595319.
DR   EnsemblGenomes-Tr; EBT00001595320.
DR   EnsemblGenomes-Tr; EBT00001595321.
DR   EnsemblGenomes-Tr; EBT00001595322.
DR   EnsemblGenomes-Tr; EBT00001595323.
DR   EnsemblGenomes-Tr; EBT00001595324.
DR   EnsemblGenomes-Tr; EBT00001595325.
DR   EnsemblGenomes-Tr; EBT00001595326.
DR   EnsemblGenomes-Tr; EBT00001595327.
DR   EnsemblGenomes-Tr; EBT00001595328.
DR   EnsemblGenomes-Tr; EBT00001595329.
DR   EnsemblGenomes-Tr; EBT00001595330.
DR   EnsemblGenomes-Tr; EBT00001595331.
DR   EnsemblGenomes-Tr; EBT00001595332.
DR   EnsemblGenomes-Tr; EBT00001595333.
DR   EnsemblGenomes-Tr; EBT00001595334.
DR   EnsemblGenomes-Tr; EBT00001595335.
DR   EnsemblGenomes-Tr; EBT00001595336.
DR   EnsemblGenomes-Tr; EBT00001595337.
DR   EnsemblGenomes-Tr; EBT00001595338.
DR   EnsemblGenomes-Tr; EBT00001595339.
DR   EnsemblGenomes-Tr; EBT00001595340.
DR   EnsemblGenomes-Tr; EBT00001595341.
DR   EnsemblGenomes-Tr; EBT00001595342.
DR   EnsemblGenomes-Tr; EBT00001595343.
DR   EnsemblGenomes-Tr; EBT00001595344.
DR   EnsemblGenomes-Tr; EBT00001595345.
DR   EnsemblGenomes-Tr; EBT00001595346.
DR   EnsemblGenomes-Tr; EBT00001595347.
DR   EnsemblGenomes-Tr; EBT00001595348.
DR   EnsemblGenomes-Tr; EBT00001595349.
DR   EnsemblGenomes-Tr; EBT00001595350.
DR   EnsemblGenomes-Tr; EBT00001595351.
DR   EnsemblGenomes-Tr; EBT00001595352.
DR   EnsemblGenomes-Tr; EBT00001595353.
DR   EnsemblGenomes-Tr; EBT00001595354.
DR   EnsemblGenomes-Tr; EBT00001595355.
DR   EnsemblGenomes-Tr; EBT00001595356.
DR   EnsemblGenomes-Tr; EBT00001595357.
DR   EnsemblGenomes-Tr; EBT00001595358.
DR   EnsemblGenomes-Tr; EBT00001595359.
DR   EnsemblGenomes-Tr; EBT00001595360.
DR   EnsemblGenomes-Tr; EBT00001595361.
DR   EnsemblGenomes-Tr; EBT00001595362.
DR   EnsemblGenomes-Tr; EBT00001595363.
DR   EnsemblGenomes-Tr; EBT00001595364.
DR   EnsemblGenomes-Tr; EBT00001595365.
DR   EnsemblGenomes-Tr; EBT00001595366.
DR   EnsemblGenomes-Tr; EBT00001595367.
DR   EnsemblGenomes-Tr; EBT00001595368.
DR   EnsemblGenomes-Tr; EBT00001595369.
DR   EnsemblGenomes-Tr; EBT00001595370.
DR   EnsemblGenomes-Tr; EBT00001595371.
DR   EnsemblGenomes-Tr; EBT00001595372.
DR   EnsemblGenomes-Tr; EBT00001595373.
DR   EnsemblGenomes-Tr; EBT00001595374.
DR   EnsemblGenomes-Tr; EBT00001595375.
DR   EnsemblGenomes-Tr; EBT00001595376.
DR   EnsemblGenomes-Tr; EBT00001595377.
DR   EnsemblGenomes-Tr; EBT00001595378.
DR   EnsemblGenomes-Tr; EBT00001595379.
DR   EnsemblGenomes-Tr; EBT00001595380.
DR   EnsemblGenomes-Tr; EBT00001595381.
DR   EnsemblGenomes-Tr; EBT00001595382.
DR   EnsemblGenomes-Tr; EBT00001595383.
DR   EnsemblGenomes-Tr; EBT00001595384.
DR   EnsemblGenomes-Tr; EBT00001595385.
DR   EnsemblGenomes-Tr; EBT00001595386.
DR   EnsemblGenomes-Tr; EBT00001595387.
DR   EnsemblGenomes-Tr; EBT00001595388.
DR   EnsemblGenomes-Tr; EBT00001595389.
DR   EnsemblGenomes-Tr; EBT00001595390.
DR   EnsemblGenomes-Tr; EBT00001595391.
DR   EnsemblGenomes-Tr; EBT00001595392.
DR   EnsemblGenomes-Tr; EBT00001595393.
DR   EnsemblGenomes-Tr; EBT00001595394.
DR   EnsemblGenomes-Tr; EBT00001595395.
DR   EnsemblGenomes-Tr; EBT00001595396.
DR   EnsemblGenomes-Tr; EBT00001595397.
DR   EnsemblGenomes-Tr; EBT00001595398.
DR   EnsemblGenomes-Tr; EBT00001595399.
DR   EnsemblGenomes-Tr; EBT00001595400.
DR   EnsemblGenomes-Tr; EBT00001595401.
DR   EnsemblGenomes-Tr; EBT00001595402.
DR   EnsemblGenomes-Tr; EBT00001595403.
DR   EnsemblGenomes-Tr; EBT00001595404.
DR   EnsemblGenomes-Tr; EBT00001595405.
DR   EnsemblGenomes-Tr; EBT00001595406.
DR   EnsemblGenomes-Tr; EBT00001595407.
DR   EnsemblGenomes-Tr; EBT00001595408.
DR   EnsemblGenomes-Tr; EBT00001595409.
DR   EnsemblGenomes-Tr; EBT00001595410.
DR   EnsemblGenomes-Tr; EBT00001595411.
DR   EnsemblGenomes-Tr; EBT00001595412.
DR   EnsemblGenomes-Tr; EBT00001595413.
DR   EnsemblGenomes-Tr; EBT00001595414.
DR   EnsemblGenomes-Tr; EBT00001595415.
DR   EnsemblGenomes-Tr; EBT00001595416.
DR   EnsemblGenomes-Tr; EBT00001595417.
DR   EnsemblGenomes-Tr; EBT00001595418.
DR   EnsemblGenomes-Tr; EBT00001595419.
DR   EnsemblGenomes-Tr; EBT00001595420.
DR   EnsemblGenomes-Tr; EBT00001595421.
DR   EnsemblGenomes-Tr; EBT00001595422.
DR   EnsemblGenomes-Tr; EBT00001595423.
DR   EnsemblGenomes-Tr; EBT00001595424.
DR   EnsemblGenomes-Tr; EBT00001595425.
DR   EnsemblGenomes-Tr; EBT00001595426.
DR   EnsemblGenomes-Tr; EBT00001595427.
DR   EnsemblGenomes-Tr; EBT00001595428.
DR   EnsemblGenomes-Tr; EBT00001595429.
DR   EnsemblGenomes-Tr; EBT00001595430.
DR   EnsemblGenomes-Tr; EBT00001595431.
DR   EnsemblGenomes-Tr; EBT00001595432.
DR   EnsemblGenomes-Tr; EBT00001595433.
DR   EnsemblGenomes-Tr; EBT00001595434.
DR   EnsemblGenomes-Tr; EBT00001595435.
DR   EnsemblGenomes-Tr; EBT00001595436.
DR   EnsemblGenomes-Tr; EBT00001595437.
DR   EnsemblGenomes-Tr; EBT00001595438.
DR   EnsemblGenomes-Tr; EBT00001595439.
DR   EnsemblGenomes-Tr; EBT00001595440.
DR   EnsemblGenomes-Tr; EBT00001595441.
DR   EnsemblGenomes-Tr; EBT00001595442.
DR   EnsemblGenomes-Tr; EBT00001595443.
DR   EnsemblGenomes-Tr; EBT00001595444.
DR   EnsemblGenomes-Tr; EBT00001595445.
DR   EnsemblGenomes-Tr; EBT00001595446.
DR   EnsemblGenomes-Tr; EBT00001595447.
DR   EnsemblGenomes-Tr; EBT00001595448.
DR   EnsemblGenomes-Tr; EBT00001595449.
DR   EnsemblGenomes-Tr; EBT00001595450.
DR   EnsemblGenomes-Tr; EBT00001595451.
DR   EnsemblGenomes-Tr; EBT00001595452.
DR   EnsemblGenomes-Tr; EBT00001595453.
DR   EnsemblGenomes-Tr; EBT00001595454.
DR   EnsemblGenomes-Tr; EBT00001595455.
DR   EnsemblGenomes-Tr; EBT00001595456.
DR   EnsemblGenomes-Tr; EBT00001595457.
DR   EnsemblGenomes-Tr; EBT00001595458.
DR   EnsemblGenomes-Tr; EBT00001595459.
DR   EnsemblGenomes-Tr; EBT00001595460.
DR   EnsemblGenomes-Tr; EBT00001595461.
DR   EnsemblGenomes-Tr; EBT00001595462.
DR   EnsemblGenomes-Tr; EBT00001595463.
DR   EnsemblGenomes-Tr; EBT00001595464.
DR   EnsemblGenomes-Tr; EBT00001595465.
DR   EnsemblGenomes-Tr; EBT00001595466.
DR   EnsemblGenomes-Tr; EBT00001595467.
DR   EnsemblGenomes-Tr; EBT00001595468.
DR   EnsemblGenomes-Tr; EBT00001595469.
DR   EnsemblGenomes-Tr; EBT00001595470.
DR   EnsemblGenomes-Tr; EBT00001595471.
DR   EnsemblGenomes-Tr; EBT00001595472.
DR   EnsemblGenomes-Tr; EBT00001595473.
DR   EnsemblGenomes-Tr; EBT00001595474.
DR   EnsemblGenomes-Tr; EBT00001595475.
DR   EnsemblGenomes-Tr; EBT00001595476.
DR   EnsemblGenomes-Tr; EBT00001595477.
DR   EnsemblGenomes-Tr; EBT00001595478.
DR   EnsemblGenomes-Tr; EBT00001595479.
DR   EnsemblGenomes-Tr; EBT00001595480.
DR   EnsemblGenomes-Tr; EBT00001595481.
DR   EnsemblGenomes-Tr; EBT00001595482.
DR   EnsemblGenomes-Tr; EBT00001595483.
DR   EnsemblGenomes-Tr; EBT00001595484.
DR   EnsemblGenomes-Tr; EBT00001595485.
DR   EnsemblGenomes-Tr; EBT00001595486.
DR   EnsemblGenomes-Tr; EBT00001595487.
DR   EnsemblGenomes-Tr; EBT00001595488.
DR   EnsemblGenomes-Tr; EBT00001595489.
DR   EnsemblGenomes-Tr; EBT00001595490.
DR   EnsemblGenomes-Tr; EBT00001595491.
DR   EnsemblGenomes-Tr; EBT00001595492.
DR   EnsemblGenomes-Tr; EBT00001595493.
DR   EnsemblGenomes-Tr; EBT00001595494.
DR   EnsemblGenomes-Tr; EBT00001595495.
DR   EnsemblGenomes-Tr; EBT00001595496.
DR   EnsemblGenomes-Tr; EBT00001595497.
DR   EnsemblGenomes-Tr; EBT00001595498.
DR   EnsemblGenomes-Tr; EBT00001595499.
DR   EnsemblGenomes-Tr; EBT00001595500.
DR   EnsemblGenomes-Tr; EBT00001595501.
DR   EnsemblGenomes-Tr; EBT00001595502.
DR   EnsemblGenomes-Tr; EBT00001595503.
DR   EnsemblGenomes-Tr; EBT00001595504.
DR   EnsemblGenomes-Tr; EBT00001595505.
DR   EnsemblGenomes-Tr; EBT00001595506.
DR   EnsemblGenomes-Tr; EBT00001595507.
DR   EnsemblGenomes-Tr; EBT00001595508.
DR   EnsemblGenomes-Tr; EBT00001595509.
DR   EnsemblGenomes-Tr; EBT00001595510.
DR   EnsemblGenomes-Tr; EBT00001595511.
DR   EnsemblGenomes-Tr; EBT00001595512.
DR   EnsemblGenomes-Tr; EBT00001595513.
DR   EnsemblGenomes-Tr; EBT00001595514.
DR   EnsemblGenomes-Tr; EBT00001595515.
DR   EnsemblGenomes-Tr; EBT00001595516.
DR   EnsemblGenomes-Tr; EBT00001595517.
DR   EnsemblGenomes-Tr; EBT00001595518.
DR   EnsemblGenomes-Tr; EBT00001595519.
DR   EnsemblGenomes-Tr; EBT00001595520.
DR   EnsemblGenomes-Tr; EBT00001595521.
DR   EnsemblGenomes-Tr; EBT00001595522.
DR   EnsemblGenomes-Tr; EBT00001595523.
DR   EnsemblGenomes-Tr; EBT00001595524.
DR   EnsemblGenomes-Tr; EBT00001595525.
DR   EnsemblGenomes-Tr; EBT00001595526.
DR   EnsemblGenomes-Tr; EBT00001595527.
DR   EnsemblGenomes-Tr; EBT00001595528.
DR   EnsemblGenomes-Tr; EBT00001595529.
DR   EnsemblGenomes-Tr; EBT00001595530.
DR   EnsemblGenomes-Tr; EBT00001595531.
DR   EnsemblGenomes-Tr; EBT00001595532.
DR   EnsemblGenomes-Tr; EBT00001595533.
DR   EnsemblGenomes-Tr; EBT00001595534.
DR   EnsemblGenomes-Tr; EBT00001595535.
DR   EnsemblGenomes-Tr; EBT00001595536.
DR   EnsemblGenomes-Tr; EBT00001595537.
DR   EnsemblGenomes-Tr; EBT00001595538.
DR   EnsemblGenomes-Tr; EBT00001595539.
DR   EnsemblGenomes-Tr; EBT00001595540.
DR   EnsemblGenomes-Tr; SeHA_C0118-1.
DR   EnsemblGenomes-Tr; SeHA_C0253-1.
DR   EnsemblGenomes-Tr; SeHA_C0288-1.
DR   EnsemblGenomes-Tr; SeHA_C0289-1.
DR   EnsemblGenomes-Tr; SeHA_C0290-1.
DR   EnsemblGenomes-Tr; SeHA_C0291-1.
DR   EnsemblGenomes-Tr; SeHA_C0292-1.
DR   EnsemblGenomes-Tr; SeHA_C0303-1.
DR   EnsemblGenomes-Tr; SeHA_C0365-1.
DR   EnsemblGenomes-Tr; SeHA_C0378-1.
DR   EnsemblGenomes-Tr; SeHA_C0570-1.
DR   EnsemblGenomes-Tr; SeHA_C0603-1.
DR   EnsemblGenomes-Tr; SeHA_C0664-1.
DR   EnsemblGenomes-Tr; SeHA_C0670-1.
DR   EnsemblGenomes-Tr; SeHA_C0782-1.
DR   EnsemblGenomes-Tr; SeHA_C0791-1.
DR   EnsemblGenomes-Tr; SeHA_C0792-1.
DR   EnsemblGenomes-Tr; SeHA_C0793-1.
DR   EnsemblGenomes-Tr; SeHA_C0794-1.
DR   EnsemblGenomes-Tr; SeHA_C0795-1.
DR   EnsemblGenomes-Tr; SeHA_C0796-1.
DR   EnsemblGenomes-Tr; SeHA_C0798-1.
DR   EnsemblGenomes-Tr; SeHA_C0878-1.
DR   EnsemblGenomes-Tr; SeHA_C0879-1.
DR   EnsemblGenomes-Tr; SeHA_C0880-1.
DR   EnsemblGenomes-Tr; SeHA_C0881-1.
DR   EnsemblGenomes-Tr; SeHA_C0882-1.
DR   EnsemblGenomes-Tr; SeHA_C1003-1.
DR   EnsemblGenomes-Tr; SeHA_C1049-1.
DR   EnsemblGenomes-Tr; SeHA_C1195-1.
DR   EnsemblGenomes-Tr; SeHA_C1244-1.
DR   EnsemblGenomes-Tr; SeHA_C1302-1.
DR   EnsemblGenomes-Tr; SeHA_C1364-1.
DR   EnsemblGenomes-Tr; SeHA_C1365-1.
DR   EnsemblGenomes-Tr; SeHA_C1382-1.
DR   EnsemblGenomes-Tr; SeHA_C1397-1.
DR   EnsemblGenomes-Tr; SeHA_C1494-1.
DR   EnsemblGenomes-Tr; SeHA_C1499-1.
DR   EnsemblGenomes-Tr; SeHA_C1556-1.
DR   EnsemblGenomes-Tr; SeHA_C1557-1.
DR   EnsemblGenomes-Tr; SeHA_C1818-1.
DR   EnsemblGenomes-Tr; SeHA_C1832-1.
DR   EnsemblGenomes-Tr; SeHA_C1839-1.
DR   EnsemblGenomes-Tr; SeHA_C1947-1.
DR   EnsemblGenomes-Tr; SeHA_C1948-1.
DR   EnsemblGenomes-Tr; SeHA_C1949-1.
DR   EnsemblGenomes-Tr; SeHA_C1950-1.
DR   EnsemblGenomes-Tr; SeHA_C1951-1.
DR   EnsemblGenomes-Tr; SeHA_C1952-1.
DR   EnsemblGenomes-Tr; SeHA_C1953-1.
DR   EnsemblGenomes-Tr; SeHA_C2017-1.
DR   EnsemblGenomes-Tr; SeHA_C2085-1.
DR   EnsemblGenomes-Tr; SeHA_C2086-1.
DR   EnsemblGenomes-Tr; SeHA_C2157-1.
DR   EnsemblGenomes-Tr; SeHA_C2158-1.
DR   EnsemblGenomes-Tr; SeHA_C2159-1.
DR   EnsemblGenomes-Tr; SeHA_C2202-1.
DR   EnsemblGenomes-Tr; SeHA_C2218-1.
DR   EnsemblGenomes-Tr; SeHA_C2220-1.
DR   EnsemblGenomes-Tr; SeHA_C2222-1.
DR   EnsemblGenomes-Tr; SeHA_C2234-1.
DR   EnsemblGenomes-Tr; SeHA_C2236-1.
DR   EnsemblGenomes-Tr; SeHA_C2354-1.
DR   EnsemblGenomes-Tr; SeHA_C2366-1.
DR   EnsemblGenomes-Tr; SeHA_C2466-1.
DR   EnsemblGenomes-Tr; SeHA_C2508-1.
DR   EnsemblGenomes-Tr; SeHA_C2637-1.
DR   EnsemblGenomes-Tr; SeHA_C2669-1.
DR   EnsemblGenomes-Tr; SeHA_C2670-1.
DR   EnsemblGenomes-Tr; SeHA_C2674-1.
DR   EnsemblGenomes-Tr; SeHA_C2675-1.
DR   EnsemblGenomes-Tr; SeHA_C2676-1.
DR   EnsemblGenomes-Tr; SeHA_C2677-1.
DR   EnsemblGenomes-Tr; SeHA_C2780-1.
DR   EnsemblGenomes-Tr; SeHA_C2796-1.
DR   EnsemblGenomes-Tr; SeHA_C2828-1.
DR   EnsemblGenomes-Tr; SeHA_C2829-1.
DR   EnsemblGenomes-Tr; SeHA_C2872-1.
DR   EnsemblGenomes-Tr; SeHA_C2874-1.
DR   EnsemblGenomes-Tr; SeHA_C2875-1.
DR   EnsemblGenomes-Tr; SeHA_C2910-1.
DR   EnsemblGenomes-Tr; SeHA_C3002-1.
DR   EnsemblGenomes-Tr; SeHA_C3007-1.
DR   EnsemblGenomes-Tr; SeHA_C3008-1.
DR   EnsemblGenomes-Tr; SeHA_C3009-1.
DR   EnsemblGenomes-Tr; SeHA_C3010-1.
DR   EnsemblGenomes-Tr; SeHA_C3011-1.
DR   EnsemblGenomes-Tr; SeHA_C3173-1.
DR   EnsemblGenomes-Tr; SeHA_C3193-1.
DR   EnsemblGenomes-Tr; SeHA_C3201-1.
DR   EnsemblGenomes-Tr; SeHA_C3202-1.
DR   EnsemblGenomes-Tr; SeHA_C3224-1.
DR   EnsemblGenomes-Tr; SeHA_C3225-1.
DR   EnsemblGenomes-Tr; SeHA_C3267-1.
DR   EnsemblGenomes-Tr; SeHA_C3294-1.
DR   EnsemblGenomes-Tr; SeHA_C3296-1.
DR   EnsemblGenomes-Tr; SeHA_C3358-1.
DR   EnsemblGenomes-Tr; SeHA_C3453-1.
DR   EnsemblGenomes-Tr; SeHA_C3467-1.
DR   EnsemblGenomes-Tr; SeHA_C3544-1.
DR   EnsemblGenomes-Tr; SeHA_C3576-1.
DR   EnsemblGenomes-Tr; SeHA_C3584-1.
DR   EnsemblGenomes-Tr; SeHA_C3587-1.
DR   EnsemblGenomes-Tr; SeHA_C3625-1.
DR   EnsemblGenomes-Tr; SeHA_C3694-1.
DR   EnsemblGenomes-Tr; SeHA_C3695-1.
DR   EnsemblGenomes-Tr; SeHA_C3696-1.
DR   EnsemblGenomes-Tr; SeHA_C3698-1.
DR   EnsemblGenomes-Tr; SeHA_C3699-1.
DR   EnsemblGenomes-Tr; SeHA_C3700-1.
DR   EnsemblGenomes-Tr; SeHA_C3855-1.
DR   EnsemblGenomes-Tr; SeHA_C3955-1.
DR   EnsemblGenomes-Tr; SeHA_C3956-1.
DR   EnsemblGenomes-Tr; SeHA_C4077-1.
DR   EnsemblGenomes-Tr; SeHA_C4222-1.
DR   EnsemblGenomes-Tr; SeHA_C4223-1.
DR   EnsemblGenomes-Tr; SeHA_C4224-1.
DR   EnsemblGenomes-Tr; SeHA_C4226-1.
DR   EnsemblGenomes-Tr; SeHA_C4227-1.
DR   EnsemblGenomes-Tr; SeHA_C4228-1.
DR   EnsemblGenomes-Tr; SeHA_C4260-1.
DR   EnsemblGenomes-Tr; SeHA_C4261-1.
DR   EnsemblGenomes-Tr; SeHA_C4262-1.
DR   EnsemblGenomes-Tr; SeHA_C4263-1.
DR   EnsemblGenomes-Tr; SeHA_C4264-1.
DR   EnsemblGenomes-Tr; SeHA_C4314-1.
DR   EnsemblGenomes-Tr; SeHA_C4315-1.
DR   EnsemblGenomes-Tr; SeHA_C4316-1.
DR   EnsemblGenomes-Tr; SeHA_C4317-1.
DR   EnsemblGenomes-Tr; SeHA_C4318-1.
DR   EnsemblGenomes-Tr; SeHA_C4328-1.
DR   EnsemblGenomes-Tr; SeHA_C4330-1.
DR   EnsemblGenomes-Tr; SeHA_C4452-1.
DR   EnsemblGenomes-Tr; SeHA_C4461-1.
DR   EnsemblGenomes-Tr; SeHA_C4462-1.
DR   EnsemblGenomes-Tr; SeHA_C4463-1.
DR   EnsemblGenomes-Tr; SeHA_C4464-1.
DR   EnsemblGenomes-Tr; SeHA_C4466-1.
DR   EnsemblGenomes-Tr; SeHA_C4470-1.
DR   EnsemblGenomes-Tr; SeHA_C4471-1.
DR   EnsemblGenomes-Tr; SeHA_C4473-1.
DR   EnsemblGenomes-Tr; SeHA_C4474-1.
DR   EnsemblGenomes-Tr; SeHA_C4482-1.
DR   EnsemblGenomes-Tr; SeHA_C4509-1.
DR   EnsemblGenomes-Tr; SeHA_C4510-1.
DR   EnsemblGenomes-Tr; SeHA_C4512-1.
DR   EnsemblGenomes-Tr; SeHA_C4717-1.
DR   EnsemblGenomes-Tr; SeHA_C4739-1.
DR   EnsemblGenomes-Tr; SeHA_C4770-1.
DR   EnsemblGenomes-Tr; SeHA_C4771-1.
DR   EnsemblGenomes-Tr; SeHA_C4772-1.
DR   EnsemblGenomes-Tr; SeHA_C4891-1.
DR   EnsemblGenomes-Tr; SeHA_C4961-1.
DR   EnsemblGenomes-Tr; SeHA_C4962-1.
DR   EnsemblGenomes-Tr; SeHA_C4963-1.
DR   EuropePMC; PMC3067318; 21278266.
DR   EuropePMC; PMC3098285; 21625519.
DR   EuropePMC; PMC3133335; 21602358.
DR   EuropePMC; PMC3163573; 21824423.
DR   EuropePMC; PMC3165684; 21764925.
DR   EuropePMC; PMC3220660; 21942987.
DR   EuropePMC; PMC3356390; 22623967.
DR   EuropePMC; PMC3411829; 22880062.
DR   EuropePMC; PMC3681947; 23785398.
DR   EuropePMC; PMC3716127; 23478955.
DR   EuropePMC; PMC4042001; 24885207.
DR   EuropePMC; PMC4616196; 26494672.
DR   EuropePMC; PMC5320704; 28348832.
DR   EuropePMC; PMC6328658; 30643885.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00014; DsrA.
DR   RFAM; RF00018; CsrB.
DR   RFAM; RF00021; Spot_42.
DR   RFAM; RF00022; GcvB.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00033; MicF.
DR   RFAM; RF00034; RprA.
DR   RFAM; RF00035; OxyS.
DR   RFAM; RF00040; rne5.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00057; RyhB.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00077; SraB.
DR   RFAM; RF00078; MicA.
DR   RFAM; RF00079; OmrA-B.
DR   RFAM; RF00080; yybP-ykoY.
DR   RFAM; RF00081; ArcZ.
DR   RFAM; RF00082; SraG.
DR   RFAM; RF00083; GlmZ_SraJ.
DR   RFAM; RF00084; CsrC.
DR   RFAM; RF00101; SraC_RyeA.
DR   RFAM; RF00110; RybB.
DR   RFAM; RF00111; RyeB.
DR   RFAM; RF00112; CyaR_RyeE.
DR   RFAM; RF00113; QUAD.
DR   RFAM; RF00114; S15.
DR   RFAM; RF00118; rydB.
DR   RFAM; RF00121; MicC.
DR   RFAM; RF00126; ryfA.
DR   RFAM; RF00127; t44.
DR   RFAM; RF00128; GlmY_tke1.
DR   RFAM; RF00140; Alpha_RBS.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00240; RNA-OUT.
DR   RFAM; RF00368; sroB.
DR   RFAM; RF00369; sroC.
DR   RFAM; RF00370; sroD.
DR   RFAM; RF00371; sroE.
DR   RFAM; RF00382; DnaX.
DR   RFAM; RF00391; RtT.
DR   RFAM; RF00505; RydC.
DR   RFAM; RF00506; Thr_leader.
DR   RFAM; RF00512; Leu_leader.
DR   RFAM; RF00513; Trp_leader.
DR   RFAM; RF00514; His_leader.
DR   RFAM; RF00534; SgrS.
DR   RFAM; RF00552; rncO.
DR   RFAM; RF00630; P26.
DR   RFAM; RF01055; MOCO_RNA_motif.
DR   RFAM; RF01056; Mg_sensor.
DR   RFAM; RF01068; mini-ykkC.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01384; InvR.
DR   RFAM; RF01385; isrA.
DR   RFAM; RF01387; isrC.
DR   RFAM; RF01388; isrD.
DR   RFAM; RF01390; isrG.
DR   RFAM; RF01391; isrH.
DR   RFAM; RF01392; isrI.
DR   RFAM; RF01394; isrK.
DR   RFAM; RF01395; isrL.
DR   RFAM; RF01396; isrN.
DR   RFAM; RF01397; isrO.
DR   RFAM; RF01398; isrP.
DR   RFAM; RF01399; isrQ.
DR   RFAM; RF01400; istR.
DR   RFAM; RF01401; rseX.
DR   RFAM; RF01402; STnc150.
DR   RFAM; RF01404; STnc440.
DR   RFAM; RF01405; STnc490k.
DR   RFAM; RF01406; STnc500.
DR   RFAM; RF01407; STnc560.
DR   RFAM; RF01408; sraL.
DR   RFAM; RF01409; STnc250.
DR   RFAM; RF01517; iscRS.
DR   RFAM; RF01695; C4.
DR   RFAM; RF01707; JUMPstart.
DR   RFAM; RF01766; cspA.
DR   RFAM; RF01769; greA.
DR   RFAM; RF01770; rimP.
DR   RFAM; RF01771; rnk_leader.
DR   RFAM; RF01795; FourU.
DR   RFAM; RF01796; frnS.
DR   RFAM; RF01809; symR.
DR   RFAM; RF01813; rdlD.
DR   RFAM; RF01830; StyR-44.
DR   RFAM; RF01832; ROSE_2.
DR   RFAM; RF01852; tRNA-Sec.
DR   RFAM; RF01859; Phe_leader.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   RFAM; RF01988; SECIS_2.
DR   RFAM; RF01989; SECIS_3.
DR   RFAM; RF02029; sraA.
DR   RFAM; RF02030; tp2.
DR   RFAM; RF02031; tpke11.
DR   RFAM; RF02048; STnc30.
DR   RFAM; RF02049; STnc460.
DR   RFAM; RF02050; STnc470.
DR   RFAM; RF02051; STnc450.
DR   RFAM; RF02052; STnc630.
DR   RFAM; RF02053; STnc430.
DR   RFAM; RF02054; STnc420.
DR   RFAM; RF02055; STnc380.
DR   RFAM; RF02056; STnc390.
DR   RFAM; RF02057; STnc40.
DR   RFAM; RF02059; STnc50.
DR   RFAM; RF02060; STnc410.
DR   RFAM; RF02062; STnc361.
DR   RFAM; RF02063; STnc350.
DR   RFAM; RF02064; STnc370.
DR   RFAM; RF02065; STnc340.
DR   RFAM; RF02066; STnc320.
DR   RFAM; RF02067; STnc310.
DR   RFAM; RF02068; STnc480.
DR   RFAM; RF02069; STnc70.
DR   RFAM; RF02070; STnc300.
DR   RFAM; RF02071; STnc280.
DR   RFAM; RF02072; STnc590.
DR   RFAM; RF02073; STnc260.
DR   RFAM; RF02074; STnc240.
DR   RFAM; RF02075; STnc230.
DR   RFAM; RF02076; STnc100.
DR   RFAM; RF02077; STnc220.
DR   RFAM; RF02078; STnc210.
DR   RFAM; RF02079; STnc180.
DR   RFAM; RF02080; STnc170.
DR   RFAM; RF02081; STnc550.
DR   RFAM; RF02082; STnc540.
DR   RFAM; RF02084; STnc130.
DR   RFAM; RF02088; STnc510.
DR   RFAM; RF02194; HPnc0260.
DR   SILVA-LSU; CP001120.
DR   SILVA-SSU; CP001120.
XX
CC   The sequenced strain has been deposited at the Salmonella Genetic
CC   Stock Center at the University of Calgary under the care of Dr.
CC   K.E. Sanderson.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..4888768
FT                   /organism="Salmonella enterica subsp. enterica serovar
FT                   Heidelberg str. SL476"
FT                   /sub_species="enterica"
FT                   /strain="SL476"
FT                   /mol_type="genomic DNA"
FT                   /serovar="Heidelberg"
FT                   /db_xref="taxon:454169"
FT   misc_feature    184..311
FT                   /note="Threonine operon leader"
FT   gene            337..2799
FT                   /gene="thrA"
FT                   /locus_tag="SeHA_C0002"
FT   CDS_pept        337..2799
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thrA"
FT                   /locus_tag="SeHA_C0002"
FT                   /product="aspartokinase/homoserine dehydrogenase I"
FT                   /EC_number="2.7.2.4"
FT                   /EC_number="1.1.1.3"
FT                   /note="identified by match to protein family HMM PF00696;
FT                   match to protein family HMM PF00742; match to protein
FT                   family HMM PF01842; match to protein family HMM PF03447;
FT                   match to protein family HMM TIGR00657"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0002"
FT                   /db_xref="EnsemblGenomes-Tr:ACF69432"
FT                   /protein_id="ACF69432.1"
FT                   /translation="MRVLKFGGTSVANAERFLRVADILESNARQGQVATVLSAPAKITN
FT                   HLVAMIEKTIGGQDALPNISDAERIFSDLLAGLASAQPGFPLARLKMVVEQEFAQIKHV
FT                   LHGISLLGQCPDSINAALICRGEKMSIAIMAGLLEARGHRVTVIDPVEKLLAVGHYLES
FT                   TVDIAESTRRIAASQIPADHMILMAGFTAGNEKGELVVLGRNGSDYSAAVLAACLRADC
FT                   CEIWTDVDGVYTCDPRQVPDARLLKSMSYQEAMELSYFGAKVLHPRTITPIAQFQIPCL
FT                   IKNTGNPQAPGTLIGASSDDDNLPVKGISNLNNMAMFSVSGPGMKGMIGMAARVFAAMS
FT                   RAGISVVLITQSSSEYSISFCVPQSDCARARRAMQDEFYLELKEGLLEPLAVTERLAII
FT                   SVVGDGMRTLRGISAKFFAALARANINIVAIAQGSSERSISVVVNNDDATTGVRVTHQM
FT                   LFNTDQVIEVFVIGVGGVGGALLEQLKRQQTWLKNKHIDLRVCGVANSKALLTNVHGLN
FT                   LDNWQAELAQANAPFNLGRLIRLVKEYHLLNPVIVDCTSSQAVADQYADFLREGFHVVT
FT                   PNKKANTSSMDYYHQLRFAAAQSRRKFLYDTNVGAGLPVIENLQNLLNAGDELQKFSGI
FT                   LSGSLSFIFGKLEEGMSLSQATALAREMGYTEPDPRDDLSGMDVARKLLILARETGREL
FT                   ELSDIVIEPVLPDEFDASGDVTAFMAHLPQLDDAFAARVAKARDEGKVLRYVGNIEEDG
FT                   VCRVKIAEVDGNDPLFKVKNGENALAFYSHYYQPLPLVLRGYGAGNDVTAAGVFADLLR
FT                   TLSWKLGV"
FT   gene            2801..3730
FT                   /gene="thrB"
FT                   /locus_tag="SeHA_C0003"
FT   CDS_pept        2801..3730
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thrB"
FT                   /locus_tag="SeHA_C0003"
FT                   /product="homoserine kinase"
FT                   /EC_number="2.7.1.39"
FT                   /note="identified by match to protein family HMM PF00288;
FT                   match to protein family HMM PF08544; match to protein
FT                   family HMM TIGR00191"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0003"
FT                   /db_xref="EnsemblGenomes-Tr:ACF69934"
FT                   /db_xref="GOA:B4TIA4"
FT                   /db_xref="InterPro:IPR000870"
FT                   /db_xref="InterPro:IPR006203"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4TIA4"
FT                   /protein_id="ACF69934.1"
FT                   /translation="MVKVYAPASSANMSVGFDVLGAAVTPVDGTLLGDVVSVEAADHFR
FT                   LHNLGRFADKLPPEPRENIVYQCWERFCQALGKTIPVAMTLEKNMPIGSGLGSSACSVV
FT                   AALVAMNEHCGKPLNDTRLLALMGELEGRISGSIHYDNVAPCFLGGMQLMIEENGIISQ
FT                   QVPGFDEWLWVLAYPGIKVSTAEARAILPAQYRRQDCIAHGRHLAGFIHACYSRQPQLA
FT                   AALMKDVIAEPYRARLLPGFSQARQAVSEIGALASGISGSGPTLFALCDKPETAQRVAD
FT                   WLSKHYLQNQEGFVHICRLDTAGARVVG"
FT   gene            3734..5020
FT                   /gene="thrC"
FT                   /locus_tag="SeHA_C0004"
FT   CDS_pept        3734..5020
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thrC"
FT                   /locus_tag="SeHA_C0004"
FT                   /product="threonine synthase"
FT                   /EC_number="4.2.3.1"
FT                   /note="identified by match to protein family HMM PF00291;
FT                   match to protein family HMM TIGR00260"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0004"
FT                   /db_xref="EnsemblGenomes-Tr:ACF69112"
FT                   /protein_id="ACF69112.1"
FT                   /translation="MKLYNLKDHNEQVSFAQAVTQGLGKQQGLFFPHELPEFSLTEIDE
FT                   MLNQDFVSRSAKILSAFIGDEIPQQILEERVRAAFAFPAPVAQVESDVGCLELFHGPTL
FT                   AFKDFGGRFMAQMLTHISGDKPVTILTATSGDTGAAVAHAFYGLENVRVVILYPRGKIS
FT                   PLQEKLFCTLGGNIETVAIDGDFDACQALVKQAFDDEELKTALGLNSANSINISRLLAQ
FT                   ICYYFEAVAQLPQGARNQLVISVPSGNFGDLTAGLLAKSLGLPVKRFIAATNVNDTVPR
FT                   FLHDGKWAPKATQATLSNAMDVSQPNNWPRVEELFRRKIWRLTELGYAAVDDTTTQQTM
FT                   RELKAKGYISEPHAAVAYRALRDQLNPGEYGLFLGTAHPAKFKESVESILGETLALPEA
FT                   LAERADLPLLSHHLPADFAALRKLMMTRQ"
FT   gene            complement(5113..5886)
FT                   /locus_tag="SeHA_C0005"
FT   CDS_pept        complement(5113..5886)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0005"
FT                   /product="protein YaaA"
FT                   /note="identified by match to protein family HMM PF03883"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0005"
FT                   /db_xref="EnsemblGenomes-Tr:ACF67852"
FT                   /db_xref="InterPro:IPR005583"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4TIA6"
FT                   /protein_id="ACF67852.1"
FT                   /translation="MLILISPAKTLDYQSPLATTRYTQPELLDHSQQLIQQARQLSAPQ
FT                   ISRLMGISDKLADLNATRFHDWQPHFTPDNARQAILAFKGDVYTGLQAETFNDADFDFA
FT                   QQHLRMLSGLYGVLRPLDLMQPYRLEMGIRLENPRGKDLYQFWGDIITDKLNEALEAQG
FT                   DRVVVNLASEEYFKSVKPKKLNAELIKPVFLDEKNGKFKVVSFYAKKARGLMSRFIIEN
FT                   RLTKPEQLTAFDREGYFFDEETSTQDELVFKRYEQ"
FT   gene            complement(5965..7422)
FT                   /locus_tag="SeHA_C0006"
FT   CDS_pept        complement(5965..7422)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0006"
FT                   /product="amino-acid carrier protein AlsT"
FT                   /note="identified by match to protein family HMM PF01235;
FT                   match to protein family HMM TIGR00835"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0006"
FT                   /db_xref="EnsemblGenomes-Tr:ACF65895"
FT                   /protein_id="ACF65895.1"
FT                   /translation="MTASTRGTLMPEFFSFINEILWGSVMIYLLLGAGCWFTWRTGFIQ
FT                   FRYIRQFGRSLKGSLSPQPGGLTSFQALCTSLAARIGSGNLAGVALAIAAGGPGAVFWM
FT                   WVSAIIGMATSFAECSLAQLYKERDPTGQFRGGPAWYMARGLGMRWMGVVFALFLLVAY
FT                   GLIFNSVQANAVSRALHFAFNIPPLISGIALALCALLIIIRGIKGVARLMQWLIPIIAL
FT                   LWVAGSVFICLWHIEQMPGVIASIVKSAFGWQEAAAGAAGYTLTQAITSGFQRGMFSNE
FT                   AGMGSTPNAAAAATSYPPHPVAQGIVQMIGVFSDTIIICTASAMIILLAGNHASHSSTE
FT                   GIQLLQHAMVSLTGEWGASFVALIVILFAFSSIVANYIYAENNLFFLRLHNAKAIWLLR
FT                   LATLGMVIAGTLISFPLIWQLADMIMACMAITNLTAILLLSPVVYTLAGDYLRQRKLGV
FT                   RPQFDPRRFPDIEPQLAPDTWDATSRD"
FT   gene            7664..8617
FT                   /gene="tal2"
FT                   /locus_tag="SeHA_C0007"
FT   CDS_pept        7664..8617
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tal2"
FT                   /locus_tag="SeHA_C0007"
FT                   /product="transaldolase"
FT                   /EC_number="2.2.1.2"
FT                   /note="identified by match to protein family HMM PF00923;
FT                   match to protein family HMM TIGR00874"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0007"
FT                   /db_xref="EnsemblGenomes-Tr:ACF66518"
FT                   /protein_id="ACF66518.1"
FT                   /translation="MTDKLTSLRQFTTVVADTGDIAAMKLYQPQDATTNPSLILNAAQI
FT                   PEYRKLIDDAVAWAKQQSSDRAQQVVDATDKLAVNIGLEILKLVPGRISTEVDARLSYD
FT                   TEASIAKAKRIIKLYNDAGISNDRILIKLASTWQGIRAAEQLEKEGINCNLTLLFSFAQ
FT                   ARACAEAGVYLISPFVGRILDWYKANTDKKDYAPAEDPGVVSVTEIYEYYKQHGYETVV
FT                   MGASFRNVGEILELAGCDRLTIAPALLKELAESEGAIERKLSFSGEVKARPERITEAEF
FT                   LWQHHQDPMAVDKLADGIRKFAVDQEKLEKMIGDLL"
FT   gene            8728..9318
FT                   /gene="mog"
FT                   /locus_tag="SeHA_C0008"
FT   CDS_pept        8728..9318
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mog"
FT                   /locus_tag="SeHA_C0008"
FT                   /product="molybdopterin biosynthesis protein Mog"
FT                   /note="identified by match to protein family HMM PF00994;
FT                   match to protein family HMM TIGR00177"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0008"
FT                   /db_xref="EnsemblGenomes-Tr:ACF67024"
FT                   /protein_id="ACF67024.1"
FT                   /translation="MDTLRIGLVSISDRASSGVYQDKGIPALEEWLASALTTPFEVQRR
FT                   LIPDEQEIIEQTLCELVDEMSCHLVLTTGGTGPARRDVTPDATLAIADREMPGFGEQMR
FT                   QISLRFVPTAILSRQVGVIRKQALILNLPGQPKSIKETLEGVKADDGSVSVPGIFASVP
FT                   YCIQLLDGPYVETAPEVVAAFRPKSARRENMSS"
FT   gene            complement(9375..9941)
FT                   /locus_tag="SeHA_C0009"
FT   CDS_pept        complement(9375..9941)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0009"
FT                   /product="membrane protein, GPR1/FUN34/yaaH family"
FT                   /note="identified by match to protein family HMM PF01184"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0009"
FT                   /db_xref="EnsemblGenomes-Tr:ACF67809"
FT                   /protein_id="ACF67809.1"
FT                   /translation="MGNTKLANPAPLGLMGFGMTTILLNLHNAGFFALDGIILAMGIFY
FT                   GGIAQIFAGLLEYKKGNTFGLTAFTSYGSFWLTLVAILLMPKMGLTDAPDAQLLGAYLG
FT                   LWGVFTLFMFFGTLKAARALQFVFLSLTVLFALLAVGNITGNEAIIHIAGWVGLVCGAS
FT                   AIYLAMGEVLNEQFGRTILPIGEAH"
FT   gene            complement(10091..10804)
FT                   /locus_tag="SeHA_C0010"
FT   CDS_pept        complement(10091..10804)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0010"
FT                   /product="positive regulator for sigma H"
FT                   /note="identified by match to protein family HMM PF03667"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0010"
FT                   /db_xref="EnsemblGenomes-Tr:ACF66279"
FT                   /protein_id="ACF66279.1"
FT                   /translation="MNVTYLHDEDLDFLQHCSEEQLADFARLLTHNEKGKARLSSVLSH
FT                   NELFKAMEGHPEQHRRNWQLIAGEFQHYGGDSIANKLRGHGKQYRAILLDVAKRLKLKA
FT                   DKSMSTFEIEQQLLEHFLRHTWQKMDAAHKQEFLQAVDAKVSELEELLPLLMKDRSLAK
FT                   GVSHLLSTQLTRILRTHAAMSILGHGLLRGAGLGGPVGAALNGVKAMSGSAYRVTIPAV
FT                   LQIACLRRMMAAVQA"
FT   gene            complement(10840..11235)
FT                   /locus_tag="SeHA_C0011"
FT   CDS_pept        complement(10840..11235)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0011"
FT                   /product="protein YaaI"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0011"
FT                   /db_xref="EnsemblGenomes-Tr:ACF66434"
FT                   /protein_id="ACF66434.1"
FT                   /translation="MLTISASLLFGLALSSVAHANDHKILGVIAMPRNETNDLTLKIPV
FT                   CRIVKRIQLTADHGDIELSGASVYFKTARSASQSLNVPSSIKEGQTTGWININSDNDNK
FT                   RCVSKITFSGHTVNSSDMARLKVIGDD"
FT   gene            11299..11424
FT                   /locus_tag="SeHA_C0012"
FT   CDS_pept        11299..11424
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0012"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0012"
FT                   /db_xref="EnsemblGenomes-Tr:ACF69650"
FT                   /protein_id="ACF69650.1"
FT                   /translation="MATIQFCNLFFLLQFFCEWYSFFNLFHEYLSVWFSIAPSRH"
FT   gene            11593..13509
FT                   /gene="dnaK"
FT                   /locus_tag="SeHA_C0013"
FT   CDS_pept        11593..13509
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaK"
FT                   /locus_tag="SeHA_C0013"
FT                   /product="chaperone protein DnaK"
FT                   /note="identified by match to protein family HMM PF00012;
FT                   match to protein family HMM TIGR02350"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0013"
FT                   /db_xref="EnsemblGenomes-Tr:ACF70388"
FT                   /db_xref="GOA:B4TIB4"
FT                   /db_xref="InterPro:IPR012725"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR018181"
FT                   /db_xref="InterPro:IPR029047"
FT                   /db_xref="InterPro:IPR029048"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4TIB4"
FT                   /protein_id="ACF70388.1"
FT                   /translation="MGKIIGIDLGTTNSCVAIMDGTQARVLENAEGDRTTPSIIAYTQD
FT                   GETLVGQPAKRQAVTNPQNTLFAIKRLIGRRFQDEEVQRDVSIMPYKIIGADNGDAWLD
FT                   VKGQKMAPPQISAEVLKKMKKTAEDYLGEPVTEAVITVPAYFNDAQRQATKDAGRIAGL
FT                   EVKRIINEPTAAALAYGLDKEVGNRTIAVYDLGGGTFDISIIEIDEVDGEKTFEVLATN
FT                   GDTHLGGEDFDTRLINYLVDEFKKDQGIDLRNDPLAMQRLKEAAEKAKIELSSAQQTDV
FT                   NLPYITADATGPKHMNIKVTRAKLESLVEDLVNRSIEPLKVALQDAGLSVSDINDVILV
FT                   GGQTRMPMVQKKVAEFFGKEPRKDVNPDEAVAIGAAVQGGVLTGDVKDVLLLDVTPLSL
FT                   GIETMGGVMTPLITKNTTIPTKHSQVFSTAEDNQSAVTIHVLQGERKRASDNKSLGQFN
FT                   LDGINPAPRGMPQIEVTFDIDADGILHVSAKDKNSGKEQKITIKASSGLNEEEIQKMVR
FT                   DAEANAESDRKFEELVQTRNQGDHLLHSTRKQVEEAGDKLPADDKTAIESALSALETAL
FT                   KGEDKAAIEAKMQELAQVSQKLMEIAQQQHAQQQAGSADASANNAKDDDVVDAEFEEVK
FT                   DKK"
FT   gene            13595..14734
FT                   /gene="dnaJ"
FT                   /locus_tag="SeHA_C0014"
FT   CDS_pept        13595..14734
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaJ"
FT                   /locus_tag="SeHA_C0014"
FT                   /product="chaperone protein DnaJ"
FT                   /note="identified by match to protein family HMM PF00226;
FT                   match to protein family HMM PF00684; match to protein
FT                   family HMM PF01556; match to protein family HMM TIGR02349"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0014"
FT                   /db_xref="EnsemblGenomes-Tr:ACF70074"
FT                   /db_xref="GOA:B4TIB5"
FT                   /db_xref="InterPro:IPR001305"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR002939"
FT                   /db_xref="InterPro:IPR008971"
FT                   /db_xref="InterPro:IPR012724"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="InterPro:IPR036410"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4TIB5"
FT                   /protein_id="ACF70074.1"
FT                   /translation="MAKRDYYEILGVSKTAEEREIKKAYKRLAMKYHPDRNQGDKEAEA
FT                   KFKEIKEAYEVLTDAQKRAAYDQYGHAAFEQGGMGGGFGGGFNGGADFSDIFGDVFGDI
FT                   FGGGRGRQRAARGADLRYNMDLTLEEAVRGVTKEIRIPTLEECDVCHGSGAKAGTQPQT
FT                   CPTCHGSGQVQMRQGFFAVQQTCPHCQGRGTLIKDPCHKCHGHGRVEKSKTLSVKIPAG
FT                   VDTGDRIRLAGEGEAGEHGAPAGDLYVQVQVKQHPIFEREGNNLYCEVPINFAMAALGG
FT                   EIEVPTLDGRVMLKVPSETQTGKLFRMRGKGVKSVRGGAQGDLLCRVVVETPVGLSEKQ
FT                   KQLLKDLQESFGGPTGEKNSPRSKSFFDGVKKFFDDLTR"
FT   gene            14846..14959
FT                   /locus_tag="SeHA_C0015"
FT   CDS_pept        14846..14959
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0015"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0015"
FT                   /db_xref="EnsemblGenomes-Tr:ACF69249"
FT                   /protein_id="ACF69249.1"
FT                   /translation="MFLLINKLMLISSFVYAYSLKKRDVMTLMIAFLDAVN"
FT   gene            15015..15962
FT                   /locus_tag="SeHA_C0016"
FT   CDS_pept        15015..15962
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0016"
FT                   /product="putative transcriptional regulator"
FT                   /note="identified by match to protein family HMM PF00126"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0016"
FT                   /db_xref="EnsemblGenomes-Tr:ACF67691"
FT                   /protein_id="ACF67691.1"
FT                   /translation="MGSKGANKSFDYNLIKILDAVILSGNAAMAAKKLGITPAAVSLAL
FT                   KRLQSYYPEELFSRGKGGLIPTAKAVDIHQNFSQVMKLVDDTFLCNSKKDEAFQITLLG
FT                   SDIVESYYLSQLYNSDIFDRILINHFTVRNMSREHISELLFTAQGDLLISAEPLLESGI
FT                   ENQIIDSFKSFVCICSSKHMLSTLSQLSLHHFYSSRHALYQPGMGASVIYHDSELFKDD
FT                   LYYTGRRIVGYRSDSLNGLMSMIERTSLIALMPLKLALFYKNHRKYDIKFIQPPPELAL
FT                   KSVQVYASWNKNSRNISTINEMVSMLQTLSSFRR"
FT   gene            16131..16433
FT                   /locus_tag="SeHA_C0017"
FT   CDS_pept        16131..16433
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0017"
FT                   /product="putative bacteriophage protein"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0017"
FT                   /db_xref="EnsemblGenomes-Tr:ACF65879"
FT                   /protein_id="ACF65879.1"
FT                   /translation="MELEILLTIISIGAWGGFVSYLLRKDKTEYNSSHESIKYCLTQIV
FT                   ISCFTSFLLSAIAIEKECSFNIVLLAAGLGGVFASPILKILGRRIKKIIEGNNSD"
FT   gene            complement(16494..17027)
FT                   /locus_tag="SeHA_C0018"
FT   CDS_pept        complement(16494..17027)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0018"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF05838;
FT                   match to protein family HMM PF09374"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0018"
FT                   /db_xref="EnsemblGenomes-Tr:ACF67320"
FT                   /protein_id="ACF67320.1"
FT                   /translation="MNPIIDGIIALEGGYVFNPKDKGGATHWGITEATARAHGYAGDMR
FT                   DLTHAEAYAILEEDYWIKPGFDVISTLSWPVSFELCDAAVNIGAYHPSAWLQRWLNVFN
FT                   HEGKRYPDIHVDGNIGPRTLAALEHYLAWRGQEGEAVLVKALNCSQGTYYLNVAEKNHN
FT                   NEQFIYGWIKNRVT"
FT   gene            complement(17044..17487)
FT                   /locus_tag="SeHA_C0019"
FT   CDS_pept        complement(17044..17487)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0019"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0019"
FT                   /db_xref="EnsemblGenomes-Tr:ACF69261"
FT                   /protein_id="ACF69261.1"
FT                   /translation="MKTYIINSNCIYNEGKYELRTVSNSQVIKMTAMRAKCLSFIIENA
FT                   HLEIIERQKITTALWGSRSHYVNDANLTQILYLIRRDLKALGINDLFITIPRQGLKVNS
FT                   DIAIIATDSETKGRKKQIVRQTIAALTTVFSVTLGSLMYLHIH"
FT   gene            17868..19967
FT                   /locus_tag="SeHA_C0020"
FT   CDS_pept        17868..19967
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0020"
FT                   /product="exochitinase"
FT                   /note="identified by match to protein family HMM PF00704;
FT                   match to protein family HMM PF02839"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0020"
FT                   /db_xref="EnsemblGenomes-Tr:ACF69021"
FT                   /protein_id="ACF69021.1"
FT                   /translation="MATSKLIQGDTITETTHAANGFDPATSDDKISYTSARVAKPVYNK
FT                   YKNSTTKPKVFGYYTDWSQYDSRLQGNMSQPGRGYDLTKVSPTAYDKLIFGFVGITGFR
FT                   KIDTEDRDVVAEAAALCGKVKYEPTFLDPWGDFQSYINLGFDVSGWDVDPKTVTQSNAK
FT                   GLLGALRDMQAKAKAAGHTLALSMSIGGWSMSNGFHETAASDSSRKIFAKGVVKLFKQF
FT                   PMFSEVDIDWEYPNNEGAGNPFGPEDGANYALLIAELRKQLDSAGLSNVKISIAASAVT
FT                   TIFDYAKVKDLMAAGLYGINLMTYDFFGTPWAETLGHHTNRKALEEGGWAVETIVDHLL
FT                   AEGFSADRINIGYAGYTRNARQVEIESLSPLKGSYNPGSGPTTGSFESGTSEWYDVIYS
FT                   YLDLENQKGRNGFNVYTDQVADADYLYSPESKLFLSLDTPRTVKAKGEYAAKLGLGGVF
FT                   TWTIDQDNGVLVNAVREGLGYEIESEVIDMEPFYFEGINVEKDEEQSDSDDAQKVNHAP
FT                   KAAIELMVVGGSTVQLSGAGSSDEDNDELSFSWGVPSQIDVADKTAEIIEVVVPEVSEK
FT                   TAFQFTLFVRDCYNEPSSQQRFVLTAVPALSQVQPEPEEEEEIIVPVPDEEEDTTPAED
FT                   DTPADDKTSPYAQWDASTVYGANWGSFEIVSWKGHNYQVKWWSMGNQPDLNCGVGGAWT
FT                   DLGAY"
FT   gene            20059..23055
FT                   /locus_tag="SeHA_C0021"
FT   CDS_pept        20059..23055
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0021"
FT                   /product="putative hydroxymethyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0021"
FT                   /db_xref="EnsemblGenomes-Tr:ACF68383"
FT                   /protein_id="ACF68383.1"
FT                   /translation="MTISIHASAFDVNSWYQKITLTFINESGNAVDMNHAAISFTASGH
FT                   IDPWGNSGGTLKGNLPLTLNDSSYGTLETNNIIINNSDALLLQPGERGTLSFSLAATQV
FT                   PVKMSAITLTLASSSSEDAESETPSDQETPAIPAADEQPAEPDVPEKDNDLQERGLTLN
FT                   VSELNTASWYQRVTFTLTNLYAQAVDLNQLQLNFTASAHPDPYSPFQGTMLGNQAVTLA
FT                   SDGGWPIEKNTITINHDGALMLAAGDTVELQCYLAATQMPVAISDLSATLAHDPARQGK
FT                   ICVHFPAMTQTVALKPAIELLFPAGETRRFVGEWGEVLTISDLSAGTYRLTVPVLANDE
FT                   MQIAPVESSFTVTLQSGDAAAQVQVSCLPIVRYASARLMIDAPALGNAKLTVDIADTTQ
FT                   ADERTVTLIANQPQLITRLLAGHHYTVNLQPAMINNRFISAPIQLTGFIPAAAQVAEVA
FT                   VAYQQSALDTASFVTVDATLLGLPDGVAPQRYLFSSGKYQYSLMLESGSDRQTLALRFA
FT                   PGLYDVQTDDIFIDSVPWRCEQAGPLRLLQKVNHVALEFLPGVTLQVKGWPDYLAHGGV
FT                   TVNAPETVSLYRDIPFSALFKYDGFDGGGDPVPAAEVDVNGDGFLDYATLPIHKTVALV
FT                   RQIEKEAGRSVMPVMVIYTANASGGSALADLQDAQKLRNHFGNFITQCLAAQSYKDETH
FT                   PVPATFVLNPDFLGALQQGPYGYTVVRQKNSVPVNAQLAAAIQALPAMAGFIAPSLPTF
FT                   SDDLYGYIQAVNYLVRQFAPDVAFGWQTNVWATGTADWVLRDTADPVAEGQAIAEFIHE
FT                   LGVYSGEYAPDFIAFDKFERDCFSPDALAHYGWNATCWLNYLAMVKQVTKSLLTPAMLW
FT                   QIPGGHMPTVEEGVSKISAAHFASGGTFFMGDARIGSDPDTLSLQLLNTALNSATYGVP
FT                   TVGDFLRKDKGYDWGQMQALNLPDFNVFSILWGGGSTISITTIHSNGEDGGWLADKMVE
FT                   YYAAPRYFR"
FT   gene            23336..24040
FT                   /locus_tag="SeHA_C0022"
FT   CDS_pept        23336..24040
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0022"
FT                   /product="putative cytoplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0022"
FT                   /db_xref="EnsemblGenomes-Tr:ACF69327"
FT                   /protein_id="ACF69327.1"
FT                   /translation="MKKMMNDAFAKDNNENSLHSFLFSQQAKPHAAIDALFSALLPFGQ
FT                   PFTLGIGDEFYLQANDEHYIVLLESGVVSFCHDDKRLHISSSFAPSVVGMVDSYGATYN
FT                   VPARPEHFLLAETVCTGRFVRLPDFIKIADECDLWHDVARCLAYRLMVMSARDRELVGV
FT                   DSYLKVRALLTEIWAYPQAYRESIIVLNFIQRRTGISRSRTMKILSELKKGGYIHIDNG
FT                   RLTALGKLPVAY"
FT   gene            24557..25537
FT                   /locus_tag="SeHA_C0023"
FT   CDS_pept        24557..25537
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0023"
FT                   /product="IS5 transposase"
FT                   /note="identified by match to protein family HMM PF01609"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0023"
FT                   /db_xref="EnsemblGenomes-Tr:ACF66635"
FT                   /protein_id="ACF66635.1"
FT                   /translation="MSHQLTFADSEFSTKRRQTRKEIFLSRMEQILPWQNMTAVIEPFY
FT                   PKAGNGRRPYPLETMLRIHCMQHWYNLSDGAMEDALYEIASMRLFARLSLDSALPDRTT
FT                   IMNFRHLLEQHQLARQLFKTINRWLAEAGVMMTQGTLVDATIIEAPSSTKNKEQQRDPE
FT                   MHQTKKGNQWHFGMKAHIGVDAKSGLTHSLVTTAANEHDLNQLGNLLHGEEQFVSADAG
FT                   YQGAPQREELAEVDVDWLIAERPGKVKTLKQHPRKNKTAINIEYMKASIRAKVEHPFRI
FT                   IKRQFGFVKARYKGLLKNDNQLAMLFTLANLFRVDQMIRQWERSH"
FT   gene            25693..26211
FT                   /locus_tag="SeHA_C0024"
FT   CDS_pept        25693..26211
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0024"
FT                   /product="fimbrial subunit"
FT                   /note="identified by match to protein family HMM PF00419"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0024"
FT                   /db_xref="EnsemblGenomes-Tr:ACF66380"
FT                   /protein_id="ACF66380.1"
FT                   /translation="MVSAIAFGGMLSTAQADTTTVTGGTVNFVGQVVDAACSVSADSVD
FT                   QTVTLGQVRASKLTEAGMVANQKEDFTIKLEDCDTQTSQNAAVIFNGQQDANQPGSLAN
FT                   TAGAGSATNVALQLYGPDGQALNIGESSSTVTLNDGENVIPLSVDYIATGTATAGNVTA
FT                   TATFSMVYS"
FT   gene            26171..26998
FT                   /locus_tag="SeHA_C0025"
FT   CDS_pept        26171..26998
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0025"
FT                   /product="chaperone protein FimC"
FT                   /note="identified by match to protein family HMM PF00345;
FT                   match to protein family HMM PF02753"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0025"
FT                   /db_xref="EnsemblGenomes-Tr:ACF66273"
FT                   /protein_id="ACF66273.1"
FT                   /translation="MLPRRRHLAWFIPDSLSGFFSRLLGGEKGALRASLRVTNRRHQDI
FT                   TQMKKNLPIFLRLLLLLSAAGLSFAAQAGGIALGATRVIYPQGSKQTSLPIINSSASNV
FT                   FLIQSWVANADGSRSTDFIITPPLFVIQPKKENILRIMYVGPSLPTDRESVFYLNSKAI
FT                   PSVDKNKLTGNSLQIATQSVIKLFIRPKNLAEAPAHAPSTLRCRNERGQLTITNPSPYY
FT                   VSMVELYSAGKKLPNTMVPPKGAITLPATPGQVSLRTVNDFGATTPARVCPAS"
FT   gene            26958..29624
FT                   /locus_tag="SeHA_C0026"
FT   CDS_pept        26958..29624
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0026"
FT                   /product="outer membrane usher protein FimD"
FT                   /note="identified by match to protein family HMM PF00577"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0026"
FT                   /db_xref="EnsemblGenomes-Tr:ACF67972"
FT                   /protein_id="ACF67972.1"
FT                   /translation="MAQRRQHAFVQLHDVMRNQLFMTRYYSSVTKPVLTPLALAIALAP
FT                   APGWAENYFNPAFLSDDPSAVADLSTFSRNAQAAGMYRVDVYLNNTFLATRDIAFQAVK
FT                   TTGKSAPTDDSGLRACLTPEMLKNMGVNTGAFPLLAKAAAGSCPDLASAIPAARTRFDF
FT                   AQQRLDISIPQAAMVASARGYIPPQYWDEGINALLLNYTFTGANSQDRSPGGSAENSYF
FT                   LGLNSGLNLGAWRLRDYSTWNANSGDQNSDSDWQHISTYLERDVVFLQGELTAGDSYTP
FT                   SALFDSLPFRGLQLASDDNMLPDSMKGFAPTIHGIARSNAQVTIRQNGYIINQRYVPPG
FT                   AFTINDLYPTAASGDLTVEVKESDGSINRYNVPYSAVPILQREGRLKYAATVAEYRSDS
FT                   SQKEKVKFSQATLIWGLPHGFTLYGGTQLSSHYHALAIGSGANLGDWGAVSLDVTQATS
FT                   TLADNNTYQGQSLRFLYAKSLAQSGTNLQLMGYRYSTSGFYTLDDTTWKRMSGYDDDSR
FT                   TDSDKSRPEWADYYNLYYTRRGKVQLDINQQLGGLGSLFITGSQQSYWHTDEKDSLLQV
FT                   GYSDTLAGIAWSVSYNNNKSAGDAERDQIFALNISVPLSQWLQHDDEVTRHHNVYATFS
FT                   TSTDKQHNVMQNAGLSGTLLDENNLSYNIQQGYQNHGIGESGAASLEYDGTKGNANIGY
FT                   NVSDNGDYQQVNYGLSGGLVAHAHGVTLSQPLGNTNILIAAPGAANVGVVDQPGIHTDA
FT                   RGYAVVPYATTYRQNRMALDVNAMADDVDIDDAVTRVVPTEGALVLASFKARVGARALV
FT                   TLNHNGKPVPFGATVTVNDRHAEAIVDEAGEVYLSGLSAQGVLHVRWGNLPDQQCVASY
FT                   HLSSSRQILSRQHAECH"
FT   gene            29625..30632
FT                   /locus_tag="SeHA_C0027"
FT   CDS_pept        29625..30632
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0027"
FT                   /product="mannose binding protein FimH"
FT                   /note="identified by match to protein family HMM PF00419"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0027"
FT                   /db_xref="EnsemblGenomes-Tr:ACF67346"
FT                   /protein_id="ACF67346.1"
FT                   /translation="MKIPLLFALLAGSVVSQYAFADVCKNVNGVPSSINYDLTTTLTAE
FT                   QNQVGKTVQLEKSQEVNVQAVCPAGAATYSQTYRSYVSPYPVVETSGNWKYLKLDPDYL
FT                   EGGMRIEDSSAGDIYPPMNNVLMGYDENVKAGQPFYVRDSNLEFQLKIVKPFVGTVNIS
FT                   PKTMFNVYVMTAAGDPLTDVVYSILYSGTVTVPQSCEINAGQTILVNFGALYSGNFNHA
FT                   GQKPEGVRAKKFSVPVKCSGLDSQVNLTMRLIATPDSHVPQAIASDNADVGVVVETDEG
FT                   NALIPNDAQSVAPFITDSAGRANITLQAYPVSTTGETPAEGAFTALASLRVDFD"
FT   gene            30663..31178
FT                   /locus_tag="SeHA_C0028"
FT   CDS_pept        30663..31178
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0028"
FT                   /product="fimbrial subunit"
FT                   /note="identified by match to protein family HMM PF00419"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0028"
FT                   /db_xref="EnsemblGenomes-Tr:ACF69006"
FT                   /protein_id="ACF69006.1"
FT                   /translation="MGLMLCPQINASADDLAYNLEFTGTIVAQTCDIDISSLSQSIDLG
FT                   QFAVGDFPSTGTTTKFKPFNINLKNCSRGIAGAKIWFTGEPDPDNPALLAITDTGMGSG
FT                   NMLASGVGVEILNDDQDTISINNADSVVYPLKAGRNTLSFYIRYKSTRPTVTSGNATAV
FT                   MYFDMQYE"
FT   gene            31194..31712
FT                   /locus_tag="SeHA_C0029"
FT   CDS_pept        31194..31712
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0029"
FT                   /product="fimbrial subunit"
FT                   /note="identified by match to protein family HMM PF00419"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0029"
FT                   /db_xref="EnsemblGenomes-Tr:ACF68340"
FT                   /protein_id="ACF68340.1"
FT                   /translation="MRNDILYGIGMLLAASGVQAHDGRVYVSGTITDNTCSLSPGSENI
FT                   NVAMGAVSQRQFYRAGDGSAWQPFAIDLQNCGSTASGVTVSFSGAADSRNTDLLALTAG
FT                   ESDASGIGIALYDQNKTLIPLGQESDVVTLSPGQASAHLQFYARYLADGGAVTPGDANA
FT                   SATFILAYE"
FT   gene            31774..32409
FT                   /locus_tag="SeHA_C0030"
FT   CDS_pept        31774..32409
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0030"
FT                   /product="fimbrial chaparone"
FT                   /note="identified by match to protein family HMM PF00345;
FT                   match to protein family HMM PF02753"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0030"
FT                   /db_xref="EnsemblGenomes-Tr:ACF69986"
FT                   /protein_id="ACF69986.1"
FT                   /translation="MVIGGTRFIYHAGAPALSVPVSNHSEASWLIDTHILPGGRWPGTK
FT                   NEGNIMPFVVTPPLFMLSARQENSMRVVYTGAPLPADRESLFTLSIAAIPSGKPEANRV
FT                   QMAFRSALKLLYRPEGLAGNPQQAYRHLIWSLTPDGATVRNPTPYYVTLFLLRANERAQ
FT                   DNAGVVAPFATRQTDWCRHTVRCTVRWQSINDYGRVMPAQTVDLTRIH"
FT   gene            32474..33319
FT                   /locus_tag="SeHA_C0031"
FT   CDS_pept        32474..33319
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0031"
FT                   /product="BcfH"
FT                   /note="identified by match to protein family HMM PF01323"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0031"
FT                   /db_xref="EnsemblGenomes-Tr:ACF66934"
FT                   /protein_id="ACF66934.1"
FT                   /translation="MYYHALKISRLAMLTLAGVAVSASAIAADSAPTSQIGPTAEAYIV
FT                   SHPDKVGEVVATYLAEHPEFLVAASETLHQRHQIAQQQAYVQLALQYRAELLSSSSPSV
FT                   GPNEAKAAVVMFFDYQCSWCSKMAPVVENLIKANPDTRFIFKEFPIFSSRWPVSGLAAR
FT                   VGEQVWLTQGGAKYLDWHNALYATGKVEGALTEHDVYTLAQHYLTPTQLAAVKEAQSSG
FT                   AAHDALLTNQALAQHMDFSGTPAFVVMPQTQNGDVKRVTVIPGSTTQDMLQMAIQKAKG
FT                   "
FT   gene            33358..33645
FT                   /pseudo
FT                   /locus_tag="SeHA_C0032"
FT                   /note="conserved hypothetical protein; this gene contains a
FT                   frame shift which may be the result of sequencing error"
FT   gene            complement(33745..34194)
FT                   /locus_tag="SeHA_C0033"
FT   CDS_pept        complement(33745..34194)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0033"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0033"
FT                   /db_xref="EnsemblGenomes-Tr:ACF67923"
FT                   /protein_id="ACF67923.1"
FT                   /translation="MRQHKINNEFIYNESLREITSLRSNAAFKMTFMRAWCLSYLIENA
FT                   HQELIIREGVAYAVWGERSQFVSDANLTQLLYLLRRDLQQIGLFELFVTLPRQGIKTDE
FT                   RFIIDAADIPPQAIQYHTHRCNKIISIGIPTLFLLIVLFFLAPFI"
FT   gene            34942..35154
FT                   /pseudo
FT                   /locus_tag="SeHA_C0034"
FT                   /note="putative arylsulfatase; this gene contains a
FT                   premature stop which may be the result of sequencing error"
FT   gene            35179..35526
FT                   /pseudo
FT                   /locus_tag="SeHA_C0035"
FT                   /note="conserved hypothetical protein; this gene contains a
FT                   premature stop which may be the result of sequencing error"
FT   gene            complement(35657..35776)
FT                   /locus_tag="SeHA_C0036"
FT   CDS_pept        complement(35657..35776)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0036"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0036"
FT                   /db_xref="EnsemblGenomes-Tr:ACF68852"
FT                   /protein_id="ACF68852.1"
FT                   /translation="MQLYRCKQYLKTCQHSHHNNGALHHTIIDMTMITCSAMF"
FT   gene            36110..36874
FT                   /locus_tag="SeHA_C0037"
FT   CDS_pept        36110..36874
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0037"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF07135"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0037"
FT                   /db_xref="EnsemblGenomes-Tr:ACF68408"
FT                   /protein_id="ACF68408.1"
FT                   /translation="MSLIKRTVLFSLLLTISTVFSHSVHALEYKNSFGSINAGYADWNS
FT                   GFVNVHRGEVWKVTADFGVNFKEAEFYSFIESNVLNHAVAGRNHTVSAMTHVRLFDSDY
FT                   TFFGKIYGQWDNSWGDDLDMFYGAGYLGWSGSWGFFKPYIGLHNQSGDYVSQKYGQTSG
FT                   WNGYVIGWTAAYNFNLFGEDFVLSDWNEIELDRNDAYTEQQFGRNGLNGGLTLAWKFYP
FT                   RWKATVTYRYFANKLGYDGYGDQMIYMVGYSF"
FT   gene            36895..38388
FT                   /locus_tag="SeHA_C0038"
FT   CDS_pept        36895..38388
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0038"
FT                   /product="sulfatase"
FT                   /note="identified by match to protein family HMM PF00884"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0038"
FT                   /db_xref="EnsemblGenomes-Tr:ACF70050"
FT                   /protein_id="ACF70050.1"
FT                   /translation="MKKTVIASMIGLALCATSTLSVVHAAAEKRPNLVFIVADDLGYGD
FT                   LATYGHQIVKTPNIDRLAKEGVKFTEYYAPAPLCSPSRAGMLTGRMPFRTGVRSWIPEG
FT                   TNVSIGRNELTIANLLKQQGYDTAMMGKLHLNAGGDRTDQPQPKELGFDYSLVNPAGFV
FT                   TDATLDNAKERPRYGVVHPTGWMRNGKHIDRADSISGEFVSSEVVNWLDNKKDDKPFFL
FT                   YVAFTEVHSPLASPKKYLDMYSQYMSEYQKQHPDLFYGDWADKPWRGTGEYYANISYMD
FT                   AQVGKVLDKIKAMGEEDNTIVIFTSDNGPVTREARKVYELNLAGETDGLRGRKDNLWEG
FT                   GIRVPAIIKYGKHIPQGVVTDTPVYGLDWMPTLANMMDFKLPTDRTYDGQSLVPLLEQK
FT                   TLKRNKPLIFGIDMPFQDDPTDEWAIRDGDWKMIIDRENKPKYLYNLKKDRFETLNQIG
FT                   KQPEIEKQLYGKFLKMKQDIDNDSLMKARGDKPTPVTWG"
FT   gene            38492..39688
FT                   /locus_tag="SeHA_C0039"
FT   CDS_pept        38492..39688
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0039"
FT                   /product="chondroitin sulfate/heparin utilization
FT                   regulation protein"
FT                   /note="identified by match to protein family HMM PF04055"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0039"
FT                   /db_xref="EnsemblGenomes-Tr:ACF70293"
FT                   /protein_id="ACF70293.1"
FT                   /translation="MQRKSCQVMIKPTGSVCNLDCKYCFYLEKEMLYPDRKNHYKMTEE
FT                   TLALFVQQHIAAQDVDEVIFAWQGGEPTLMGLPFYRQAVALQQRYANGKAIVNTFQTNG
FT                   ILIDDEWARFFRAHDFLVGISIDGDAALHDEWRVTRAGQPTHHKVEQAIKCLASHGVEF
FT                   NTLTVVSQSNMLHPQRVYAYLKSIGSRYMQFIPLVERAANKDGMLAHPQDEQTAVTPWS
FT                   VDGLQFGKFLNAIFDIWIREDIGDIGIQLFEQTLAAWCGLPPQVCVFAPVCGSAFAMEM
FT                   NGDVYNCDHFVYPQYKLGNINDTPLRQMNNSAQNQQFGLDKSRTMAQECHTCPWQFACY
FT                   GGCPKHRFLPSACGPMKQNYLCAGYQCFFSHTAPMMKAMKTLYVNNLSPAEIRSVFFK"
FT   gene            39706..40959
FT                   /locus_tag="SeHA_C0040"
FT   CDS_pept        39706..40959
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0040"
FT                   /product="putative cytoplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0040"
FT                   /db_xref="EnsemblGenomes-Tr:ACF69642"
FT                   /protein_id="ACF69642.1"
FT                   /translation="MFANINVDCCKTPGCKNLGVLNSPDYVRQGKDVLCRECGFLFPVI
FT                   SAGALNLFRHTVNRGWKGLVKQCPACGSTSLKKYGFSTQGEHRMACSQCRKTFIVPEKA
FT                   KSDCRQDELATLIEEGTSLAGIRSQLKLDSTGLNRALFKLSRNANLAERCQQFPAFDIA
FT                   LSTRAFRVNYNGGDSSLYVLVTAEEQSGRVVAISSNYSAQPLDKAWQYQSYYEERLPPG
FT                   TLAHMVQRKEAITARRETLFDIDYGPASLYKNDSGMIVKPVLPAYRHFELVRMLTDERS
FT                   LNVQHYLDHECFILGGCMMANMPHVHQGRCHISFVKERGTTPLQKDIPPRLFLSGGIRN
FT                   NVWRTFSTRDYAMAVCNLTGNKKITQQRYATLQGATAFINYLYAHPFLAQLNRLSPANV
FT                   TATLDYLKYEYNQSRKVG"
FT   gene            41078..41484
FT                   /pseudo
FT                   /locus_tag="SeHA_C0041"
FT                   /note="putative sulfatase; this gene contains a frame shift
FT                   which may be the result of sequencing error"
FT   gene            41647..42813
FT                   /gene="nhaA"
FT                   /locus_tag="SeHA_C0043"
FT   CDS_pept        41647..42813
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nhaA"
FT                   /locus_tag="SeHA_C0043"
FT                   /product="Na+/H+ antiporter NhaA"
FT                   /note="identified by match to protein family HMM PF06965;
FT                   match to protein family HMM TIGR00773"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0043"
FT                   /db_xref="EnsemblGenomes-Tr:ACF67682"
FT                   /protein_id="ACF67682.1"
FT                   /translation="MKHLHRFFSSDASGGIILIIAAALAMLMANMGATSGWYHDFLETP
FT                   VQLRVGALEINKNMLLWINDALMAVFFLLIGLEVKRELMQGSLASLRQAAFPVIAAIGG
FT                   MIVPALLYLAFNYSDPVTREGWAIPAATDIAFALGVLALLGSRVPLALKIFLMALAIID
FT                   DLGAIVIIALFYTSDLSIVSLGVAAFAIAVLALLNLCGVRRTGVYILVGAVLWTAVLKS
FT                   GVHATLAGVIVGFFIPLKEKHGRSPAKRLEHVLHPWVAYLILPLFAFANAGVSLQGVTI
FT                   DGLTSMLPLGIIAGLLIGKPLGISLFCWLALRFKLAHLPQGTTYQQIMAVGILCGIGFT
FT                   MSIFIASLAFGNVDPELINWAKLGILIGSLLSAVVGYSWLRARLNAPA"
FT   gene            42881..43774
FT                   /locus_tag="SeHA_C0044"
FT   CDS_pept        42881..43774
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0044"
FT                   /product="transcriptional activator protein NhaR"
FT                   /note="identified by match to protein family HMM PF00126"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0044"
FT                   /db_xref="EnsemblGenomes-Tr:ACF67063"
FT                   /protein_id="ACF67063.1"
FT                   /translation="MSHINYNHLYYFWHVYKEGSVVGAAEALFLTPQTITGQIKALEER
FT                   LQGKLFKRKGRGLEPSELGELVFRYADKMFTLSQEMLDIVNYRKESNLLFDVGVADALS
FT                   KRLVSSVLDAAVVVDEPIHLRCFESTHEMLLEQLSQHKLDMIISDCPIDSTQQEGLFSV
FT                   KIGECSVSFWCTNPLPEKAFPACLEERRLLVPGRRSMLGRKLLNWFNSQGLQVEILGEF
FT                   DDAALMKAFGATHDAIFVAPSLYSLDFYADESVIEIGRVENVMEEYHAIFAERMIQHPA
FT                   VQRICNADYSALFKLQ"
FT   gene            complement(43829..45868)
FT                   /locus_tag="SeHA_C0045"
FT   CDS_pept        complement(43829..45868)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0045"
FT                   /product="glycoside hydrolase, family 31"
FT                   /note="identified by match to protein family HMM PF01055"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0045"
FT                   /db_xref="EnsemblGenomes-Tr:ACF69958"
FT                   /protein_id="ACF69958.1"
FT                   /translation="MPFMQQDPRRLVWQQNDRYLWIEPWGENSLRVRSGRHLPVMRNED
FT                   WALTEPVAESQCHIDYEHHQATLTNGKIIAIVNQKGQVTFYRHPHKPLLQEFWRLRGEI
FT                   GEDESSHGQYVSALNLEGREFRPIQGGKYSLKARFEATEGEKIYGMGQYQQANLDLKGC
FT                   VLELAQRNSQASVPFMLSSLGYGFLWNNPAVGRVTFAQNVTEWEAQVSEQLDYWITAGD
FT                   TPAEISRAYALATGTPPMMPDYAMGFWQCKLRYRTQEELLEVAREYKRRNLPISVIVID
FT                   FFHWPNQGDWMFDARDWPDPDAMIAELKSLGIELMVSVWPTVDNRTESYREMRENGWLV
FT                   QTERGLPINMDFLGNTTYFDATHPGARDYVWGKAKRNYYDKGVKLFWLDEAEPEFSVYD
FT                   YDNYRYHAGPVLEVGNIYPRMYAKTFFDGMKADGEDQVINLLRCAWAGSQKFGALVWSG
FT                   DIHSSFRSLRNQFAAGLNMGIAGIPWWTTDIGGFHGGNIHDPKFHELLIRWFQWGVFSP
FT                   VMRLHGNRDPQILPAQPYRDGIAQCPTGAPNEVWSYGEEVCEVLTGCLALREKLKPYIK
FT                   ALMEETHKHNTPVMRPLFFEFPEQETSWAITDQYCFGPDLLIAPVMHEGMRERDIWLPE
FT                   GETWTDLATGESYSGGQTLHYATPLNRIPVFIREGGQYRSLLNL"
FT   gene            complement(45908..47281)
FT                   /locus_tag="SeHA_C0046"
FT   CDS_pept        complement(45908..47281)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0046"
FT                   /product="xylose-proton symporter"
FT                   /note="identified by match to protein family HMM TIGR00792"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0046"
FT                   /db_xref="EnsemblGenomes-Tr:ACF67313"
FT                   /protein_id="ACF67313.1"
FT                   /translation="MSSVIEDTQPSGSASLSLLQRISYGSLDVAGNLLYCFGSTYILYF
FT                   YTDVAGISLAVAGVILLLARIIDGIDAPIWGIIIDKTRSRYGKCRPWFLWLPLPFAVFS
FT                   ALSFWSPDISMTGKAIYAAISYMIASILFTGLNTPLSAILPLMTLSPKERLVLNSWRMT
FT                   GGQIGVLLMNATALPLVAFLGNGDDHAGFIYTAITFAIISCALTLFAFKNIREMDTDKI
FT                   QHEPKLPMKKSFAAMKGNWPWILMVLANLIFWIALQQRNTTIVYYLTYNLDRKDLVPLI
FT                   NSLATIQILFIIAIPFFSKYLAKTWIWVGGLLVATFGGVMMWLAADNITFLIAAWILGN
FT                   IGSGIACSMPFAMLGFAVDFGAWKTGIKATGILIAFGSTFCIKMGSGLGTAFAAWIMNS
FT                   FGYVPNHAQSAAGLEGIIWAFIWAPALLFALAAIPLLFFRKYEAMEEKIRHDLETVNS"
FT   gene            complement(47737..48000)
FT                   /gene="rpsT"
FT                   /locus_tag="SeHA_C0047"
FT   CDS_pept        complement(47737..48000)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsT"
FT                   /locus_tag="SeHA_C0047"
FT                   /product="ribosomal protein S20"
FT                   /note="identified by match to protein family HMM PF01649;
FT                   match to protein family HMM TIGR00029"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0047"
FT                   /db_xref="EnsemblGenomes-Tr:ACF66648"
FT                   /db_xref="GOA:B4TIE3"
FT                   /db_xref="InterPro:IPR002583"
FT                   /db_xref="InterPro:IPR036510"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4TIE3"
FT                   /protein_id="ACF66648.1"
FT                   /translation="MANIKSAKKRAVQSEKARKHNASRRSMMRTFIKKVYAAIEAGDKA
FT                   AALKAFNEMQPIVDRQAAKGLIHKNKAARHKANLTAQINKLA"
FT   gene            48329..49267
FT                   /gene="ribF"
FT                   /locus_tag="SeHA_C0048"
FT   CDS_pept        48329..49267
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ribF"
FT                   /locus_tag="SeHA_C0048"
FT                   /product="riboflavin biosynthesis protein RibF"
FT                   /EC_number="2.7.1.26"
FT                   /EC_number="2.7.7.2"
FT                   /note="identified by match to protein family HMM PF01687;
FT                   match to protein family HMM PF06574; match to protein
FT                   family HMM TIGR00083"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0048"
FT                   /db_xref="EnsemblGenomes-Tr:ACF66538"
FT                   /protein_id="ACF66538.1"
FT                   /translation="MKLIRGIHNLSQAPHGCVLTIGNFDGVHRGHRALLQGLQEEGRRR
FT                   GLPVVVMIFEPQPLELFATDKAPARLTRLREKLYYLAQCGVDYVLCVKFDRRFAALTAQ
FT                   TFISELLVERLGVQFLAVGDDFRFGASRAGDFLLLQKAGAEYGFAVSSTQTFCEGGVRI
FT                   SSTAVRQALAEDNLALAESLLGHPFTISGRVVHGDELGRTIGFPTANLPLRRQVSPVKG
FT                   VYAVEVTGLGDKPLPGVANIGTRPTVAGVRQQLEVHLLDVVMDLYGRHIDVILRKKIRN
FT                   EQRFASLDELKAQIARDELTARKFFGLAGQV"
FT   gene            49276..52146
FT                   /gene="ileS"
FT                   /locus_tag="SeHA_C0049"
FT   CDS_pept        49276..52146
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ileS"
FT                   /locus_tag="SeHA_C0049"
FT                   /product="isoleucyl-tRNA synthetase"
FT                   /EC_number="6.1.1.5"
FT                   /note="identified by match to protein family HMM PF00133;
FT                   match to protein family HMM PF06827; match to protein
FT                   family HMM PF08264; match to protein family HMM PF09334;
FT                   match to protein family HMM TIGR00392"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0049"
FT                   /db_xref="EnsemblGenomes-Tr:ACF65953"
FT                   /protein_id="ACF65953.1"
FT                   /translation="MFIKPKYGTENLMSDYKSTLNLPETGFPMRGDLAKREPGMLARWT
FT                   DDDLYGIIRAAKKGKKTFILHDGPPYANGSIHIGHSVNKILKDIIVKSKGLSGFDSPYV
FT                   PGWDCHGLPIELKVEQEFGKPGEKFTAAEFRAKCREYAATQVDGQRKDFIRLGVLGDWS
FT                   HPYLTMDFKTEANIIRALGRIIKNGHLHKGAKPVHWCVDCRSALAEAEVEYYDKTSPSI
FT                   DVAFRAVDQDAVKAKFGLPGVSGPVSLVIWTTTPWTLPANRAISLAPDFDYALVQIDGQ
FT                   AVILAKDLVESVMQRIGAAEYTILGTVKGAELELLRFTHPFMGFDVPAILGDHVTLDAG
FT                   TGAVHTAPGHGPDDYVIGQKYGLETANPVGPDGAYLPGTYPTLDGVNVFKANDIVIELL
FT                   KEKGALLHVEKMQHSYPCCWRHKTPIIFRATPQWFVSMDKEGLRQQSLKEIKGVQWIPD
FT                   WGQARIESMVANRPDWCISRQRTWGVPMSLFVHKETQELLPIERTLAAMEEVAKRVEVD
FT                   GIQAWWDLDPKEILGEDADQYEKVPDTLDVWFDSGSTSYSVVDARPEFAGHAADMYLEG
FT                   SDQHRGWFMSSLMISVAMKGKAPYRQVLTHGFTVDGQGRKMSKSIGNTVSPQDVMNKLG
FT                   ADILRLWVASTDYTGEMAVSDEILKRAADSYRRIRNTARFLLANLNGFNPATDMVKPEE
FT                   MVVLDRWAVGCAKTAQQEILKAYEAYDFHEVVQRLMRFCSVEMGSFYLDIIKDRQYTAK
FT                   ADSVARRSCQTALYHIAEALVRWMAPIMSFTADEIWGYLPGEREKYVFTGEWYDGLFGL
FT                   EENEEFNDAFWDDVRYIKDQVNKELENQKANGIKSNLEAKVTLKYADDANGTIKKLKLL
FT                   GEEVRFIFITSQFVISEQAGGIDDENIQYNAGNTTVQAVVTRAEGDKCPRCWHYTTDVG
FT                   KVAEHADICGRCVSNIAGNGEQRKFA"
FT   gene            52146..52646
FT                   /gene="lspA"
FT                   /locus_tag="SeHA_C0050"
FT   CDS_pept        52146..52646
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lspA"
FT                   /locus_tag="SeHA_C0050"
FT                   /product="signal peptidase II"
FT                   /EC_number="3.4.23.36"
FT                   /note="identified by match to protein family HMM PF01252;
FT                   match to protein family HMM TIGR00077"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0050"
FT                   /db_xref="EnsemblGenomes-Tr:ACF67840"
FT                   /db_xref="GOA:B4TIE6"
FT                   /db_xref="InterPro:IPR001872"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4TIE6"
FT                   /protein_id="ACF67840.1"
FT                   /translation="MSKPLCSTGLRWLWLVVVVLIIDLGSKYLILQNFALGDTVGLFPS
FT                   LNLHYARNYGAAFSFLADSGGWQRWFFAGIAIGICVILLVMMYRSKATQKLNNIAYALI
FT                   IGGALGNLFDRLWHGFVVDMIDFYVGNWHFATFNLADSAICIGAALIVLEGFLPKPTAK
FT                   EQA"
FT   gene            52660..52791
FT                   /locus_tag="SeHA_C0051"
FT   CDS_pept        52660..52791
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0051"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0051"
FT                   /db_xref="EnsemblGenomes-Tr:ACF67176"
FT                   /protein_id="ACF67176.1"
FT                   /translation="MALIRFCRPGKRSAIRQTWCRMAVKTPYPAYGFIVLYASGQNT"
FT   gene            52801..53250
FT                   /gene="fkpB"
FT                   /locus_tag="SeHA_C0052"
FT   CDS_pept        52801..53250
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fkpB"
FT                   /locus_tag="SeHA_C0052"
FT                   /product="FKBP-type 16 kDa peptidyl-prolyl cis-trans
FT                   isomerase"
FT                   /EC_number="5.2.1.8"
FT                   /note="identified by match to protein family HMM PF00254"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0052"
FT                   /db_xref="EnsemblGenomes-Tr:ACF69102"
FT                   /protein_id="ACF69102.1"
FT                   /translation="MSKSVQSNSAILVHFTLKLDDGSTAESTRNNGKPALFRLGDTSLS
FT                   EGLEQQLLGLKEGEKKAFSLEPDAAFGVPSPDLIQYFSRREFMAAGEPEVGAIMLFTAM
FT                   DGSEMPGVIREINGDSITVDFNHPLAGHTVHFDIEVLEIDPALEA"
FT   gene            53253..54203
FT                   /gene="ispH"
FT                   /locus_tag="SeHA_C0053"
FT   CDS_pept        53253..54203
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ispH"
FT                   /locus_tag="SeHA_C0053"
FT                   /product="4-hydroxy-3-methylbut-2-enyl diphosphate
FT                   reductase"
FT                   /EC_number="1.17.1.2"
FT                   /note="identified by match to protein family HMM PF02401;
FT                   match to protein family HMM TIGR00216"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0053"
FT                   /db_xref="EnsemblGenomes-Tr:ACF68506"
FT                   /db_xref="GOA:B4TIE9"
FT                   /db_xref="InterPro:IPR003451"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4TIE9"
FT                   /protein_id="ACF68506.1"
FT                   /translation="MQILLANPRGFCAGVDRAISIVENALAIYGAPIYVRHEVVHNRYV
FT                   VDSLRQRGAIFIEQISEVPDGAILIFSAHGVSQAVRNEAKSRDLTVFDATCPLVTKVHM
FT                   EVARASRRGEESILIGHAGHPEVEGTMGQYSNPEGGMYLVESPEDVWTLNVKNEGKLSF
FT                   MTQTTLSVDDTSDVIDALRKRFPKIVGPRKDDICYATTNRQEAVRALAEQADVVLVVGS
FT                   KNSSNSNRLAELAQRMGRTAFLIDDAADIQEAWVKEAACVGVTAGASAPDILVQNVIAR
FT                   LREFGGGEAVTLEGREENIVFEVPKELRVDVREVE"
FT   gene            54403..55605
FT                   /locus_tag="SeHA_C0054"
FT   CDS_pept        54403..55605
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0054"
FT                   /product="putative nitrite reductase"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0054"
FT                   /db_xref="EnsemblGenomes-Tr:ACF70479"
FT                   /protein_id="ACF70479.1"
FT                   /translation="MGKIKYGLPTLLAIGFWMDATSATVLELPAWERNYTGTIAGKPVN
FT                   VNITRFGNSLNGYYCYEPCNQHKAVIVLRGSLQDKEVHLEERVKALSGYWNAEISSSEI
FT                   KGEWTSADKKRHFPVALIYYKPKNSPDIVLVTNTNDAGGYDPSKEIDCGNTPAISAIKL
FT                   YRDGKLIQTLDTASVGTCSPFMPQWGDVNFDGYPDLSIVTELLAGPDAPVQTWLYDPAK
FT                   QRYVDAPASYQEITSPEIDAEHKQIVSYWRGGCCSHGVNVYRWKGKTIELIDRGESYFQ
FT                   PVISKGKMYNCYMTPSYADGRIIYPLVRKNGHLTPPLSLDGTCQSFWLTGNVRTVIQAE
FT                   KPGAEPESLEIQWQENKASPGRFCPLVPFVEGDKLSPRLVTDDDVPDACISRAEYEDIK
FT                   Q"
FT   gene            55621..56541
FT                   /locus_tag="SeHA_C0055"
FT   CDS_pept        55621..56541
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0055"
FT                   /product="Non-specific ribonucleoside hydrolase RihC"
FT                   /EC_number="3.2.-.-"
FT                   /note="identified by match to protein family HMM PF01156"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0055"
FT                   /db_xref="EnsemblGenomes-Tr:ACF70008"
FT                   /db_xref="GOA:B4TIF1"
FT                   /db_xref="InterPro:IPR001910"
FT                   /db_xref="InterPro:IPR022976"
FT                   /db_xref="InterPro:IPR023186"
FT                   /db_xref="InterPro:IPR036452"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4TIF1"
FT                   /protein_id="ACF70008.1"
FT                   /translation="MTASLHIILDTDPGIDDAAAIAAALFAPQLDLQLITTVAGNVSVE
FT                   KTTRNALQLLHFWNSDIPLAQGAATPLLRPLRDAAYVHGESGMEGYDFVDHQRQPLAKP
FT                   AFIAIRDVLMNAPEPMTLVAIGPLTNIALLLMHYPECACNIRRLVLMGGSAGRGNFTPN
FT                   AEFNIAVDPEAAALVFRSGLEIVMCGLDVTNQAMLSPDFLNKLPALNRTGKMLHSLFNH
FT                   YRSGSMRTGVRMHDLCAIAWLVRPELFTLQSCFVAVETQGQYTAGTTVVDIEGRLGQPA
FT                   NAQVALALDVDGFRQWVAEVFACAP"
FT   gene            complement(56563..57249)
FT                   /locus_tag="SeHA_C0056"
FT   CDS_pept        complement(56563..57249)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0056"
FT                   /product="transcriptional regulatory protein CitB"
FT                   /note="identified by match to protein family HMM PF00072"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0056"
FT                   /db_xref="EnsemblGenomes-Tr:ACF66836"
FT                   /protein_id="ACF66836.1"
FT                   /translation="MDSITTLIVEDEPMLAEILVDTIKLFPQFSIVGIADKLESAKKQI
FT                   RLYQPQLILLDNFLPDGKGIDLIRHTISTNYTGRIIFITADNHMDTISDALRMGVFDYL
FT                   IKPVHYQRLQHTLERFTRYRSSLRSSEQANQTHVDALFNIQAKEQTAEPNSGLRGIDEN
FT                   TFNRVRQIFADPQAVHTADTLAQILGSSKTTARRYLEQGVKNNFLEAEISYGKVGRPER
FT                   LYRGKV"
FT   gene            complement(57251..58909)
FT                   /locus_tag="SeHA_C0057"
FT   CDS_pept        complement(57251..58909)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0057"
FT                   /product="sensor kinase DpiB"
FT                   /EC_number="2.7.13.3"
FT                   /note="identified by match to protein family HMM PF02518"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0057"
FT                   /db_xref="EnsemblGenomes-Tr:ACF66636"
FT                   /protein_id="ACF66636.1"
FT                   /translation="MQENTVIKYLNTNMFIREITRWFARRSFQNRIFLLILFTSTIVML
FT                   AITWYLTDITKERLHYQVGQRALIQAMQISAMPELVEAVEAHDLSRIKALIDPMRSFSD
FT                   ATYITVGNEKGQRLYHVNPDEIGKYMEGGDSDDALYNAKSYVSVRKGSLGSSLRGKSPI
FT                   QDSTGKVIGIVSVGYTLEQLESWLNLQISSLLFPMALLLLVLLYCARRFSLHIKKQMLN
FT                   MEPQQLSQLLIQQSVLFESVFEGLIAIDSHHRITAINQTARRLLNLSQPESELIGYAIH
FT                   HIVLPEAFFYDAPQKNKKDEIVTFNQMKVIASRMAVIIDNQPQGWVISFRNKDDINTLS
FT                   LQLSQVRQYADNLRAVQHEHRNLISTIAGLLFLKRYDNALALIQQQSESHQKVLDFISH
FT                   NFRDHHLAGLLIGKYYRAKELGLELIFDPSSFVEHLPSSLSHNEWISIVGNLLDNAYNA
FT                   TLLNREGSRQIECLINSEGNEVIIEVADQGCGIDENIRQHIFERGVTTHNNGDHGIGLW
FT                   LVHSYVKQANGDIIVDNNNPFGTIFTLYIPFTREE"
FT   gene            complement(59005..60306)
FT                   /locus_tag="SeHA_C0058"
FT   CDS_pept        complement(59005..60306)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0058"
FT                   /product="oxaloacetate decarboxylase beta chain"
FT                   /EC_number="4.1.1.3"
FT                   /note="identified by match to protein family HMM PF03977;
FT                   match to protein family HMM TIGR01109"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0058"
FT                   /db_xref="EnsemblGenomes-Tr:ACF66672"
FT                   /protein_id="ACF66672.1"
FT                   /translation="MESLNALLQGMGLMHLGAGQAIMLLVSLLLLWLAIAKKFEPLLLL
FT                   PIGFGGLLSNIPEAGMALTALESLLAHHDAGQLAVIAAKLNCAPDVHAIKEALALALPS
FT                   VQGQMENLAVDMGYTPGVLALFYKVAIGSGVAPLVIFMGVGAMTDFGPLLANPRTLLLG
FT                   AAAQFGIFATVLGALTLNYFGIISFTLPQAAAIGIIGGADGPTAIYLSGKLAPELLGAI
FT                   AVAAYSYMALVPLIQPPIMRALTTETERKIRMVQLRTVSKREKILFPVVLLLLVALLLP
FT                   DAAPLLGMFCFGNLMRESGVVERLSDTVQNGLINIVTIFLGLSVGAKLVADKFLQPQTL
FT                   GILLLGVVAFGIGTAAGVLMAKLLNLCSKNKINPLIGSAGVSAVPMAARVSNKVGLESD
FT                   PQNFLLMHAMGPNVAGVIGSAIAAGVMLKYVLAM"
FT   gene            complement(60319..62094)
FT                   /gene="oadA"
FT                   /locus_tag="SeHA_C0059"
FT   CDS_pept        complement(60319..62094)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="oadA"
FT                   /locus_tag="SeHA_C0059"
FT                   /product="oxaloacetate decarboxylase alpha subunit"
FT                   /EC_number="4.1.1.3"
FT                   /note="identified by match to protein family HMM PF00364;
FT                   match to protein family HMM PF00682; match to protein
FT                   family HMM PF02436; match to protein family HMM TIGR01108"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0059"
FT                   /db_xref="EnsemblGenomes-Tr:ACF69364"
FT                   /protein_id="ACF69364.1"
FT                   /translation="MTIAITDVVLRDAHQSLFATRLRLDDMLPIAAALDDVGYGSLECW
FT                   GGATFDACIRFLGEDPWLRLRELKKAMPKTPLQMLLRGQNLLGYRHYADDVVERFVERA
FT                   VKNGMDVFRVFDAMNDPRNMKAALQAVRSHGAHAQGTLSYTTSPAHTLQTWLDLTEQLL
FT                   ETGVDSIAIKDMSGILTPMAAYELVSEIKKRYDVRLHLHCHATTGMAEMALLKAIEAGV
FT                   DGVDTAISSMSATYGHPATEALVATLAGTKYDTGLDILKLENIAAYFREVRKKYHAFEG
FT                   QLKGYDSRILVAQVPGGMLTNLESQLKQQNAADRLDQVLAEIPRVREDLGFIPLVTPTS
FT                   QIVGTQAVLNVLTGERYKTIAKETAGILKGEYGHTPVPVNAGLQARVLEGGAPVTCRPA
FT                   DLLKPELAELEADVRRQAQEKGIQLAGNAIDDVLTVALFPQIGLKFLENRHNPAAFEPL
FT                   PQAEAAQPVAKAEKSAASGIYTVEVEGKVFVVKVSDGGDISQLTAAVPAASSAPVQAAA
FT                   PAGAGTPVTAPLAGNIWKVIATEGQTVAEGDVLLILEAMKMETEIRAAQAGTVRGIAVK
FT                   SGDAVSVGDTLMTLA"
FT   gene            complement(62111..62350)
FT                   /locus_tag="SeHA_C0060"
FT   CDS_pept        complement(62111..62350)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0060"
FT                   /product="conserved domain protein"
FT                   /EC_number="4.1.1.3"
FT                   /note="identified by match to protein family HMM PF04277;
FT                   match to protein family HMM TIGR01195"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0060"
FT                   /db_xref="EnsemblGenomes-Tr:ACF66121"
FT                   /protein_id="ACF66121.1"
FT                   /translation="MNEAVLLGEGFTLMFLGMGFVLSFLFLLIFAIRGMSAVITRFFSE
FT                   PVAAPAPRAVPVVDDFTRLKPVIAAAIHHHRHHV"
FT   gene            complement(62509..63849)
FT                   /locus_tag="SeHA_C0061"
FT   CDS_pept        complement(62509..63849)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0061"
FT                   /product="citrate-sodium symporter"
FT                   /note="identified by match to protein family HMM PF03390;
FT                   match to protein family HMM TIGR00783"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0061"
FT                   /db_xref="EnsemblGenomes-Tr:ACF66024"
FT                   /protein_id="ACF66024.1"
FT                   /translation="MTNMTQASATEKKGASDLLRFKIFGMPLPLYAFALITLLLSHFYN
FT                   AIPTDLVGGFALMFVMGAIFGEIGKRLPIFNKYIGGAPVMIFLVAAYFVYAGIFTQKEI
FT                   DAISNVMDKSNFLNLFIAVLITGAILSVNRKLLLKSLLGYIPTILAGIVGASLFGIVIG
FT                   LCFGIPVDRIMMLYVLPIMGGGNGAGAVPLSEIYHSVTGRSREEYYSTAIAILTIANIF
FT                   AIIFAALLDMIGKKYTWLSGEGELVRKASFKTEDDEKAGQITHRETAVGMVLSTTCFLL
FT                   AYVVAKKILPSIGGVSIHYFAWMVLIVAALNASGLCSPEIKAGAKRLSDFFSKQLLWVL
FT                   MVGVGVCYTDLQEIIDALTFANVVIAAIIVVGAVVGAAIGGWLIGFYPIESSITAGLCM
FT                   ANRGGSGDLEVLSACNRMNLISYAQISSRLGGGIVLVIASIVFSMMV"
FT   gene            64106..65137
FT                   /gene="citC"
FT                   /locus_tag="SeHA_C0062"
FT   CDS_pept        64106..65137
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="citC"
FT                   /locus_tag="SeHA_C0062"
FT                   /product="[citrate (pro-3S)-lyase] ligase"
FT                   /EC_number="6.2.1.22"
FT                   /note="identified by match to protein family HMM PF00583;
FT                   match to protein family HMM PF08218; match to protein
FT                   family HMM TIGR00124; match to protein family HMM
FT                   TIGR00125"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0062"
FT                   /db_xref="EnsemblGenomes-Tr:ACF67502"
FT                   /protein_id="ACF67502.1"
FT                   /translation="MNLIFKRIYLQKDVLRRESVAMFLEGVGLALEDDCEIAVCAYWQG
FT                   EIVGCGSLAGNVLKCIAVSPVLQGEGLSLKLLTELLTLAYELNRSELFLFTKPQNRLLF
FT                   SGAGFWPIAQAGELAVLMENSSERLARFCRQLALYRQPGKTIGAIVMNANPFTLGHRYL
FT                   VEQAAAACDWLHLFVVKEDASFFSYTDRWALIEQGIAGIDNVTLHSGSAYMISRATFPG
FT                   YFLKEKGVVDDCHCQIDLQLFREHLAPALGITHRFVGSEPFCPLTCAYNQRMHDILHDP
FT                   KRSGPVIEVVELARVEKNGTAISASRVRKLYSERNWPAISALVPAGTLAYLQRHAARHT
FT                   ETI"
FT   gene            65167..65460
FT                   /gene="citD"
FT                   /locus_tag="SeHA_C0063"
FT   CDS_pept        65167..65460
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="citD"
FT                   /locus_tag="SeHA_C0063"
FT                   /product="citrate lyase acyl carrier protein"
FT                   /EC_number="4.1.3.6"
FT                   /note="identified by match to protein family HMM PF04953;
FT                   match to protein family HMM TIGR01608"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0063"
FT                   /db_xref="EnsemblGenomes-Tr:ACF68149"
FT                   /protein_id="ACF68149.1"
FT                   /translation="MKIIKDALAGTLESSDVMIRIGPSSEPGIRLELESLVKQQFGAAI
FT                   EQVVRETLAKLGVERALVSVDDKGALECILRARVQAAALRAAEQTEIQWSAL"
FT   gene            65457..66326
FT                   /gene="citE"
FT                   /locus_tag="SeHA_C0064"
FT   CDS_pept        65457..66326
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="citE"
FT                   /locus_tag="SeHA_C0064"
FT                   /product="citrate (pro-3S)-lyase, beta subunit"
FT                   /EC_number="4.1.3.6"
FT                   /note="identified by match to protein family HMM PF03328;
FT                   match to protein family HMM TIGR01588"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0064"
FT                   /db_xref="EnsemblGenomes-Tr:ACF68231"
FT                   /protein_id="ACF68231.1"
FT                   /translation="MRPRRSMLFIPGANAAMLSTSFVYGADAVMFDLEDAVALREKDTA
FT                   RLLVHHALQHPFYQDVEKVVRINPLNTPFGLADLEAVVRGGADIVRLPKTDSKNDVLEL
FT                   EAQVERIERECGRAVGSTRLMAAIESAKGVVNAVDIATSSPRMVAIALAAFDYVMDMGT
FT                   CRGDGTELFYARCAVLHAARVAGIAAYDVVWSDINNEEGFLKEVQLAKGLGFNGKSLVN
FT                   PRQIELLHQAYSPTRKEVEHAYEVIAAAEEAESRGLGVVSLNGKMIDGPIIDHARKVVA
FT                   LSASGIRD"
FT   gene            66337..67857
FT                   /gene="citF"
FT                   /locus_tag="SeHA_C0065"
FT   CDS_pept        66337..67857
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="citF"
FT                   /locus_tag="SeHA_C0065"
FT                   /product="citrate lyase, alpha subunit"
FT                   /EC_number="2.8.3.10"
FT                   /note="identified by match to protein family HMM PF04223;
FT                   match to protein family HMM TIGR01584"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0065"
FT                   /db_xref="EnsemblGenomes-Tr:ACF68365"
FT                   /protein_id="ACF68365.1"
FT                   /translation="MKETVTMLNQQYVVPEGLQPYQGVTANSPWLASETEKRRRKICDS
FT                   LEEAIRRSGLKNGMTISFHHAFRGGDKVVNMVMAKLAEMGFRDLTLASSSLIDAHWPLI
FT                   EHIKNGVVRQIYTSGLRGKLGEEISAGLMENPVQIHSHGGRVKLIQSGELNIDVAFLGV
FT                   PCCDEFGNANGFSGKSRCGSLGYAQVDAQYAKCVVLLTEEWVEFPNYPASIAQDQVDLI
FT                   VQVDEVGDPEKITAGAIRLSSNPRELLIARQAANVIEHSGYFCDGFSLQTGTGGASLAV
FT                   TRFLEDKMRRHNITASFGLGGITGTMVDLHEKGLIKALLDTQSFDGDAARSLAQNPHHI
FT                   EISTNQYANPVSKGAACERLNVVMLSALEIDVNFNVNVMTGSNGVLRGASGGHSDTAAG
FT                   ADLTIITAPLVRGRIPCVVEKVLTTVTPGASVDVLVTDHGIAVNPARQDLLDNLRAAGV
FT                   ALMTIEQLQQRAEQLTGKPQPIEFTDRVVAVVRYRDGSVIDVIRQVKG"
FT   gene            67857..68408
FT                   /gene="citX"
FT                   /locus_tag="SeHA_C0066"
FT   CDS_pept        67857..68408
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="citX"
FT                   /locus_tag="SeHA_C0066"
FT                   /product="holo-ACP synthase CitX"
FT                   /EC_number="2.7.7.61"
FT                   /note="identified by match to protein family HMM PF03802;
FT                   match to protein family HMM TIGR03124"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0066"
FT                   /db_xref="EnsemblGenomes-Tr:ACF70307"
FT                   /protein_id="ACF70307.1"
FT                   /translation="MKGTDLLYQGQAVTLEEMLQARDKRAARQRQALNCYRLPLISLTL
FT                   VAPGAVKNSAVWRRVADYAIAEILALCEQKEWVNVWEMQVNERSGPEWMAAVCAPAMAL
FT                   KQHMSTLEMSHPLGRLWDIDIIDSDGKSLSRRELGYPARPCLICQQDAHLCARGKHHTL
FT                   DLLLDEIARRIECYERERCD"
FT   gene            68386..69294
FT                   /gene="citG"
FT                   /locus_tag="SeHA_C0067"
FT   CDS_pept        68386..69294
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="citG"
FT                   /locus_tag="SeHA_C0067"
FT                   /product="triphosphoribosyl-dephospho-CoA synthase CitG"
FT                   /EC_number="2.4.2.52"
FT                   /note="identified by match to protein family HMM PF01874;
FT                   match to protein family HMM TIGR03125"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0067"
FT                   /db_xref="EnsemblGenomes-Tr:ACF67343"
FT                   /protein_id="ACF67343.1"
FT                   /translation="MNVSVVTERRTPAYSSLAAGELNGLVARALLTEARLTPKPGLVDI
FT                   RNSGAHRDMDLAAFERSTTAIAPWMEKFFIMGNNTAALAAENVLVMLRPLGMACENDML
FT                   QATNGVNTHRGAIFAFGLLSAAIGRLLARGEPLEQNRICDQVARLSRNIVAHELSAKKA
FT                   GKLTKSETHFQCYGLSGARGEAESGFRTVRTQALPVFNRVVQEHDDTHLALLQTLLHLM
FT                   AWNDDTNLVSRGGLEGLYYVQQQAQKLLWQGGVLVEGGIEAMQSLDDELILRNLSPGGS
FT                   ADLLAVTWFLSHFPAGSLYPE"
FT   gene            69474..70295
FT                   /gene="dapB"
FT                   /locus_tag="SeHA_C0068"
FT   CDS_pept        69474..70295
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dapB"
FT                   /locus_tag="SeHA_C0068"
FT                   /product="dihydrodipicolinate reductase"
FT                   /EC_number="1.17.1.8"
FT                   /note="identified by match to protein family HMM PF01113;
FT                   match to protein family HMM PF05173; match to protein
FT                   family HMM TIGR00036"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0068"
FT                   /db_xref="EnsemblGenomes-Tr:ACF69200"
FT                   /db_xref="GOA:B4TIG4"
FT                   /db_xref="InterPro:IPR000846"
FT                   /db_xref="InterPro:IPR022663"
FT                   /db_xref="InterPro:IPR022664"
FT                   /db_xref="InterPro:IPR023940"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4TIG4"
FT                   /protein_id="ACF69200.1"
FT                   /translation="MHEAQIRVAIAGAGGRMGRQLIQAAMAMEGVQLGAALEREGSSLL
FT                   GSDAGELAGAGKSGVIVQSSLEAVKDDFDVFIDFTRPEGTLTHLAFCRQHGKGMVIGTT
FT                   GFDDAGKQAIREASQEIAIVFAANFSVGVNVMLKLLEKAAKVMGDYSDIEIIEAHHRHK
FT                   VDAPSGTALAMGEAIAGALDKNLKDCAVYSREGYTGERVPGTIGFATVRAGDIVGEHTA
FT                   MFADIGERVEITHKASSRMTFANGALRSALWLKTKKNGLFDMRDVLGLDVL"
FT   gene            complement(70771..70917)
FT                   /locus_tag="SeHA_C0069"
FT   CDS_pept        complement(70771..70917)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0069"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0069"
FT                   /db_xref="EnsemblGenomes-Tr:ACF66253"
FT                   /protein_id="ACF66253.1"
FT                   /translation="MSSKKTGWHDKKWTKWSNFTLKQQKTTIKIHLITINAIKCIKIQN
FT                   KEN"
FT   gene            71131..72306
FT                   /gene="carA"
FT                   /locus_tag="SeHA_C0070"
FT   CDS_pept        71131..72306
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="carA"
FT                   /locus_tag="SeHA_C0070"
FT                   /product="carbamoyl-phosphate synthase, small subunit"
FT                   /EC_number="6.3.5.5"
FT                   /note="identified by match to protein family HMM PF00117;
FT                   match to protein family HMM PF00988; match to protein
FT                   family HMM TIGR01368"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0070"
FT                   /db_xref="EnsemblGenomes-Tr:ACF67083"
FT                   /protein_id="ACF67083.1"
FT                   /translation="MSEYSLEGVLIKSALLVLEDGTQFHGRAIGATGSAVGEVVFNTSM
FT                   TGYQEILTDPSYSRQIVTLTYPHIGNVGTNEADEESSQVHAQGLVIRDLPLIASNFRNT
FT                   EDLSSYLKRHNIVAIADIDTRKLTRLLREKGAQNGCIIAGDSPDAKLALEKAKAFPGLN
FT                   GMDLAKEVTTTETYRWTQGSWTLKDGLPEAKSEDDLPFHVVAYDFGAKRNILRMLVDRG
FT                   CRLTVVPAQTSAEEVLKMNPDGIFLSNGPGDPAPCDYAIEAIKKFLQTDIPVFGICLGH
FT                   QLLALASGAKTVKMKFGHHGGNHPVKDMDRNVVMITAQNHGFAVDEDSLPANLRVTHKS
FT                   LFDGTLQGIHRTDKPAFSFQGHPEASPGPHDAAPLFDHFIELIEQYRQSAK"
FT   gene            72325..75552
FT                   /gene="carB"
FT                   /locus_tag="SeHA_C0071"
FT   CDS_pept        72325..75552
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="carB"
FT                   /locus_tag="SeHA_C0071"
FT                   /product="carbamoyl-phosphate synthase, large subunit"
FT                   /EC_number="6.3.5.5"
FT                   /note="identified by match to protein family HMM PF00289;
FT                   match to protein family HMM PF02142; match to protein
FT                   family HMM PF02786; match to protein family HMM PF02787;
FT                   match to protein family HMM TIGR01369"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0071"
FT                   /db_xref="EnsemblGenomes-Tr:ACF66407"
FT                   /protein_id="ACF66407.1"
FT                   /translation="MPKRTDIKSILILGAGPIVIGQACEFDYSGAQACKALREEGYRVI
FT                   LVNSNPATIMTDPEMADATYIEPIHWEVVRKIIEKERPDAVLPTMGGQTALNCALELER
FT                   QGVLEEFGVTMIGATADAIDKAEDRRRFDIAMKKIGLDTARSGIAHTMEEALAVAADVG
FT                   FPCIIRPSFTMGGTGGGIAYNREEFEEICERGLDLSPTNELLIDESLIGWKEYEMEVVR
FT                   DKNDNCIIVCSIENFDAMGIHTGDSITVAPAQTLTDKEYQIMRNASMAVLREIGVETGG
FT                   SNVQFAVNPKNGRLIVIEMNPRVSRSSALASKATGFPIAKVAAKLAVGYTLDELMNDIT
FT                   GGRTPASFEPSIDYVVTKIPRFNFEKFAGANDRLTTQMKSVGEVMAIGRTQQESLQKAL
FT                   RGLEVGATGFDPKVSLDDPEALTKIRRELKDAGADRIWYIADAFRAGLSVDGVFNLTNI
FT                   DRWFLVQIEELVRLEEKVTEVGITGLNADFLRQLKRKGFADARLAKLAGVREAEIRKLR
FT                   DQYDLHPVYKRVDTCAAEFATDTAYMYSTYEDECEANPSVDRDKIMVLGGGPNRIGQGI
FT                   EFDYCCVHASLALREDGYETIMVNCNPETVSTDYDTSDRLYFEPVTLEDVLEIVRIEKP
FT                   KGVIVQYGGQTPLKLARALEAAGVPVIGTSPDAIDRAEDRERFQHAVDRLKLKQPANAT
FT                   VTAIEQAVEKAKEIGYPLVVRPSYVLGGRAMEIVYDEADLRRYFQTAVSVSNDAPVLLD
FT                   RFLDDAVEVDVDAICDGEMVLIGGIMEHIEQAGVHSGDSACSLPAYTLSQEIQDVMRQQ
FT                   VQKLAFELQVRGLMNVQFAVKDNEVYLIEVNPRAARTVPFVSKATGVPLAKVAARVMAG
FT                   KSLTEQGVTQEIIPPYYSVKEVVLPFNKFPGVDPLLGPEMRSTGEVMGVGRTFAEAFAK
FT                   AQLGSNSTMKKQGRALLSVREGDKERVVDLAAKLLKQGFELDATHGTAIVLGEAGINPR
FT                   LVNKVHEGRPHIQDRIKNGEYTYIINTTAGRRAIEDSRVIRRSALQYKVHYDTTLNGGF
FT                   ATTMALNADATEKVTSVQEMHAQIKKS"
FT   gene            75826..76221
FT                   /pseudo
FT                   /locus_tag="SeHA_C0072"
FT                   /note="transcriptional activatory protein CaiF; this gene
FT                   contains a frame shift which may be the result of
FT                   sequencing error"
FT   gene            complement(76299..76895)
FT                   /locus_tag="SeHA_C0073"
FT   CDS_pept        complement(76299..76895)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0073"
FT                   /product="carnitine operon protein CaiE"
FT                   /note="identified by match to protein family HMM PF00132"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0073"
FT                   /db_xref="EnsemblGenomes-Tr:ACF70308"
FT                   /db_xref="GOA:B4TIG8"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR023446"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4TIG8"
FT                   /protein_id="ACF70308.1"
FT                   /translation="MSYYAFEGLIPVVHPDAFVHPSAVLIGDVIVGAGVYIGPLASLRG
FT                   DYGRLILEAGSNLQDGCIMHGYCDTDTIVHENGHIGHGAILHGCVVGRDALVGMNSVIM
FT                   DGAVIGEESIVAAMSFVKAGFQGEARQLLVGSPARVLRQVTDQELHWKRLNTKEYQDLA
FT                   IRCRTGLSETKPLTQVEENRPRLKGTTDVKPKSAQ"
FT   gene            complement(76993..77778)
FT                   /locus_tag="SeHA_C0074"
FT   CDS_pept        complement(76993..77778)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0074"
FT                   /product="carnitinyl-CoA dehydratase"
FT                   /EC_number="4.2.1.-"
FT                   /note="identified by match to protein family HMM PF00378"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0074"
FT                   /db_xref="EnsemblGenomes-Tr:ACF69676"
FT                   /db_xref="GOA:B4TIG9"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR022852"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4TIG9"
FT                   /protein_id="ACF69676.1"
FT                   /translation="MSESLHLTRNGPILEITLDRPKANAIDAKTSFAMGEAFLNFRDDP
FT                   ELRVAIITGGGEKFFSAGWDLKAAAEGEAPDADFGPGGFAGLTEIFDLDKPVIAAVNGY
FT                   AFGGGFELALAADFIVCAENASFALPEAKLGIVPDSGGVLRLPKLLPPAIVNEMVMTGR
FT                   RMSAEEALRWGVVNRVVSQSELMESARELAQQLVNSAPLAIAALKEIYRATSEMPVEEG
FT                   YRYIRSGVLKHYPSVLHSEDALEGPQAFAEKRDPVWKGR"
FT   gene            complement(77832..79385)
FT                   /locus_tag="SeHA_C0075"
FT   CDS_pept        complement(77832..79385)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0075"
FT                   /product="probable crotonobetaine/carnitine-CoA ligase"
FT                   /EC_number="6.2.1.-"
FT                   /note="identified by match to protein family HMM PF00501"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0075"
FT                   /db_xref="EnsemblGenomes-Tr:ACF69449"
FT                   /db_xref="GOA:B4TIH0"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR023456"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4TIH0"
FT                   /protein_id="ACF69449.1"
FT                   /translation="MDIVGGQNLRQMWDDLAGVYGDKTALIFESCEGIVRQFSYASLNE
FT                   EINRTANLFYSLGIRKGDRVALHLDNCPEFIFCWFGLAKIGAIMVPINARLLGEESAWI
FT                   LQNSQVSLLVTSAQFYPMYREIRQDNSTPLNHICLIGEQLPADDGVSHFTQLQARQSAT
FT                   LCYTPVLSTDDTAEILFTSGTTSRPKGVVITHYNLRFAGYYSAWQIALRDDDVYMTVMP
FT                   AFHIDCQCTAAMPAFSAGSTFVLLEKYSARAFWDQVRKYQATVTECIPMMIRTLMVQPA
FT                   APTDRQHHLREVMFYLNLSEQEKDDFTERFGVRLLTSYGMTETIVGIIGDRPGDKRRWP
FT                   SIGRVGFSYEAEIRDDQNRPLPAGEIGEICIKGIPGKTIFKEYYMQPEATAKALEPEGW
FT                   LHTGDSGYQDEDGYFYFVDRRCNMIKRGGENVSCVELENIISAHPKIQDIVVVGIKDAI
FT                   RDEAIKAFIVLNEGETLSEAEFFSFCENNMAKFKVPSFMEIRTDLPRNCSGKIIKKNLK
FT                   "
FT   gene            complement(79448..80719)
FT                   /locus_tag="SeHA_C0076"
FT   CDS_pept        complement(79448..80719)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0076"
FT                   /product="crotonobetainyl-CoA:carnitine CoA-transferase"
FT                   /EC_number="2.8.3.-"
FT                   /note="identified by match to protein family HMM PF02515"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0076"
FT                   /db_xref="EnsemblGenomes-Tr:ACF69029"
FT                   /protein_id="ACF69029.1"
FT                   /translation="MALCLSGLHTAKNARRKMMNHLPMPTFGPLAGVRVVFSGIEIAGP
FT                   FAGQMFAEWGAEVIWIENVAWADTIRVQPNYPQLSRRNLHALSLNIFKDEGREAFLKLM
FT                   ETTDIFIEASKGPAFARRGITDEVLWEHNPKLVIAHLSGFGQYGTEEYTNLPAYNTIAQ
FT                   AFSGYLIQNGDVDQPMPAFPYTADYFSGMTATTAALAALHKVRETGKGESIDIAMYEVM
FT                   LRMGQYFMMDYFNGGEICPRMTKGKDPYYAGCGLYKCADGYIVMELVGITQINECFKDI
FT                   GLAHILGTPEVPEGTQLIHRVECPYGPLVEEKLDAWLATHTIADVQARFAELNIACAKV
FT                   LTIPELEGNPQYVARESITQWQTMDGRTCKGPNIMPKFKNNPGKIWRGMPSHGMDTAAI
FT                   LKNIGYSEADIKELVGKGLAKVED"
FT   gene            complement(80777..81919)
FT                   /gene="caiA"
FT                   /locus_tag="SeHA_C0077"
FT   CDS_pept        complement(80777..81919)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="caiA"
FT                   /locus_tag="SeHA_C0077"
FT                   /product="crotonobetainyl-CoA dehydrogenase"
FT                   /EC_number="1.3.99.-"
FT                   /note="identified by match to protein family HMM PF00441;
FT                   match to protein family HMM PF02770; match to protein
FT                   family HMM PF02771; match to protein family HMM PF08028"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0077"
FT                   /db_xref="EnsemblGenomes-Tr:ACF69378"
FT                   /db_xref="GOA:B4TIH2"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR023450"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4TIH2"
FT                   /protein_id="ACF69378.1"
FT                   /translation="MDFNLNDEQELFVAGIRELMASENWEAYFAECDRDSVYPERFVKA
FT                   LADMGIDSLLIPEEHGGLEAGFVTVAAVWMELGRLGAPTYVLYQLPGGFNTFLREGTQE
FT                   QIDKIMAFRGTGKQMWNSAITEPGAGSDVGSLKTTYTRKNGKVYLNGSKCFITSSAYTP
FT                   YIVVMARDGASPDKPVYTEWFVDMSKAGIKVNKLEKLGLRMDSCCEITFDDVELDEKDM
FT                   FGREGNGFNRVKEEFDHERFLVALTNYGTAMCAFEDAARYANQRVQFGEAIGRFQLIQE
FT                   KFAHMAIKLNSMKNMLLEAAWKADNGTITSGDAAMCKYFCANAAFEVVDTAMQVLGGVG
FT                   IAGNHRITRFWRDLRVDRVSGGSDEMQILTLGRAVLKQYR"
FT   gene            complement(81954..83471)
FT                   /gene="caiT"
FT                   /locus_tag="SeHA_C0078"
FT   CDS_pept        complement(81954..83471)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="caiT"
FT                   /locus_tag="SeHA_C0078"
FT                   /product="L-carnitine/gamma-butyrobetaine antiporter"
FT                   /note="identified by match to protein family HMM PF02028;
FT                   match to protein family HMM TIGR00842"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0078"
FT                   /db_xref="EnsemblGenomes-Tr:ACF70289"
FT                   /db_xref="GOA:B4TIH3"
FT                   /db_xref="InterPro:IPR000060"
FT                   /db_xref="InterPro:IPR018093"
FT                   /db_xref="InterPro:IPR023449"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4TIH3"
FT                   /protein_id="ACF70289.1"
FT                   /translation="MKNEKKKSGIEPKVFFPPLIIVGILCWLTVRDLDAANVVINAVFS
FT                   YVTNVWGWAFEWYMVVMLFGWFWLVFGPYAKKRLGDEKPEFSTASWIFMMFASCTSAAV
FT                   LFWGSIEIYYYISTPPFGLEPNSTGAKEIGLAYSLFHWGPLPWATYSFLSVAFAYFFFV
FT                   RKMDVIRPSSTLVPLVGEKHAKGLFGTIVDNFYLVALIFAMGTSLGLATPLVTECMQWL
FT                   FGIPHTLQLDAIIITCWIILNAICVACGLQKGVRIASDVRSYLSFLMLGWVFIVSGASF
FT                   IMNYFTDSVGMLLMHLPRMLFYTDAIGKGGFPQGWTVFYWAWWVIYAIQMSIFLARISR
FT                   GRTVRELCFGMVMGLTASTWILWTVLGSNTLLLMDKNILNIPQLIEQHGVARAIIETWA
FT                   ALPLSTATMWGFFILCFIATVTLINACSYTLAMSTCREVRDGEEPPLLVRIGWSVLVGI
FT                   IGIVLLALGGLKPIQTAIIAGGCPLFFVNIMVTLSFIKDAKVHWKDK"
FT   gene            83613..83729
FT                   /locus_tag="SeHA_C0079"
FT   CDS_pept        83613..83729
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0079"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0079"
FT                   /db_xref="EnsemblGenomes-Tr:ACF66161"
FT                   /protein_id="ACF66161.1"
FT                   /translation="MILLSSSHFFALIILCLNFDFCFIYQLIGCGFLTFLSI"
FT   gene            83699..83884
FT                   /locus_tag="SeHA_C0080"
FT   CDS_pept        83699..83884
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0080"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0080"
FT                   /db_xref="EnsemblGenomes-Tr:ACF66925"
FT                   /protein_id="ACF66925.1"
FT                   /translation="MWFFNFFKYLTFNIVEPANNIENFHIWHISFNIGEVRNTIESYEY
FT                   QCVTFSILVIKVLFPN"
FT   gene            83952..84722
FT                   /gene="fixA"
FT                   /locus_tag="SeHA_C0081"
FT   CDS_pept        83952..84722
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fixA"
FT                   /locus_tag="SeHA_C0081"
FT                   /product="protein FixA"
FT                   /note="identified by match to protein family HMM PF01012"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0081"
FT                   /db_xref="EnsemblGenomes-Tr:ACF67463"
FT                   /protein_id="ACF67463.1"
FT                   /translation="MKIITCYKCVPDEQDIAINNADGTLDFSKADSKISQYDLNAIEAA
FT                   CQLKQQLGDAQVVAMSVGGKALTNAKGRKDVLSRGPDELIVVIDDQFEQALPQHTATAL
FT                   AAAAQKSGFDLLICGDGSSDLYAQQVGLLVGEALNIPAINGVSKILSLTDSTLTVEREL
FT                   EDEVETLSIPLPAVIAVSTDINIPQIPSMKAILGAAKKPVQVWSPADIGLNSVSAYSAQ
FT                   QVAAPKQRERQRVVIEGDGEEQIAAFVENLRKII"
FT   gene            84738..85679
FT                   /gene="fixB"
FT                   /locus_tag="SeHA_C0082"
FT   CDS_pept        84738..85679
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fixB"
FT                   /locus_tag="SeHA_C0082"
FT                   /product="electron transfer flavoprotein, alpha subunit"
FT                   /note="identified by match to protein family HMM PF00766;
FT                   match to protein family HMM PF01012"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0082"
FT                   /db_xref="EnsemblGenomes-Tr:ACF68256"
FT                   /protein_id="ACF68256.1"
FT                   /translation="MNKFSSVWVFSDTPSRLPELMSGAQAVGEKVNAFVLNEADSATAC
FT                   HLGADHVWLLSGKPEDRMIEDYAAAMAETIRQHSEGGAVLLPNTRRGKLLAAKLGYRLS
FT                   AAVSNDASEVALQDGKAAVKHMVYGGLAIGAESIASPFAVITLSSGTFDAQDPDTSRSG
FT                   EMHTVQWQAPAITVTRTATQARQSNSVDLDKARLVVSVGRGIGSKENISLAEALCQTIG
FT                   AELACSRPVAENEKWMEHERYVGISNLMLKPELYLAVGISGQIQHMVGANGAQTIFAIN
FT                   KDKNAPIFQYADFGIVGDALKILPALTAALAR"
FT   gene            85729..87015
FT                   /gene="fixC"
FT                   /locus_tag="SeHA_C0083"
FT   CDS_pept        85729..87015
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fixC"
FT                   /locus_tag="SeHA_C0083"
FT                   /product="protein FixC"
FT                   /note="identified by match to protein family HMM PF01266;
FT                   match to protein family HMM PF01494; match to protein
FT                   family HMM PF03486"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0083"
FT                   /db_xref="EnsemblGenomes-Tr:ACF68751"
FT                   /protein_id="ACF68751.1"
FT                   /translation="MSEDIFDAIIVGAGLAGSVAALVLAREGAQVLVIERGNSAGAKNV
FT                   TGGRLYAHSLERIIPGFADQAPIERMITHEKLAFMTDNGAMTIDYCNGEDASASQVSYS
FT                   VLRSKFDAWLMEQAEEAGAQLITGIRVDNVVQRDGKVVGVEADGDILEAKVVILADGVN
FT                   SLLAEKLGMAKRVEASHVAVGVKELIELPKSVIEDRFQLQGNEGAACLFAGAPTDGLMG
FT                   GGFLYTNETTLSLGLVCGLHHLKDAKKSVPQMLEDFKQHPTVAPLIAGGKLVEYAAHVV
FT                   PEAGMNMQPELVGDGVLIAGDAAGMCMNLGFTIRGMDLAISAGEAAAKTVLSAMKRDDF
FT                   SKQSLGEYRQHLDEGPMRDMRMYQKLPAFLDNPRMFTAYPEMAVNIARDLFTVDGSAPV
FT                   PMRKKILRHAKKVGFINLMKDGLKGVTVL"
FT   gene            87012..87299
FT                   /locus_tag="SeHA_C0084"
FT   CDS_pept        87012..87299
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0084"
FT                   /product="4Fe-4S ferredoxin, iron-sulfur binding domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0084"
FT                   /db_xref="EnsemblGenomes-Tr:ACF68261"
FT                   /protein_id="ACF68261.1"
FT                   /translation="MTSPVNVDVKLGVNKFNVDEDSPHIILKTDPDKQALEVLIKACPA
FT                   GLYKKQDDGSVRFDYAGCLECGTCRILGLDTALEKWEYPRGTFGVEFRYG"
FT   gene            87380..88786
FT                   /locus_tag="SeHA_C0085"
FT   CDS_pept        87380..88786
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0085"
FT                   /product="putative metabolite transport protein YaaU"
FT                   /note="identified by match to protein family HMM PF00083;
FT                   match to protein family HMM PF07690"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0085"
FT                   /db_xref="EnsemblGenomes-Tr:ACF66622"
FT                   /protein_id="ACF66622.1"
FT                   /translation="MAAETPYPAYRCALPVLKQDITMQQPRNFDDLKFSSIHRRIMLWG
FT                   SGGPFLDGYVLVIIGVALEQLTPLLHLDAEWIGALGAATLAGLFIGTSLFGYICDKVGR
FT                   RKMFLLDIIAIGVISVATMFVSTPLELLVMRVLIGIVIGADYPIATSMITEFSNTRQRA
FT                   FSIGFIAAMWYVGATCANLVGYWLYDMEGGWRWMLGSAFIPCLIILIGRFDLPESPRWL
FT                   LRKGRVKECEQMMIKLFGEPVCFDDEPPQETRFLQLFNRRHFPFVLFVAAIWTCQVIPM
FT                   FAIYTFGPQIVGLLGWEQGRNAALGNVVISLFFMLGCIPAMFWLNSIGRRPLLIGSFAM
FT                   MTIALALLGLVSNLGIILVVVAFAVYAFFSGGPGILQWLYPNELFPTDIRASAVGVIMS
FT                   LSRIGTIISTWALPIFITRYGINNVMLIGALISLVGLGVSVMFAPETRGLTLTQTGNMT
FT                   LRGTPSDNPR"
FT   gene            88875..89105
FT                   /locus_tag="SeHA_C0086"
FT   CDS_pept        88875..89105
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0086"
FT                   /product="conserved domain protein"
FT                   /note="identified by match to protein family HMM PF06004"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0086"
FT                   /db_xref="EnsemblGenomes-Tr:ACF67167"
FT                   /protein_id="ACF67167.1"
FT                   /translation="MQKRLMTALFTAATLFTVAGCSSNQAVETTDGKTIVTDGKPEVDN
FT                   DTGMVSYKNAATGKTEQINRDQLKNMSELDN"
FT   gene            89385..89801
FT                   /locus_tag="SeHA_C0087"
FT   CDS_pept        89385..89801
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0087"
FT                   /product="probable secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0087"
FT                   /db_xref="EnsemblGenomes-Tr:ACF67724"
FT                   /protein_id="ACF67724.1"
FT                   /translation="MKLIPFYLLALFSAASGATEINACKDLIGTWKTTADNPPYTMTIL
FT                   PPVEGCGEKCVKLNVQYELDVTHRNALYCHEGQEGVKGQGPMVIAFEGAYGGHAIGTYN
FT                   RQLQLLWAGVIPKNKKGKWITKMENYWFRQVKAH"
FT   gene            complement(90025..90315)
FT                   /locus_tag="SeHA_C0088"
FT   CDS_pept        complement(90025..90315)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0088"
FT                   /product="probable secreted protein"
FT                   /note="identified by match to protein family HMM PF07338"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0088"
FT                   /db_xref="EnsemblGenomes-Tr:ACF68865"
FT                   /protein_id="ACF68865.1"
FT                   /translation="MKKRIIAAALLATVASFSTLAAEQVSKQEISHFKLVKVGTINVSQ
FT                   SGEQISSPSDLREKLSELADAKGGKYYHIIAAREHGPNFEAVAEVYNDATK"
FT   gene            91213..93102
FT                   /locus_tag="SeHA_C0089"
FT   CDS_pept        91213..93102
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0089"
FT                   /product="sulfatase"
FT                   /note="identified by match to protein family HMM PF00884;
FT                   match to protein family HMM TIGR01409"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0089"
FT                   /db_xref="EnsemblGenomes-Tr:ACF69541"
FT                   /protein_id="ACF69541.1"
FT                   /translation="MSNKKNLSAEETDLTRRKLLTSAGILAAGGMLSGAVKADEKCAVK
FT                   AKPAWDKPFTGEIPEKLPEGYNILLVVTDQERFFPTFPFPVPGRERLMKTGVTFCNHQN
FT                   TSNVCTPSRSVLYTGLHMPQTKMFDNLGLPWMPYDLDPALGTTGHMMRELGYYTAYKGK
FT                   WHLTEKLEKPLPDEKDEDIDVGDIPEPELHKIMEKYGFADYHGIGDIIGHSKGGYFYDS
FT                   TTTAQTINWLRCKGQPLNDQHKPWFLAVNLVNPHDVMFIDTDKEGEKVQWRGELDQDDN
FT                   TLAPTQPPENELYQASWPNYPLPANRHQSFNEQGRPPAHLEYQTARAALEGQFPDEDRR
FT                   WRKLLDYYFNCIRDCDTHLDRILNELDALKLTDKTIVVFTADHGELGGSHQMHGKGASV
FT                   YKEQIHVPMIISHPAYPGNKKCQALTCHLDIAPTLVGLTGLPEEKQHQALGNRKGVNFS
FT                   GLLKNPESVAVNAVRNASLYCYGMILYTDAHYLHRVIALQRDKQKTVAQIKQEISHLHP
FT                   DFSHRSGTRMINDGRYKFARYFSLREHNTPETWEDLIKYNDLELYDLKNDPDENHNLAA
FT                   DKQKYQDLILTMNEKLNKIIKDEIGVDDGSFMPDAAHEPWDLTIEQFNRMAKD"
FT   gene            93656..94186
FT                   /gene="kefF"
FT                   /locus_tag="SeHA_C0090"
FT   CDS_pept        93656..94186
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kefF"
FT                   /locus_tag="SeHA_C0090"
FT                   /product="glutathione-regulated potassium-efflux system
FT                   ancillary protein kefF"
FT                   /note="identified by match to protein family HMM PF02525"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0090"
FT                   /db_xref="EnsemblGenomes-Tr:ACF70177"
FT                   /db_xref="GOA:B4TII5"
FT                   /db_xref="InterPro:IPR003680"
FT                   /db_xref="InterPro:IPR023948"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4TII5"
FT                   /protein_id="ACF70177.1"
FT                   /translation="MILIIYAHPYPHHSHANKRMLEQAGTLENVEIRSLYHLYPDFNID
FT                   VAAEQEALSRASLIVWQHPMQWYSVPPLLKLWMDKVLTHGWAYGHGGTALHGKHLLWAV
FT                   TTGGGENHFAIGSHPGFDVLSQPLQATALYCGLKWLPPFAMHCTFICDDDTLQAQARQY
FT                   KQRLLAWQEVNHG"
FT   gene            94179..96041
FT                   /locus_tag="SeHA_C0091"
FT   CDS_pept        94179..96041
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0091"
FT                   /product="glutathione-regulated potassium-efflux system
FT                   protein KefC"
FT                   /note="identified by match to protein family HMM PF00999;
FT                   match to protein family HMM PF02254; match to protein
FT                   family HMM TIGR00932"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0091"
FT                   /db_xref="EnsemblGenomes-Tr:ACF66119"
FT                   /db_xref="GOA:B4TJ42"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR004771"
FT                   /db_xref="InterPro:IPR006036"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR023941"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4TJ42"
FT                   /protein_id="ACF66119.1"
FT                   /translation="MDSHTLLQALIYLGSAALIVPIAVRLGLGSVLGYLIAGCIIGPWG
FT                   LRLVTDAESILHFAEIGVVLMLFVIGLELDPQRLWKLRASVFGGGALQMVVCGGLIGLF
FT                   CMFLGLRWQVAELIGMTLALSSTAIAMQAMNERNLTVSQVGRSAFAVLLFQDIAAIPLV
FT                   AMIPLLAASGASTTLGAFALSALKVAGALALVVLLGRYVTRPALRFVARSGLREVFSAV
FT                   ALFLVFGFGLLLEEVGLSMAMGAFLAGVLLASSEYRHALESDIEPFKGLLLGLFFIGVG
FT                   MSIDFGTLVENPLRILLLLAGFLAIKIVMLWLVARPLGVPAKQRRWFAVLLGQGSEFAF
FT                   VVFGAAQMAGVLEPEWAKALTLAVALSMAATPIFLMLLTRMEKTEKGEAREADEIDEEQ
FT                   PRVIVAGFGRFGQIAGRLLLSSGVKMVVLDHDPDHIETLRKFGMKVFYGDATRMDLLES
FT                   AGAAKAEVLINAIDDPQTNLQLSELVKSHFPHLQIIARARDVDHYIRLRQAGVAMPERE
FT                   TFEGALKSGRQALEALGLGRYEARERADLFRHFNTRMVEEMAKGENDPLSRAAAYKRTS
FT                   AMLSEIITEDREHLSLIQRHGWQGTAEGKHSGEAADEPEVKPSI"
FT   gene            complement(96038..96163)
FT                   /locus_tag="SeHA_C0092"
FT   CDS_pept        complement(96038..96163)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0092"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0092"
FT                   /db_xref="EnsemblGenomes-Tr:ACF66720"
FT                   /protein_id="ACF66720.1"
FT                   /translation="MSTKIFRSAGDATHLMWSASITVVQKQPISSKVCRTSHFLL"
FT   gene            96239..96718
FT                   /gene="folA"
FT                   /locus_tag="SeHA_C0093"
FT   CDS_pept        96239..96718
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folA"
FT                   /locus_tag="SeHA_C0093"
FT                   /product="dihydrofolate reductase"
FT                   /EC_number="1.5.1.3"
FT                   /note="identified by match to protein family HMM PF00186"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0093"
FT                   /db_xref="EnsemblGenomes-Tr:ACF66823"
FT                   /protein_id="ACF66823.1"
FT                   /translation="MISLIAALAVDRVIGMENAMPWNLPADLAWFKRNTLNKPVVMGRH
FT                   TWESIGRPLPGRKNIVISSQPGTDDRVQWVKSVDEAIAACGDAPEIMVIGGGRVYEQFL
FT                   PKAQKLYLTHIDAEVEGDTHFPDYEPDDWESVFSEFHDADAQNSHSYCFEILERR"
FT   gene            complement(96824..97672)
FT                   /locus_tag="SeHA_C0094"
FT   CDS_pept        complement(96824..97672)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0094"
FT                   /product="bis(5'-nucleosyl)-tetraphosphatase (symmetrical)"
FT                   /EC_number="3.6.1.41"
FT                   /note="identified by match to protein family HMM PF00149;
FT                   match to protein family HMM TIGR00668"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0094"
FT                   /db_xref="EnsemblGenomes-Tr:ACF67517"
FT                   /db_xref="GOA:B4TJ45"
FT                   /db_xref="InterPro:IPR004617"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4TJ45"
FT                   /protein_id="ACF67517.1"
FT                   /translation="MATYLIGDVHGCYDELIALLQQVEFTPDTDTLWLTGDLVARGPGS
FT                   LDVLRYVKSLGNSVRLVLGNHDLHLLAVFAGISRNKPKDRLTPLLEAPDADELLNWLRR
FT                   QPLLQVDEEKKLVMAHAGITPQWDLQTAKECARDVEAVLSSDSYPFFLDAMYGDMPNNW
FT                   SPELSGLARLRFITNAFTRMRYCFPNGQLDMYSKASPENAPAPLKPWFAIPGPVSEAYS
FT                   IAFGHWASLEGKGTPEGIYALDTGCCWGGELTCLRWEDKQYFVQPSNRQMDMGEGEAVN
FT                   A"
FT   gene            complement(97683..98060)
FT                   /gene="apaG"
FT                   /locus_tag="SeHA_C0095"
FT   CDS_pept        complement(97683..98060)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="apaG"
FT                   /locus_tag="SeHA_C0095"
FT                   /product="protein ApaG"
FT                   /note="identified by match to protein family HMM PF04379"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0095"
FT                   /db_xref="EnsemblGenomes-Tr:ACF68143"
FT                   /db_xref="InterPro:IPR007474"
FT                   /db_xref="InterPro:IPR023065"
FT                   /db_xref="InterPro:IPR036767"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4TJ46"
FT                   /protein_id="ACF68143.1"
FT                   /translation="MINSPRVCIQVQSVYIEAQSSPDDERYVFAYTVTIRNLGRAPVQL
FT                   LGRYWLITNGHGRETEVQGEGVVGVQPRIAPGEEYQYTSGAVIETPLGTMQGHYEMIDE
FT                   NGDAFTIDIPVFRLAVPTLIH"
FT   gene            complement(98063..98884)
FT                   /gene="ksgA"
FT                   /locus_tag="SeHA_C0096"
FT   CDS_pept        complement(98063..98884)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ksgA"
FT                   /locus_tag="SeHA_C0096"
FT                   /product="dimethyladenosine transferase"
FT                   /EC_number="2.1.1.-"
FT                   /note="identified by match to protein family HMM PF00398;
FT                   match to protein family HMM TIGR00755"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0096"
FT                   /db_xref="EnsemblGenomes-Tr:ACF68749"
FT                   /db_xref="GOA:B4TJ47"
FT                   /db_xref="InterPro:IPR001737"
FT                   /db_xref="InterPro:IPR011530"
FT                   /db_xref="InterPro:IPR020596"
FT                   /db_xref="InterPro:IPR020598"
FT                   /db_xref="InterPro:IPR023165"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4TJ47"
FT                   /protein_id="ACF68749.1"
FT                   /translation="MNNRVHQGHLARKRFGQNFLNDRFVIDSIVSAINPQKGQAMVEIG
FT                   PGLAALTEPVGERLDKLTVIELDRDLAARLQTHPFLGPKLTIYQQDAMTMNFGELSAQL
FT                   GQPLRVFGNLPYNISTPLMFHLFSYTDAIADMHFMLQKEVVNRLVAGPNSKAYGRLSVM
FT                   AQYYCQVIPVLEVPPSAFTPPPKVDSAVVRLVPHATMPYPVKDIRVLSRITTEAFNQRR
FT                   KTIRNSLGNLFSVETLTEMGIDPAMRAENISVAQYCQMANYLSENAPLKES"
FT   gene            complement(98881..99870)
FT                   /gene="pdxA"
FT                   /locus_tag="SeHA_C0097"
FT   CDS_pept        complement(98881..99870)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pdxA"
FT                   /locus_tag="SeHA_C0097"
FT                   /product="4-hydroxythreonine-4-phosphate dehydrogenase"
FT                   /EC_number="1.1.1.262"
FT                   /note="identified by match to protein family HMM PF04166;
FT                   match to protein family HMM TIGR00557"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0097"
FT                   /db_xref="EnsemblGenomes-Tr:ACF69313"
FT                   /protein_id="ACF69313.1"
FT                   /translation="MSSAQRVVITPGEPAGIGPDLVVQLAQRAWPIELVVCADGALLTE
FT                   RAAMLGLPLSLLPYSPDVPAAPQPAGTLTLLPVSLRAPAISGQLTVENGPYVVETLARA
FT                   CDGCLNGEFAALITGPVHKGVINDAGISFTGHTEFFEERSQAKKVVMMLATEELRVALA
FT                   TTHLPLRAIADAITPALLHEVIAILHHDLRTKFGIAEPRILVCGLNPHAGEGGHMGTEE
FT                   IDTIIPVLDELRAQGMKLNGPLPADTLFQPKYLDNADAVLAMYHDQGLPVLKYQGFGRG
FT                   VNITLGLPFIRTSVDHGTALELAGRGKADVGSFITALNLAIKMIVNTQ"
FT   gene            complement(99870..101156)
FT                   /gene="surA"
FT                   /locus_tag="SeHA_C0098"
FT   CDS_pept        complement(99870..101156)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="surA"
FT                   /locus_tag="SeHA_C0098"
FT                   /product="chaperone/peptidyl-prolyl cis-trans isomerase
FT                   SurA"
FT                   /EC_number="5.2.1.8"
FT                   /note="identified by match to protein family HMM PF00639;
FT                   match to protein family HMM PF09312"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0098"
FT                   /db_xref="EnsemblGenomes-Tr:ACF70147"
FT                   /protein_id="ACF70147.1"
FT                   /translation="MKNWKTLLLGIAMIANTSFAAPQVVDKVAAVVNNGVVLESDVDGL
FT                   MQSVKLNAGQAGQQLPDDATLRHQILERLIMDQIILQMGQKMGVKITDEQLDQAIANIA
FT                   KQNNMTMDQMRSRLAYDGLNYSTYRNQIRKEMIISEVRNNEVRRRITVLPQEVDALAKQ
FT                   IGTQNDASTELNLSHILIALPENPTSEQVNDAQRQAESIVEEARNGADFGKLAITYSAD
FT                   QQALKGGQMGWGRIQELPGIFAQALSTAKKGDIVGPIRSGVGFHILKVNDLRGQSQSIS
FT                   VTEVHARHILLKPSPIMNDQQARLKLEEIAADIKSGKTTFAAAAKEYSQDPGSANQGGD
FT                   LGWATPDIFDPAFRDALTKLHKGQISAPVHSSFGWHLIELLDTRKVDKTDAAQKDRAYR
FT                   MLMNRKFSEEAATWMQEQRASAYVKILSN"
FT   gene            complement(101210..103570)
FT                   /gene="imp"
FT                   /locus_tag="SeHA_C0099"
FT   CDS_pept        complement(101210..103570)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="imp"
FT                   /locus_tag="SeHA_C0099"
FT                   /product="LPS-assembly protein"
FT                   /note="identified by match to protein family HMM PF03968;
FT                   match to protein family HMM PF04453"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0099"
FT                   /db_xref="EnsemblGenomes-Tr:ACF69433"
FT                   /protein_id="ACF69433.1"
FT                   /translation="MKKRIPTLLATMIASALYSHQGLAADLASQCMLGVPSYDRPLVKG
FT                   DTNDLPVTINADNAKGNYPDDAVFTGNVDIMQGNSRLQADEVQLHQKQAEGQPEPVRTV
FT                   DALGNVHYDDNQVILKGPKGWANLNTKDTNVWEGDYQMVGRQGRGKADLMKQRGENRYT
FT                   ILENGSFTSCLPGSDTWSVVGSEVIHDREEQVAEIWNARFKVGPVPIFYSPYLQLPVGD
FT                   KRRSGFLIPNAKYTTKNYFEFYLPYYWNIAPNMDATITPHYMHRRGNIMWENEFRYLTQ
FT                   AGEGVMELDYLPSDKVYEDDHPKEGDKHRWLFYWQHSGVMDQVWRFNVDYTKVSDSSYF
FT                   NDFDSKYGSSTDGYATQKFSVGYAVQNFDATVSTKQFQVFNDQNTSSYSAEPQLDVNYY
FT                   HNDLGPFDTRIYGQAVHFVNTKDNMPEATRVHLEPTINLPLSNRWGSLNTEAKLMATHY
FT                   QQTNLDSYNSDPNNKNKLEDSVNRVMPQFKVDGKLIFERDMAMLAPGYTQTLEPRVQYL
FT                   YVPYRDQSGIYNYDSSLLQSDYNGLFRDRTYGGLDRIASANQVTTGVTTRIYDDAAVER
FT                   FNVSVGQIYYFTESRTGDDNIKWENDDKTGSLVWAGDTYWRISERWGLRSGVQYDTRLD
FT                   SVATSSSSLEYRRDQDRLVQLNYRYASPEYIQATLPSYYSTAEQYKNGINQVGAVASWP
FT                   IADRWSIVGAYYFDTNSSKPADQMLGLQYNSCCYAIRVGYERKLNGWDNDKQHAIYDNA
FT                   IGFNIELRGLSSNYGLGTQEMLRSNILPYQSSM"
FT   gene            complement(103580..103741)
FT                   /locus_tag="SeHA_C0100"
FT   CDS_pept        complement(103580..103741)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0100"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0100"
FT                   /db_xref="EnsemblGenomes-Tr:ACF70153"
FT                   /protein_id="ACF70153.1"
FT                   /translation="MWDIAYNLHYHTCHSMPCLTPQTLNGRINTGAAKMSKLGCDRLSR
FT                   ATLPMMEQ"
FT   gene            103824..104636
FT                   /locus_tag="SeHA_C0101"
FT   CDS_pept        103824..104636
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0101"
FT                   /product="DnaJ domain protein"
FT                   /note="identified by match to protein family HMM PF00226"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0101"
FT                   /db_xref="EnsemblGenomes-Tr:ACF69499"
FT                   /protein_id="ACF69499.1"
FT                   /translation="MQYWGKIIGVAVALMMGGGFWGVVLGLLVGHMFDKARSRKMAWFA
FT                   NQRERQALFFATTFEVMGHLTKSKGRVTEADIHIASQLMDRMNLHGDSRTAAQNAFRVG
FT                   KADNYPLREKMRQFRSVCFGRFDLIRMFLEIQIQAAFADGSLHPNEREVLYVIAEELGI
FT                   SRVQFDQFLRMMQGGAQFGGGYHQQSGGGWQQAQRGPTLEDACNVLGVKTTDDATTIKR
FT                   AYRKLMSEHHPDKLVAKGLPPEMMEMAKQKAQEIQKAYELIKEQKGFK"
FT   gene            complement(104731..105390)
FT                   /locus_tag="SeHA_C0102"
FT   CDS_pept        complement(104731..105390)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0102"
FT                   /product="pseudouridine synthase, RluA family"
FT                   /note="identified by match to protein family HMM PF00849"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0102"
FT                   /db_xref="EnsemblGenomes-Tr:ACF66807"
FT                   /protein_id="ACF66807.1"
FT                   /translation="MGMENYNPPQEPWLVILYQDEHIMVVNKPSGLLSVPGRLEAHKDS
FT                   IMTRIQRDYPQAESVHRLDMATSGVIVVALTKAAERELKRQFREREPKKQYVARVWGHP
FT                   SPAEGLVDLPLICDWPNRPKQKVCYETGKPAQTEYNVVEFAADNTARVVLKPITGRSHQ
FT                   LRVHMLALGHPILGDRFYASPEALSLAPRLQLHAEMLTITHPAYGNSMTFKVPADF"
FT   gene            complement(105402..108236)
FT                   /gene="rapA"
FT                   /locus_tag="SeHA_C0103"
FT   CDS_pept        complement(105402..108236)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rapA"
FT                   /locus_tag="SeHA_C0103"
FT                   /product="RNA polymerase associated protein RapA"
FT                   /EC_number="3.6.1.-"
FT                   /note="identified by match to protein family HMM PF00176;
FT                   match to protein family HMM PF00271; match to protein
FT                   family HMM PF04851"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0103"
FT                   /db_xref="EnsemblGenomes-Tr:ACF66171"
FT                   /protein_id="ACF66171.1"
FT                   /translation="MDARTVTLLFPSTGENRLYARSDSPVTRVMFNPGDTITSHEGWQL
FT                   HIDEVKEENGLLVYVGTRLDTEETNVTLREVLLDSKLVFSKPQDRLFAGQIDRMDRFAL
FT                   RYRARKFQSEQYRMPYSGLRGQRTNLIPHQLNIAHDVGRRHAPRVLLADEVGLGKTIEA
FT                   GMILHQQLLSGAAERVLIIVPETLQHQWLVEMLRRFNLRFALFDDERYTEAQHDAYNPF
FT                   ETEQLVICSLDFARRNKQRLEHLCDAEWDLLVVDEAHHLVWSTDAPSREYMAIEQLAER
FT                   VPGVLLLTATPEQLGMESHFARLRLLDPNRFHDFEQFVEEQKNYRPVADAVAMLLAGNK
FT                   LSNDELNRLGDLIGEQDIEPLLQAANSDRDDAQAARDELVSMLMDRHGTSRVLFRNTRN
FT                   GVKGFPKRELHTVKLPLPTQYQTAIKVSGIMGARKSAEDRARDMLYPEQIYQEFEGDTG
FT                   TWWNFDPRVEWLMGYLTSHRSQKVLVICAKATTALQLEQVLREREGIRAAVFHEGMSII
FT                   ERDRAAAWFAEEDTGAQVLLCSEIGSEGRNFQFASNLVMFDLPFNPDLLEQRIGRLDRI
FT                   GQAHDIQIHVPYLEKTAQSVLVRWYHEGLDAFEHTCPTGRAIYDSAYASLINYLAAPEE
FT                   TDGFDDLIKSCREQHEALKAQLEQGRDRLLEIHSNGGEKAQQLAQSIEEQDDDTNLIAF
FT                   AMNLFDIVGINQDDRGDNLIVLTPSDHMLVPDFPGLPEDGCTITFERDVALSREDAQFI
FT                   TWEHPLIRNGLDLILSGDTGSSTISLLKNKALPVGTLLVELVYVVEAQAPKQLQLNRFL
FT                   PPTPVRMLLDKNGNNLAAQVEFETFNRQLSAVNRHTGSKLVNAVQQDVHAILQLGETQI
FT                   EKSARALIDNARREADEKLSGELSRLEALRAVNPNIRDDELAAIDSNRQQVLESLNQAG
FT                   WRLDALRLIVVTHQ"
FT   gene            complement(108482..110833)
FT                   /locus_tag="SeHA_C0104"
FT   CDS_pept        complement(108482..110833)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0104"
FT                   /product="DNA polymerase II"
FT                   /EC_number="2.7.7.7"
FT                   /note="identified by match to protein family HMM PF00136;
FT                   match to protein family HMM PF03104"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0104"
FT                   /db_xref="EnsemblGenomes-Tr:ACF68161"
FT                   /protein_id="ACF68161.1"
FT                   /translation="MAQAGFILTRHWRDTPQGTEVSFWLATDNGPVQATLAPQESVAFI
FT                   PTSQTSRAASLLQAEKDYRLTPLQLRDFHRQPVSGLYCRTHRQLMRMEKLLRENGVTVY
FT                   EADVRPPERYLMERFITSPVWVDGEMRNGVIRNARLKPHSDYRPPLKWVSLDIETTRHG
FT                   ELYCIGLEGCGQRTVYMLGPANGDDHQLDFELVYVASRPQLLEKLNAWFAEHDPDVIIG
FT                   WNVVQFDLRMLQKHAERYRIPLRLGRDNSELEWREHGFKNGVFFAQARGRVIIDGIDAL
FT                   KSAFWNFSSFSLEAVSQELLGEGKSIDNPWDRMDEIDRRFAQDKPALATYNLKDCELVT
FT                   RIFHKTEIMPFLLERATINGLPVDRHGGSVAAFGHLYFPRMHRAGYVAPNLGEVPPLAS
FT                   PGGYVMDSQPGLYDSVLVLDYKSLYPSIIRTFLIDPVGLVEGMAQPDPEHSTEGFLDAW
FT                   FSREKHCLPEIVSQIWHGRDEAKRQGNKPLSQALKIIMNAFYGVLGTTACRFFDPRLAS
FT                   SITMRGHAIMRQTKALIEAQGYDVIYGDTDSTFVWLRRAHSEADAAEIGHRLVRHVNEW
FT                   WAQTLQQQNLTSALELEFETHFCRFLMPTIRGADTGSKKRYAGLIQEGDSQRMVFKGLE
FT                   TVRTDWTPLAQRFQQELYLRVFRNEPYQDYVRETIDKLMAGELDAQLVYRKRLRRPLHE
FT                   YQRNVPPHVRAARLADEQNLKQGRPAQYQNRGAIKYVWTVNGPEPVDYQQSPLDYEHYL
FT                   TRQLQPVAEGILPFVEDNFATLLTGQLGLF"
FT   gene            complement(110877..111626)
FT                   /locus_tag="SeHA_C0105"
FT   CDS_pept        complement(110877..111626)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0105"
FT                   /product="putative secreted protein"
FT                   /note="identified by match to protein family HMM PF02698"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0105"
FT                   /db_xref="EnsemblGenomes-Tr:ACF67367"
FT                   /protein_id="ACF67367.1"
FT                   /translation="MIISAVYTGIIILINIRQQKYLTLKALLSLKYPLHPSRGTNSFMK
FT                   YRYIIRIAAGIILIMATVFIHNAIAIYQFSQQNQTRVADCAIVAGAGVSGKTPSPVFQA
FT                   RLDHAIWLYQQHIVRALVLTGGYGAGATVSDAAIARQYVLEKGIPAKAIFIEERSTVTR
FT                   ENIRYAKQILRQQQWRTALLVSDPLHMLRLKTIAQDNGIDSRSSPTRSTRYKSWWAQTR
FT                   FLLRETFYYSGYRLLRYMPVQNNSITP"
FT   gene            112015..112434
FT                   /locus_tag="SeHA_C0106"
FT   CDS_pept        112015..112434
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0106"
FT                   /product="putative cytoplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0106"
FT                   /db_xref="EnsemblGenomes-Tr:ACF69285"
FT                   /protein_id="ACF69285.1"
FT                   /translation="MNVSMQARLVGNDRYLFVNTQRANPSIKTVSRFFEYKTWTEQIWR
FT                   TEIIENGNAFFHWQGHDRKNGHRDTIINYLLNGQRWQSTIEDYIFFHALEGKAWQGHYD
FT                   NIIEYVSSDHYVYQSAFAEYITDQIHQRAPHGTRF"
FT   gene            complement(112440..113135)
FT                   /gene="araD"
FT                   /locus_tag="SeHA_C0107"
FT   CDS_pept        complement(112440..113135)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="araD"
FT                   /locus_tag="SeHA_C0107"
FT                   /product="L-ribulose-5-phosphate 4-epimerase"
FT                   /EC_number="5.1.3.4"
FT                   /note="identified by match to protein family HMM PF00596;
FT                   match to protein family HMM TIGR00760"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0107"
FT                   /db_xref="EnsemblGenomes-Tr:ACF68473"
FT                   /protein_id="ACF68473.1"
FT                   /translation="MLEDLKRQVLEANLALPKHNLVTLTWGNVSAVDRERGVLVIKPSG
FT                   VDYSVMTADDMVVVSLESGEVVEGHKKPSSDTPTHRLLYQAFPTIGGIVHTHSRHATIW
FT                   AQAGQPIPATGTTHADYFYGTIPCTRKMTEAEINGEYEWETGNVIVETFEKQGIDAAQM
FT                   PGVLVHSHGPFAWGKNAEDAVHNAIVLEEVAYMGIFCRQLAPQLPDMQQSLLDKHYLRK
FT                   HGAKAYYGQ"
FT   gene            complement(113276..114778)
FT                   /gene="araA"
FT                   /locus_tag="SeHA_C0108"
FT   CDS_pept        complement(113276..114778)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="araA"
FT                   /locus_tag="SeHA_C0108"
FT                   /product="L-arabinose isomerase"
FT                   /EC_number="5.3.1.4"
FT                   /note="identified by match to protein family HMM PF02610"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0108"
FT                   /db_xref="EnsemblGenomes-Tr:ACF68797"
FT                   /db_xref="GOA:B4TJ59"
FT                   /db_xref="InterPro:IPR003762"
FT                   /db_xref="InterPro:IPR004216"
FT                   /db_xref="InterPro:IPR009015"
FT                   /db_xref="InterPro:IPR024664"
FT                   /db_xref="InterPro:IPR038583"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4TJ59"
FT                   /protein_id="ACF68797.1"
FT                   /translation="MTIFDNYEVWFVIGSQHLYGAETLRQVTQHAEHVVNALNTEAKLP
FT                   CKLVLKPLGTSPDEITAICRDANYDDRCAGLVVWLHTFSPAKMWINGLSILNKPLLQFH
FT                   TQFNAALPWDSIDMDFMNLNQTAHGGREFGFIGARMRQQHAVVTGHWQDKEAHTRIGAW
FT                   MRQAVSKQDTRQLKVCRFGDNMREVAVTDGDKVAAQIKFGFSVNTWAVGDLVQVVNSIG
FT                   DGDINALIDEYESSYTLTPATQIHGDKRQNVREAARIELGMKRFLEQGGFHAFTTTFED
FT                   LHGLKQLPGLAVQRLMQQGYGFAGEGDWKTAALLRIMKVMSTGLQGGTSFMEDYTYHFE
FT                   KGNDLVLGSHMLEVCPSIAVEEKPILDVQHLGIGGKEDPARLIFNTQTGPAIVASLIDL
FT                   GDRYRLLVNCIDTVKTPHSLPKLPVANALWKAQPDLPTASEAWILAGGAHHTVFSHALD
FT                   LNDMRQFAEIHDIEIAVIDNDTHLPAFKDALRWNEVYYGFKR"
FT   gene            complement(114789..116498)
FT                   /gene="araB"
FT                   /locus_tag="SeHA_C0109"
FT   CDS_pept        complement(114789..116498)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="araB"
FT                   /locus_tag="SeHA_C0109"
FT                   /product="L-ribulokinase"
FT                   /EC_number="2.7.1.16"
FT                   /note="identified by match to protein family HMM PF00370;
FT                   match to protein family HMM PF02782; match to protein
FT                   family HMM TIGR01234"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0109"
FT                   /db_xref="EnsemblGenomes-Tr:ACF68318"
FT                   /db_xref="GOA:B4TJ60"
FT                   /db_xref="InterPro:IPR005929"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4TJ60"
FT                   /protein_id="ACF68318.1"
FT                   /translation="MAIAIGLDFGSDSVRALAVDCATGDEIATSIEWYPRWQEGRYCDG
FT                   PNNQFRHHPRDYMESMEAALKAVLAQLSAAQRANVVGIGVDSTGSTPAPIDADGNVLAL
FT                   RPEFAENPNAMFVLWKDHTAVEEADEITRLCHKPGKVDYSRYIGGIYSSEWFWAKILHV
FT                   TRQDSAVAQAAVSWIELCDWVPALLSGTTRPQDIRRGRCSAGHKTLWHESWGGLPPASF
FT                   FDELDPCINRHLRYPLFSETFTADLPVGTLCAEWAQRLDLPESVVISGGAFDCHMGAVG
FT                   AGAQPNTLVKVIGTSTCDILIADKQSVGDRAVKGICGQVDGSVVPNFIGLEAGQSAFGD
FT                   IYAWFSRVLSWPLEQLAAQHPELKPQINASQKQLLPALTDAWAKNPSLDHLPVVLDWFN
FT                   GRRTPNANQRLKGVITDLNLATDAPALFGGLVASTAFGARAIQECFTDQGIAVNNVMAL
FT                   GGIARKNQVIMQVCCDVLNRPLQIVASDQCCALGAAIFAAVAAKVHADIPAAQQSMASA
FT                   VERTLRPHPEQAQRFEQLYRRYQQWALSAEQHYLPTAAPAPTTPANQAILTH"
FT   gene            116839..117684
FT                   /locus_tag="SeHA_C0110"
FT   CDS_pept        116839..117684
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0110"
FT                   /product="arabinose operon regulatory protein"
FT                   /note="identified by match to protein family HMM PF00165;
FT                   match to protein family HMM PF02311"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0110"
FT                   /db_xref="EnsemblGenomes-Tr:ACF70114"
FT                   /protein_id="ACF70114.1"
FT                   /translation="MAETQNDPLLPGYSFNAHLVAGLTPIEANGYLDFFIDRPLGMKGY
FT                   ILNLTIRGEGVINNNGEQFVCRPGDILLFPPGEIHHYGRHPDASEWYHQWVYFRPRAYW
FT                   QEWLTWPTIFAQTGFFRPDEARQPHFSELFGQIISAGQGEGRYSELLAINLLEQLLLRR
FT                   MAVINESLHPPMDSRVRDACQYISDHLADSHFDIASVAQHVCLSPSRLSHLFRQQLGIS
FT                   VLSWREDQRISQAKLLLSTTRMPIATVGRNVGFDDQLYFSRVFKKCTGASPSEFRAGCE
FT                   "
FT   gene            117803..118570
FT                   /locus_tag="SeHA_C0111"
FT   CDS_pept        117803..118570
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0111"
FT                   /product="inner membrane protein YabI"
FT                   /note="identified by match to protein family HMM PF09335"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0111"
FT                   /db_xref="EnsemblGenomes-Tr:ACF69575"
FT                   /protein_id="ACF69575.1"
FT                   /translation="MQALLEHFITQSTLYSLIAVLLVAFLESLALVGLILPGTVLMAGL
FT                   GALIGSGELNFWHAWLVGIIGCLMGDWISFWLGWRFKKPLHRWSFMKKNKSLLDKTEHA
FT                   LHQHSMFTILVGRFVGPTRPLVPMVAGMLDLPVAKFIGPNLIGCLLWPPFYFLPGILAG
FT                   AAIDIPSDMQSGDFKWLLLATALLLWVGGWLCWRLWRSGKAAVDRLTAYFPRSRLLYLA
FT                   PLTLGIGVVALVVLVRHPLMPVYIDILRKVVGY"
FT   gene            complement(118609..119316)
FT                   /gene="thiQ"
FT                   /locus_tag="SeHA_C0112"
FT   CDS_pept        complement(118609..119316)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiQ"
FT                   /locus_tag="SeHA_C0112"
FT                   /product="thiamine ABC transporter, ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005;
FT                   match to protein family HMM TIGR01277"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0112"
FT                   /db_xref="EnsemblGenomes-Tr:ACF66203"
FT                   /protein_id="ACF66203.1"
FT                   /translation="MLKLIDITWLYHHLPMRFTLAVERGEQVAILGPSGAGKSTLLNLI
FT                   AGFLAPASGTLLIAGDDHTLTPPSRRPVSMLFQENNLFSHLNVQQNIGLGLNPGLTLNA
FT                   SQREKRDAIAHQMGIESLMTRLPGELSGGQRQRVALARCLVREQPVLLLDEPFSALDPA
FT                   LRQEMLTLVSDICRERQLTLLMVSHSVEDAARIAPRSIVVADGRIAWQGKTDELLSGQA
FT                   SASALLGIKSHIL"
FT   gene            complement(119300..120910)
FT                   /gene="thiP"
FT                   /locus_tag="SeHA_C0113"
FT   CDS_pept        complement(119300..120910)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiP"
FT                   /locus_tag="SeHA_C0113"
FT                   /product="thiamine/thiamine pyrophosphate ABC transporter,
FT                   permease protein"
FT                   /note="identified by match to protein family HMM PF00528;
FT                   match to protein family HMM TIGR01253"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0113"
FT                   /db_xref="EnsemblGenomes-Tr:ACF67761"
FT                   /protein_id="ACF67761.1"
FT                   /translation="MATRRQPLIPGWLIPGLCAAALMITVSLAAFLALWLNAPSGAWST
FT                   IWRDSYLWHVVRFSFWQAFLSAVLSVVPAVFLARALYRRRFPGRLALLRLCAMTLILPV
FT                   LVAVFGILSVYGRQGWLASLWQMLGLQWTFSPYGLQGILLAHVFFNLPMASRLLLQSLE
FT                   SIPGEQRQLAAQLGMRGWHFFRFVEWPWLRRQIPPVAALIFMLCFASFATVLSLGGGPQ
FT                   ATTIELAIFQALSYDYDPARAAMLALIQMVCCLALVLLSQRLSKAIAPGMTLTQGWRDP
FT                   DDRLHSRLTDALLIVLALLLLLPPLVAVVVDGVNRSLPEVLAQPILWQAVWTSLRIALA
FT                   AGVLCVVLTMMLLWSSRELRQRQQLFAGQTLELSGMLILAMPGIVLATGFFLLLNNSVG
FT                   LPESADGIVIFTNALMAIPYALKVLENPMRDITARYGMLCQSLGIEGWSRLKIVELRAL
FT                   KRPLAQALAFACVLSIGDFGVVALFGNDNFRTLPFYLYQQIGSYRSQDGAVTALILLLL
FT                   CFTLFTLIEKLPGRHAKTD"
FT   gene            complement(120886..121869)
FT                   /gene="thiB"
FT                   /locus_tag="SeHA_C0114"
FT   CDS_pept        complement(120886..121869)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiB"
FT                   /locus_tag="SeHA_C0114"
FT                   /product="thiamin/thiamin pyrophosphate ABC transporter,
FT                   periplasmic thiamin/thiamin pyrophospate-binding protein"
FT                   /note="identified by match to protein family HMM PF01547;
FT                   match to protein family HMM TIGR01254; match to protein
FT                   family HMM TIGR01276"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0114"
FT                   /db_xref="EnsemblGenomes-Tr:ACF67537"
FT                   /protein_id="ACF67537.1"
FT                   /translation="MLKKYLPLLLLCAAPAFAKPVLTVYTYDSFAADWGPGPAVKKAFE
FT                   ADCNCELKLVALEDGVSLLNRLRMEGKNSKADVVLGLDNNLLEAATQTKLFAKSGVANE
FT                   AVKVPGGWKNDTFVPFDYGYFAFVYDKSKLKNPPKSLKELVESDQKWRVIYQDPRTSTP
FT                   GLGLLLWMRKVYGDNAPQAWQKLAAKTVTVTKGWSEAYGLFLKGESDLVLSYTTSPAYH
FT                   IIEEKKDNYAAANFSEGHYLQVEVAARTVASKQPELAEKFLKFMVSPAFQNAIPTGNWM
FT                   YPVADVALPAGFESLAKPATTLEFTPQQVAAQRQAWISEWQRAVSR"
FT   misc_binding    complement(121901..122000)
FT                   /bound_moiety="thiamin/thiamin pyrophosphate"
FT                   /note="TPP riboswitch (THI element)"
FT   gene            complement(121914..122033)
FT                   /locus_tag="SeHA_C0116"
FT   CDS_pept        complement(121914..122033)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0116"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0116"
FT                   /db_xref="EnsemblGenomes-Tr:ACF67094"
FT                   /protein_id="ACF67094.1"
FT                   /translation="MLPGNKITTLTPNSTGCRAHARAEKIPVEPDPDNAGEGI"
FT   gene            complement(122047..123705)
FT                   /locus_tag="SeHA_C0117"
FT   CDS_pept        complement(122047..123705)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0117"
FT                   /product="HTH-type transcriptional regulator SgrR"
FT                   /note="identified by match to protein family HMM PF00496"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0117"
FT                   /db_xref="EnsemblGenomes-Tr:ACF69389"
FT                   /protein_id="ACF69389.1"
FT                   /translation="MPSGRLQQQFIRLWQCCDGKTQDTTLNELADLLNCSRRHMRTLLN
FT                   TMQARGWLTWEAEVGRGKRSRLTFLYTGLALQQQRAEDLLEQDRIDQLVQLVGDKSAVR
FT                   QMLISHLGRSFRQGRHILRVLYYRPMHNLLPGTALRRSETHIARQIFSSLTRVNEENGE
FT                   LEADIAHHWQQISPLLWRFYLRPGIHFHHGRELEMEDVISSLTRINTLPLYSHITKIDS
FT                   PTAWTLDIHLSQPDRWLPWLLGQVPAMILPREWETLANFASHPIGTGPYAVRRNTPNQL
FT                   KILAFDDYFGYRALIDEVNVWVLPDISEEPACGLMLEGPIQGGEKAIESRLEEGCYYLL
FT                   FDARTPRGAHPQVREWVSHVLSPTNLLYHADEPLQQLWFPAYGLLPRWHHARPGPGEKP
FT                   AGLETLTLTFYREHIEHRVIARIMSALLAEHQVHLHIQEIDYDQWHAGEIESDIWLNSA
FT                   NFTLPLDFSLFAHLCEVPLLQNCIPRDWQGDAAQWRAGEMNLANWCQQLLANKAIVPLI
FT                   HHWLIIQGQRSMRGLRMNTLGWFDFKSAWFAPPDP"
FT   gene            123773..124010
FT                   /locus_tag="SeHA_C0118"
FT   ncRNA           123773..124010
FT                   /locus_tag="SeHA_C0118"
FT                   /product="SgrS RNA"
FT                   /ncRNA_class="other"
FT   gene            124122..124235
FT                   /locus_tag="SeHA_C0120"
FT   CDS_pept        124122..124235
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0120"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0120"
FT                   /db_xref="EnsemblGenomes-Tr:ACF70290"
FT                   /protein_id="ACF70290.1"
FT                   /translation="MPEYPRHERLMSNPELDGATLIRPTEYNGNRVILHNL"
FT   gene            complement(124256..124861)
FT                   /gene="leuD"
FT                   /locus_tag="SeHA_C0121"
FT   CDS_pept        complement(124256..124861)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="leuD"
FT                   /locus_tag="SeHA_C0121"
FT                   /product="3-isopropylmalate dehydratase, small subunit"
FT                   /EC_number="4.2.1.33"
FT                   /note="identified by match to protein family HMM PF00694;
FT                   match to protein family HMM TIGR00171"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0121"
FT                   /db_xref="EnsemblGenomes-Tr:ACF69034"
FT                   /protein_id="ACF69034.1"
FT                   /translation="MAEKFTQHTGLVVPLDAANVDTDAIIPKQFLQKVTRTGFGAHLFN
FT                   DWRFLDEKGQQPNPEFVLNFPEYQGASILLARENFGCGSSREHAPWALTDYGFKVVIAP
FT                   SFADIFYGNSFNNQLLPVTLSDAQVDELFALVKANPGIKFEVDLEAQVVKAGDKTYSFK
FT                   IDDFRRHCMLNGLDSIGLTLQHEDAIAAYENKQPAFMR"
FT   gene            complement(124872..126272)
FT                   /gene="leuC"
FT                   /locus_tag="SeHA_C0122"
FT   CDS_pept        complement(124872..126272)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="leuC"
FT                   /locus_tag="SeHA_C0122"
FT                   /product="3-isopropylmalate dehydratase, large subunit"
FT                   /EC_number="4.2.1.33"
FT                   /note="identified by match to protein family HMM PF00330;
FT                   match to protein family HMM TIGR00170"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0122"
FT                   /db_xref="EnsemblGenomes-Tr:ACF67336"
FT                   /protein_id="ACF67336.1"
FT                   /translation="MAKTLYEKLFDAHVVFEAPNETPLLYIDRHLVHEVTSPQAFDGLR
FT                   AHHRPVRQPGKTFATMDHNVSTQTKDINASGEMARIQMQELIKNCNEFGVELYDLNHPY
FT                   QGIVHVMGPEQGVTLPGMTIVCGDSHTATHGAFGALAFGIGTSEVEHVLATQTLKQGRA
FT                   KTMKIEVTGNAAPGITAKDIVLAIIGKTGSAGGTGHVVEFCGDAIRALSMEGRMTLCNM
FT                   AIEMGAKAGLVAPDETTFNYVKGRLHAPKGRDFDEAVEYWKTLKTDDGATFDTVVALRA
FT                   EEIAPQVTWGTNPGQVISVTDIIPDPASFSDPVERASAEKALAYMGLQPGVPLTDVAID
FT                   KVFIGSCTNSRIEDLRAAAEVAKGRKVAPGVQALVVPGSGPVKAQAEAEGLDKIFIEAG
FT                   FEWRLPGCSMCLAMNNDRLNPGERCASTSNRNFEGRQGRGGRTHLVSPAMAAAAAVTGH
FT                   FADIRSIK"
FT   gene            complement(126275..127366)
FT                   /gene="leuB"
FT                   /locus_tag="SeHA_C0123"
FT   CDS_pept        complement(126275..127366)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="leuB"
FT                   /locus_tag="SeHA_C0123"
FT                   /product="3-isopropylmalate dehydrogenase"
FT                   /EC_number="1.1.1.85"
FT                   /note="identified by match to protein family HMM PF00180;
FT                   match to protein family HMM TIGR00169"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0123"
FT                   /db_xref="EnsemblGenomes-Tr:ACF67971"
FT                   /protein_id="ACF67971.1"
FT                   /translation="MSKNYHIAVLPGDGIGPEVMAQALKVMDAVRSRFDMRITTSHYDV
FT                   GGIAIDNHGHPLPKATVEGCEQADAILFGSVGGPKWENLPPESQPERGALLPLRKHFKL
FT                   FSNLRPAKLYQGLEAFCPLRADIAANGFDILCVRELTGGIYFGQPKGREGSGQYEKAFD
FT                   TEVYHRFEIERIARIAFESARKRRRKVTSIDKANVLQSSILWREIVNDVAKTYPDVELA
FT                   HMYIDNATMQLIKDPSQFDVLLCSNLFGDILSDECAMITGSMGMLPSASLNEQGFGLYE
FT                   PAGGSAPDIAGKNIANPIAQILSLALLLRYSLDANDAATAIEQAINRALEEGVRTGDLA
FT                   RGAAAVSTDEMGDIIARYVAEGV"
FT   gene            complement(127366..128937)
FT                   /gene="leuA"
FT                   /locus_tag="SeHA_C0124"
FT   CDS_pept        complement(127366..128937)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="leuA"
FT                   /locus_tag="SeHA_C0124"
FT                   /product="2-isopropylmalate synthase"
FT                   /EC_number="2.3.3.13"
FT                   /note="identified by match to protein family HMM PF00682;
FT                   match to protein family HMM PF08502; match to protein
FT                   family HMM TIGR00973"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0124"
FT                   /db_xref="EnsemblGenomes-Tr:ACF66296"
FT                   /db_xref="GOA:B4TJ72"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR002034"
FT                   /db_xref="InterPro:IPR005671"
FT                   /db_xref="InterPro:IPR013709"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR036230"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4TJ72"
FT                   /protein_id="ACF66296.1"
FT                   /translation="MSQQVIIFDTTLRDGEQALQASLSAKEKLQIALALERMGVDVMEV
FT                   GFPVSSPGDFESVQTIARTIKNSRVCALARCVEKDIDVAAQALKVADAFRIHTFIATSP
FT                   MHIATKLRSTLDEVIERAVYMVKRARNYTDDVEFSCEDAGRTPVDDLARVVEAAINAGA
FT                   RTINIPDTVGYTMPFEFAGIISGLYERVPNIDKAIISVHTHDDLGIAVGNSLAAVHAGA
FT                   RQVEGAMNGIGERAGNCALEEVIMAIKVRKDIMNVHTNINHHEIWRTSQTVSQICNMPI
FT                   PANKAIVGSGAFAHSSGIHQDGVLKNRENYEIMTPESIGLNQIQLNLTSRSGRAAVKHR
FT                   MEEMGYKDTDYNMDHLYDAFLKLADKKGQVFDYDLEALAFINKQQEEPEHFRLDYFSVQ
FT                   SGSSDIATASVKLACGEEIKAEAANGNGPVDAIYQAINRITGYDVELVKYDLNAKGQGK
FT                   DALGQVDIVVNHHGRRFHGVGLATDIVESSAKAMVHVLNNIWRAAEVEKELQRKAQNKE
FT                   NNKETV"
FT   misc_feature    complement(128978..129125)
FT                   /note="Leucine operon leader"
FT   gene            129768..130712
FT                   /locus_tag="SeHA_C0126"
FT   CDS_pept        129768..130712
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0126"
FT                   /product="probable HTH-type transcriptional regulator LeuO"
FT                   /note="identified by match to protein family HMM PF00126;
FT                   match to protein family HMM PF03466"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0126"
FT                   /db_xref="EnsemblGenomes-Tr:ACF66499"
FT                   /protein_id="ACF66499.1"
FT                   /translation="MPEVKTEKPHLLDMGKPQLRMVDLNLLTVFDAVMQEQNITRAAHT
FT                   LGMSQPAVSNAVARLKVMFNDELFVRYGRGIQPTARAFQLFGSVRQALQLVQNELPGSG
FT                   FEPTSSERVFNLCVCSPLDNILTSQIYNRVEKIAPNIHVVFKASLNQNTEHQLRYQETE
FT                   FVISYEEFRRPEFTSVPLFKDEMVLVASRKHPRISGPLLEGDVYNEQHAVVSLDRYASF
FT                   SQPWYDTPDKQSSVAYQGMALISVLNVVSQTHLVAIAPRWLAEEFAESLDLQILPLPLK
FT                   LNSRTCYLSWHEAAGRDKGHQWMEDLLVSVCKR"
FT   gene            131004..132758
FT                   /gene="ilvB"
FT                   /locus_tag="SeHA_C0127"
FT   CDS_pept        131004..132758
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ilvB"
FT                   /locus_tag="SeHA_C0127"
FT                   /product="acetolactate synthase, large subunit,
FT                   biosynthetic type"
FT                   /EC_number="2.2.1.6"
FT                   /note="identified by match to protein family HMM PF00205;
FT                   match to protein family HMM PF02775; match to protein
FT                   family HMM PF02776; match to protein family HMM TIGR00118"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0127"
FT                   /db_xref="EnsemblGenomes-Tr:ACF66627"
FT                   /protein_id="ACF66627.1"
FT                   /translation="MMTGIKWRQAVEMLSGAEMVVRSLIDQGVKQVFGYPGGAVLDIYD
FT                   ALHTVGGIDHVLVRHEQAAVHMADGLARATGDVGVVLVTSGPGATNAITGIATAYMDSI
FT                   PLVILSGQVATSLIGYDAFQECDMVGISRPVVKHSFLVKQTEDIPLVLKKAFWLAASGR
FT                   PGPVVVDLPKDILNPAKKMPYAWPETVSMRSYNPTTSGHKGQIKRALQTLASAKKPVVY
FT                   VGGGAISAACYAPLRHIIETFNLPVVSSLMGLGAFPATHRQSLGMLGMHGTYEANMTMH
FT                   NADVIFAVGVRFDDRTTNNLAKYCPNATVLHIDIDPTSISKTVNADIPVVGDARLVLEQ
FT                   MLELLAQDAPSQPQDDIRDWWQQIESWRARQCLKYDAESESIKPQAVIETLWRLTKGDA
FT                   YVTSDVGQHQMFAALYYPFDKPRRWINSGGLGTMGFGLPAALGVKMALPKEMVVCVTGD
FT                   GSIQMNIQELSTALQYELPVLVLNLNNRYLGMVKQWQDMIYSGRHSQSYMQSLPDFVRL
FT                   AEAYGHVGLQINRPDELESKLSEALEHVRNNRLVFVDVTVDGSEHVYPMQIRGGGMDEM
FT                   WLSKTERT"
FT   gene            132758..133252
FT                   /gene="ilvN"
FT                   /locus_tag="SeHA_C0128"
FT   CDS_pept        132758..133252
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ilvN"
FT                   /locus_tag="SeHA_C0128"
FT                   /product="acetolactate synthase, small subunit"
FT                   /EC_number="2.2.1.6"
FT                   /note="identified by match to protein family HMM PF01842;
FT                   match to protein family HMM TIGR00119"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0128"
FT                   /db_xref="EnsemblGenomes-Tr:ACF69776"
FT                   /protein_id="ACF69776.1"
FT                   /translation="MMRRILSVLLENESGALSRVIGLFSQRGYNIESLTVAPTDDPTLS
FT                   RMTIQTVGDEKVLEQIEKQLHKLVDVLRVSELGQGAHVEREIMLVKIQASGYGREEVKR
FT                   NTEIFRGQIIDVTPTLYTVQLAGTSDKLDAFLASLRDVAKIVEVARSGVVGLSRGDKIM
FT                   R"
FT   gene            complement(133242..133364)
FT                   /locus_tag="SeHA_C0129"
FT   CDS_pept        complement(133242..133364)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0129"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0129"
FT                   /db_xref="EnsemblGenomes-Tr:ACF67636"
FT                   /protein_id="ACF67636.1"
FT                   /translation="MADIRQTCLMALRLSDLGQISASRPDKTHARRHPANLLSA"
FT   gene            133536..134540
FT                   /gene="fruR"
FT                   /locus_tag="SeHA_C0130"
FT   CDS_pept        133536..134540
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fruR"
FT                   /locus_tag="SeHA_C0130"
FT                   /product="fructose repressor"
FT                   /note="identified by match to protein family HMM PF00356;
FT                   match to protein family HMM PF00532; match to protein
FT                   family HMM TIGR02417"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0130"
FT                   /db_xref="EnsemblGenomes-Tr:ACF66778"
FT                   /protein_id="ACF66778.1"
FT                   /translation="MKLDEIARLAGVSRTTASYVINGKAKQYRVSDKTVEKVMAVVREH
FT                   NYHPNAVAAGLRAGRTRSIGLVIPDLENTSYTRIANYLERQARQRGYQLLIACSEDQPD
FT                   NEMRCIEHLLQRQVDAIIVSTSLPPEHPFYQRWANDPFPIVALDRALDREHFTSVVGAD
FT                   QDDAEMLAEELRKFPAETVLYLGALPELSVSFLREQGFRTAWKDDPREVNFLYANSYER
FT                   EAAAQLFEKWLETHPMPQALFTTSFALLQGVMDVTLRRDGKLPSDLAIATFGDHELLDF
FT                   LQCPVLAVAQRHRDVAERVLEIVLASLDEPRKPKPGLTRIRRNLYRRGILSRS"
FT   gene            135146..135604
FT                   /gene="mraZ"
FT                   /locus_tag="SeHA_C0131"
FT   CDS_pept        135146..135604
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mraZ"
FT                   /locus_tag="SeHA_C0131"
FT                   /product="MraZ protein"
FT                   /note="identified by match to protein family HMM PF02381;
FT                   match to protein family HMM TIGR00242"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0131"
FT                   /db_xref="EnsemblGenomes-Tr:ACF69144"
FT                   /db_xref="GOA:B4TJ78"
FT                   /db_xref="InterPro:IPR003444"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR020603"
FT                   /db_xref="InterPro:IPR035642"
FT                   /db_xref="InterPro:IPR035644"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="InterPro:IPR038619"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4TJ78"
FT                   /protein_id="ACF69144.1"
FT                   /translation="MFRGATLVNLDSKGRLTVPTRYREQLIESATGQMVCTIDIHHPCL
FT                   LLYPLPEWEIIEQKLSRLSSMNPVERRVQRLLLGHASECQMDGAGRLLIAPVLRQHAGL
FT                   TKEVMLVGQFNKFELWDETTWYQQVKEDIDAEQSATETLSERLQDLSL"
FT   gene            135606..136547
FT                   /gene="mraW"
FT                   /locus_tag="SeHA_C0132"
FT   CDS_pept        135606..136547
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mraW"
FT                   /locus_tag="SeHA_C0132"
FT                   /product="S-adenosyl-methyltransferase MraW"
FT                   /EC_number="2.1.1.-"
FT                   /note="identified by match to protein family HMM PF01795;
FT                   match to protein family HMM TIGR00006"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0132"
FT                   /db_xref="EnsemblGenomes-Tr:ACF68512"
FT                   /db_xref="GOA:B4TJ79"
FT                   /db_xref="InterPro:IPR002903"
FT                   /db_xref="InterPro:IPR023397"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4TJ79"
FT                   /protein_id="ACF68512.1"
FT                   /translation="MMENFKHTTVLLDEAVNGLNIRPDGIYIDGTFGRGGHSRLILSQL
FT                   GEEGRLLAIDRDPQAIAVAQTINDPRFSIIHGPFSALADYVAERELTGKIDGILLDLGV
FT                   SSPQLDDAERGFSFMRDGPLDMRMDPTRGQSAAEWLQTAEEADIAWVLKTFGEERFAKR
FT                   IARAIVERNREQPMTRTKELAEVVAAATPVKDKFKHPATRTFQAVRIWVNSELEEIEQA
FT                   LKSSLSVLAPGGRLSIISFHSLEDRIVKRFMREQSRGPQVPAGLPMTEAQLKKLGGREL
FT                   RALGKLMPGEKEVAENPRARSSVLRIAERTNA"
FT   gene            136544..136909
FT                   /gene="ftsL"
FT                   /locus_tag="SeHA_C0133"
FT   CDS_pept        136544..136909
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsL"
FT                   /locus_tag="SeHA_C0133"
FT                   /product="cell division protein FtsL"
FT                   /note="identified by match to protein family HMM PF04999;
FT                   match to protein family HMM TIGR02209"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0133"
FT                   /db_xref="EnsemblGenomes-Tr:ACF67298"
FT                   /protein_id="ACF67298.1"
FT                   /translation="MISRVTEALSKVKGSIGSNERHALPGVIGDDLLRFGKLPLCLFIC
FT                   IILTAVTVVTTAHHTRLLTAQREQLVLERDALDIEWRNLILEENALGDHSRVERIATEK
FT                   LQMQHVDPSQENIVVQK"
FT   gene            136925..138691
FT                   /gene="ftsI"
FT                   /locus_tag="SeHA_C0134"
FT   CDS_pept        136925..138691
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsI"
FT                   /locus_tag="SeHA_C0134"
FT                   /product="peptidoglycan synthetase FtsI"
FT                   /EC_number="2.4.1.129"
FT                   /note="identified by match to protein family HMM PF00905;
FT                   match to protein family HMM PF03717"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0134"
FT                   /db_xref="EnsemblGenomes-Tr:ACF68887"
FT                   /protein_id="ACF68887.1"
FT                   /translation="MKAAAKTQKSKRQEEQTNFISWRFALLCGCILLALVFLLGRAAWL
FT                   QIIAPDMLVRQGDMRSLRVQEVSTSRGMITDRSGRPLAVSVPVKAIWADPKEVHDAGGI
FT                   SVGDRWKALSTALNIPLDQLSARINANPKGRFIYLARQVNPDMADYIKKLKLPGIHLRE
FT                   ESRRYYPSGEVTAHLIGFTNVDSQGIEGVEKSFDKWLTGQPGERIVRKDRYGRVIEDIS
FT                   STDSQAAHNLALSIDERLQALVYRELNNAVAFNKAESGSAVLVDVNTGEVLAMANSPSY
FT                   NPNNLAGTPKDAMRNRTITDVFEPGSTVKPMVVMTALQRGIVNENTVLNTVPYRINGHE
FT                   IKDVARYSELTLTGVLQKSSNVGVSKLALAMPSSALVDTYSRFGLGKATNLGLVGERSG
FT                   LYPQKQRWSDIERATFSFGYGLMVTPLQLARVYATIGSYGIYRPLSITKVDPPVPGERI
FT                   FPESTVRTVVHMMESVALPGGGGVKAAIKGYRIAIKTGTAKKVGPDGRYINKYIAYTAG
FT                   VAPASQPRFALVVVINDPQAGKYYGGAVSAPVFGAIMGGVLRTMNIEPDALATGEKNEF
FT                   VINQGEGTGGRS"
FT   gene            138678..140165
FT                   /gene="murE"
FT                   /locus_tag="SeHA_C0135"
FT   CDS_pept        138678..140165
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murE"
FT                   /locus_tag="SeHA_C0135"
FT                   /product="UDP-N-acetylmuramoylalanyl-D-glutamate--2,
FT                   6-diaminopimelate ligase"
FT                   /EC_number="6.3.2.13"
FT                   /note="identified by match to protein family HMM PF01225;
FT                   match to protein family HMM PF02875; match to protein
FT                   family HMM PF08245; match to protein family HMM TIGR01085"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0135"
FT                   /db_xref="EnsemblGenomes-Tr:ACF67666"
FT                   /protein_id="ACF67666.1"
FT                   /translation="MADRNLRDLLAPWVAGLPARELREMTLDSRVAAAGDLFVAVVGHQ
FT                   ADGRRYIPQAIAQGVAAIIAEAKDEASDGEIREMHGVPVVYLSQLNERLSALAGRFYHE
FT                   PSENMRLVAVTGTNGKTTTTQLLAQWSQLLGETSAVMGTVGNGLLGKVIPTENTTGSAV
FT                   DVQHVLASLVAQGATFGAMEVSSHGLVQHRVAALKFAASVFTNLSRDHLDYHGDMAHYE
FT                   AAKWMLYSTHHHGQAIVNADDEVGRRWLASLPDAVAVSMEGHINPNCHGRWLKAEAVEY
FT                   HDRGATIRFASSWGEGEIESCLMGAFNVSNLLLALATLLALGYPLTDLLKTAARLQPVC
FT                   GRMEVFTAPGKPTVVVDYAHTPDALEKALQAARLHCAGKLWCVFGCGGDRDKGKRPLMG
FT                   AIAEEFADIVVVTDDNPRTEEPRAIINDILAGMLDAGQVRVMEGRAEAVTNAIMQAKDN
FT                   DVVLIAGKGHEDYQIVGTQRLDYSDRVTAARLLGVIA"
FT   gene            140162..141520
FT                   /gene="murF"
FT                   /locus_tag="SeHA_C0136"
FT   CDS_pept        140162..141520
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murF"
FT                   /locus_tag="SeHA_C0136"
FT                   /product="UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D-alanine
FT                   ligase"
FT                   /EC_number="6.3.2.10"
FT                   /note="identified by match to protein family HMM PF01225;
FT                   match to protein family HMM PF02875; match to protein
FT                   family HMM PF08245; match to protein family HMM TIGR01143"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0136"
FT                   /db_xref="EnsemblGenomes-Tr:ACF67115"
FT                   /protein_id="ACF67115.1"
FT                   /translation="MISVTLSKIADVLGAEHRGADLTLDTVITDTRKVTPGCLFVALKG
FT                   ERFDAHDFADKAKANGAGALLVSRPLDIDLPQVIVKDTRQAFGQLAAWVRMQVPARVVA
FT                   LTGSSGKTSVKEMTAAILSQCGNTLYTAGNFNNDIGVPITLLRLNHDYDYAVIELGANH
FT                   QGAIAWTVSLTRPEAALVNNLAAAHLEGFGSLAGVAKAKGEIYTGLPENGIAIMNADNN
FT                   DWLNWQSIIGDRQVWRFSPNAANSDFTAANIHVTSHGTEFTLQTPMGSIDVLLPLPGRH
FT                   NIANALAAAALSMAVGATLAAIKAGLAALKAVPGRLFPIQLSENQLVLDDAYNANVGSM
FT                   TAAVQVLSEMPGYRVLVVGDMAELGAESEACHLQVGEAAKAAGIDRVLSTGKLSQAISH
FT                   ASGVGEHFADKAALIARLHALLQEQPMMTILVKGSRSAAMEDVVHALQEKGSC"
FT   gene            141514..142596
FT                   /gene="mraY"
FT                   /locus_tag="SeHA_C0137"
FT   CDS_pept        141514..142596
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mraY"
FT                   /locus_tag="SeHA_C0137"
FT                   /product="phospho-N-acetylmuramoyl-pentapeptide-transferase"
FT                   /EC_number="2.7.8.13"
FT                   /note="identified by match to protein family HMM PF00953;
FT                   match to protein family HMM TIGR00445"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0137"
FT                   /db_xref="EnsemblGenomes-Tr:ACF66589"
FT                   /db_xref="GOA:B4TJ84"
FT                   /db_xref="InterPro:IPR000715"
FT                   /db_xref="InterPro:IPR003524"
FT                   /db_xref="InterPro:IPR018480"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4TJ84"
FT                   /protein_id="ACF66589.1"
FT                   /translation="MLVWLAEHLVKYYSGFNVFSYLTFRAIVSLLTALFISLWMGPRMI
FT                   ARLQKLSFGQVVRNDGPESHFSKRGTPTMGGIMILTAIVISVLLWAYPSNPYVWCVLVV
FT                   LIGYGIIGFVDDYRKVVRKDTKGLIARWKYFWMSVIALGVAFALYLVGKDTPATQLVVP
FT                   FFKDVMPQLGLFYILLSYFVIVGTGNAVNLTDGLDGLAIMPTVFVAAGFALVAWATGNM
FT                   NFANYLHIPYLRHAGELVIVCTAIVGAGLGFLWFNTYPAQVFMGDVGSLALGGALGIIA
FT                   VLLRQEFLLVIMGGVFVVETLSVILQVGSFKLRGQRIFRMAPIHHHYELKGWPEPRVIV
FT                   RFWIISLMLVLIGLATLKVR"
FT   gene            142599..143915
FT                   /gene="murD"
FT                   /locus_tag="SeHA_C0138"
FT   CDS_pept        142599..143915
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murD"
FT                   /locus_tag="SeHA_C0138"
FT                   /product="UDP-N-acetylmuramoylalanine--D-glutamate ligase"
FT                   /EC_number="6.3.2.9"
FT                   /note="identified by match to protein family HMM PF02875;
FT                   match to protein family HMM PF08245; match to protein
FT                   family HMM TIGR01087"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0138"
FT                   /db_xref="EnsemblGenomes-Tr:ACF66628"
FT                   /protein_id="ACF66628.1"
FT                   /translation="MADYQDKNVVIIGLGLTGLSCVDFFLARGVTPRVMDTRVTPPGLD
FT                   KLPQEVERHVGGLNDEWLLAADLIVASPGIALAHPSLSAAASAGVEIVGDIELFCREAQ
FT                   APIVAITGSNGKSTVTTLVGEMAKAAGVNVGVGGNIGLPALMLLDADRELYVLELSSFQ
FT                   LETTSSLQAAAATVLNVTEDHMDRYPFGLQQYRAAKLRVYEKAKVCVVNADDALTMPVR
FT                   GADERCVSFGVNMGDYHLNRQQGETWLRVKGEKVLNVKEMKLSGQHNYTNALAALALAD
FT                   AVGLPRASSLKALTTFTGLAHRFQLALEHNGVRWINDSKATNVGSTEAALNGLHVDGTL
FT                   HLLLGGDGKSADFSPLTRYLTGDRIRLYCFGRDGAQLAALRPEIAQQTETMEEAMRLLA
FT                   PRVQPGDMVLLSPACASLDQFKNFEQRGDVFTRLAKELG"
FT   gene            143915..145159
FT                   /gene="ftsW"
FT                   /locus_tag="SeHA_C0139"
FT   CDS_pept        143915..145159
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsW"
FT                   /locus_tag="SeHA_C0139"
FT                   /product="cell division protein FtsW"
FT                   /note="identified by match to protein family HMM PF01098;
FT                   match to protein family HMM TIGR02614"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0139"
FT                   /db_xref="EnsemblGenomes-Tr:ACF70190"
FT                   /protein_id="ACF70190.1"
FT                   /translation="MRLSLPRLRMPRVPGFGLLAWLFAALKGWVMASRDKDADSLIMYD
FT                   RTLLWLTFGLAAIGFVMVTSASMPVGQRLANDPFLFAKRDALYIFLAFCLAMVTLRLPM
FT                   TFWQKYSTTMLIASIIMLLIVLVVGSSVNGASRWIALGPLRIQPAEFTKLSLFCYLANY
FT                   LVRKVDEVRNNLRGFLKPMGVILVLAVLLLAQPDLGTVVVLFVTTLAMLFLAGAKLWQF
FT                   IAIIGMGISAVILLILAEPYRIRRVTSFWNPWEDPFGSGYQLTQSLMAFGRGEIWGQGL
FT                   GNSVQKLEYLPEAHTDFIFAIIGEELGYIGVVLALLMVFFVAFRAMSIGRKALEIDHRF
FT                   SGFLACSIGIWFSFQALVNVGAAAGMLPTKGLTLPLISYGGSSLLIMSTAIMFLLRIDY
FT                   ETRLEKAQAFTRGSR"
FT   gene            145156..146223
FT                   /gene="murG"
FT                   /locus_tag="SeHA_C0140"
FT   CDS_pept        145156..146223
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murG"
FT                   /locus_tag="SeHA_C0140"
FT                   /product="undecaprenyldiphospho-muramoylpentapeptide
FT                   beta-N-acetylglucosaminyltransferase"
FT                   /EC_number="2.4.1.227"
FT                   /note="identified by match to protein family HMM PF03033;
FT                   match to protein family HMM PF04101; match to protein
FT                   family HMM TIGR01133"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0140"
FT                   /db_xref="EnsemblGenomes-Tr:ACF66193"
FT                   /db_xref="GOA:B4TJ87"
FT                   /db_xref="InterPro:IPR004276"
FT                   /db_xref="InterPro:IPR006009"
FT                   /db_xref="InterPro:IPR007235"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4TJ87"
FT                   /protein_id="ACF66193.1"
FT                   /translation="MSGQPKRLMVMAGGTGGHVFPGLAVAHHLMAQGWQVRWLGTADRM
FT                   EADLVPKHGIDIDFIRISGLRGKGVKALLAAPLRIFNAWRQARAIMKRFKPDVVLGMGG
FT                   YVSGPGGLAAWSLGIPVVLHEQNGIAGLTNQWLAKIATTVMQAFPGAFPNAEVVGNPVR
FT                   TDVLALPLPQVRLAGRDGPIRVLVVGGSQGARVLNQTMPQVAARLGDTVTIWHQSGKGA
FT                   QLTVEQAYAGAGQPQHKVTEFIDDMAAAYAWADVVVCRSGALTVSEIAAAGLPAIFVPF
FT                   QHKDRQQYWNALPLENAGAAKIFEQPQFTVEAVADTLAGWSREALLTMAERARAVSIPD
FT                   ATERVASEVSRVART"
FT   gene            146342..147817
FT                   /gene="murC"
FT                   /locus_tag="SeHA_C0141"
FT   CDS_pept        146342..147817
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murC"
FT                   /locus_tag="SeHA_C0141"
FT                   /product="UDP-N-acetylmuramate--alanine ligase"
FT                   /EC_number="6.3.2.8"
FT                   /note="identified by match to protein family HMM PF01225;
FT                   match to protein family HMM PF02875; match to protein
FT                   family HMM PF08245; match to protein family HMM TIGR01082"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0141"
FT                   /db_xref="EnsemblGenomes-Tr:ACF69235"
FT                   /db_xref="GOA:B4TJ88"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005758"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4TJ88"
FT                   /protein_id="ACF69235.1"
FT                   /translation="MNTQQLAKLRSIVPEMRRVRHIHFVGIGGAGMGGIAEVLANEGYQ
FT                   ISGSDLAPNPVTQQLTSLGATIFFNHRPENVRDASVVVVSSAISADNPEIVAAHEARIP
FT                   VIRRAEMLAELMRFRHGIAIAGTHGKTTTTAMVSSIYAEAGLDPTFVNGGLVKAAGVHA
FT                   RLGHSRYLIAEADESDASFLHLQPMVAIVTNIEADHMDTYHGDFENLKQTFINFLHNLP
FT                   FYGRAVMCVDDPVIRELLPRVGRQTTTYGFSEDADVRVEDYQQIGPQGHFTLLRQGMPD
FT                   LHVTLNAPGRHNALNAAAAVAVATEEGIADDAILRALESFQGTGRRFDFLGEFPLEPVN
FT                   GKAGTAMLVDDYGHHPTEVDATIKAARAGWPDKNLVMLFQPHRYTRTRDLYDDFANVLT
FT                   QVDALLMLDVYPAGEAPIPGADSRSLCRTIRNRGKIDPILVSDPAQVATMLAPVLTGND
FT                   LILVQGAGNVGKIARYLSEIKLKPQIQEEEQHG"
FT   gene            147810..148730
FT                   /gene="ddlB"
FT                   /locus_tag="SeHA_C0142"
FT   CDS_pept        147810..148730
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ddlB"
FT                   /locus_tag="SeHA_C0142"
FT                   /product="D-alanine--D-alanine ligase B"
FT                   /EC_number="6.3.2.4"
FT                   /note="identified by match to protein family HMM PF01820;
FT                   match to protein family HMM PF07478; match to protein
FT                   family HMM TIGR01205"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0142"
FT                   /db_xref="EnsemblGenomes-Tr:ACF69851"
FT                   /protein_id="ACF69851.1"
FT                   /translation="MADKIAVLLGGTSAERDVSLNSGAAVLAGLREGGIDAHPVDPQEV
FT                   DVAQLKAMGFQKVFIALHGRGGEDGTLQGMLELLGLPYTGSGVMASALSMDKLRSKLLW
FT                   QGAGLPVAPWVALTRAEFEKGLSEEQKARISALGLPLIVKPSREGSSVGMTKVVEENAL
FT                   QGALSLAFQHDDEILIEKWLCGPEFTVAIVGEEILPSIRIQPAGTFYDYEAKYLSDETQ
FT                   YFCPAGLEASQEAALQSLVLQAWKALGCTGWGRIDVMLDSDGQFYLLEANTSPGMTSHS
FT                   LVPMAARQAGMSFSQLVVRILELAD"
FT   gene            148732..149562
FT                   /gene="ftsQ"
FT                   /locus_tag="SeHA_C0143"
FT   CDS_pept        148732..149562
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsQ"
FT                   /locus_tag="SeHA_C0143"
FT                   /product="cell division protein FtsQ"
FT                   /note="identified by match to protein family HMM PF03799;
FT                   match to protein family HMM PF08478"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0143"
FT                   /db_xref="EnsemblGenomes-Tr:ACF68678"
FT                   /protein_id="ACF68678.1"
FT                   /translation="MSQAALNTRNSDEETPSSRRNNGTRLAGILFLLTVLCTVFVSGWV
FT                   VLGWMEDAQRLPLSKLVLTGERHYTRNDDIRQAILALGAPGTFMTQDVNIIQSQIERLP
FT                   WIKQASVRKQWPDELKIHLVEYVPIARWNDQHMVDAEGNTFSVPSDRIGKQVLPMLYGP
FT                   EGSASEVLQGYREMGQVLAKDKFTLKEAAMTARRSWQLTLNNGIKLNLGRGDTMKRLAR
FT                   FVELYPVLQQQAQTDGKRISYVDLRYDSGAAVGWAPLPPEESNQQQNQAQAEQQ"
FT   gene            149559..150821
FT                   /gene="ftsA"
FT                   /locus_tag="SeHA_C0144"
FT   CDS_pept        149559..150821
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsA"
FT                   /locus_tag="SeHA_C0144"
FT                   /product="cell division protein FtsA"
FT                   /note="identified by match to protein family HMM PF02491;
FT                   match to protein family HMM TIGR01174"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0144"
FT                   /db_xref="EnsemblGenomes-Tr:ACF69258"
FT                   /protein_id="ACF69258.1"
FT                   /translation="MIKATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRG
FT                   MDKGGVNDLESVVKCVQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEV
FT                   TQEDVENVVHTAKSVRVRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITC
FT                   HNDMAKNIVKAVERCGLKVDQLIFAGLAASYSVLTEDERELGVCVVDIGGGTMDIAVYT
FT                   GGALRHTKVIPYAGNVVTSDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVG
FT                   GRPPRSLQRQTLAEVIEPRYTELLNLVNEEILQLQEQLRQQGVKHHLAAGIVLTGGAAQ
FT                   IEGLAACAQRVFHTQVRIGAPLNITGLTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEK
FT                   RVTASVGSWIKRLNSWLRKEF"
FT   gene            150882..152033
FT                   /gene="ftsZ"
FT                   /locus_tag="SeHA_C0145"
FT   CDS_pept        150882..152033
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsZ"
FT                   /locus_tag="SeHA_C0145"
FT                   /product="cell division protein FtsZ"
FT                   /note="identified by match to protein family HMM PF00091;
FT                   match to protein family HMM PF03953; match to protein
FT                   family HMM TIGR00065"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0145"
FT                   /db_xref="EnsemblGenomes-Tr:ACF66581"
FT                   /protein_id="ACF66581.1"
FT                   /translation="MFEPMELTNDAVIKVIGVGGGGGNAVEHMVRERIEGVEFFAVNTD
FT                   AQALRKTAVGQTIQIGSGITKGLGAGANPEVGRNAADEDREALRAALEGADMVFIAAGM
FT                   GGGTGTGAAPVVAEVAKDLGILTVAVVTKPFNFEGKKRMAFAEQGITELSKHVDSLITI
FT                   PNDKLLKVLGRGISLLDAFGAANDVLKGAVQGIAELITRPGLMNVDFADVRTVMSEMGY
FT                   AMMGSGVASGEDRAEEAAEMAISSPLLEDIDLSGARGVLVNITAGFDLRLDEFETVGNT
FT                   IRAFASDNATVVIGTSLDPDMNDELRVTVVATGIGMDKRPEITLVTNKQVQQPVLDRYQ
FT                   QHGMAPLTQEQKTVSKVVNDNTPQAAKEPDYLDIPAFLRKQAD"
FT   gene            152134..153051
FT                   /gene="lpxC"
FT                   /locus_tag="SeHA_C0146"
FT   CDS_pept        152134..153051
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lpxC"
FT                   /locus_tag="SeHA_C0146"
FT                   /product="UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine
FT                   deacetylase"
FT                   /EC_number="3.5.1.-"
FT                   /note="identified by match to protein family HMM PF03331;
FT                   match to protein family HMM TIGR00325"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0146"
FT                   /db_xref="EnsemblGenomes-Tr:ACF67043"
FT                   /db_xref="GOA:B4TJ93"
FT                   /db_xref="InterPro:IPR004463"
FT                   /db_xref="InterPro:IPR011334"
FT                   /db_xref="InterPro:IPR015870"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4TJ93"
FT                   /protein_id="ACF67043.1"
FT                   /translation="MIKQRTLKRIVQATGVGLHTGKKVTLTLRPAPANTGVIYRRTDLN
FT                   PPVDFPADAKSVRDTMLCTCLVNEHDVRISTVEHLNAALAGLGIDNIVIEVNAPEIPIM
FT                   DGSAAPFVYLLLDAGIDELNCAKKFVRIKETVRVEDGDKWAEFRPYNGFTLDFTIDFNH
FT                   PAIDSSSQRYAMNFSADAFMRQISRARTFGFMRDIEYLQSRGLCLGGSFDCAIVVDDYR
FT                   VLNEDGLRFEDEFVRHKMLDAIGDLFMCGHNIIGAFTAYKSGHALNNKLLQAVLAKQEA
FT                   WEFVTFQDDAELPLAFKAPSTVLA"
FT   gene            153330..153827
FT                   /pseudo
FT                   /gene="secM"
FT                   /locus_tag="SeHA_C0147"
FT                   /note="secretion monitor protein; this gene contains a
FT                   frame shift which may be the result of sequencing error;
FT                   identified by match to protein family HMM PF06558"
FT   gene            153889..156594
FT                   /gene="secA"
FT                   /locus_tag="SeHA_C0148"
FT   CDS_pept        153889..156594
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secA"
FT                   /locus_tag="SeHA_C0148"
FT                   /product="preprotein translocase, SecA subunit"
FT                   /note="identified by match to protein family HMM PF01043;
FT                   match to protein family HMM PF02810; match to protein
FT                   family HMM PF07516; match to protein family HMM PF07517;
FT                   match to protein family HMM TIGR00963"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0148"
FT                   /db_xref="EnsemblGenomes-Tr:ACF69236"
FT                   /db_xref="GOA:B4TJ94"
FT                   /db_xref="InterPro:IPR000185"
FT                   /db_xref="InterPro:IPR004027"
FT                   /db_xref="InterPro:IPR011115"
FT                   /db_xref="InterPro:IPR011116"
FT                   /db_xref="InterPro:IPR011130"
FT                   /db_xref="InterPro:IPR014018"
FT                   /db_xref="InterPro:IPR020937"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036266"
FT                   /db_xref="InterPro:IPR036670"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4TJ94"
FT                   /protein_id="ACF69236.1"
FT                   /translation="MLIKLLTKVFGSRNDRTLRRMRKAVSLINAMEPEMEKLSDDELKA
FT                   KTNEFRARIEKGESVESLIPEAFAVVREASKRVFGMRHFDVQLLGGMVLNDRCIAEMRT
FT                   GEGKTLTATLPAYLNALSGKGVHVVTVNDYLAQRDAENNRPLFEFLGMSVGINLPGMPA
FT                   PAKREAYAADITYGTNNEYGFDYLRDNMAFSPEERVQRKLHYALVDEVDSILIDEARTP
FT                   LIISGPAEDSSEMYKKVNKIIPHLIRQEKEDSDTFQGEGHFSVDEKARQVNLTERGLVL
FT                   IEELLVQEGIMDEGESLYSPGNIMLMHHVTAALRAHALFTRDVDYIVKDGEVIIVDEHT
FT                   GRTMQGRRWSDGLHQAVEAKEGVEIQNENQTLASITFQNYFRLYEKLAGMTGTADTEAF
FT                   EFSSIYKLDTVVVPTNRPMIRKDLPDLVYMTEAEKIQAIIEDIKERTANGQPVLVGTIS
FT                   IEKSEVVSRELTKAGIKHNVLNAKFHANEAGIVAQAGYPAAVTIATNMAGRGTDIMLGG
FT                   SWQAEVAALEAPTEEQIAQIKADWQVRHDAVLAAGGLHIIGTERHESRRIDNQLRGRSG
FT                   RQGDPGSSRFYLSMEDALMRIFASDRVSGMMRKLGMKPGEAIEHPWVTKAIANAQRKVE
FT                   SRNFDIRKQLLEYDDVANDQRRAIYTQRNELLDVSDVSDTINSIREDVFKATIDAYIPP
FT                   QSLEEMWDIPGLQERLKNDFDLEMPIAEWLDKEPELHEETLRERILAQSIEVYQRKEEV
FT                   VGAEMMRHFEKGVMLQTLDSLWKEHLAAMDYLRQGIHLRGYAQKDPKQEYKRESFAMFA
FT                   AMLESLKYEVISTLSKVQVRMPEEVEAMEMQRREEAERLAQMQQLSHQDDDAAVAADLA
FT                   AQTGERKIGRNDPCPCGSGKKYKQCHGRLS"
FT   gene            156746..157141
FT                   /locus_tag="SeHA_C0149"
FT   CDS_pept        156746..157141
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0149"
FT                   /product="mutator MutT protein"
FT                   /EC_number="3.6.1.-"
FT                   /note="identified by match to protein family HMM PF00293;
FT                   match to protein family HMM TIGR00586"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0149"
FT                   /db_xref="EnsemblGenomes-Tr:ACF66557"
FT                   /protein_id="ACF66557.1"
FT                   /translation="MKKLQIAVGIIRNPNDEIFITQRAADAHMANKLEFPGGKIEAGET
FT                   PEQALIRELQEEVGITPTQVTLFDTLEYQFPDRHITLWFWLVERWEGEPWGKEGQPGRW
FT                   IAQNALSTDDFPPANEPIIRKLRQFAL"
FT   gene            complement(157175..157309)
FT                   /locus_tag="SeHA_C0150"
FT   CDS_pept        complement(157175..157309)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0150"
FT                   /product="putative aldo/keto reductase"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0150"
FT                   /db_xref="EnsemblGenomes-Tr:ACF66077"
FT                   /protein_id="ACF66077.1"
FT                   /translation="MDENLGALSLTLSPQELTAIEAVFPHDAAAGPRYWPEIMSTLNR"
FT   gene            complement(157463..157654)
FT                   /locus_tag="SeHA_C0151"
FT   CDS_pept        complement(157463..157654)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0151"
FT                   /product="conserved domain protein"
FT                   /note="identified by match to protein family HMM PF03884"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0151"
FT                   /db_xref="EnsemblGenomes-Tr:ACF67122"
FT                   /db_xref="GOA:B4TJ97"
FT                   /db_xref="InterPro:IPR005584"
FT                   /db_xref="InterPro:IPR013088"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4TJ97"
FT                   /protein_id="ACF67122.1"
FT                   /translation="MSDVTVVNCPTCGKPVVWGEISPFRPFCSKRCQLIDLGEWAAEEK
FT                   RIASSGDQSDSDDWSEER"
FT   gene            complement(157664..158407)
FT                   /locus_tag="SeHA_C0152"
FT   CDS_pept        complement(157664..158407)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0152"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF07072"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0152"
FT                   /db_xref="EnsemblGenomes-Tr:ACF66572"
FT                   /db_xref="GOA:B4TJ98"
FT                   /db_xref="InterPro:IPR009777"
FT                   /db_xref="InterPro:IPR027462"
FT                   /db_xref="InterPro:IPR036268"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4TJ98"
FT                   /protein_id="ACF66572.1"
FT                   /translation="MHTQVLFEHPLNEKMRTWLRIEFLIQQLSINLPIADHAGALHFFR
FT                   NISDLLDVFERGEVRTELLKELERQQRKLQAWVEVPGVDQDRIEALRQQLKSAGSVLIS
FT                   APRIGQQLREDRLIALVRQRLSIPGGCCSFDLPTLHIWLHLQQAQRDAQIESWLASLNP
FT                   LTQALTLVLDLIRNSAPFRKQTSLNGFYQDNGDDADLLRLMLTLDSQLYPQISGHKSRF
FT                   AIRFMPLDSENGLVPERLDFELACC"
FT   gene            complement(158407..159027)
FT                   /gene="coaE"
FT                   /locus_tag="SeHA_C0154"
FT   CDS_pept        complement(158407..159027)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="coaE"
FT                   /locus_tag="SeHA_C0154"
FT                   /product="dephospho-CoA kinase"
FT                   /EC_number="2.7.1.24"
FT                   /note="identified by match to protein family HMM PF01121;
FT                   match to protein family HMM TIGR00152"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0154"
FT                   /db_xref="EnsemblGenomes-Tr:ACF68430"
FT                   /protein_id="ACF68430.1"
FT                   /translation="MRYTVALTGGIGSGKSTVADAFADLGITVIDADIIARQMVEPGQP
FT                   ALNAIAEHFGSELIAADGTLRRRALRERIFSHPEEKAWLNALLHPLIQQETQRQFQQAT
FT                   SPYVLWVVPLLVENRLYQKANRVLVVDVTPETQLIRTMQRDDVTREHVEHILAAQATRE
FT                   ARLAVADDVIDNNGAPDAIASDVARLHASYLKLASQFVSQEKP"
FT   gene            159253..160296
FT                   /gene="guaC"
FT                   /locus_tag="SeHA_C0155"
FT   CDS_pept        159253..160296
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="guaC"
FT                   /locus_tag="SeHA_C0155"
FT                   /product="guanosine monophosphate reductase"
FT                   /EC_number="1.7.1.7"
FT                   /note="identified by match to protein family HMM PF00478;
FT                   match to protein family HMM TIGR01305"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0155"
FT                   /db_xref="EnsemblGenomes-Tr:ACF69085"
FT                   /db_xref="GOA:B4TJA0"
FT                   /db_xref="InterPro:IPR001093"
FT                   /db_xref="InterPro:IPR005993"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR015875"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4TJA0"
FT                   /protein_id="ACF69085.1"
FT                   /translation="MRIEEDLKLGFKDVLIRPKRSTLKSRSDVELERQFTFKHSGQTWS
FT                   GVPIIAANMDTVGTFEMAQALAGFDILTAVHKHYTVEEWAAFINTASADVLKHVMVSTG
FT                   TSDADFEKTVQILALNPALNFVCIDVANGYSEHFVQFVAKAREAWPTKTICAGNVVTGE
FT                   MCEELILSGADIVKVGIGPGSVCTTRVKTGVGYPQLSAVIECADAAHGLGGMIVSDGGC
FT                   TMPGDVAKAFGGGADFVMLGGMLAGHEESGGSVVEENGEKFMLFYGMSSESAMNRHVGG
FT                   VAKYRAAEGKTVKLPLRGPVGNTARDILGGLRSACTYVGASRLKELTKRTTFIRVQEQE
FT                   NRIFNSL"
FT   gene            complement(160327..161529)
FT                   /locus_tag="SeHA_C0156"
FT   CDS_pept        complement(160327..161529)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0156"
FT                   /product="protein transport protein HofC"
FT                   /note="identified by match to protein family HMM PF00482"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0156"
FT                   /db_xref="EnsemblGenomes-Tr:ACF68565"
FT                   /protein_id="ACF68565.1"
FT                   /translation="MSVKQLWRWQGVNDKGQLEQDVVWADNRLALIITLQHQRIMPLRI
FT                   KRMGVNAALWKEEQSAEIIHQLATLIHAGLTLSEGLELLAKQHPHRQWQALLRTLAHEL
FT                   EQGVPFSSALVSWPQVFPPLYQTMIRTGELTGKLAECCFELARQQKAQRQITVSVKKAL
FT                   RYPAIILTMAALVVFAMLHFVLPEFAAIYRSFNTPLPLLTRGIIAIAQWGSAWGWLILF
FT                   LTMLVAIAHRRVKQKPSWQAQRQRLLLRLPVMGRLIRGQKLAQIFTVLALTQSAGIPFL
FT                   QGLESAIDSLGCPYWSQRLTQVHQEIAAGNPVWLALKNTQEFSPLCLQLVRTGEASGSL
FT                   DIMLHNLARHHSETTLALADNLASLLEPALLIITGLIIGTLVVAMYLPIFHLGDAMSGM
FT                   G"
FT   gene            complement(161519..162904)
FT                   /locus_tag="SeHA_C0157"
FT   CDS_pept        complement(161519..162904)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0157"
FT                   /product="protein transport protein HofB"
FT                   /note="identified by match to protein family HMM PF00437"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0157"
FT                   /db_xref="EnsemblGenomes-Tr:ACF70378"
FT                   /protein_id="ACF70378.1"
FT                   /translation="MKDAQLNTLCQRHQAVLINSASNSITVAVVDAPSHALLDALHFAT
FT                   QKQIDIVCWTRQQMENHRHKPDQAPSANAAKGGETAAQLLNQTLRSAMAKRASDIHLEP
FT                   GASRYRIRLRIDGVLHILQDIAKETGLALTARLKVLGNLDIAEHRLPQDGQFTVDLAGD
FT                   SISFRIATLPCKEGEKVVLRLLHQVEQTLDLDTLGMYGAQLTAFRQALQQPQGLVLVTG
FT                   PTGSGKTVTLYSALQTRNTPGINLCSVEDPIEIPLDGINQTQIHPRAGLTFQNVLRALL
FT                   RQDPDIIMVGEIRDGDTAEIAIKAAQTGHLVLSTLHTNSTSETLIRLQQMGVARWMISS
FT                   ALTLVVAQRLVRKLCPHCKQRLSDPVVLSPNLWPSALPRWQASGCQHCYHGFYGRTALF
FT                   EVLTVTPALRQLIASGASAQALEAHLQQTGTGTLFENGCRAVEQGMTSFEEILRVLGMP
FT                   HER"
FT   gene            complement(162914..163351)
FT                   /locus_tag="SeHA_C0158"
FT   CDS_pept        complement(162914..163351)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0158"
FT                   /product="prepilin peptidase dependent protein D"
FT                   /note="identified by match to protein family HMM PF07963;
FT                   match to protein family HMM TIGR02532"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0158"
FT                   /db_xref="EnsemblGenomes-Tr:ACF67161"
FT                   /protein_id="ACF67161.1"
FT                   /translation="MEKQRGFTLIELMVVIGIIAILSAIGIPAYQNYLRKAALTDMLQT
FT                   FVPYRTAVELCALEHGGTSTCDAGVNGIPSPVITRYVSGMSVEKGVITLTGQESLSGLS
FT                   VIMTPAWDNANGITGWTRNCNIQSDSALQQACEDVFRFDTN"
FT   gene            complement(163573..164466)
FT                   /gene="nadC"
FT                   /locus_tag="SeHA_C0159"
FT   CDS_pept        complement(163573..164466)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nadC"
FT                   /locus_tag="SeHA_C0159"
FT                   /product="nicotinate-nucleotide diphosphorylase"
FT                   /EC_number="2.4.2.19"
FT                   /note="identified by match to protein family HMM PF01729;
FT                   match to protein family HMM PF02749; match to protein
FT                   family HMM TIGR00078"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0159"
FT                   /db_xref="EnsemblGenomes-Tr:ACF66500"
FT                   /protein_id="ACF66500.1"
FT                   /translation="MPPRRYNPDDRRDALLERINLDIPAAVAQALREDLGGEVDAGNDI
FT                   TAQLLPADTQAHATVITREDGVFCGKRWVEEVFIQLAGDDVRLTWHVDDGDAIHANQTV
FT                   FELNGPARVLLTGERTALNFVQTLSGVASEVRRYVGLLAGTQTQLLDTRKTLPGLRTAL
FT                   KYAVLCGGGANHRLGLTDAFLIKENHIIASGSVRQAVEKAFWLHPDVPVEVEVENLDEL
FT                   DDALKAGADIIMLDNFNTDQMREAVKRVNGQARLEVSGNVTAETLREFAETGVDFISVG
FT                   ALTKHVRALDLSMRFC"
FT   gene            164554..165117
FT                   /locus_tag="SeHA_C0160"
FT   CDS_pept        164554..165117
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0160"
FT                   /product="N-acetyl-anhydromuramyl-L-alanine amidase"
FT                   /note="identified by match to protein family HMM PF01510"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0160"
FT                   /db_xref="EnsemblGenomes-Tr:ACF65856"
FT                   /protein_id="ACF65856.1"
FT                   /translation="MLPDKGWLVEARRVPSPHYDCRPDDEKPSLLVVHNISLPPGEFGG
FT                   PWIDALFTGTIDPDAHPFFAEIAHLRVSAHCLIRRDGEIVQYVPFDKRAWHAGVSNYQG
FT                   RERCNDFSIGIELEGTDTLAYTDAQYQQLAAVTRTLIACYPAIADNMTGHCNIAPDRKT
FT                   DPGPAFDWPRFRALVALSSHKEMT"
FT   gene            165114..165968
FT                   /locus_tag="SeHA_C0161"
FT   CDS_pept        165114..165968
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0161"
FT                   /product="AmpE protein"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0161"
FT                   /db_xref="EnsemblGenomes-Tr:ACF67949"
FT                   /protein_id="ACF67949.1"
FT                   /translation="MTLFTTLLVLIVERLFKLGEHWQLDHRLEALFRRITHFSMLRTMG
FT                   MTAIAMVVTFLLLQALKGLLFNVPTLVVWILLGVLCIGAGKARVHYHAWLKAASRNDPH
FT                   PCEAMASELTLIHGVPPDCNEREFLRELQNALLWINFRFYLAPLFWFIVGGPWGPVTLV
FT                   GYAFLRAWQTWLARYQTPHQRLQSGIDAILHVLDWIPVRLAGVVYALLGHGEKALPAWF
FT                   ASLADLHTSQYQVLTRLAQFSLAREPHTDKVETPKAAVSMAKKASFVVVVIIALLTIYG
FT                   ALV"
FT   gene            complement(166060..167010)
FT                   /locus_tag="SeHA_C0162"
FT   CDS_pept        complement(166060..167010)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0162"
FT                   /product="alpha-N-arabinofuranosidase 2"
FT                   /EC_number="3.2.1.55"
FT                   /note="identified by match to protein family HMM PF04616"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0162"
FT                   /db_xref="EnsemblGenomes-Tr:ACF67148"
FT                   /protein_id="ACF67148.1"
FT                   /translation="MANWPNPFIEQRADPFILRDGSDYYFIASVPEYDRLEIRRANSLE
FT                   GLRAADPVVVWRKPESGPMSQLIWAPEMHRINGKWYIYFAATHTQALDKLGMFQHRMFA
FT                   LECADADPLTGKWTEKGQIKTPFDTFALDATTFYHQGKQWYLWAQKAPDIAGNSNIYLA
FT                   ELENPWTIKGEPVRLSKPEYDWECRGFWVNEGPAVVVHGDKLFISYSASATDENYCMGL
FT                   LWINVNDDPRDPANWHKSPRPVFTTSYENRQYGPGHNSFTQTPEGEDVLVYHARNYTEI
FT                   EGDPLYDPNRHTRLKRVRWDENGMPDFGVPPADTI"
FT   gene            complement(167010..168416)
FT                   /locus_tag="SeHA_C0163"
FT   CDS_pept        complement(167010..168416)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0163"
FT                   /product="Na+/galactoside symporter"
FT                   /note="identified by match to protein family HMM PF07690;
FT                   match to protein family HMM TIGR00792"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0163"
FT                   /db_xref="EnsemblGenomes-Tr:ACF69241"
FT                   /protein_id="ACF69241.1"
FT                   /translation="MDKGRLSVREKIGYGMGDAGCNIIFGAIMLFVNYFYTDIFGLAPA
FT                   LVGVLLLSVRVIDAVTDPVMGALADRTQSKYGRFRPWLLWIAFPYALFSVLMFTTPDWG
FT                   YNSKVVYAFVTYFLLSVTYTAINIPYCSLGGVITNDPKERVACQAYRFVLVGIATLLLS
FT                   LTLLPMVDWFGGGDKAKGYQLAMTVLAIIGMGMFLFCFASVRERVRPAVPTHDDMKNDF
FT                   KDVWKNDQWVRILLLTLCNVCPGFIRMAATMYYVTWVMGQSTHFATLFISLGVVGMMIG
FT                   SMLAKVLTDRWCKLKVFFWTNIALAIFSCAFYFFDPKATVMIVALYFLLNILHQIPSPL
FT                   HWSLMADVDDYGEWKTGKRITGISFSGNLFFLKLGLAIAGAMVGFLLSWYGYDASAKAQ
FT                   SASAMNGIMLLFTVIPGVGYLITAGVVRLLKVDRELMKKIQDDLEKRRTNYRELSELQD
FT                   LNAAESVRKA"
FT   gene            complement(168580..169950)
FT                   /locus_tag="SeHA_C0164"
FT   CDS_pept        complement(168580..169950)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0164"
FT                   /product="aromatic amino acid transport protein AroP"
FT                   /note="identified by match to protein family HMM PF00324"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0164"
FT                   /db_xref="EnsemblGenomes-Tr:ACF68483"
FT                   /protein_id="ACF68483.1"
FT                   /translation="MDSQQHGEQLKRGLKNRHIQLIALGGAIGTGLFLGSASVIQSAGP
FT                   GIILGYAIAGFIAFLIMRQLGEMVVEEPVAGSFSHFAYKYWGGFAGFASGWNYWVLYVL
FT                   VAMAELTAVGKYIQFWYPEIPTWASAAAFFVIINAINLTNVKVFGEMEFWFAIIKVIAV
FT                   IAMILFGAWLLFSDTAGPQATVRNLWEQGGFLPHGWTGLVMMMAIIMFSFGGLELVGIT
FT                   AAEADNPEQSIPKATNQVIYRILIFYIGSLAVLLSLLPWTRVTADTSPFVLIFHELGDT
FT                   FVANALNIVVLTAALSVYNSCVYCNSRMLFGLAQQGNAPKALLNVDKRGVPVSSILVSA
FT                   VVTALCVLLNYLAPESAFGLLMALVVSALVINWAMISLAHMMFRRAKQQQGVKTRFPAL
FT                   FYPFGNVLCLLFMAAVLIIMLMTPGMAISVWLIPVWLLILGVGYLCKEKTAKTVKAH"
FT   gene            170516..171280
FT                   /locus_tag="SeHA_C0165"
FT   CDS_pept        170516..171280
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0165"
FT                   /product="transcriptional regulator, GntR family"
FT                   /EC_number="1.8.1.4"
FT                   /note="identified by match to protein family HMM PF00392;
FT                   match to protein family HMM PF07729"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0165"
FT                   /db_xref="EnsemblGenomes-Tr:ACF69393"
FT                   /protein_id="ACF69393.1"
FT                   /translation="MAYSKIRQPKLSDVIEQQLEFLILEGTLRPGEKLPPERELAKQFD
FT                   VSRPSLREAIQRLEAKGLLLRRQGGGTFVQSSLWQSFSDPLVELLSDHPESQFDLLETR
FT                   HALEGIAAYYAALRSTDEDKDRIRELHHAIELAQESGDLDAESEAVLQYQIAVTEAAHN
FT                   VVLLHLLRCMEPMLAQNVRQNFELLYARREMLPLVSTHRTRIFEAIMAGKPEEAREASH
FT                   RHLAFIEEIMLDRSREESRRERALRRLEQRKN"
FT   gene            171440..174103
FT                   /gene="aceE"
FT                   /locus_tag="SeHA_C0166"
FT   CDS_pept        171440..174103
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aceE"
FT                   /locus_tag="SeHA_C0166"
FT                   /product="pyruvate dehydrogenase (acetyl-transferring),
FT                   homodimeric type"
FT                   /EC_number="1.2.4.1"
FT                   /note="identified by match to protein family HMM TIGR00759"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0166"
FT                   /db_xref="EnsemblGenomes-Tr:ACF69803"
FT                   /protein_id="ACF69803.1"
FT                   /translation="MSERFQNDVDPIETRDWLQAIESVIREEGVERAQYLIDQLLSEAR
FT                   KGGVKVAAGAGASNYINTIAVEDEPEYPGNLELERRIRSAIRWNAIMTVLRASKKDLEL
FT                   GGHMASFQSSATIYDVCFNHFFRARNEQDGGDLVYFQGHISPGIYARAFLEGRLTQEQM
FT                   DNFRQEVHGNGLSSYPHPKLMPEFWQFPTVSMGLGPIGAIYQAKFLKYLEHRGLKDTSK
FT                   QTVYAFLGDGEMDEPESKGAITIATREKLDNLVFVINCNLQRLDGPVTGNGKIVNELEG
FT                   IFAGAGWNVIKVMWGGRWDELLRKDTSGKLIQLMNETVDGDYQTFKSKDGAYVREHFFG
FT                   KYPETAALVADWTDEQIWALNRGGHDPKKVYAALKKAQETKGKATVILAHTIKGYGMGD
FT                   TAEGKNIAHQVKKMNMDGVRYVRDRFNVPVADADLEKLPYITFPEGSEEHKYLHERRQA
FT                   LHGYLPSRQPNFTEKLELPQLSDFGALLEEQSKEISTTIAFVRALNVMLKNKSIKDRLV
FT                   PIIADEARTFGMEGLFRQIGIYSPNGQQYTPQDREQVAYYKEDEKGQILQEGINELGAG
FT                   ASWLAAATSYSTNDLPMIPFYIYYSMFGFQRIGDLCWQAGDQQARGFLIGGTSGRTTLN
FT                   GEGLQHEDGHSHIQSLTIPNCISYDPAYAYEVAVIMHDGLERMYGEKQENVYYYITTLN
FT                   ENYHMPAMPAGAEEGIRKGIYKLETLEGSKGKVQLLGSGSILRHVREAAQILAKDYGVG
FT                   SDVYSVTSFTELARDGQDCERWNMLHPLETPRVPYIAQVMNDAPAVASTDYMKLFAEQV
FT                   RTYVPADDYRVLGTDGFGRSDSRENLRHHFEVDASYVVVAALGELAKRGEIDKKVVADA
FT                   ITKFNIDADKVNPRLA"
FT   gene            174118..176007
FT                   /gene="aceF"
FT                   /locus_tag="SeHA_C0167"
FT   CDS_pept        174118..176007
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aceF"
FT                   /locus_tag="SeHA_C0167"
FT                   /product="dihydrolipoyllysine-residue acetyltransferase"
FT                   /EC_number="2.3.1.12"
FT                   /note="identified by match to protein family HMM PF00198;
FT                   match to protein family HMM PF00364; match to protein
FT                   family HMM PF02817; match to protein family HMM TIGR01348"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0167"
FT                   /db_xref="EnsemblGenomes-Tr:ACF66019"
FT                   /protein_id="ACF66019.1"
FT                   /translation="MAIEIKVPDIGTDEVEITEILVKVGDKVEAEQSLITVEGDKASME
FT                   VPSPQAGVVKEIKVSVGDKTETGALIMIFDSADGAADAAPAKAEEKKEAAPTAAPAAAA
FT                   AKDVHVPDIGSDEVEVTEVMVKVGDTVEAEQSLITVEGDKASMEVPAPFAGTVKEIKVN
FT                   TGDKVSTGSLIMVFEVAGEAGAAAPAKAEAAPAAAAPAAATGVKDVNVPDIGGDEVEVT
FT                   EVMVKVGDKVTAEQSLITVEGDKASMEVPAPFAGTVKEIKISTGDKVKTGSLIMVFEVE
FT                   GAAPAAAPAKQEAAAPAPAAKAEKPAAPAAKAEGKSEFAENDAYVHATPLIRRLAREFG
FT                   VNLAKVKGTGRKGRILREDVQAYVKDAIKRAEAAPAAAGGGIPGMLPWPKVDFSKFGEV
FT                   EEVELGRIQKISGANLSRNWVMIPHVTHFDKTDITDLEAFRKQQNAEAEKRKLDVKYTP
FT                   VVFIMKAVAAALEQMPRFNSSLSEDGQRLTLKKYINIGVAVDTPNGLVVPVFKDVNKKS
FT                   VTELSRELTTISKKARDGKLTAGEMQGGCFTISSIGGLGTTHFAPIVNAPEVAILGVSK
FT                   SAMEPVWNGKEFVPRLMMPISLSFDHRVIDGADGARFITIINNMLSDIRRLVM"
FT   gene            176207..177631
FT                   /gene="lpdA"
FT                   /locus_tag="SeHA_C0168"
FT   CDS_pept        176207..177631
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lpdA"
FT                   /locus_tag="SeHA_C0168"
FT                   /product="dihydrolipoamide dehydrogenase"
FT                   /EC_number="1.8.1.4"
FT                   /note="identified by match to protein family HMM PF00070;
FT                   match to protein family HMM PF01134; match to protein
FT                   family HMM PF02852; match to protein family HMM PF07992;
FT                   match to protein family HMM TIGR01350"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0168"
FT                   /db_xref="EnsemblGenomes-Tr:ACF70237"
FT                   /protein_id="ACF70237.1"
FT                   /translation="MSTEIKTQVVVLGAGPAGYSAAFRCADLGLETVIVERYNTLGGVC
FT                   LNVGCIPSKALLHVAKVIEEAKALAEHGIVFGEPKTDIDKIRTWKEKVITQLTGGLAGM
FT                   AKGRKVKVVNGLGKFTGANTLEVEGENGKTVINFDNAIIAAGSRPIQLPFIPHEDPRVW
FT                   DSTDALELKEVPKRMLVMGGGIIGLEMGTVYHALGSEIDVVEMFDQVIPAADKDIVKVF
FT                   TKRISKKFNLMLETKVTAVEAKEDGIYVSMEGKKAPAEAQRYDAVLVAIGRVPNGKNLD
FT                   AGKAGVEVDDRGFIRVDKQLRTNVPHIFAIGDIVGQPMLAHKGVHEGHVAAEVIAGKKH
FT                   YFDPKVIPSIAYTEPEVAWVGLTEKEAKEKGISYETATFPWAASGRAIASDCADGMTKL
FT                   IFDKESHRVIGGAIVGTNGGELLGEIGLAIEMGCDAEDIALTIHAHPTLHESVGLAAEV
FT                   FEGSITDLPNPKAKKK"
FT   gene            177709..177837
FT                   /locus_tag="SeHA_C0169"
FT   CDS_pept        177709..177837
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0169"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0169"
FT                   /db_xref="EnsemblGenomes-Tr:ACF66733"
FT                   /protein_id="ACF66733.1"
FT                   /translation="MCQMMAKDNETAKFIVSAAVRFSKLMPSVVPLSVIFDQLIVS"
FT   gene            177920..178204
FT                   /locus_tag="SeHA_C0170"
FT   CDS_pept        177920..178204
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0170"
FT                   /product="probable secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0170"
FT                   /db_xref="EnsemblGenomes-Tr:ACF67225"
FT                   /protein_id="ACF67225.1"
FT                   /translation="MKLFLTTAALTATLISGMAFASDPVIPWATNSGGTESTHIAAMGE
FT                   DLNAQHQQITHTHEGVWAANSGSIQADEAALTSNKPPVQGHPELMPHQG"
FT   gene            complement(178242..179033)
FT                   /locus_tag="SeHA_C0171"
FT   CDS_pept        complement(178242..179033)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0171"
FT                   /product="probable secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0171"
FT                   /db_xref="EnsemblGenomes-Tr:ACF67800"
FT                   /protein_id="ACF67800.1"
FT                   /translation="MKKVMLSALLLSLPLLGYAQERFPSPEAAASAFAAAVAGKNETQL
FT                   TALLGDDWRQFLPPEGADPEAVARFNRDWREGHRIVQKDNTAHLNVGREDWQLPVPMVK
FT                   ETGGWRFDMAAAGNEILTRTIGRNELSTLQAMHAYVDAQQDYYLQNHRWAHRIISSEGQ
FT                   KDGLYWPTKAGDVPSPLGPNFSPAAPDEGYHGYHFRIISDNDGHGAALLAWPMHYGETG
FT                   VMSFMVNQDDRIYQADLGKETESKVQAITRFAPDAQWQVAE"
FT   gene            complement(179046..180671)
FT                   /locus_tag="SeHA_C0172"
FT   CDS_pept        complement(179046..180671)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0172"
FT                   /product="putative outer membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0172"
FT                   /db_xref="EnsemblGenomes-Tr:ACF68300"
FT                   /protein_id="ACF68300.1"
FT                   /translation="MTLPFKPHLIALVCSAGLFAASGVLYVKSRAPEAPAQAAAPASEP
FT                   TQTAVPAPVAKTTFTTAQIDQWVAPVALYPDALLSQVLMASTYPANVVQAVQWSRDNPT
FT                   LQGDAAIQAVASQPWDPSVKSLVAFPQLMALMGENPQWVQNLGDAFLAQPQDVMDAVQR
FT                   LRLLAQQTGSLKSTPQQTVTSVPKSSASTAVTTTTTTTSASTPATPSTVIKIEPANPQV
FT                   VYVPNYNPATVYGAWPNTAYPPVYLPPPPGQQFADSFVKGFGYSLGVATTYALFSSIDW
FT                   DDDDHHHHDDDHHDDDYHHGGNGYQHNGDNININVNNFNRISGQNLPGQTMGWQHNPAW
FT                   RNGVPYPNNTVAQRFHPTNVSGGLSATQQAPVSRDSQRQAAMTQFQQRSHTANASLPAP
FT                   GTRDAQRKAASQQLNQIAQRNNYRGYDGTQNSSRREAAQQTLNKSTTQQHRSELKAKAQ
FT                   QHPVSQQQRDTARQRIESSTPQQRQAFRQNMHANVFSGNDSRSPSWQSQQLRGLESRRG
FT                   SHLNTEQRAAAREHFSEHHEFHRR"
FT   gene            181060..183657
FT                   /gene="acnB"
FT                   /locus_tag="SeHA_C0173"
FT   CDS_pept        181060..183657
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="acnB"
FT                   /locus_tag="SeHA_C0173"
FT                   /product="aconitate hydratase 2"
FT                   /EC_number="4.2.1.3"
FT                   /note="identified by match to protein family HMM PF00330;
FT                   match to protein family HMM PF06434; match to protein
FT                   family HMM TIGR00117"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0173"
FT                   /db_xref="EnsemblGenomes-Tr:ACF69414"
FT                   /protein_id="ACF69414.1"
FT                   /translation="MLEEYRKHVAERAAQGIVPKPLDATQMAALVELLKTPPVGEEEFL
FT                   LDLLINRVPPGVDEAAYVKAGFLAAVAKGDTTSPLVSPEKAIELLGTMQGGYNIHPLID
FT                   ALDDAKLAPIAAKALSHTLLMFDNFYDVEEKAKAGNEYAKQVMQSWADAEWFLSRPPLA
FT                   EKITVTVFKVTGETNTDDLSPAPDAWSRPDIPLHAQAMLKNAREGIEPDQPGVVGPIKQ
FT                   IEALQKKGYPLAYVGDVVGTGSSRKSATNSVLWFMGDDIPNVPNKRGGGLCLGGKIAPI
FT                   FFNTMEDAGALPIEVDVSNLNMGDVIDVYPYKGEVRNHETGELLATFELKTDVLIDEVR
FT                   AGGRIPLIIGRGLTTKAREALGLPHSDVFRQAKDVAESSRGFSLAQKMVGRACGVKGIR
FT                   PGAYCEPKMTSVGSQDTTGPMTRDELKDLACLGFSADLVMQSFCHTAAYPKPVDVTTHH
FT                   TLPDFIMNRGGVSLRPGDGVIHSWLNRMLLPDTVGTGGDSHTRFPIGISFPAGSGLVAF
FT                   AAATGVMPLDMPESVLVRFKGKMQPGITLRDLVHAIPLYAIKQGLLTVEKKGKKNIFSG
FT                   RILEIEGLPDLKVEQAFELTDASAERSAAGCTIKLNKEPIIEYLTSNIVLLKWMIAEGY
FT                   GDRRTLERRIQGMEKWLADPQLLEADADAEYAAVIDIDLADIKEPILCAPNDPDDARLL
FT                   SDVQGEKIDEVFIGSCMTNIGHFRAAGKLLDSHKGQLPTRLWVAPPTRMDAAQLTEEGY
FT                   YSVFGKSGARIEIPGCSLCMGNQARVADGATVVSTSTRNFPNRLGTGANVFLASAELAA
FT                   VAALIGKLPTPEEYQTFVAQVDKTAVDTYRYLNFDQLSQYTEKADGVIFQTAV"
FT   gene            complement(183689..184660)
FT                   /locus_tag="SeHA_C0174"
FT   CDS_pept        complement(183689..184660)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0174"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0174"
FT                   /db_xref="EnsemblGenomes-Tr:ACF69872"
FT                   /protein_id="ACF69872.1"
FT                   /translation="MTYFKWLSVLLCFITSYHAYANDSAVGETNGSIEFLQQNEISMAK
FT                   ERLLIASDRINVDYVFINHSAQDITVPVAFPMPAISQQYMGDRTEGIANFKISVDGKPV
FT                   KSESRWRVIHDLGGKGEEDITAKLLQTGWTIPQLRHVLNREGKASIEEGYKEGKQQLPS
FT                   EWFDDGYLNIAVQQYFIWQQRFPAGKEIVIHHSYTPSTSTGVPDSLDSLLGDELGDQCL
FT                   TAATRKALKQLDAGIKYKNEDGSANIGWGYLGYILKTGANWKEGVIGDFTLRIHKKDET
FT                   EVVVPCFNYPLKQIDPLTLEFKQKNFKPDENLDIHFYYDSSL"
FT   gene            184733..185821
FT                   /locus_tag="SeHA_C0175"
FT   CDS_pept        184733..185821
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0175"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0175"
FT                   /db_xref="EnsemblGenomes-Tr:ACF70374"
FT                   /protein_id="ACF70374.1"
FT                   /translation="MRYYLFLLLIICQNTFAEEIKPLPQGDTWRKYIALSLRDEEGLED
FT                   GLFNLRRIEANSSIAYVCGLIKDKNDNFLTDGQNQYHLYDRVMAIGYRWSWGSVVRFDK
FT                   TIASPQDVHCHYGKNVPLTSALLREQVAAQGRKNICQPVKASNPLRSDILNGLRASYIG
FT                   DSNSLTLNGPLPTVKFIVEDLCATEDYAYFLGKATGDKTSFFIHDDANNRLRVVLKKYP
FT                   DGVWRPQPENNLLTQQSKVSGGYCSDGTLRETDLAQLAQACRVEGDTVNLTGTLRQQGD
FT                   GESAYWTLTPDNPLACVRDANKQQPGWNQTIQLVLTPQERESLNNLVGKKVSVGGDIFL
FT                   ALSASHHTPLLLDNIFRLTEIK"
FT   gene            185855..186163
FT                   /locus_tag="SeHA_C0176"
FT   CDS_pept        185855..186163
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0176"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0176"
FT                   /db_xref="EnsemblGenomes-Tr:ACF66196"
FT                   /protein_id="ACF66196.1"
FT                   /translation="MLCGNVDAAAKLQYLHVTNGGMMAFYDDGNAKMCARCEPMVQNLK
FT                   SMNNKAPYARWKQMGDVIKLKSPNSESDYKFYQQGEILSTWWIFNYKTLHALVDLSE"
FT   gene            complement(186178..187110)
FT                   /locus_tag="SeHA_C0177"
FT   CDS_pept        complement(186178..187110)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0177"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0177"
FT                   /db_xref="EnsemblGenomes-Tr:ACF67419"
FT                   /protein_id="ACF67419.1"
FT                   /translation="MKKIAFGFPLLLAVLPHPAQANEAVANSSLHLLAQSDIQLAKERL
FT                   LIERDRINADYLFVNPTAQDITVPVVFPMPPLSFSDVNEAGEDYIPGIRNIKIRVDGQI
FT                   VTPQPRWTVVLNAPQEEITDKLQQAGWTVEQLIAALSDGEFSPPADLPALPPEWFKDNQ
FT                   PQFTIQRNFIWQQTFPAGKAVTIHQVYTPSVSLSALMSTDELDNDNTCPTAENRQQIQQ
FT                   ALDQLMTAQGPAGALGQNRMDVVLTGDPAWKEGDIGEFTLRLHGDAITTCFQPPLTRIN
FT                   ATTLEFKQKNFRPAENLAVTFYSLSSMYE"
FT   gene            187185..188324
FT                   /locus_tag="SeHA_C0178"
FT   CDS_pept        187185..188324
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0178"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0178"
FT                   /db_xref="EnsemblGenomes-Tr:ACF67544"
FT                   /protein_id="ACF67544.1"
FT                   /translation="MRYFLLLLMMFCCNLYASDMFPLKPDANPRGAIALTLREEVGLLN
FT                   ARFDIKRIEINETRELAYFCGLLKDTDGQYIKDEDDKYYLFDRILLDSGTEGWVSTVYL
FT                   DEEFSAPEQAKCHFAGNVDLKSQELRALVKQYGRIAACLPVEKGDPLRTQLLDAVRENY
FT                   VGDLNRKTTLNNTPVPSFVVTQLCAAQKYAYFCGEPANADADWYSQDSKKLDVVLVLQK
FT                   DANNTWWLPVPQFQGISRQSSLAWCNHSTDILPVKTVEEMAKKRQQRCVREGDTVSLRG
FT                   ILAEQKSGAQRYWVVKLEEPLTCVQDADMQTADWNGQVQLLLSDEIIERVKVQYGDDLL
FT                   NQEIVVTGDVLLALSSDHHTPLVLENIVKLMPVMEGPGW"
FT   gene            188326..188505
FT                   /locus_tag="SeHA_C0179"
FT   CDS_pept        188326..188505
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0179"
FT                   /product="aconitate hydratase"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0179"
FT                   /db_xref="EnsemblGenomes-Tr:ACF67533"
FT                   /protein_id="ACF67533.1"
FT                   /translation="MRLPIFNDCVIPAHNKRSSTDRFPASAELAAVDTYRYLNFDQLSQ
FT                   YTEKADGVIFQTAV"
FT   gene            complement(188545..189009)
FT                   /locus_tag="SeHA_C0180"
FT   CDS_pept        complement(188545..189009)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0180"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0180"
FT                   /db_xref="EnsemblGenomes-Tr:ACF68048"
FT                   /protein_id="ACF68048.1"
FT                   /translation="MSVFRRIIYHSGWFILFGPLIGAAIAIGIINFLPAIIGGPDSFLL
FT                   YFCRTIPELVIITGWIYSLLPAWLTGVACALIPLKLYQKIINRMILCAIAGGLITTLFN
FT                   FARYGFDISILPLIYGEVLIMLIPAIVAGAIMGGVITYLPGLREVKRNNK"
FT   gene            complement(189427..189750)
FT                   /locus_tag="SeHA_C0181"
FT   CDS_pept        complement(189427..189750)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0181"
FT                   /product="low molecular weight phosphotyrosine protein
FT                   phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0181"
FT                   /db_xref="EnsemblGenomes-Tr:ACF68218"
FT                   /protein_id="ACF68218.1"
FT                   /translation="MNVLFICSRNQWRSPTAEQVFRRYPGLSVRSAGTSRNAKKSVSCG
FT                   LLQWADVICVMEQKHKDRLMAEYRRIIENKPLHVLDIPDDYRYMDPELVRQLEELVPDM
FT                   LGI"
FT   gene            190021..190383
FT                   /locus_tag="SeHA_C0183"
FT   CDS_pept        190021..190383
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0183"
FT                   /product="protein YacL"
FT                   /note="identified by match to protein family HMM PF06062"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0183"
FT                   /db_xref="EnsemblGenomes-Tr:ACF70116"
FT                   /db_xref="InterPro:IPR008249"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4TJC7"
FT                   /protein_id="ACF70116.1"
FT                   /translation="MDYEFLRDVTGGVKVRMSMGHEVVGHWFNEEVKDNLSLLDEVEQA
FT                   ARTVKGSERSWQRAGHEYTIWMDGEEVMIRANQLDFSGDEMEEGMSYYNEESLSLCGME
FT                   DFLRVVAAYREFVSKA"
FT   gene            190618..191571
FT                   /locus_tag="SeHA_C0184"
FT   CDS_pept        190618..191571
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0184"
FT                   /product="2-keto-3-deoxygluconate permease"
FT                   /note="identified by match to protein family HMM PF03812"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0184"
FT                   /db_xref="EnsemblGenomes-Tr:ACF66818"
FT                   /protein_id="ACF66818.1"
FT                   /translation="MNIKKAIERVPGGMMVVPLVIGAVINTFAPQALEIGGFTTALFKN
FT                   GAAPLIGAFLLCMGAGISVKAAPQALLQGGTITLTKLLVAIGIGLGVEHLFGAEGIFGL
FT                   SGVAIIAAMSNSNGGLYAALVGEFGNERDVGAISILSLNDGPFFTMIALGAAGMANIPI
FT                   MALVAVLVPLVVGMILGNLDPHMRDFLTKGGPLLIPFFAFALGAGINLEMLLQGGLAGI
FT                   LLGVLTTFVGGFFNIRADRLVGGTGIAGAAASSTAGNAVATPLAIAQADPSLAEVAAAA
FT                   APLIAASVITTAILTPVLTSWVAKKQARQASLEKNA"
FT   gene            191568..192557
FT                   /pseudo
FT                   /locus_tag="SeHA_C0185"
FT                   /note="YgbK domain protein; this gene contains a premature
FT                   stop which may be the result of sequencing error;
FT                   identified by match to protein family HMM PF07005"
FT   gene            192618..192839
FT                   /pseudo
FT                   /locus_tag="SeHA_C0186"
FT                   /note="conserved hypothetical protein; this gene contains a
FT                   premature stop which may be the result of sequencing error"
FT   gene            192829..193812
FT                   /gene="pdxA"
FT                   /locus_tag="SeHA_C0187"
FT   CDS_pept        192829..193812
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pdxA"
FT                   /locus_tag="SeHA_C0187"
FT                   /product="4-hydroxythreonine-4-phosphate dehydrogenase"
FT                   /EC_number="1.1.1.262"
FT                   /note="identified by match to protein family HMM PF04166;
FT                   match to protein family HMM TIGR00557"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0187"
FT                   /db_xref="EnsemblGenomes-Tr:ACF68057"
FT                   /protein_id="ACF68057.1"
FT                   /translation="METKTVAITMGDPAGIGPEIIVKALSEDGLNGAPLVVIGCLATLK
FT                   RLQAKGITPNVELRAIERVAEARFAPGIIHVIDEPLAQPEALEAGKVQAQAGDLAYRCV
FT                   KRATELALRGDVQAIATAPLNKEALHLAGHNYPGHTELLATLTHSRDYAMVLYTDKLKV
FT                   IHVSTHIALRKFLDTLSTTRVETVIGIADTFLKRVGYVKPRIAVAGVNPHAGENGLFGD
FT                   EETRILTPAITDARAKGMDVYGPCPPDTVFLQAYEGQYDMVVAMYHDQGHIPLKLLGFY
FT                   DGVNITAGLPFIRTSADHGTAFDIAWTGKAKSESMAVSIKLAMQLA"
FT   gene            193822..194589
FT                   /locus_tag="SeHA_C0188"
FT   CDS_pept        193822..194589
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0188"
FT                   /product="DeoR-family transcriptional regulator"
FT                   /note="identified by match to protein family HMM PF00455;
FT                   match to protein family HMM PF08220"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0188"
FT                   /db_xref="EnsemblGenomes-Tr:ACF70206"
FT                   /protein_id="ACF70206.1"
FT                   /translation="MKGQHRLDLIVAYLKNHTLVTVEQLVEAVDASPATIRRDLIKLDE
FT                   QGVISRSHGGVALRRFEPAQPTTNEKQLRSPAEKRAIARVAASLVNAGDAVVLDAGTTM
FT                   MELAKCLTHLPLRVITVDLHIALFLAEFRQIEVTIVGGRIDDSSQSCIGEHGRKLLRSV
FT                   YPNIAFMSCNSWGVKTGVTTPTEDKAGLKQEIIANAQRKVLLADSSKYGAHSLFNVVPL
FT                   ERFNDVITDVNLPPSAQVELKGRAFALTLVQPE"
FT   gene            complement(194619..195413)
FT                   /gene="speD"
FT                   /locus_tag="SeHA_C0189"
FT   CDS_pept        complement(194619..195413)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="speD"
FT                   /locus_tag="SeHA_C0189"
FT                   /product="S-adenosylmethionine decarboxylase proenzyme"
FT                   /EC_number="4.1.1.50"
FT                   /note="identified by match to protein family HMM PF02675;
FT                   match to protein family HMM TIGR03331"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0189"
FT                   /db_xref="EnsemblGenomes-Tr:ACF70015"
FT                   /db_xref="GOA:B4TJD1"
FT                   /db_xref="InterPro:IPR003826"
FT                   /db_xref="InterPro:IPR009165"
FT                   /db_xref="InterPro:IPR016067"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4TJD1"
FT                   /protein_id="ACF70015.1"
FT                   /translation="MKKLKLHGFNNLTKSLSFCIYDICYAKTAEERDGYIAYIDELYNA
FT                   NRLTEILSETCSIIGANILNIARQDYEPQGASVTILVSEEPVDPKLIDQTEHPGPLPET
FT                   VVAHLDKSHICVHTYPESHPEGGLCTFRADIEVSTCGVISPLKALNYLIHQLESDIVTI
FT                   DYRVRGFTRDVNGMKHFIDHEINSIQNFMSEDMKSLYDMVDVNVYQENIFHTKMLLKEF
FT                   DLKHYMFHTKPEDLTETERQEITAALWKEMREIYYGRNISAV"
FT   gene            complement(195434..196294)
FT                   /gene="speE"
FT                   /locus_tag="SeHA_C0190"
FT   CDS_pept        complement(195434..196294)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="speE"
FT                   /locus_tag="SeHA_C0190"
FT                   /product="spermidine synthase"
FT                   /EC_number="2.5.1.16"
FT                   /note="identified by match to protein family HMM PF01564;
FT                   match to protein family HMM TIGR00417"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0190"
FT                   /db_xref="EnsemblGenomes-Tr:ACF68722"
FT                   /db_xref="GOA:B4TJD2"
FT                   /db_xref="InterPro:IPR001045"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR030373"
FT                   /db_xref="InterPro:IPR030374"
FT                   /db_xref="InterPro:IPR035246"
FT                   /db_xref="InterPro:IPR037163"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4TJD2"
FT                   /protein_id="ACF68722.1"
FT                   /translation="MAENTMWHETLHDQFGQYFAVDNVLYHEKTDHQDLIIFENAAFGR
FT                   VMALDGVVQTTERDEFIYHEMMTHVPLLAHGHAKHVLIIGGGDGAMLREVTRHKNVETI
FT                   TMVEIDAGVVSFCRQYLPNHNAGSYDDPRFTLVIDDGVNFVNQTHQTFDVIISDCTDPI
FT                   GPGESLFTSAFYEGCKRCLNPGGIFVAQNGVCFLQQDEALDSHRKLSHYFSDVGFYQAA
FT                   IPTYYGGIMTFAWATDNDALRHLSSEIIQARFHAAGLKCRYYNPAIHAAAFALPQYLHD
FT                   ALSAQ"
FT   gene            complement(196401..196787)
FT                   /locus_tag="SeHA_C0191"
FT   CDS_pept        complement(196401..196787)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0191"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0191"
FT                   /db_xref="EnsemblGenomes-Tr:ACF66653"
FT                   /protein_id="ACF66653.1"
FT                   /translation="MLTLTFPDAVVEAMKTFFRPVLFGSLMALCANSYALTESEAEDMA
FT                   DLTAVFVFLKNDCGYQNLPNSQIRRALVFFAQQNQWDLSNYDTFDMKSLGEDSYRDLSG
FT                   IGIPVAKKCKALARDSLSLLAYVK"
FT   gene            196950..198560
FT                   /locus_tag="SeHA_C0192"
FT   CDS_pept        196950..198560
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0192"
FT                   /product="blue copper oxidase CueO"
FT                   /note="identified by match to protein family HMM PF07731;
FT                   match to protein family HMM PF07732; match to protein
FT                   family HMM TIGR01409"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0192"
FT                   /db_xref="EnsemblGenomes-Tr:ACF69559"
FT                   /protein_id="ACF69559.1"
FT                   /translation="MLRRDFLKYSVALGVASALPLWSRAAFAAERPALPIPDLLTADAS
FT                   NRMQLIVKAGQSTFAGKNATTWGYNGNLLGPAVQLHKGKSVTVDIHNQLAEDTTLHWHG
FT                   LEIPGIVDGGPQGIIPAGGTRTVTFTPQQRAATCWIHPHKHGKTGRQVAMGLAGLVLIE
FT                   DDEIRKLRLPKQWGIDDVPVIIQDKRFSADGQIDYQLDIMTAAVGWFGDTLLTNGAIYP
FT                   QHSAPKGWLRLRLLNGCNARSLNIAASDNRPLYVIASDGGLLAEPVKVTELPLLMGERF
FT                   EVLVDISDGKAFDLVTLPVSQMGMAIAPFDKPHPVMRIQPLRITASGTLPDTLTTMPAL
FT                   PSLEGLTVRNLKLSMDPRLDMMGMQMLMKKYGAQAMSGMDHDSMNAHMQGGNMGHGEMD
FT                   HGNMDHSGMNHGAMGNMNHGGKFDFHNANFINGQVFDMNKPMFAAQKGRHERWVISGVG
FT                   DMMLHPFHIHGTQFRILSENGKAPAAHRTGWKDTVRVEGGISEVLVKFDHDAPKEHAYM
FT                   AHCHLLEHEDTGMMLGFTV"
FT   gene            complement(198638..200881)
FT                   /gene="gcd"
FT                   /locus_tag="SeHA_C0193"
FT   CDS_pept        complement(198638..200881)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gcd"
FT                   /locus_tag="SeHA_C0193"
FT                   /product="quinoprotein glucose dehydrogenase"
FT                   /EC_number="1.1.5.2"
FT                   /note="identified by match to protein family HMM PF01011;
FT                   match to protein family HMM TIGR03074"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0193"
FT                   /db_xref="EnsemblGenomes-Tr:ACF67878"
FT                   /protein_id="ACF67878.1"
FT                   /translation="MLVVAGLLWRSKRAALWLYAALLLATMIWGVWEVGFDFWALTPRS
FT                   DILVFFGIWLILPFVWHRLVVPSSGAVAALVVALLISGGILTWAGFNDPQEINGTLRAD
FT                   ATPAATSSSIADEDWPAYGRNQEGQRYSPLKQITADNVHQLKEAWVFRTGDLKQPNDPG
FT                   EITNEVTPIKVGDTLYLCTAHQRLFALDAASGKEKWHFDPQLKTDSSFQHVTCRGVSYH
FT                   EAKADTASPEVIADCPRRIILPVNDGRLFAVNAETGKLCETFANKGVLNLQTNMPDTTP
FT                   GLYEPTSPPIITDKTIVIAGSVTDNFSTRETSGVIRGFDVNSGKLMWAFDPGAKDPNAI
FT                   PADEHAFTFNSPNSWAPAAYDAKLDLVYLPMGVTTPDIWGGNRTPEQERYASSILALNA
FT                   TTGKLAWSYQTVHHDLWDMDLPAQPTLADITVDGTTVPVIYAPAKTGNIFVLDRRNGEL
FT                   VVPAPEKPVPQGAAKGDYVAKTQPFSDLTFRPKKDLSGADMWGATMFDQLVCRVMFHQL
FT                   RYEGIFTPPSEQGTLVFPGNLGMFEWGGISVDPDRQVAIANPMALPFVSKLIPRGPGNP
FT                   MEPPKDAKGTGTEAGIQPQYGVPFGVTLNPFLSPFGLPCKQPAWGYISALDLKTNEIVW
FT                   KKRIGTPRDSMPFPMPVPVPFNMGMPMLGGPISTAGNVLFIAATADNYLRAYNMSNGEK
FT                   LWQGRLPAGGQATPMTYEVNGKQYVVVSAGGHGSFGTKMGDYIVAYALPDDAK"
FT   gene            201234..201770
FT                   /gene="hpt"
FT                   /locus_tag="SeHA_C0194"
FT   CDS_pept        201234..201770
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hpt"
FT                   /locus_tag="SeHA_C0194"
FT                   /product="hypoxanthine phosphoribosyltransferase"
FT                   /EC_number="2.4.2.8"
FT                   /note="identified by match to protein family HMM PF00156;
FT                   match to protein family HMM TIGR01203"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0194"
FT                   /db_xref="EnsemblGenomes-Tr:ACF66732"
FT                   /protein_id="ACF66732.1"
FT                   /translation="MKHTVEVMIPEAEIKARIAELGRQITERYKDSGSEMVLVGLLRGS
FT                   FMFMADLCREVQVPHEVDFMTASSYGSGMSTTRDVKILKDLDEDIRGKDVLIVEDIIDS
FT                   GNTLSKVREILGLREPKSLAICTLLDKPSRREVDVPVEFVGFSIPDEFVVGYGIDYAQR
FT                   YRHLPYVGKVVVLDE"
FT   gene            complement(201828..202490)
FT                   /locus_tag="SeHA_C0195"
FT   CDS_pept        complement(201828..202490)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0195"
FT                   /product="carbonate dehydratase"
FT                   /note="identified by match to protein family HMM PF00484"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0195"
FT                   /db_xref="EnsemblGenomes-Tr:ACF67458"
FT                   /protein_id="ACF67458.1"
FT                   /translation="MKDIDTLISNNALWSKMLVEEDPGFFEKLAQAQKPRFLWIGCSDS
FT                   RVPAERLTGLEPGELFVHRNVANLVIHTDLNCLSVVQYAVDVLEVEHIIICGHSGCGGI
FT                   KAAVENPELGLINNWLLHIRDIWLKHSSLLGKMPEEQRLDALYELNVMEQVYNLGHSTI
FT                   MQSAWKRGQNVTIHGWAYSINDGLLRDLDVTATNRETLENGYHKGISALSLKYIPHQ"
FT   gene            202599..203525
FT                   /locus_tag="SeHA_C0196"
FT   CDS_pept        202599..203525
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0196"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0196"
FT                   /db_xref="EnsemblGenomes-Tr:ACF68116"
FT                   /protein_id="ACF68116.1"
FT                   /translation="MTIALELQQLKKTYPGGVQALRGIDLQVEAGDFYALLGPNGAGKS
FT                   TTIGIISSLVNKTSGRVNVFGYDLEKDVVNAKRQLGLVPQEFNFNPFETVQQIVVNQAG
FT                   YYGVEHKEAVLRSEKYLKQLDLWEKRHERARMLSGGMKRRLMIARALMHEPKLLILDEP
FT                   TAGVDIELRRSMWGFLKDLNAKGTTIILTTHYLEEAETLCRNIGIIQHGELVENTSMKN
FT                   LLSKLKSETFILDLAPKSPLPKLTGYQYRLVDTSTLEVEVLREQGVNSVFSQLSEQGVQ
FT                   VLSMRNKANRLEELFVSLVHEKQGDRA"
FT   gene            203522..204292
FT                   /locus_tag="SeHA_C0197"
FT   CDS_pept        203522..204292
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0197"
FT                   /product="ABC transporter, permease protein"
FT                   /note="identified by match to protein family HMM PF01061"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0197"
FT                   /db_xref="EnsemblGenomes-Tr:ACF69778"
FT                   /protein_id="ACF69778.1"
FT                   /translation="MMQLYWVALKSIWAKEIHRFMRIWVQTLVPPVITMTLYFIIFGNL
FT                   IGSRIGEMHGFSYMQFIVPGLIMMAVITNSYANVASSFFSAKFQRNIEELLVAPVPTHV
FT                   IIAGFVGGGVARGLCVGILVTAISLFFVPFQVHSWVFVALTLILTAILFSLAGLLNAVF
FT                   AKTFDDISLIPTFVLTPLTYLGGVFYSLTLLPPFWQGLSHLNPIVYMISGFRYGFLGIH
FT                   DVPLVTTFGVLVIFIAAFYLLCWSLIQRGRGLRS"
FT   gene            complement(204409..205488)
FT                   /locus_tag="SeHA_C0198"
FT   CDS_pept        complement(204409..205488)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0198"
FT                   /product="putative fimbrial protein precurosr"
FT                   /note="identified by match to protein family HMM PF00419"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0198"
FT                   /db_xref="EnsemblGenomes-Tr:ACF69298"
FT                   /protein_id="ACF69298.1"
FT                   /translation="MKNLWMLLALSLFSGHALADGTMGNGSGWCQPTSGTHNFFFPLDQ
FT                   TITDTDENQAGKIVKESWSVGGEYSARCDCDNKDYQGVNYFTATTGDLTQKGTYSEAGS
FT                   NGQQMDFYVLVAGKLEIGTETYIVGNLKQYIPVPFSAISNQDPTAGGCTGADINKMSAG
FT                   NKGNVRIYITHPLVGEITIPETTIMNLYLSKTPGSSGDNIPPSVPPMAHVTMSGTITVP
FT                   QSCSINAGQVIEVRLPDIEGKDIRHLGDSPQNSHVTTQVNFTCSNVADGTNLSMSLNGA
FT                   TDPHNPDYLKTDNENLGIRISDKYDNTIVPGGSAELPIEDYTDGRGSTEFTAAPVNTTG
FT                   HVPHTGEYQATATLEIQIR"
FT   gene            complement(205497..208043)
FT                   /locus_tag="SeHA_C0199"
FT   CDS_pept        complement(205497..208043)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0199"
FT                   /product="outer membrane usher protein FimD"
FT                   /note="identified by match to protein family HMM PF00577"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0199"
FT                   /db_xref="EnsemblGenomes-Tr:ACF69068"
FT                   /protein_id="ACF69068.1"
FT                   /translation="MRKRQHRVFYLSRCAVCIALGSTFAHVAWARDYFNPAFIENHGQA
FT                   SRTSVELSTFDNDKSQLPGTYYVTININKTEIGARNVDFQLATLSDGQQALQGCLRLQE
FT                   LKDNGVKTDLFPTLESEKGCVDLSVIPGASQRFDFQQQALSVSIPQLYIANNARGYVPP
FT                   EKWQEGITALMLNYSFSGYKEYGSSEDSDDAESKYLALQPGFNLGPWRFRNYSNWSSNN
FT                   GESGSWNSVYNYLQRDIIALKSQFTAGDSNTPSDVFDSVPFRGLQLTSDDQMQPNSQRG
FT                   YAPTIRGIARSNAQVIVRQNGYIAYQTAVSPGEFEINDMFPTGSNGDYDVTVKETDGSE
FT                   QHFIVPYSSLPILQRTGRTKYSVTVGKYRDYNNHTLDDFGQATLLYGLPWGITLYGGSQ
FT                   IASDKYQSVAFGVGQNMQMLGAISLDGIWSHAKFDDGRKEIGQSWRVRYSKGVVSTGTT
FT                   FSLAGYRYASENYNSLSEVINPDDDFYDNYGKRHNRFEASVNQQISNTLGSLTLSWVKE
FT                   DYWHSAQQMESLSASYNNSWGPVSYTLSYSYNKNTYQYRSDNDDDDNDDDRYNQNDRLF
FT                   TLSLHVPFTVFDSRLYASYMLNTRKHDATVNSTTLSGTALRDRNLNWSLQQSHSTQDGD
FT                   SGGVNASYKGTYANLNAGYNQSPDSQQVSYGISGGILAHENGITLSQPITGAAILIKAP
FT                   GASGVSVENQTGVATDFRGYTVIPNVTPYYRYDISLDSSTFADNVDIPLNNQTVYPTRN
FT                   AVVRAAYDTHKGYRVLLTLTRSNGEPVPFGATASVDGQDANLASIVGDKGQVFLSGLPE
FT                   EGLLLVNWGSASCRTDYRLDISKNMNGIVMANAVCQ"
FT   gene            complement(208070..208753)
FT                   /locus_tag="SeHA_C0200"
FT   CDS_pept        complement(208070..208753)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0200"
FT                   /product="chaperone protein FimC"
FT                   /note="identified by match to protein family HMM PF00345;
FT                   match to protein family HMM PF02753"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0200"
FT                   /db_xref="EnsemblGenomes-Tr:ACF67377"
FT                   /protein_id="ACF67377.1"
FT                   /translation="MNSLAKAGLLCCLLCGSLAHAAGINIGTTRVIFHGDAKDTSISIS
FT                   NNDNVPYLIQSWAQSISETGASGDAPFMVTPPLFRLNGGQKNVLRIIRTGGNLPEDRES
FT                   LYWLDIKSIPSSNPDNKHNTLMLAVKAEFKLIYRPKALTQKPEEVADRLTWSRQGRTLT
FT                   VKNPTPYYMNFATLSVGSQKVKAPRYVAPFGNAQYTLPAAASGTIVWSIINDFGGTGPE
FT                   HKQTP"
FT   gene            complement(208801..209343)
FT                   /locus_tag="SeHA_C0201"
FT   CDS_pept        complement(208801..209343)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0201"
FT                   /product="putative fimbrial subunit"
FT                   /note="identified by match to protein family HMM PF00419"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0201"
FT                   /db_xref="EnsemblGenomes-Tr:ACF70241"
FT                   /protein_id="ACF70241.1"
FT                   /translation="MKLTLKTLTVALAAITLSPAALADTAKDGTVHITGLIKQNACTVT
FT                   TDSIDVTLQDEFASLFTAAGQTAGDKGFTIDLENCDANIYSSVQARFEGTLDGTDATIL
FT                   KNEGGDATNIGVQILDNADTTMTFNDLQAWSAPVNLPTAEGVTELSMPFTARYISTAVP
FT                   VKSGTVEATATFYLQYN"
FT   gene            complement(209557..209670)
FT                   /locus_tag="SeHA_C0202"
FT   CDS_pept        complement(209557..209670)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0202"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0202"
FT                   /db_xref="EnsemblGenomes-Tr:ACF68440"
FT                   /protein_id="ACF68440.1"
FT                   /translation="MFFWPTTHYDHDHFLFKKFCIIFKIVSSLHRIWPIKG"
FT   gene            209712..210152
FT                   /locus_tag="SeHA_C0203"
FT   CDS_pept        209712..210152
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0203"
FT                   /product="PTS system, IIA component"
FT                   /note="identified by match to protein family HMM PF03610"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0203"
FT                   /db_xref="EnsemblGenomes-Tr:ACF66887"
FT                   /protein_id="ACF66887.1"
FT                   /translation="MLGWVISCHDDRAQEMLEGLEKKYGPLAQCRAVNFWRGLSVNMLS
FT                   RMMCDALHATDSGEGVIFLTDISGAAPYRVASLMSHKHSQCEVISGVSYSLMEEMIPWR
FT                   ESMSSSAFRDQIVALGAPDVTSLWHQQQKNPPFVLLHDSYEF"
FT   gene            210214..211443
FT                   /locus_tag="SeHA_C0204"
FT   CDS_pept        210214..211443
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0204"
FT                   /product="polysaccharide deacetylase domain protein"
FT                   /note="identified by match to protein family HMM PF01522"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0204"
FT                   /db_xref="EnsemblGenomes-Tr:ACF69734"
FT                   /protein_id="ACF69734.1"
FT                   /translation="MVMRVVLILLFFFAGNVLAALPARYMQTTKDAAIWSQIGDKMVTV
FT                   GNIRAGQILSVTPVAADYYAFKFGFGVGFIDKGHLESVQGKQKVEDGLGDLNKPLSNQN
FT                   LVTWKDTPVYNAPDISSAPFGVLVDNLRYPIISKLQGRLHQTWYQIRIGDRLAYVSAMD
FT                   AQEDNGIPILTYHHILRDEENTRFRHTSTTTSVRAFSNQMTWLRDRGYATLTMYQLEDY
FT                   IHNRANFPARAVVITFDDGLKSVSRYAYPVLKQYGMKATAFIISSRIKRHPQTWNPRSL
FT                   QFMSVSELRKISDVFDFQSHTHFLHRVDGHRRPILYSRSYHNILFDFERSRRALTQFTP
FT                   HVFYLSYPFGGYNATAIKAAKDAGFHLAVTTVRGKVKPGDNPMLLKRLYILRTDSLETM
FT                   SRLIVNQPQG"
FT   gene            complement(211445..212506)
FT                   /locus_tag="SeHA_C0205"
FT   CDS_pept        complement(211445..212506)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0205"
FT                   /product="putative fimbrial protein"
FT                   /note="identified by match to protein family HMM PF00419"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0205"
FT                   /db_xref="EnsemblGenomes-Tr:ACF65915"
FT                   /protein_id="ACF65915.1"
FT                   /translation="MKLFPYLAALLLLSASGVAYGALECKFYNGDTRQIMSPGVQPIIT
FT                   FHPSVQTATLLASGITMELTPEMHSHCAVGDDGENIYQMTDNTLLEGYVDGKALFRTNI
FT                   PGITYAIGLYPAGKGITGWFPVNPGQYYMTAYADDNEGYFEHEKKWYAVMEIYQMPGFN
FT                   GVPSGVGFISSIGGPLGHIVLGDPIGSESDHPRPLITISDMMFNIPFSEPTCILTAPTT
FT                   VNLGDWYRSDVEKDQTTEVPFQITGTCTGTIEVSFVAKSSYTNADKNLFTNSITSNSNV
FT                   TAAGGVGVKISSPAYSQIHADSSPEVIAVGDIIGRPVTSVNANFKAKLVKTGTEAVTPG
FT                   IFGSSVTFQVTYE"
FT   gene            complement(212518..213117)
FT                   /locus_tag="SeHA_C0206"
FT   CDS_pept        complement(212518..213117)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0206"
FT                   /product="putative fimbrial protein"
FT                   /note="identified by match to protein family HMM PF00419"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0206"
FT                   /db_xref="EnsemblGenomes-Tr:ACF66415"
FT                   /protein_id="ACF66415.1"
FT                   /translation="MQQLLFLLRQPSLMLLMGLTGGFWSGISQAGSNLDINLTASIVNS
FT                   TCKLSLENGGEVYLPNVTRAWFYNNDGSSKYAPTDEAGGTPFNVRLEDCADNSSIKQLM
FT                   FSFTPQSGFWSNQNQVFKNDATTGAAQNVGIVIFSADYKTNVLNSDGSSNVVYDVSGKS
FT                   SSLYLTDYQFYARYQNTGAVVSGVVTSNVLVDVSYE"
FT   gene            complement(213136..213693)
FT                   /locus_tag="SeHA_C0207"
FT   CDS_pept        complement(213136..213693)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0207"
FT                   /product="putative fimbrial protein"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0207"
FT                   /db_xref="EnsemblGenomes-Tr:ACF68323"
FT                   /protein_id="ACF68323.1"
FT                   /translation="MKFTSALITLSVSAVLFSGMGRAAITGTDSVQMTFKTTVTTGTCK
FT                   AIVVNGDGKNVSTIGYGETYKSDLNKKAMPLSIVFSNCSGVTIAEVEAKAGTGGTCSGD
FT                   NLDGDSYAAGLNTAFEIWGGDADTGVKLSCKTPPAAQEVTITNGAGTYPMTSRIVVANG
FT                   KSLSDVTAGDVTAPVTFVVTYP"
FT   gene            complement(213720..214247)
FT                   /locus_tag="SeHA_C0208"
FT   CDS_pept        complement(213720..214247)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0208"
FT                   /product="putative fimbrial protein"
FT                   /note="identified by match to protein family HMM PF00419"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0208"
FT                   /db_xref="EnsemblGenomes-Tr:ACF66768"
FT                   /protein_id="ACF66768.1"
FT                   /translation="MAASGSALAANSTNLDVNFTATIKETTCDMKLVGGTGSDTVQELI
FT                   IGNSSGEVRIDDVRAGTATADFKLVIVECPASLQSLKTSINGTPSGFSTKILTNGIKGS
FT                   ADYIGVSVARASKPDEPFVINSTADSERLVWSEVEINSKEVPLIAIMKETKANSATTGA
FT                   FSAVATFVFSYE"
FT   gene            complement(214327..216924)
FT                   /locus_tag="SeHA_C0209"
FT   CDS_pept        complement(214327..216924)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0209"
FT                   /product="outer membrane usher protein HtrE"
FT                   /note="identified by match to protein family HMM PF00577"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0209"
FT                   /db_xref="EnsemblGenomes-Tr:ACF68467"
FT                   /protein_id="ACF68467.1"
FT                   /translation="MLFQRSLLCLTIGAALPFSVSAANSAAEKTVVESDEAVEFNEQFL
FT                   LNSSANIDISRYAYGNPVLAGTYRVKVNLNNALKSTSEITFNENGTPRASACLTPLLLT
FT                   QAGVDPAAMRDDVEVDDNTTCLDIKKYYPGATANYDSGKQAMDLNFPQIYILKRPAGYV
FT                   DPSLWEDGVPAAIVSYDMNAWHSEGNGTTSDTAYVGLRYGLNMGPWRLRSRGSLNWNKD
FT                   TGSEYNNQDVYLQRDITALKAQMVIGDSYTRGDAFDSFSLSGIRMYNDDRMLPMGSSNY
FT                   APVIRGVANSNAKVTVMQSGNKIYETTVPPGAFEINDLSTTGYGNDLLVTVEEADGSKR
FT                   SFTVPFSSVTQMLRPGATRWDIGVGELNDDSLHDKPQVGYAQFYYGLNNTFTGYIGAQY
FT                   TDMNFYAGLLGLAMNTGIGAFAFDVTQSHASIDDLGTLSGQSYRLTYSKMLEATNTSFN
FT                   VAAYRFSTEDYLSLNDAASLQDSVKHQQYAQQSYRSGNELYDDYQRTKNQVQISINQPL
FT                   NQGETTWGSVYVSGTWQDYWNDAGSTANYSVGYNNSFAYGSYSVSLQRAYDQNGSKDDS
FT                   VYLSFSIPLSMFSPDGERSGGFSNINMGLRSDMKGGTNVNSTASGNTKDSDISYSVSAT
FT                   SSSGNYGNLNQVSGFGSLNSSYGPLGLSASFGDDNSQQYSASYSGGMVLHSGGVAFAPG
FT                   SIGETDAVALVKASGAQGAGLGYSSSEIGSSGYGILPYMSAYRENRVSLDISTLEKDVE
FT                   IKSTSTVTVPRSGAVVLVNFETDEGRSLILELLRSDKGFIPLGADVLNEKNETVGTVGQ
FT                   AGQAYVRGVEPQGELRVVWGSGKESTCTVRYQLAEITVKAGLTPVLNNQLCHM"
FT   gene            complement(216992..217744)
FT                   /locus_tag="SeHA_C0210"
FT   CDS_pept        complement(216992..217744)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0210"
FT                   /product="chaperone protein EcpD"
FT                   /note="identified by match to protein family HMM PF00345"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0210"
FT                   /db_xref="EnsemblGenomes-Tr:ACF70476"
FT                   /protein_id="ACF70476.1"
FT                   /translation="MVNTVITKGFKTTCFAAAAFTAFATFQVNADIVISGTRIVYPASS
FT                   KDVIVNLDNRGNKPLLVQTWLDDGRDGVDPQELKLPFVITPPVSRIDPQKGQSLRITYM
FT                   GSALPQDRESLFWFNVLEIPPKSKAKEGESLNQLQLAFRTRIKLFFRPDGLKGTPGDAA
FT                   ANLKWSQKKEGNTLSLFAQNDSAYNVSISNVKLKVGGKEYTVDSKSVLPFSGVSMPVKG
FT                   LSNNINGTVIYNTINDNGGTNKREAKID"
FT   gene            complement(217831..218436)
FT                   /locus_tag="SeHA_C0211"
FT   CDS_pept        complement(217831..218436)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0211"
FT                   /product="major fimbrial subunit"
FT                   /note="identified by match to protein family HMM PF00419"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0211"
FT                   /db_xref="EnsemblGenomes-Tr:ACF67621"
FT                   /protein_id="ACF67621.1"
FT                   /translation="MFFRKYGVAAFIAMTLSAGSAMAADPDTGTITFHGLVSNNTCKIS
FT                   LDNKIDQDGNDFDITLDTVFVKNFATALGDNSTLGEKQFTLNLSECDNATVKDASAQFN
FT                   SWGGSSSTSGGLLVPPANLQGAAENVNLVLANNGNGATDLIKIDQTNNTQKATISADGT
FT                   GDLFYRVAYTQGQKWNADTSPVTAGTVQAQVAFTVIYN"
FT   gene            complement(218714..219094)
FT                   /gene="panD"
FT                   /locus_tag="SeHA_C0212"
FT   CDS_pept        complement(218714..219094)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="panD"
FT                   /locus_tag="SeHA_C0212"
FT                   /product="aspartate 1-decarboxylase"
FT                   /EC_number="4.1.1.11"
FT                   /note="identified by match to protein family HMM PF02261;
FT                   match to protein family HMM TIGR00223"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0212"
FT                   /db_xref="EnsemblGenomes-Tr:ACF67092"
FT                   /db_xref="GOA:B4TK03"
FT                   /db_xref="InterPro:IPR003190"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4TK03"
FT                   /protein_id="ACF67092.1"
FT                   /translation="MIRTMLQGKLHRVKVTQADLHYEGSCAIDQDFLDASGILENEAID
FT                   IWNVTNGKRFSTYAIAAERGSRIISVNGAAAHCAEVGDIVIIASFVTMSDEEARTWRPK
FT                   VAYFEGDNEMKRTAKAIPVQVA"
FT   gene            complement(219189..220043)
FT                   /gene="panC"
FT                   /locus_tag="SeHA_C0213"
FT   CDS_pept        complement(219189..220043)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="panC"
FT                   /locus_tag="SeHA_C0213"
FT                   /product="pantoate--beta-alanine ligase"
FT                   /EC_number="6.3.2.1"
FT                   /note="identified by match to protein family HMM PF02569;
FT                   match to protein family HMM TIGR00018; match to protein
FT                   family HMM TIGR00125"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0213"
FT                   /db_xref="EnsemblGenomes-Tr:ACF67832"
FT                   /db_xref="GOA:B4TK04"
FT                   /db_xref="InterPro:IPR003721"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR042176"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4TK04"
FT                   /protein_id="ACF67832.1"
FT                   /translation="MLIIETLPLLRQHIRRLRQEGKRVALVPTMGNLHDGHMKLVDEAK
FT                   ARADVVIVSIFVNPMQFDRPDDLVRYPRTLQEDCEKLNKRKVDYVFAPAVEEIYPHGLE
FT                   GQTYVDVPGLSTMLEGASRPGHFRGVSTIVSKLFNLIQPDIACFGEKDFQQLALIRKMV
FT                   ADMSYDIEIVGVPIIRAKDGLALSSRNAYLTAEQRKIAPGLYNVMNSIAEKLIAGNREL
FT                   QEIIAIAEQELNEKGFRADDIQIRDADTLQELTETSKRAVILAAAWLGQARLIDNQSVT
FT                   LAQ"
FT   gene            complement(220169..220960)
FT                   /gene="panB"
FT                   /locus_tag="SeHA_C0214"
FT   CDS_pept        complement(220169..220960)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="panB"
FT                   /locus_tag="SeHA_C0214"
FT                   /product="3-methyl-2-oxobutanoate hydroxymethyltransferase"
FT                   /EC_number="2.1.2.11"
FT                   /note="identified by match to protein family HMM PF02548;
FT                   match to protein family HMM TIGR00222"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0214"
FT                   /db_xref="EnsemblGenomes-Tr:ACF67119"
FT                   /db_xref="GOA:B4TK05"
FT                   /db_xref="InterPro:IPR003700"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4TK05"
FT                   /protein_id="ACF67119.1"
FT                   /translation="MKPTTISLLQKCKQEKKRFATITAYDYSFAKLFADEGINVMLVGD
FT                   SLGMTIQGHDSTLPVTVEDIAYHTRAVRRGAPNCLLLSDLPFMAYATPEQACENAAIVM
FT                   RAGANMVKIEGGAWLVDTVKMLTERAVPVCGHLGLTPQSVNIFGGYKIQGRGDAGQVLL
FT                   DDALALEAAGAQLLVLECVPVELAKRVTEALSIPVIGIGAGNVTDGQILVMHDAFGITG
FT                   GHIPKFAKNFLAEAGDMRAAVQQYMAEVESGVYPGEEHSFH"
FT   gene            complement(221081..221560)
FT                   /gene="folK"
FT                   /locus_tag="SeHA_C0215"
FT   CDS_pept        complement(221081..221560)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folK"
FT                   /locus_tag="SeHA_C0215"
FT                   /product="2-amino-4-hydroxy-6-hydroxymethyldihydropteridine
FT                   pyrophosphokinase"
FT                   /EC_number="2.7.6.3"
FT                   /note="identified by match to protein family HMM PF01288;
FT                   match to protein family HMM TIGR01498"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0215"
FT                   /db_xref="EnsemblGenomes-Tr:ACF66770"
FT                   /protein_id="ACF66770.1"
FT                   /translation="MTIAYIALGSNLASPLEQVNAALKAIANIPDSRIVAVSSFYRTPP
FT                   LGPQDQPDYLNAAVALDTALAPEELLNHTQRIELQQGRVRKAERWGPRTLDLDIMLFGD
FT                   EVINTDRLTVPHYDMKNRGFMLWPLFEIAPDLIFPDGISLHQHLTHLGAAKPAHW"
FT   gene            complement(221557..222870)
FT                   /locus_tag="SeHA_C0216"
FT   CDS_pept        complement(221557..222870)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0216"
FT                   /product="poly(A) polymerase (PAP) (Plasmid copy number
FT                   protein)"
FT                   /EC_number="2.7.7.19"
FT                   /note="identified by match to protein family HMM PF01743;
FT                   match to protein family HMM TIGR01942"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0216"
FT                   /db_xref="EnsemblGenomes-Tr:ACF66098"
FT                   /protein_id="ACF66098.1"
FT                   /translation="MTIIPREQHAISRKDISENALKVLYRLNKAGYEAYLVGGGVRDLL
FT                   LGKKPKDFDVTTNATPDQVRKLFRNCRLVGRRFRLAHVMFGPEIIEVATFRGHHEGSES
FT                   DRTTSQRGQNGMLLRDNIFGSIEEDAQRRDFTINSLYYSVADFTVRDYVGGMQDLQEGV
FT                   IRLIGNPETRYREDPVRMLRAVRFAAKLNMHISPETAEPIPRLATLLNDIPPARLFEES
FT                   LKLLQAGNGYETYQQLREYHLFQPLFPTITRYFTENGDSAMERIIAQVLKNTDNRIRNE
FT                   MRVNPAFLFAAMFWYPLLEMAQKIAQESGLAYYDAFALAMNDVLDEACRSLAIPKRLTT
FT                   LTRDIWQLQLRMSRRQGKRAWKLMEHPKFRAAFDLLELRAQVENNTELQRLAQWWAEFQ
FT                   ASAPPEQKGMLNELDDDPAPRRRRSRPRKRAPRREGTV"
FT   gene            complement(223116..224057)
FT                   /locus_tag="SeHA_C0217"
FT   CDS_pept        complement(223116..224057)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0217"
FT                   /product="glutamyl-Q tRNA"
FT                   /EC_number="6.1.1.-"
FT                   /note="identified by match to protein family HMM PF00749"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0217"
FT                   /db_xref="EnsemblGenomes-Tr:ACF70426"
FT                   /protein_id="ACF70426.1"
FT                   /translation="MTGGSFPALFFIARSMTDSHYIGRFAPSPSGELHFGSLIAALGSY
FT                   LQARAQRGIWRVRIEDIDPPREVPGAAATILRQLEHYGLHWDGEVLWQSQRHEAYREAL
FT                   AWLHEQGLSYYCTCPRSRIQRLGGIYDGHCRTLCHGPENAAVRIKQQHPVMRFHDALRG
FT                   DIQADPQLASEDFIIHRRDGLFAYNLAVVVDDHFQGVTEIVRGADLIEPTVRQLSLYKQ
FT                   FGWRAPGYVHLPLALNEQGAKLSKQNHAPALATGDPRPVLVQALRFLGQRDVVAWQEMS
FT                   VEELLRFAVTHWRLTAVPTSANVNPAFSNASR"
FT   gene            complement(224081..224536)
FT                   /gene="dksA"
FT                   /locus_tag="SeHA_C0218"
FT   CDS_pept        complement(224081..224536)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dksA"
FT                   /locus_tag="SeHA_C0218"
FT                   /product="RNA polymerase-binding protein DksA"
FT                   /note="identified by match to protein family HMM PF01258;
FT                   match to protein family HMM TIGR02420"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0218"
FT                   /db_xref="EnsemblGenomes-Tr:ACF67280"
FT                   /protein_id="ACF67280.1"
FT                   /translation="MQEGQNRKTSSLSILAIAGVEPYQEKPGEEYMNEAQLSHFKRILE
FT                   AWRNQLRDEVDRTVTHMQDEAANFPDPVDRAAQEEEFSLELRNRDRERKLIKKIEKTLK
FT                   KVEDEDFGYCESCGVEIGIRRLEARPTADLCIDCKTLAEIREKQMAG"
FT   gene            complement(224713..225417)
FT                   /gene="sfsA"
FT                   /locus_tag="SeHA_C0219"
FT   CDS_pept        complement(224713..225417)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sfsA"
FT                   /locus_tag="SeHA_C0219"
FT                   /product="sugar fermentation stimulation protein"
FT                   /note="identified by match to protein family HMM PF03749;
FT                   match to protein family HMM TIGR00230"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0219"
FT                   /db_xref="EnsemblGenomes-Tr:ACF70333"
FT                   /db_xref="GOA:B4TK10"
FT                   /db_xref="InterPro:IPR005224"
FT                   /db_xref="InterPro:IPR040452"
FT                   /db_xref="InterPro:IPR041465"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4TK10"
FT                   /protein_id="ACF70333.1"
FT                   /translation="MLFSPPLQRATLIQRYKRFLADVITPDGTTLTLHCPNTGAMTGCA
FT                   TPGDTVWYSTSENTKRKYPHTWELTETQSGAFICVNTLRANQLTKEAIQENRLPALAGY
FT                   NILKSEVKYGAERSRIDFMLQADFRPDCYIEVKSVTLAEKENGYFPDAITERGQKHLRE
FT                   LMGVAAAGHRAVVVFAVLHSAITRFSPARHIDIKYAQLLSEAQNKGVEVLAYKAELSAQ
FT                   KMELNEPVPITL"
FT   gene            complement(225434..225964)
FT                   /locus_tag="SeHA_C0220"
FT   CDS_pept        complement(225434..225964)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0220"
FT                   /product="2'-5' RNA ligase"
FT                   /EC_number="6.5.1.-"
FT                   /note="identified by match to protein family HMM PF02834;
FT                   match to protein family HMM TIGR02258"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0220"
FT                   /db_xref="EnsemblGenomes-Tr:ACF69652"
FT                   /protein_id="ACF69652.1"
FT                   /translation="MSEPKRLFFAIDLPDDARAQIIAWRAAHFASEDGRPVAAANLHLT
FT                   LAFLGDVSSDKQRALAQLAGRIRQPGFTLHLDDAGQWLRSRVVWLGMRQPPRGLLQLAN
FT                   MLRAQAARSGCYQSPQPFHPHITLLRDASHTVAIPPPGFCWSFPVTSFALYASSYGQGR
FT                   TRYAELQRWTLGE"
FT   gene            225992..228466
FT                   /gene="hrpB"
FT                   /locus_tag="SeHA_C0221"
FT   CDS_pept        225992..228466
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hrpB"
FT                   /locus_tag="SeHA_C0221"
FT                   /product="ATP-dependent helicase HrpB"
FT                   /EC_number="3.6.1.-"
FT                   /note="identified by match to protein family HMM PF00270;
FT                   match to protein family HMM PF00271; match to protein
FT                   family HMM PF04408; match to protein family HMM PF08482;
FT                   match to protein family HMM TIGR01970"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0221"
FT                   /db_xref="EnsemblGenomes-Tr:ACF69273"
FT                   /protein_id="ACF69273.1"
FT                   /translation="MLQCGAKKVNPVEPFVTSLPVAAVLPELLTALKTAPQVLLSAPTG
FT                   AGKSTWLPLQLLQQGPVAGKILLLEPRRLAARNVAQRLAEALNEKPGETVGYRMRAQSC
FT                   VGPRTRLEVVTEGVLTRMIQRDPELRGVGLVILDEFHERSLQADLALALLLDIQQGLRD
FT                   DLRLLIMSATLDNDRLCQRLPDAPTIVSEGRAFPVERRYQPLAAHLRFDEAVAMATAEL
FT                   LRNENGSLLLFLPGVGEIQRVHEHLASRVGSDVLLCPLYGALSLEAQRKAIVPAPAGMR
FT                   KVVLATNIAETSLTIEGIRLVVDSAQERVARFDARTGLTRLVTQRISQASMTQRAGRAG
FT                   RLAPGICLHLLAKEQAERAAAQSDPEILHSDLSGLLMEVLQWGCHDPTSLFWLDRPPEV
FT                   NLQAARRLLLMLGALEGERLSARGRKMAAMGNDPRLAAMLVNADEGDSAATAAMLAAIL
FT                   EDPPRGGGTDLSVVFSRRQPGWQQRSQQLLKRLQVRNGEPDSALIMPLLARAFSDRIAR
FT                   RRGQEGRYQLANGMGAMLDADDALGRHEWLIAPLLLQGSASPDARILLAQPLDIASLIQ
FT                   ACPDLLRQSDTVEWDEAQGTLKAWRRMRIGQLTVSVQPLAKPSEEELHQAMLNGIRDKG
FT                   LSVLNWTPEAEQFRLRLHCAAKWLPEYDWPAVDEASLLATLENWLLPHMTGVQSLRSLK
FT                   SLNVTQALRGLLDYAMLQRLDSELPGHYTVPTGSRITIRYHEDNPPALAVRMQEMFGEA
FT                   KTPTIAQGRVPLVLELLSPAQRPLQITRDLSAFWQGAYREVQKEMKGRYPKHVWPDDPA
FT                   NTAPTRRTKKYS"
FT   gene            228607..231129
FT                   /gene="mrcB"
FT                   /locus_tag="SeHA_C0222"
FT   CDS_pept        228607..231129
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mrcB"
FT                   /locus_tag="SeHA_C0222"
FT                   /product="penicillin-binding protein 1B"
FT                   /note="identified by match to protein family HMM PF00905;
FT                   match to protein family HMM PF00912; match to protein
FT                   family HMM TIGR02071"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0222"
FT                   /db_xref="EnsemblGenomes-Tr:ACF68628"
FT                   /protein_id="ACF68628.1"
FT                   /translation="MAGNDREPIGRKGKPSRPVKQKVSRRRQHDDDYDDDYEDEEPMPR
FT                   KGKGKGRKPRGKRGWLWLLLKLFIVFVVLFAIYGVYLDQKIRSRIDGKVWQLPAAVYGR
FT                   MVNLEPDMPVSKNEMVKLLEATQYRLVTKMTRPGEFTVQANSIEMIRRPFDFPDSKEGQ
FT                   VRARLTFSDGRLETIVNLDNNRQFGFFRLDPRLITMLSSPNGEQRLFVPRSGFPDLLVD
FT                   TLLATEDRHFYEHDGISLYSIGRAVLANLTAGRTVQGASTLTQQLVKNLFLSSERSYWR
FT                   KANEAYMALIMDARYSKDRILELYMNEVYLGQSGDNEIRGFPLASLYYFGRPVEELSLD
FT                   QQALLVGMVKGASIYNPWRNPKLALERRNLVLRLLQQQKIIDQELYDMLSARPLGVQPR
FT                   GGVISPQPAFMQMVRQELQAKLGDKIKDLSGVKIFTTFDSVAQDAAEKAVVEGIPALKK
FT                   QRKLSDLETAMVVVDRFSGEVRAMVGGAEPQYAGYNRAMQARRSIGSLAKPATYLTALS
FT                   QPNLYRLNTWIADAPISLRQPNGQVWSPQNDDHRYSESGKVMLVDALTRSMNVPTVNLG
FT                   MALGLPAVTDTWTKLGVPKDQLNPVPAMLLGALNLTPIEVAQAFQTIASGGNRAPLSAL
FT                   RSVIAEDGKVLYQSYPQAERAVPAQAAYLTLWTMQQVVQRGTGRQLGAKYPGLHLAGKT
FT                   GTTNNNVDTWFAGIDGSQVTITWVGRDNNQPTKLYGASGAMAIYQRYLANQTPTPLVLT
FT                   PPEDVVDMGVDYDGNFVCSGGMRTLPVWTDDPNTLCQQGEMMQQQQQPSGNPFDQSSQP
FT                   QQPAQQQPPKEEKSDGVAGWIKEMFGGN"
FT   gene            complement(231268..231408)
FT                   /locus_tag="SeHA_C0223"
FT   CDS_pept        complement(231268..231408)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0223"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0223"
FT                   /db_xref="EnsemblGenomes-Tr:ACF69302"
FT                   /protein_id="ACF69302.1"
FT                   /translation="MKVNDNVNDNYYYNRSMIGEISSQWQAIRGPTKTKGLRNNQMKRK
FT                   G"
FT   gene            231422..233665
FT                   /gene="fhuA"
FT                   /locus_tag="SeHA_C0224"
FT   CDS_pept        231422..233665
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fhuA"
FT                   /locus_tag="SeHA_C0224"
FT                   /product="ferrichrome-iron receptor"
FT                   /note="identified by match to protein family HMM PF00593;
FT                   match to protein family HMM PF07715; match to protein
FT                   family HMM TIGR01783"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0224"
FT                   /db_xref="EnsemblGenomes-Tr:ACF68652"
FT                   /protein_id="ACF68652.1"
FT                   /translation="MARLKTAQPNSSLRKIAVVVATAVSGMSVYAQAAVQPKEETITVT
FT                   AAPAAQESAWGPAATIAARQSATATKTDTPIQKVPQPISVVTAEEMALHQPKSVKEALS
FT                   YTPGVAVGTRGASNTYDYLIIRGFAADGQSQNNYLNGLKMQGNFYNDAVIDPYMLERAE
FT                   VMRGPVSVLYGKSSPGGLLNMVSKRPTTEPLKEIQFKMGTDSLFQTGFDFSDALDEEGV
FT                   YSYRLTGLARSANAQQDRAEEQRYAIAPAFTWRPDDKTNFTFLSYFQNEPETGYYGWLP
FT                   KEGTVEPLPNGKRLPTDFNEGAKNNTYSRNEKMVGYSFDHEFNDIFTVRQNLRYAENKV
FT                   SQNSVYGYGVCSDPANGYSKQCAALAPADKGHYLARKYVVDDEKLQNFSVDTQLQSKFA
FT                   TGEVDHTLLTGVDFMRMRNDINAWFGYDDSVPLLDLYNPVYTDFDFASRDPATSGPYQI
FT                   LNKQKQTGLYVQDQAQWDKVLVTLGGRYDWADQESLNRTTGITSKRDDKQFTWRGGVNY
FT                   LFDNGITPYFSYSESFEPASQTGENGKIFAPSKGKQYEAGVKYVPNDRPIVITGAVYQL
FT                   TKTNNLMADPAGSFFSVEGGEIRARGVELEAKAALSASINVVGSYTYTDAEYTTDTTYK
FT                   GNTPAQVPKHMASLWGDYTFFDGPLSGLTLGTGGRFTGSSYGDPANSFKVGSYTVVDAL
FT                   VRYDLARVGMAGSNVALHVNNLFDREYVASCFQTYGCFWGAERQVVATATFRF"
FT   gene            233714..234511
FT                   /gene="fhuC"
FT                   /locus_tag="SeHA_C0225"
FT   CDS_pept        233714..234511
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fhuC"
FT                   /locus_tag="SeHA_C0225"
FT                   /product="ferrichrome transport ATP-binding protein FhuC"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0225"
FT                   /db_xref="EnsemblGenomes-Tr:ACF67730"
FT                   /protein_id="ACF67730.1"
FT                   /translation="MQENHIHSDTTFALRSVAFRVPGRTLLHPLSLTFPAGRVTGLIGH
FT                   NGSGKSTLLKMLGRHQPPSEGDILLDNQPLASWSSKAFARKVAYLPQQLPQAEGMTVRE
FT                   LVAIGRYPWHGALGRFGVADREKVDEAITLVGLKPLAHRLVDSLSGGERQRAWIAMLVA
FT                   QDSRCLLLDEPTSALDIAHQVDVLALVHRLSQQRGLTVVAVLHDINMAARYCDYLVALR
FT                   GGEMIAQGTPAELMRSDTLEQIYGIPMGILPHPAGAAPVSFVY"
FT   gene            234511..235401
FT                   /locus_tag="SeHA_C0226"
FT   CDS_pept        234511..235401
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0226"
FT                   /product="ferrichrome-binding periplasmic protein"
FT                   /note="identified by match to protein family HMM PF01497"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0226"
FT                   /db_xref="EnsemblGenomes-Tr:ACF67234"
FT                   /protein_id="ACF67234.1"
FT                   /translation="MRDLYPLTRRRLLTAMALSPLLWQMNMAQAAAIDPRRIVALEWLP
FT                   VELLLALGITPYGVADVPNYKLWVSEPPLPDSVIDVGLRTEPNLELLTEMKPSFMVWSA
FT                   GYGPSPEKLARIAPGRGFDFSDGKKPLAVARRSLVELAQTLNLEAAAEKHLAQYDRFIA
FT                   SQKPHFIRRGGRPLLMTTLIDPRHMLVLGPNCLFQEVLDEYGIVNAWQGETNFWGSTAV
FT                   SIDRLAMYKEADVICFDHGNNTDMNALMATPLWQAMPFVRAGRFHRVPAVWFYGATLST
FT                   MHFVRILDNVLGGKA"
FT   gene            235398..237455
FT                   /locus_tag="SeHA_C0227"
FT   CDS_pept        235398..237455
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0227"
FT                   /product="ferrichrome transport system permease protein
FT                   FhuB"
FT                   /note="identified by match to protein family HMM PF01032;
FT                   match to protein family HMM TIGR01409"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0227"
FT                   /db_xref="EnsemblGenomes-Tr:ACF66668"
FT                   /protein_id="ACF66668.1"
FT                   /translation="MSRKREMPDGGAKSALSDLRFGRFVGRIRRSRHPALLLLALFVAA
FT                   CWLTWVNFSVALPRSQWQQAIWSPDIDIIEQMIFHYSLLPRLAISLLVGAGLGLVGVLF
FT                   QQVLRNPLAEPTTLGVATGAQLGITVTTLWAIPGALATQFAALTGACIVGALVFGVAWG
FT                   KRLSPVTLILAGLVVSLYCGAINQLLVIFHHDQLQSMFLWSTGTLTQTDWSGVQRLWPQ
FT                   LLGGVMLTLLLLRPMTLMGLDDGVARNLGLALSLARLAALSLAIVLSALLVNAVGIIGF
FT                   IGLFAPLLAKMLGARRLLARLMLAPLIGALILWLSDQIILWLTRVWMEVSTGSVTALIG
FT                   APLLLWLLPRLKSMSAPDMNASDRVAAERRHVLAFAVAGGALLLLATWGALSFGRDAHG
FT                   WTWASGTLLEELMPWRWPRILAALMAGVMLAVAGCIIQRLTGNPMASPEVLGISSGAAF
FT                   GLVLMLFLVPGNAFGWLLPAGSLGAAATLLIIMLAAGRGGFSPQRMLLAGMALSTAFTM
FT                   LLMMLQASGDPRMAEVLTWIAGSTYNATGGQVTRTAIVMVILLAIVPLCRRWLTILPLG
FT                   GDAARAVGMALTPSRIALLALAACLTATATMTIGPLSFVGLMAPHIARMLGFRRTMPHM
FT                   VISALAGGVLLVFADWCGRMALFPYQIPAGLLSSFIGAPYFIYLLRKQSR"
FT   gene            complement(237643..237756)
FT                   /locus_tag="SeHA_C0228"
FT   CDS_pept        complement(237643..237756)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0228"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0228"
FT                   /db_xref="EnsemblGenomes-Tr:ACF66153"
FT                   /protein_id="ACF66153.1"
FT                   /translation="MPQFIINVSGLDMLKLVTLFRRQQRATEIAHDLSIQK"
FT   gene            complement(237854..237985)
FT                   /locus_tag="SeHA_C0229"
FT   CDS_pept        complement(237854..237985)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0229"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0229"
FT                   /db_xref="EnsemblGenomes-Tr:ACF68138"
FT                   /protein_id="ACF68138.1"
FT                   /translation="MLNYIFFVYSWQLIYFNRVVFYYFDKKNNILLSKFYNENLLLN"
FT   gene            238036..238209
FT                   /locus_tag="SeHA_C0230"
FT   CDS_pept        238036..238209
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0230"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0230"
FT                   /db_xref="EnsemblGenomes-Tr:ACF68804"
FT                   /protein_id="ACF68804.1"
FT                   /translation="MLYIQYCNSDLFLFILSCLLLFGLSRLACFVCFLNGKKYLLFNAD
FT                   DPLNKKHLSLGF"
FT   gene            238397..238957
FT                   /locus_tag="SeHA_C0231"
FT   CDS_pept        238397..238957
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0231"
FT                   /product="putative fimbrial subunit"
FT                   /note="identified by match to protein family HMM PF00419"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0231"
FT                   /db_xref="EnsemblGenomes-Tr:ACF66797"
FT                   /protein_id="ACF66797.1"
FT                   /translation="MNTAVKAAVAAALVMGVSSFANAAGSNTGTVTFTGTIEDSPCSIV
FT                   VGDEHQTVNLGHIGTGSLMGGKESSKVDFHIGLENCAFTTEKEASTVFSAIGNESSANP
FT                   GSVALMRIGGGEMAGSSIVIGNHLGSAIKLGDAYSENLTMNGSVAAAKQTLNFKAWVKG
FT                   DSAATTIDTGEFSSTVNFTISYL"
FT   gene            239043..241700
FT                   /locus_tag="SeHA_C0232"
FT   CDS_pept        239043..241700
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0232"
FT                   /product="fimbrial usher protein"
FT                   /note="identified by match to protein family HMM PF00577"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0232"
FT                   /db_xref="EnsemblGenomes-Tr:ACF67493"
FT                   /protein_id="ACF67493.1"
FT                   /translation="MAHYKKFRLSTLAAVVGIVLAVGPENSYAEAPIQFNTRFLDVKDD
FT                   ASLDLSRFSRKGYIMPGSYHLQVLVNQSQIAQDNVITYSVDNNDPDNTYPCLSPELVSL
FT                   LGLKPEIADKMIWINAGQCLQPDQLEGMETQTDLSQSTLTVIIPQAYLEYSDEEWDPPS
FT                   RWDEGIPGVLFDYNVNSQWRHAEHDDGDEYDISGNGTVGANLGAWRLRADWQANYRHEN
FT                   DSEDKDNFGSSSEQNWDWNRYYAWRAIPQLRAQLTLGEGSLESDIFDGFNYVGGSLITD
FT                   DQMLPPNLRGYAPDISGVARTNAKVTVTQRGRVIYESQVPAGPFRIQDINETVSGDLHV
FT                   KIEEQSGQVQEYDVSTASIPFLTRPGQVRYKLAAGRPQDWDHNMEGGFFTSAEASWGIA
FT                   NGWSLYGGAIGEQDYQALALGLGRDLALLGAFSVDVTHSRATLPEGSAYGDGTIQGNSF
FT                   RASYAKDFDDIDSRLTFAGYRFSEENYMTMDEFIDTHNDDNDRQRTGHDKEMYTLTYSQ
FT                   NFSAINVNAYINYTHRTYWNQPNQDSYNLTLSHYFDVGEVRGISLSVNGFRNEYDNERD
FT                   DGVYVSLSIPWGNNRTLSYNGSFSDDNNSNQVGYYERIDDRNNYQINAGRTDNGATLDG
FT                   YYRHQASYADIDVSANYQEGDYTSGGLNIQGGATLTAKGGALHRTSVNGGSRLLVDVGD
FT                   EANVPISGYSTPVYTNAFGKAVIVDVNDYYRNQVKIDITQLPEDAEAILSIAQATLTEG
FT                   AIGYRRMEVLSGKKAMGSIRLRDGGTPPFGAEVYNSRQQQLGIVGEGGSVYLIGINPGE
FT                   RLQVTWEGKTQCEAALPDPLPGDLFSGLLLPCIGDASSPEATQPEEKPLLQLHTQRRTS
FT                   STQPEALSSRYPTH"
FT   gene            241718..242470
FT                   /locus_tag="SeHA_C0233"
FT   CDS_pept        241718..242470
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0233"
FT                   /product="chaperone protein PapD"
FT                   /note="identified by match to protein family HMM PF00345"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0233"
FT                   /db_xref="EnsemblGenomes-Tr:ACF66082"
FT                   /protein_id="ACF66082.1"
FT                   /translation="MMSLKRYNLAAVLLLLLGGYGSAQAAIAPDRTRLVFRGEDKSISV
FT                   DLKNANSKLPYLAQSWVEDEKGVKITSPLIVVPPVQRIEPSAIGQVKIQGMPALASLPK
FT                   DRETLFYYNVREIPPQSDKPNTLQIALQTRIKVFYRPQALSKIDMQHPWQYKITLQRQG
FT                   NGYQVSNPTGYYVVLSNASNRMDGTPARGFSPLVIAPKSNVTLGGDASELGHSPVLTYV
FT                   NDYGARLPLIFNCTDNSCAVDEAKSRKS"
FT   gene            242489..243001
FT                   /locus_tag="SeHA_C0234"
FT   CDS_pept        242489..243001
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0234"
FT                   /product="putative minor fimbrial subunit"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0234"
FT                   /db_xref="EnsemblGenomes-Tr:ACF66726"
FT                   /protein_id="ACF66726.1"
FT                   /translation="MRQWRLRLGTVTCAAMLSAVSMPLAAGSKTVNMTLTIVVNAAPPC
FT                   TVTGGEVEFGNVLTTKVDGVNYRQAVGYSLSCNGRVSDYLKLQIQGNAVTINGEPVLQT
FT                   DVDGLGIRLQTATDGALVSPGNTQWLSFQYSGGSGPAIEAIPVKDNGVTLTGGAFNAGA
FT                   TLVVDYQ"
FT   gene            242998..243474
FT                   /locus_tag="SeHA_C0235"
FT   CDS_pept        242998..243474
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0235"
FT                   /product="fimbrial subunit"
FT                   /note="identified by match to protein family HMM PF00419"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0235"
FT                   /db_xref="EnsemblGenomes-Tr:ACF69465"
FT                   /protein_id="ACF69465.1"
FT                   /translation="MKKMALMVLISSSFAAQSAENLKFHGTLISPPNCTISHNQTIDVE
FT                   FGNMLISKIDGTRYAQNVPYEITCDSAVRDDTMTMTLTLSGSVTDFNQAAINTSVAGLG
FT                   IELRQNDQPFTLGSTITVNEQSAPVLKAIPVKKSGASLTEGDFDATATLQVDYQ"
FT   gene            243474..244004
FT                   /locus_tag="SeHA_C0236"
FT   CDS_pept        243474..244004
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0236"
FT                   /product="minor fimbrial subunit StfG"
FT                   /note="identified by match to protein family HMM PF00419"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0236"
FT                   /db_xref="EnsemblGenomes-Tr:ACF70057"
FT                   /protein_id="ACF70057.1"
FT                   /translation="MVKKQTLLHGVAFILWGTLILPVSAADNLHFSGSLVASPCTLTMQ
FT                   GADIAEVDFSSLDASDFIPGGQSARKPVVFELTDCDSALSNGVQVIFTGTEATGMRGIL
FT                   AIDSYSGASGIGIGIETLSGVPVGINNESGAVFTLVTGKNTLSLNAWVQRLPGEDLIPG
FT                   RFSASALATFEYL"
FT   gene            243991..244125
FT                   /locus_tag="SeHA_C0237"
FT   CDS_pept        243991..244125
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0237"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0237"
FT                   /db_xref="EnsemblGenomes-Tr:ACF68710"
FT                   /protein_id="ACF68710.1"
FT                   /translation="MSIYNENNTDFIFAADCRLWWFGIGQTHAESDVWEHHAILWYWP"
FT   gene            244208..244849
FT                   /locus_tag="SeHA_C0238"
FT   CDS_pept        244208..244849
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0238"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0238"
FT                   /db_xref="EnsemblGenomes-Tr:ACF66689"
FT                   /protein_id="ACF66689.1"
FT                   /translation="MARKGATATLLSWTGPDPAPTIVLRDFDNSISKSNCKNLPSSWNG
FT                   CGYYTVDITVQSDNYGCPWLAATHSTAEDLVSGETYSAPDTRSSVCPKIPVDTFDISWD
FT                   ANVSKQKTTLMLDATGGTVNRTLHTYLMEGGKLCDGSKFDDRGAYCRFVSSGITLNVLG
FT                   CDQSSVTTSAVDHPITDVELHDINVAVNTRNIGSGQFTSTCSFQYIIDEL"
FT   gene            complement(244947..246227)
FT                   /gene="hemL"
FT                   /locus_tag="SeHA_C0239"
FT   CDS_pept        complement(244947..246227)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemL"
FT                   /locus_tag="SeHA_C0239"
FT                   /product="glutamate-1-semialdehyde-2,1-aminomutase"
FT                   /EC_number="5.4.3.8"
FT                   /note="identified by match to protein family HMM PF00202;
FT                   match to protein family HMM TIGR00713"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0239"
FT                   /db_xref="EnsemblGenomes-Tr:ACF67312"
FT                   /db_xref="GOA:B4TK30"
FT                   /db_xref="InterPro:IPR004639"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4TK30"
FT                   /protein_id="ACF67312.1"
FT                   /translation="MSKSENLYSAARELIPGGVNSPVRAFTGVGGTPLFIEKADGAYLY
FT                   DVDGKAYIDYVGSWGPMVLGHNHPAIRNAVIEAAERGLSFGAPTEMEVKMAELVTNLVP
FT                   TMDMVRMVNSGTEATMSAIRLARGFTGRDKIIKFEGCYHGHADCLLVKAGSGALTLGQP
FT                   NSPGVPADFAKHTLTCTYNDLTSVRAAFEQYPQEIACIIVEPVAGNMNCVPPLPEFLPG
FT                   LRALCDEFGALLIIDEVMTGFRVALAGAQDYYGVVPDLTCLGKIIGGGMPVGAFGGRRD
FT                   VMDALAPTGPVYQAGTLSGNPIAMAAGFACLNEVAQPGIHETLDELTTRLAEGLCEAAQ
FT                   EAGIPLVVNHVGGMFGIFFTDAESVTCYQDVMACDVERFKRFFHLMLEEGVYLAPSAFE
FT                   AGFMSVAHSMDDINNTIDAARRVFATL"
FT   gene            246397..247818
FT                   /locus_tag="SeHA_C0240"
FT   CDS_pept        246397..247818
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0240"
FT                   /product="H(+)/Cl(-) exchange transporter ClcA (ClC-ec1)"
FT                   /note="identified by match to protein family HMM PF00654"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0240"
FT                   /db_xref="EnsemblGenomes-Tr:ACF67222"
FT                   /db_xref="GOA:B4TK31"
FT                   /db_xref="InterPro:IPR001807"
FT                   /db_xref="InterPro:IPR014743"
FT                   /db_xref="InterPro:IPR023861"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4TK31"
FT                   /protein_id="ACF67222.1"
FT                   /translation="MKTDTSTFLAQQIVRLRRRDQIRRLMQRDKTPLAILFMAAVVGTL
FT                   TGLVGVAFEKAVSWVQNMRIGALVQVADHAFLLWPLAFILSALLAMVGYFLVRKFAPEA
FT                   GGSGIPEIEGALEELRPVRWWRVLPVKFIGGMGTLGAGMVLGREGPTVQIGGNLGRMVL
FT                   DVFRMRSAEARHTLLATGAAAGLSAAFNAPLAGILFIIEEMRPQFRYNLISIKAVFTGV
FT                   IMSSIVFRIFNGEAPIIEVGKLSDAPVNTLWLYLILGIIFGCVGPVFNSLVLRTQDMFQ
FT                   RFHGGEIKKWVLMGGAIGGLCGILGLIEPEAAGGGFNLIPIAAAGNFSVGLLLFIFIAR
FT                   VVTTLLCFSSGAPGGIFAPMLALGTLLGTAFGMAAAVLFPQYHLEAGTFAIAGMGALMA
FT                   ASVRAPLTGIVLVLEMTDNYQLILPMIITCLGATLLAQFLGGKPLYSTILARTLAKQDA
FT                   EQAAKNQNAPAGENT"
FT   gene            247900..248244
FT                   /gene="yadR"
FT                   /locus_tag="SeHA_C0241"
FT   CDS_pept        247900..248244
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yadR"
FT                   /locus_tag="SeHA_C0241"
FT                   /product="iron-sulfur cluster assembly accessory protein
FT                   YadR"
FT                   /note="identified by match to protein family HMM PF01521;
FT                   match to protein family HMM TIGR00049"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0241"
FT                   /db_xref="EnsemblGenomes-Tr:ACF66298"
FT                   /db_xref="GOA:B4TK32"
FT                   /db_xref="InterPro:IPR000361"
FT                   /db_xref="InterPro:IPR016092"
FT                   /db_xref="InterPro:IPR017870"
FT                   /db_xref="InterPro:IPR023063"
FT                   /db_xref="InterPro:IPR035903"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4TK32"
FT                   /protein_id="ACF66298.1"
FT                   /translation="MSDDVALPLQFTDAAANKVKSLIADEDNPNLKLRVYITGGGCSGF
FT                   QYGFTFDDQVNEGDMTIEKQGVGLVVDPMSLQYLVGGSVDYTEGLEGSRFIVTNPNAKS
FT                   TCGCGSSFSI"
FT   gene            complement(248345..248968)
FT                   /locus_tag="SeHA_C0242"
FT   CDS_pept        complement(248345..248968)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0242"
FT                   /product="inner membrane protein YadS"
FT                   /note="identified by match to protein family HMM PF03458"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0242"
FT                   /db_xref="EnsemblGenomes-Tr:ACF66785"
FT                   /protein_id="ACF66785.1"
FT                   /translation="MLVYWLDIVGTAVFAISGVLLAGKLRMDPFGVLVLGVVTAVGGGT
FT                   IRDMALDNGPVFWVKDPTDLVVAMVTSMLTILLVRQPRRLPKWMLPVLDAVGLAVFVGI
FT                   GVNKAFLAETGPLVAVCMGVITGVGGGIIRDVLAREIPMILRTEIYATACIIGGIVHAT
FT                   AFYTFSVPLESASMMGMVVTLFIRLAAIRWHLKLPTFALDENGR"
FT   gene            complement(249005..249793)
FT                   /locus_tag="SeHA_C0243"
FT   CDS_pept        complement(249005..249793)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0243"
FT                   /product="cobalamin periplasmic binding protein"
FT                   /note="identified by match to protein family HMM PF01497"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0243"
FT                   /db_xref="EnsemblGenomes-Tr:ACF69386"
FT                   /protein_id="ACF69386.1"
FT                   /translation="MFRALVALLLTLPVWLYAAPRVITLSPANTELAFAAGITPVGVSS
FT                   YSDYPPEAQKIEQVSTWQGMNLERIVALKPDLVVAWRGGNAERQVNQLTSLGIKVMWVD
FT                   AVSIEQIADTLRQLAAWSPQPEKAQQAAQTLLNEYAALNAEYAGKAKKRVFLQFGMNPL
FT                   FTSGKGSIQHQVLTTCGGENVFADSRVPWPQVSREQVLARHPQAIIVAGKAGEILKIEQ
FT                   YWGNLLKIPVIPLNSDWFERASPRIILAAKQLCNALSQVN"
FT   gene            complement(249798..250496)
FT                   /gene="mtnN"
FT                   /locus_tag="SeHA_C0244"
FT   CDS_pept        complement(249798..250496)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mtnN"
FT                   /locus_tag="SeHA_C0244"
FT                   /product="MTA/SAH nucleosidase"
FT                   /EC_number="3.2.2.16"
FT                   /EC_number="3.2.2.9"
FT                   /note="identified by match to protein family HMM PF01048;
FT                   match to protein family HMM TIGR01704"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0244"
FT                   /db_xref="EnsemblGenomes-Tr:ACF70478"
FT                   /db_xref="GOA:B4TK35"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR010049"
FT                   /db_xref="InterPro:IPR035994"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4TK35"
FT                   /protein_id="ACF70478.1"
FT                   /translation="MKIGIIGAMEEEVTLLRDKIDNRQTITLGGCEIYTGQLNGTEVAL
FT                   LKSGIGKVAAALGATLLLEHCKPDVIINTGSAGGLASTLKVGDIVVSDEARYHDADVTA
FT                   FGYEYGQLPGCPAGFKADDKLIAAAESCIRELNLNAVRGLIVSGDAFINGSVGLAKIRH
FT                   NFPDAVAVEMEATAIAHVCYNFSVPFVVVRAISDVADQQSHLSFDEFLAVAAKQSTLMV
FT                   ETLVQKLAHG"
FT   gene            250539..252098
FT                   /gene="dgt"
FT                   /locus_tag="SeHA_C0245"
FT   CDS_pept        250539..252098
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dgt"
FT                   /locus_tag="SeHA_C0245"
FT                   /product="deoxyguanosinetriphosphate triphosphohydrolase"
FT                   /EC_number="3.1.5.1"
FT                   /note="identified by match to protein family HMM PF01966;
FT                   match to protein family HMM TIGR01353"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0245"
FT                   /db_xref="EnsemblGenomes-Tr:ACF68181"
FT                   /protein_id="ACF68181.1"
FT                   /translation="MRLWGSAFLRRGEDMASIDFRNKINWHRRYRSPQGVKTEHEILRI
FT                   FESDRGRIINSPAIRRLQQKTQVFPLERNAAVRTRLTHSMEVQQVGRYIAKEILSRLKE
FT                   QNRLEEYGLDALTGPFESIVEMACLMHDIGNPPFGHFGEAAINDWFRQRLHPEDAESQP
FT                   LTHDRCVVSSLRLQEGEENLNDIRRKVRQDICHFEGNAQGIRLVHTLMRMNLTWAQVGG
FT                   ILKYTRPAWWRGPVPDSHRYLMKKPGYYLSEEKYIARLRKELQLAPYSRFPLTWIMEAA
FT                   DDISYCVADLEDAVEKRIFSVEQLYHHLYHAWGHHEKDSLFELVVGNAWEKSRANTLSR
FT                   STEDQFFMYLRVNTLNKLVPYAAQRFIDNLPQIFAGTFNQALLEDASGFSRLLELYKNV
FT                   AVEHVFSHPDVEQLELQGYRVISGLLDIYQPLLSLSLNDFRELVEKERLKRFPIESRLF
FT                   QKLSTRHRLAYVEVVSKLPTDSAEYPVLEYYYRCRLIQDYISGMTDLYAWDEYRRLMAV
FT                   EQ"
FT   gene            252228..253655
FT                   /gene="degP"
FT                   /locus_tag="SeHA_C0246"
FT   CDS_pept        252228..253655
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="degP"
FT                   /locus_tag="SeHA_C0246"
FT                   /product="protease Do"
FT                   /EC_number="3.4.21.-"
FT                   /note="identified by match to protein family HMM PF00089;
FT                   match to protein family HMM PF00595; match to protein
FT                   family HMM TIGR02037"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0246"
FT                   /db_xref="EnsemblGenomes-Tr:ACF68875"
FT                   /protein_id="ACF68875.1"
FT                   /translation="MKKTTLAMSALALSLGLALSPLSATAAETSSSAMTAQQMPSLAPM
FT                   LEKVMPSVVSINVEGSTTVNTPRMPRNFQQFFGDDSPFCQDGSPFQNSPFCQGGGNGGN
FT                   GGQQQKFMALGSGVIIDAAKGYVVTNNHVVDNASVIKVQLSDGRKFDAKVVGKDPRSDI
FT                   ALIQIQNPKNLTAIKLADSDALRVGDYTVAIGNPFGLGETVTSGIVSALGRSGLNVENY
FT                   ENFIQTDAAINRGNSGGALVNLNGELIGINTAILAPDGGNIGIGFAIPSNMVKNLTSQM
FT                   VEYGQVKRGELGIMGTELNSELAKAMKVDAQRGAFVSQVMPNSSAAKAGIKAGDVITSL
FT                   NGKPISSFAALRAQVGTMPVGSKISLGLLREGKAITVNLELQQSSQSQVDSSTIFSGIE
FT                   GAEMSNKGQDKGVVVSSVKANSPAAQIGLKKGDVIIGANQQPVKNIAELRKILDSKPSV
FT                   LALNIQRGDSSIYLLMQ"
FT   gene            253808..254965
FT                   /locus_tag="SeHA_C0247"
FT   CDS_pept        253808..254965
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0247"
FT                   /product="carbohydrate diacid regulator"
FT                   /note="identified by match to protein family HMM PF05651"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0247"
FT                   /db_xref="EnsemblGenomes-Tr:ACF66613"
FT                   /protein_id="ACF66613.1"
FT                   /translation="MAGWHLDTKMAQDIVARTMRIIDTNINVMDARGRIIGSGDRERIG
FT                   ELHEGALLVLSQGRVVDIDDAVARHLHGVRQGINLPLRLEGEIVGVIGLTGEPEHLRKY
FT                   GELVCMTAEMMLEQSRLMHLLAQDSRLREELVMNLIQAEENTPALVEWAQRLGIDLNQP
FT                   RVAAVVEVDSGQLGVDSAMAELQQLQNALTTPERNNLIAIVSLTEMVVLKPALNSFGRW
FT                   DAEDHRKRVEQLISRMKENGQLRFRVALGNYFTGPGSIARSYRTARTTMMVGKQRMPES
FT                   RSYFYQDLMLPVLLDSLRGGWQANELARPLVKLKAMDNNGLLRRTLTAWFRHNVQPLAT
FT                   SKALFIHRNTLEYRLNRISELTGLDLGNFDDRLLLYVALQLDEQR"
FT   gene            complement(255054..255440)
FT                   /locus_tag="SeHA_C0248"
FT   CDS_pept        complement(255054..255440)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0248"
FT                   /product="protein YaeH"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0248"
FT                   /db_xref="EnsemblGenomes-Tr:ACF69932"
FT                   /db_xref="InterPro:IPR020911"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4TK39"
FT                   /protein_id="ACF69932.1"
FT                   /translation="MYDNLKSLGITNPEEIDRYSLRQEANNDILKIYFQKDRGEFFAKS
FT                   VKFKYPRQRKTVVADGIGQGYKEVQEISPNLRYVIDELDQICQRDRSELDLKRKILDDL
FT                   RHLESVVANKISEIEADLDKLTRK"
FT   gene            255687..256988
FT                   /locus_tag="SeHA_C0249"
FT   CDS_pept        255687..256988
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0249"
FT                   /product="shikimate transporter"
FT                   /note="identified by match to protein family HMM PF00083;
FT                   match to protein family HMM PF07690"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0249"
FT                   /db_xref="EnsemblGenomes-Tr:ACF67661"
FT                   /protein_id="ACF67661.1"
FT                   /translation="MSGTYNATIRRVVVSAWIGNSIEYYDFLLYGLASALVFGPLFFPG
FT                   ASPLTATLSSFASFGVGFISRPLGALFFGNRGDTLGRKNTLLITLGGMGAVTFLIGCLP
FT                   SYASIGALAPALLVILRFLQGFMVGGEWGGAMLMVVEYAAGKHRGRLSALSQTGGLTGQ
FT                   LLATGVFIVVTQLPKEALLSWGWRIPFLLSALLVLPGLYMRHRLDETPVFRAFKKQQAI
FT                   NHRQQREERPVVKVVREQWRSILLIIILRFAESVPFFLATVFAVSWATTQLGIASLTIL
FT                   YIVMFTCLLAYPMHVLFGIMSDRRGCRQVYIFGALFVAAMAFPFFWLLESRSLILMTMG
FT                   YVLLINIGHNSLNAVQPSFFAGLFHPPVRYSGSSIGAQLGAVVAGGFTPFIAKALSAVY
FT                   DNSWALVAGYVVLTALASAFAAKIAPETVLPHSP"
FT   gene            complement(257024..257848)
FT                   /gene="dapD"
FT                   /locus_tag="SeHA_C0250"
FT   CDS_pept        complement(257024..257848)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dapD"
FT                   /locus_tag="SeHA_C0250"
FT                   /product="2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
FT                   N-succinyltransferase"
FT                   /EC_number="2.3.1.117"
FT                   /note="identified by match to protein family HMM TIGR00965"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0250"
FT                   /db_xref="EnsemblGenomes-Tr:ACF68461"
FT                   /db_xref="GOA:B4TK41"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005664"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR023180"
FT                   /db_xref="InterPro:IPR037133"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4TK41"
FT                   /protein_id="ACF68461.1"
FT                   /translation="MQQLQNVIETAFERRADITPANVDTVTREAVNQVISLLDSGALRV
FT                   AEKIDGQWVTHQWLKKAVLLSFRINDNQVIDGGESRYFDKVPMKFADYDEARFQKEGFR
FT                   VVPPAAVRQGAFIARNTVLMPSYVNIGAYVDEGTMVDTWATVGSCAQIGKNVHLSGGVG
FT                   IGGVLEPLQANPTIIEDNCFIGARSEVVEGVIVEEGSVISMGVYLGQSTKIYDRETGEV
FT                   HYGRVPAGSVVVSGNLPSKDGKYSLYCAVIVKKVDAKTRGKVGINELLRTID"
FT   gene            complement(257878..260550)
FT                   /gene="glnD"
FT                   /locus_tag="SeHA_C0251"
FT   CDS_pept        complement(257878..260550)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glnD"
FT                   /locus_tag="SeHA_C0251"
FT                   /product="protein-P-II uridylyltransferase"
FT                   /EC_number="2.7.7.59"
FT                   /note="identified by match to protein family HMM PF01842;
FT                   match to protein family HMM PF01909; match to protein
FT                   family HMM PF01966; match to protein family HMM PF08335;
FT                   match to protein family HMM TIGR01693"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0251"
FT                   /db_xref="EnsemblGenomes-Tr:ACF66615"
FT                   /db_xref="GOA:B4TK42"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR002934"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR010043"
FT                   /db_xref="InterPro:IPR013546"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4TK42"
FT                   /protein_id="ACF66615.1"
FT                   /translation="MNTLPEQHANTALPTLPDQPQNPGVWPRAELTVAGIKARIDIFQH
FT                   WLGEAFDSGICAEQLIEARTEFIDQLLQRLWIEAGFGQIADLALVAVGGYGRGELHPLS
FT                   DIDLLILSRKKLPDEQAQKVGELLTLLWDVKLDVGHSVRTLEECLLEGLSDLTVATNLI
FT                   ETRLLIGDVALFLALQKHIFSEGFWPSDKFYAAKVEEQNQRHQRYHGTSYNLEPDIKSS
FT                   PGGLRDIHTLQWVARRHFGATSLDEMVGFGFLTPAERAELNECLHILWRIRFALHLVVS
FT                   RYDNRLLFDRQLSVAQRLNYSGEGNDPVERMMKDYFRVTRRVSELNQMLLQLFDEAILA
FT                   LPADEKPRPVDDEFQLRGTLIDLRDDTLFIREPQAILRMFYMMVRNSAITGIYSTTLRH
FT                   LRHARRHLSQPLCYIPEARTLFLSMLRHPGAVSRGLLPMHRHSVLWAYMPQWSHIVGQM
FT                   QFDLFHAYTVDEHTIRVMLKLESFAKEETRQRHPLCVDLWPRLPHPELILIAALFHDIA
FT                   KGRGGDHSVLGAQDVLTFAELHGLNSRETQLVAWLVRQHLLMSVTAQRRDIQDPEVIKQ
FT                   FAEEVQTETRLRFLVCLTVADICATNETLWNSWKQSLLRELYFATEKQLRRGMQNTPDM
FT                   RERVRHHQLQALALLRMDNIDEAALHKIWTRCRANYFVRHSPNQLAWHARHLLQHDLRQ
FT                   PLVLLSPQATRGGTEIFIWSPDRPYLFAAVCAELDRRNLSVHDAQIFTTRDGMAMDTFI
FT                   VLEPDGSPLAADRHDVIRTGLEQTITQRSWQPPQPRRQPAKLRHFTVETEVNFLPTHTD
FT                   RKSFMELIALDQPGLLARVGQIFADLGISLHGARITTIGERVEDLFIIATADRRALNNV
FT                   LQLEVQQRLTAALNPNDKG"
FT   gene            complement(260788..261582)
FT                   /gene="map"
FT                   /locus_tag="SeHA_C0252"
FT   CDS_pept        complement(260788..261582)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="map"
FT                   /locus_tag="SeHA_C0252"
FT                   /product="methionine aminopeptidase, type I"
FT                   /EC_number="3.4.11.18"
FT                   /note="identified by match to protein family HMM PF00557;
FT                   match to protein family HMM TIGR00500"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0252"
FT                   /db_xref="EnsemblGenomes-Tr:ACF67452"
FT                   /protein_id="ACF67452.1"
FT                   /translation="MAISIKTSEDIEKMRVAGRLAAEVLEMIEPYIKPGVTTGELDRIC
FT                   NDYIVNEQHAISACLGYHGYPKSVCISINEVVCHGIPDDAKHLKDGDIVNIDVTVIKDE
FT                   FHGDTSKMFIVGKPTILGERLCRVTQESLYLGIKMVKPGIRLRTIGAAIQKYAEGEGFS
FT                   VVREYCGHGIGRGFHEEPQVLHYDADDGGVVLQPGMTFTIEPMLNAGDYRIRTMKDGWT
FT                   VKTKDRSLSAQYEHTIVVTENGCEILTLRKDDTIPAIITHDE"
FT   gene            261866..262004
FT                   /locus_tag="SeHA_C0253"
FT   ncRNA           261866..262004
FT                   /locus_tag="SeHA_C0253"
FT                   /product="t44 RNA"
FT                   /ncRNA_class="other"
FT   gene            262033..262758
FT                   /gene="rpsB"
FT                   /locus_tag="SeHA_C0254"
FT   CDS_pept        262033..262758
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsB"
FT                   /locus_tag="SeHA_C0254"
FT                   /product="ribosomal protein S2"
FT                   /note="identified by match to protein family HMM PF00318;
FT                   match to protein family HMM TIGR01011"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0254"
FT                   /db_xref="EnsemblGenomes-Tr:ACF69750"
FT                   /db_xref="GOA:B4TK44"
FT                   /db_xref="InterPro:IPR001865"
FT                   /db_xref="InterPro:IPR005706"
FT                   /db_xref="InterPro:IPR018130"
FT                   /db_xref="InterPro:IPR023591"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4TK44"
FT                   /protein_id="ACF69750.1"
FT                   /translation="MATVSMRDMLKAGVHFGHQTRYWNPKMKPFIFGARNKVHIINLEK
FT                   TVPMFNEALAELNKISARKGKILFVGTKRAASEAVKEAANSCDQFFVNHRWLGGMLTNW
FT                   KTVRQSIKRLKDLETQSQDGTFEKLTKKEALMRTRELEKLENSLGGIKDMGGLPDALFV
FT                   IDADHEHIAIKEANNLGIPVFAIVDTNSDPDGVDFVIPGNDDAIRAVSLYLGAVAATVR
FT                   EGRSQDLASQAEESFVEAE"
FT   gene            263016..263867
FT                   /gene="tsf"
FT                   /locus_tag="SeHA_C0255"
FT   CDS_pept        263016..263867
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tsf"
FT                   /locus_tag="SeHA_C0255"
FT                   /product="translation elongation factor Ts"
FT                   /note="identified by match to protein family HMM PF00627;
FT                   match to protein family HMM PF00889; match to protein
FT                   family HMM TIGR00116"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0255"
FT                   /db_xref="EnsemblGenomes-Tr:ACF70250"
FT                   /db_xref="GOA:B4TK45"
FT                   /db_xref="InterPro:IPR001816"
FT                   /db_xref="InterPro:IPR009060"
FT                   /db_xref="InterPro:IPR014039"
FT                   /db_xref="InterPro:IPR018101"
FT                   /db_xref="InterPro:IPR036402"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4TK45"
FT                   /protein_id="ACF70250.1"
FT                   /translation="MAEITASLVKELRERTGAGMMDCKKALTEANGDIELAIENMRKSG
FT                   AIKAAKKAGNVAADGVIKTKIDGNVAFILEVNCQTDFVAKDAGFQAFADKVLDAAVAGK
FT                   ITDVEVLKAQFEEERVALVAKIGENINIRRVASLEGDVLGSYQHGARIGVLVAAKGADE
FT                   ELVKQLAMHVAASKPEFVKPEDVSADVVEKEYQVQLDIAMQSGKPKEIAEKMVEGRMKK
FT                   FTGEVSLTGQPFVMEPSKSVGQLLKEHNADVTGFIRFEVGEGIEKVETDFAAEVAAMSK
FT                   QS"
FT   gene            264012..264737
FT                   /gene="pyrH"
FT                   /locus_tag="SeHA_C0256"
FT   CDS_pept        264012..264737
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyrH"
FT                   /locus_tag="SeHA_C0256"
FT                   /product="UMP kinase"
FT                   /EC_number="2.7.4.22"
FT                   /note="identified by match to protein family HMM PF00696;
FT                   match to protein family HMM TIGR02075"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0256"
FT                   /db_xref="EnsemblGenomes-Tr:ACF68881"
FT                   /protein_id="ACF68881.1"
FT                   /translation="MATNAKPVYKRILLKLSGEALQGTEGFGIDASILDRMAQEIKELV
FT                   ELGIQVGVVIGGGNLFRGAGLAKAGMNRVVGDHMGMLATVMNGLAMRDALHRAYVNARL
FT                   MSAIPLNGVCDNYSWAEAISLLRNNRVVILSAGTGNPFFTTDSAACLRGIEIEADVVLK
FT                   ATKVDGVFTADPAKDPSATMYDQLTYSEVLDKELKVMDLAAFTLARDHKLPIRVFNMNK
FT                   PGALRRVVMGEKEGTLITE"
FT   gene            264884..265441
FT                   /gene="frr"
FT                   /locus_tag="SeHA_C0257"
FT   CDS_pept        264884..265441
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="frr"
FT                   /locus_tag="SeHA_C0257"
FT                   /product="ribosome releasing factor"
FT                   /note="identified by match to protein family HMM PF01765;
FT                   match to protein family HMM TIGR00496"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0257"
FT                   /db_xref="EnsemblGenomes-Tr:ACF69213"
FT                   /db_xref="GOA:B4TK47"
FT                   /db_xref="InterPro:IPR002661"
FT                   /db_xref="InterPro:IPR023584"
FT                   /db_xref="InterPro:IPR036191"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4TK47"
FT                   /protein_id="ACF69213.1"
FT                   /translation="MISDIRKDAEVRMEKCVEAFKTQISKVRTGRASPSLLDGIVVEYY
FT                   GTPTPLRQLASVTVEDSRTLKINVFDRSMGPAVEKAIMASDLGLNPSSAGTDIRVPLPP
FT                   LTEERRKDLTKIVRGEAEQARVAVRNVRRDANDKVKALLKDKAISEDDDRRSQEEVQKM
FT                   TDAAIKKVDAALADKEAELMQF"
FT   gene            265496..266779
FT                   /gene="dxr"
FT                   /locus_tag="SeHA_C0258"
FT   CDS_pept        265496..266779
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dxr"
FT                   /locus_tag="SeHA_C0258"
FT                   /product="1-deoxy-D-xylulose 5-phosphate reductoisomerase"
FT                   /EC_number="2.7.4.-"
FT                   /note="identified by match to protein family HMM PF02670;
FT                   match to protein family HMM PF08436; match to protein
FT                   family HMM TIGR00243"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0258"
FT                   /db_xref="EnsemblGenomes-Tr:ACF67056"
FT                   /protein_id="ACF67056.1"
FT                   /translation="MYKAPRRRHYQVSCAAFCFLFRFNTSGRFMKQLTILGSTGSIGCS
FT                   TLDVVRHNPDSFRVIALVAGKNVARMAEQCLEFSPRYAVMDDTSSAEQLKIMLQQHGSR
FT                   TEVLSGQQAACEMAALDEVGHVMAAIVGAAGLLPTLAAIRAGKTILLANKESLVTCGRL
FT                   FMDEVKRSNARLLPVDSEHNAIFQSLPQSIQHNLGYADLEQNGVTSILLTGSGGPFRET
FT                   PMCDLAAMTPDQACRHPNWSMGRKISVDSATMMNKGLEYIEARWLFNASARQMEVLIHP
FT                   QSVIHSMVRYQDGSVLAQLGEPDMRTPIAHTMAWPNRVTSGAQPLDFCKLSALTFSAPD
FT                   YQRYPCLKLAMEAFEQGQAATTALNAANEITVAAFLAQQIRFTDIAGLNLAVLERMDLQ
FT                   EPASVEDVLQVDAIAREVARKQVIRLSR"
FT   gene            267092..267850
FT                   /gene="uppS"
FT                   /locus_tag="SeHA_C0259"
FT   CDS_pept        267092..267850
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="uppS"
FT                   /locus_tag="SeHA_C0259"
FT                   /product="di-trans,poly-cis-decaprenylcistransferase"
FT                   /EC_number="2.5.1.31"
FT                   /note="identified by match to protein family HMM PF01255;
FT                   match to protein family HMM TIGR00055"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0259"
FT                   /db_xref="EnsemblGenomes-Tr:ACF68612"
FT                   /protein_id="ACF68612.1"
FT                   /translation="MLSATQPVSENLPAHGCRHVAIIMDGNGRWAKKQGKIRAFGHKAG
FT                   AKSVRRAVSFAANNGIDALTLYAFSSENWNRPAQEVSALMELFVWALDSEVKSLHRHNV
FT                   RLRIIGDISRFNSRLQERIRKSEALTAHNTGLTLNIAANYGGRWDIVQGVRQLAEQVQA
FT                   GVLRPDQIDEERLGQQICMHELAPVDLVIRTGGEHRISNFLLWQIAYAELYFTDVLWPD
FT                   FDEQDFEGALHAFANRERRFGGTEPGDDKA"
FT   gene            267863..268720
FT                   /gene="cdsA1"
FT                   /locus_tag="SeHA_C0260"
FT   CDS_pept        267863..268720
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cdsA1"
FT                   /locus_tag="SeHA_C0260"
FT                   /product="phosphatidate cytidylyltransferase"
FT                   /EC_number="2.7.7.41"
FT                   /note="identified by match to protein family HMM PF01148"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0260"
FT                   /db_xref="EnsemblGenomes-Tr:ACF67505"
FT                   /protein_id="ACF67505.1"
FT                   /translation="MLKYRLISAFVLIPAVIAALFLLPPVGFAIITLVVCMLAAWEWGQ
FT                   LSGFAARSQRVWLAVLCGLLLALMLFLLPEYHHNIRQPLVEMSLWASLGWWVVALLLVL
FT                   FYPGSAAIWRNSKTLRLIFGLLTIVPFFWGMLALRAWHYDENHYSGAIWLLYVMILVWG
FT                   ADSGAYMFGKLFGKHKLAPKVSPGKTWQGFIGGLATAAVISWGYGMWANLNVAPVILLI
FT                   CSVVAALASVLGDLTESMFKREAGIKDSGHLIPGHGGILDRIDSLTAAVPVFACLLLLV
FT                   FRTL"
FT   gene            268732..270084
FT                   /gene="rseP"
FT                   /locus_tag="SeHA_C0261"
FT   CDS_pept        268732..270084
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rseP"
FT                   /locus_tag="SeHA_C0261"
FT                   /product="RIP metalloprotease RseP"
FT                   /EC_number="3.4.24.-"
FT                   /note="identified by match to protein family HMM PF00595;
FT                   match to protein family HMM PF02163; match to protein
FT                   family HMM TIGR00054"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0261"
FT                   /db_xref="EnsemblGenomes-Tr:ACF67926"
FT                   /protein_id="ACF67926.1"
FT                   /translation="MLSILWNLAAFIIALGVLITVHEFGHFWVARRCGVRVERFSIGFG
FT                   KALWRRTDRYGTEYVIALIPLGGYVKMLDERAEPVAPELRRHAFNNKTVGQRAAIIAAG
FT                   PVANFIFAIFAYWLVFIIGVPGVRPVIGEITPNSIAAQAQIAPGTELKAVDGIETPDWD
FT                   AVRLQLVSKIGDQQTTVSVAPFGSDQRQDKTLDLRHWAFEPDKQDPVSSLGIRPRGPQI
FT                   EPVLSEVQANSAASKAGLQAGDRIVKVDGQPLTQWMKFVTFVRDNPGKPLALEIERQGS
FT                   ALSLTLTPDTKSVNGKAEGFAGVVPKIIPLPEEYKTIRQYGPFSAILEATDKTWQLMKL
FT                   TVSMLGKLITGDVKLNNLSGPISIAQGAGMSAEFGVIYYLMFLALISVNLGIINLFPLP
FT                   VLDGGHLLFLAIEKLKGGPVSERVQDFSYRIGSILLVLLMGLALFNDFSRL"
FT   gene            270116..272527
FT                   /gene="yaeT"
FT                   /locus_tag="SeHA_C0262"
FT   CDS_pept        270116..272527
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaeT"
FT                   /locus_tag="SeHA_C0262"
FT                   /product="outer membrane protein assembly complex, YaeT
FT                   protein"
FT                   /note="identified by match to protein family HMM PF01103;
FT                   match to protein family HMM PF07244; match to protein
FT                   family HMM TIGR03303"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0262"
FT                   /db_xref="EnsemblGenomes-Tr:ACF66187"
FT                   /db_xref="GOA:B4TK52"
FT                   /db_xref="InterPro:IPR000184"
FT                   /db_xref="InterPro:IPR010827"
FT                   /db_xref="InterPro:IPR023707"
FT                   /db_xref="InterPro:IPR034746"
FT                   /db_xref="InterPro:IPR039910"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4TK52"
FT                   /protein_id="ACF66187.1"
FT                   /translation="MAMKKLLIASLLFSSATVYGAEGFVVKDIHFEGLQRVAVGAALLS
FT                   MPVRTGDTVNDEDISNTIRALFATGNFEDVRVLRDGNTLLVQVKERPTIASITFSGNKS
FT                   VKDDMLKQNLEASGVRVGESLDRTTLSDIEKGLEDFYYSVGKYSASVKAVVTPLPRNRV
FT                   DLKLVFQEGVSAKIQQINIVGNHAFSTEELISHFQLRDEVPWWNVVGDRKYQKQKLAGD
FT                   LETLRSYYLDRGYARFNIDSTQVSLTPDKKGIYITVNITEGDQYKLSGVQVSGNLAGHS
FT                   AEIENLTKIEPGELYNGTKVTKMEDDIKKLLGRYGYAYPRVQSQPEINDADKTVKLRVN
FT                   VDAGNRFYVRKIRFEGNDTSKDSVLRREMRQMEGAWLGSDLVDQGKERLNRLGFFETVD
FT                   TDTQRVPGSLDQVDVVYKVKERNTGSFNFGIGYGTESGVSFQAGVQQDNWLGTGYSVGI
FT                   NGTKNDYQTYSELSVTNPYFTVDGVSLGGRIFYNDFEADDADLSDYTNKSYGTDVTLGF
FT                   PINEYNTLRAGLGYVHNKLSNMQPQIAMDRYLESMGDPDASDFAADDFTFNYGWTYNKL
FT                   DRGYFPTDGSRVNLTGKVTIPGSDNEYYKVSLDTATYVPIDNDHKWVVLGRTRWGYGDG
FT                   LGGKEMPFYENFYAGGSSTVRGFQSNTIGPKAVYKNGAHTSWDDNDDYEDCTQESGCKS
FT                   DDAVGGNAMAVASLEFITPTPFISEKYANSVRTSFFWDMGTVWDTNWDPSSAPSDVPDY
FT                   SDPGNIRMSAGIALQWMSPLGPLVFSYAQPFKKYDGDKAEQFQFNIGKTW"
FT   gene            272650..273135
FT                   /gene="skp"
FT                   /locus_tag="SeHA_C0263"
FT   CDS_pept        272650..273135
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="skp"
FT                   /locus_tag="SeHA_C0263"
FT                   /product="chaperone protein Skp"
FT                   /note="identified by match to protein family HMM PF03938"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0263"
FT                   /db_xref="EnsemblGenomes-Tr:ACF65978"
FT                   /protein_id="ACF65978.1"
FT                   /translation="MKKWLLAAGLGLAMVTSAQAADKIAIVNMGNLFQQVAQKTGVSNT
FT                   LENEFKGRAAELQKMETDLQSKMQRLQSMKAGSDRTKLEKDVMSQRQTFAQKAQAFEKD
FT                   RARRSNEERNKLVTRIQTAVKKVANDQSIDLVVDANTVAYNSSDVKDITADVLKQVK"
FT   gene            273139..274164
FT                   /gene="lpxD"
FT                   /locus_tag="SeHA_C0264"
FT   CDS_pept        273139..274164
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lpxD"
FT                   /locus_tag="SeHA_C0264"
FT                   /product="UDP-3-O-[3-hydroxymyristoyl] glucosamine
FT                   N-acyltransferase"
FT                   /EC_number="3.1.26.4"
FT                   /note="identified by match to protein family HMM PF00132;
FT                   match to protein family HMM PF04613; match to protein
FT                   family HMM TIGR01853"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0264"
FT                   /db_xref="EnsemblGenomes-Tr:ACF68373"
FT                   /protein_id="ACF68373.1"
FT                   /translation="MPSIRLADLAEQLDAELHGDGDIVITGVASMQSATTGHITFMVNP
FT                   KYREHLGLCQASAVVMTQDDLPFAKSAALVVKNPYLTYARMAQILDTTPQPAQNIAASA
FT                   VIDATATLGSNVSVGANAVIESGVQLGDNVVIGAGCFVGKNSKIGAGSRLWANVTIYHD
FT                   IQIGENCLIQSSTVIGADGFGYANDRGNWVKIPQLGRVIIGDRVEIGACTTIDRGALDD
FT                   TVIGNGVIIDNQCQIAHNVVIGDNTAVAGGVIMAGSLKIGRYCMIGGASVINGHMEICD
FT                   KVTVTGMGMVMRPITEPGVYSSGIPLQPNKVWRKTAALVMNIDDMSKRLKAIERKVNQQ
FT                   D"
FT   gene            274270..274725
FT                   /gene="fabZ"
FT                   /locus_tag="SeHA_C0265"
FT   CDS_pept        274270..274725
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fabZ"
FT                   /locus_tag="SeHA_C0265"
FT                   /product="beta-hydroxyacyl-(acyl-carrier-protein)
FT                   dehydratase FabZ"
FT                   /EC_number="4.2.1.-"
FT                   /note="identified by match to protein family HMM PF07977;
FT                   match to protein family HMM TIGR01750"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0265"
FT                   /db_xref="EnsemblGenomes-Tr:ACF69741"
FT                   /db_xref="GOA:B4TK55"
FT                   /db_xref="InterPro:IPR010084"
FT                   /db_xref="InterPro:IPR013114"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4TK55"
FT                   /protein_id="ACF69741.1"
FT                   /translation="MTTNTHTLQIEEILELLPHRFPFLLVDRVLDFEEGRFLRAVKNVS
FT                   VNEPFFQGHFPGKPILPGVLILEAMAQATGILAFKSVGKLEPGELYYFAGIDEARFKRP
FT                   VVPGDQMIMEVTFEKTRRGLTRFKGVALVDGKVVCEATMMCARSREA"
FT   gene            274729..275517
FT                   /gene="lpxA"
FT                   /locus_tag="SeHA_C0266"
FT   CDS_pept        274729..275517
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lpxA"
FT                   /locus_tag="SeHA_C0266"
FT                   /product="acyl-[acyl-carrier-protein]-UDP-N-acetylglucosamine
FT                   O-acyltransferase"
FT                   /EC_number="2.3.1.129"
FT                   /note="identified by match to protein family HMM PF00132;
FT                   match to protein family HMM TIGR01852"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0266"
FT                   /db_xref="EnsemblGenomes-Tr:ACF67940"
FT                   /db_xref="GOA:B4TK56"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR010137"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR029098"
FT                   /db_xref="InterPro:IPR037157"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4TK56"
FT                   /protein_id="ACF67940.1"
FT                   /translation="MIDKSAFIHPTAIVEDGAVIGANAHIGPFCIVGPQVEIGEGTVLK
FT                   SHVVVNGQTKIGRDNEIYQFASIGEVNQDLKYAGEPTRVEIGDRNRIRESVTIHRGTVQ
FT                   GGGLTKVGSDNLLMINAHVAHDCTVGNRCILANNATLAGHVSVDDFAIIGGMTAVHQFC
FT                   IIGAHVMVGGCSGVAQDVPPYVVAQGNHATPFGVNIEGLKRRGFSREGLVAIRNAYKLL
FT                   YRSGKTLDEAKLEIAELAEKHPEVKAFTEFFERSTRGPIR"
FT   gene            275517..276665
FT                   /gene="lpxB"
FT                   /locus_tag="SeHA_C0267"
FT   CDS_pept        275517..276665
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lpxB"
FT                   /locus_tag="SeHA_C0267"
FT                   /product="lipid-A-disaccharide synthase"
FT                   /EC_number="2.4.1.182"
FT                   /note="identified by match to protein family HMM PF02684;
FT                   match to protein family HMM TIGR00215"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0267"
FT                   /db_xref="EnsemblGenomes-Tr:ACF68709"
FT                   /db_xref="GOA:B4TK57"
FT                   /db_xref="InterPro:IPR003835"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4TK57"
FT                   /protein_id="ACF68709.1"
FT                   /translation="MAAQRPLTIALVAGETSGDILGAGLIRALKARVPNARFVGVAGPR
FT                   MQAEGCEAWYEMEELAVMGIVEVLGRLRRLLHIRADLTRRFTELKPDVFVGIDAPDFNI
FT                   TLEGNLKKQGIKTIHYVSPSVWAWRQKRVFKIGRSTHMVLAFLPFEKAFYDKFNVPCRF
FT                   IGHTMADAMPLDPDKNAARDVLGIPHDAHCLALLPGSRGAEVEMLSADFLKTAQLLRQR
FT                   YPDLEVVVPLVNAKRREQFEKIKAEVAPDLAVHLLDGMAREAMIASDAALLASGTAALE
FT                   CMLAKCPMVVGYRMKPFTFWLAKRLVKTEYVSLPNLLAGRELVKELLQEECEPQKLAEA
FT                   LLPLLANGKTSHAMHDTFRELHQQIRCNADEQAADAVLELAQ"
FT   gene            276662..277258
FT                   /gene="rnhB"
FT                   /locus_tag="SeHA_C0268"
FT   CDS_pept        276662..277258
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rnhB"
FT                   /locus_tag="SeHA_C0268"
FT                   /product="ribonuclease HII"
FT                   /EC_number="3.1.26.4"
FT                   /note="identified by match to protein family HMM PF01351"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0268"
FT                   /db_xref="EnsemblGenomes-Tr:ACF66364"
FT                   /db_xref="GOA:B4TK58"
FT                   /db_xref="InterPro:IPR001352"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR022898"
FT                   /db_xref="InterPro:IPR024567"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4TK58"
FT                   /protein_id="ACF66364.1"
FT                   /translation="MIEFVYPHTHLVAGVDEVGRGPLVGAVVTAAVILDPARPIVGLND
FT                   SKKLSEKRRLSLYDEIKEKALSWSLGRAEAHEIDELNILHATMLAMQRAVAGLHIAPEY
FT                   VLIDGNRCPELPVPSMAVVKGDSRVAEISAASILAKVTRDAEMAALDIVFPQYGFAQHK
FT                   GYPTAFHLEKLAQYGATAHHRRSFAPVKRALGLVS"
FT   gene            277282..280764
FT                   /gene="dnaE"
FT                   /locus_tag="SeHA_C0269"
FT   CDS_pept        277282..280764
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaE"
FT                   /locus_tag="SeHA_C0269"
FT                   /product="DNA polymerase III, alpha subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="identified by match to protein family HMM PF01336;
FT                   match to protein family HMM PF02811; match to protein
FT                   family HMM PF07733; match to protein family HMM TIGR00594"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0269"
FT                   /db_xref="EnsemblGenomes-Tr:ACF67529"
FT                   /protein_id="ACF67529.1"
FT                   /translation="MSEPRFVHLRVHSDYSMIDGLAKTGPLVKKAASLGMPALAITDFT
FT                   NLCGLVKFYGAGHGAGIKPIVGADFNVHNELLGDELTHLTVLAANNTGYQNLTLLISKA
FT                   YQRGYGAAGPIIERDWLVELKEGLILISGGRMGDVGRCLLRGNQALVEECVAFYETHFP
FT                   DRYFLELIRTGRQDEETYLHAAVELAEARGLPVVATNDVRFLESDDFDAHEIRVAIHDG
FT                   FTLDDPKRPRNYSPQQYMRSEEEMCELFSDIPEALENTVEIAKRCNVTVRLGEYFLPQF
FT                   PTGDMTTEDYLVKKAKEGLEERLAFLFPDEEERKKRRPEYDERLDIELQVINQMGFPGY
FT                   FLIVMEFIQWSKDNGVPVGPGRGSGAGSLVAYALKITDLDPLEFDLLFERFLNPERVSM
FT                   PDFDVDFCMEKRDQVIEHVADMYGRDAVSQIITFGTMAAKAVIRDVGRVLGHPYGFVDR
FT                   ISKLVPPDPGMTLAKAFEAEPQLPEIYEADEEVRALIDMARKLEGVTRNAGKHAGGVVI
FT                   APTKITDFAPLYCDEEGKHPVTQFDKSDVEYAGLVKFDFLGLRTLTIINWALEMINKRR
FT                   EKNGEPPLDIAAIPLDDKKSFDMLQRSETTAVFQLESRGMKDLIKRLQPDCFEDMIALV
FT                   ALFRPGPLQSGMVDNFIDRKHGREELSYPDVQWQHESLKPVLEPTYGIILYQEQVMQIA
FT                   QVLSGYTLGGADMLRRAMGKKKPEEMAKQRSVFEEGAKKNGIDGELAMKIFDLVEKFAG
FT                   YGFNKSHSAAYALVSYQTLWLKAHYPAEFMAAVMTADMDNTEKVVGLVDECWRMGLKIL
FT                   PPDINSGLYHFHVNDEGEIVYGIGAIKGVGEGPIEAIIDARNQGGYFRELFDLCARTDT
FT                   KKLNRRVLEKLIMSGAFDRLGPHRAALMNSLGDALKAADQHAKAEAIGQADMFGVLAEE
FT                   PEQIEQSYASCQPWPEQVVLDGERETLGLYLTGHPINQYLKEIERYVGGVRLKDMHPTE
FT                   RGKVTTAAGLVIAARVMVTKRGNRIGICTLDDRSGRLEVMLFTDALDKYQQLLEKDRIL
FT                   IVSGQVSFDDFSGGLKMTAREVMDIDEAREKYARGLAISLTDRQIDDQLLNRLRQSLEP
FT                   HRSGTIPVHLYYQRADARARLRFGATWRVSPSDRLLNDLRGLIGSEQVELEFD"
FT   gene            280777..281736
FT                   /gene="accA"
FT                   /locus_tag="SeHA_C0270"
FT   CDS_pept        280777..281736
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="accA"
FT                   /locus_tag="SeHA_C0270"
FT                   /product="acetyl-CoA carboxylase, carboxyl transferase,
FT                   alpha subunit"
FT                   /EC_number="6.4.1.2"
FT                   /note="identified by match to protein family HMM PF03255;
FT                   match to protein family HMM TIGR00513"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0270"
FT                   /db_xref="EnsemblGenomes-Tr:ACF68366"
FT                   /db_xref="GOA:B4TK60"
FT                   /db_xref="InterPro:IPR001095"
FT                   /db_xref="InterPro:IPR011763"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4TK60"
FT                   /protein_id="ACF68366.1"
FT                   /translation="MSLNFLDFEQPIAELEAKIDSLTAVSRQDEKLDINIDEEVHRLRE
FT                   KSVELTRKIFADLGAWQVAQLARHPQRPYTLDYVRLAFDEFDELAGDRAYADDKAIVGG
FT                   IARLEGRPVMIIGHQKGRETKEKIRRNFGMPAPEGYRKALRLMEMAERFNMPIITFIDT
FT                   PGAYPGVGAEERGQSEAIARNLREMSRLNVPVICTVIGEGGSGGALAIGVGDKVNMLQY
FT                   STYSVISPEGCASILWKSADKAPLAAEAMGIIAPRLKELKLIDSIIPEPLGGAHRNPEA
FT                   MAASLKAQLLEDLADLDVLSTDDLKNRRYQRLMSYGYA"
FT   gene            281916..283679
FT                   /locus_tag="SeHA_C0271"
FT   CDS_pept        281916..283679
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0271"
FT                   /product="endochitinase"
FT                   /note="identified by match to protein family HMM PF00182;
FT                   match to protein family HMM PF00801"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0271"
FT                   /db_xref="EnsemblGenomes-Tr:ACF70010"
FT                   /protein_id="ACF70010.1"
FT                   /translation="MGLQKTLALSAVAAGIMLSLSGAQAAPLLSSSEPMTINASDLAAK
FT                   EKALTDFPLMEAVKSSIQTLDNSAVEQIEPGRAANPANVKRVESILKEADWDYLFPMRA
FT                   PEYTYSNFLKAIGKFPAVCGTYTDGRDSDAICRKTLATMFAHFAQETGGHESWRDIPEW
FT                   RQALVYLREVGWTEGQKGGYNGECNPDVWQGQTWPCGKDKDGDFLSYFGRGAKQLSYNY
FT                   NYGPFSDAMYGDVRPLLDKPELVADTWMNLASAVFFFVYPQPPKPSMLHVIDGTWQPND
FT                   RDKANGLVSGFGVTIQIINGGVECGGADENAQSLNRIAYYKEFANYLKVPVPADEVLGC
FT                   KKMKQFDEGGAGALPIYWEQDWGWSADTADGKTYSCQLVGYQTPYTAFKEGDYTKCVQH
FT                   YFNVNVVDDSGTTEPDVTPTPAPVTDENVAPVARIAGPVGAVEAGSPVSLSAEGSTDAN
FT                   GDKLTYTWMSQDGKTLSGQDKAVVIFNAPDVTQNTQYVVNLTVSDGTLSSTAVYTLNVK
FT                   AKAAAADDEDKTTSYPAWSSSQKWNPGDIVNSNGALYQCKPFPEGSWCNVAPAYYEPGV
FT                   GIAWADAWNAL"
FT   gene            283755..285896
FT                   /locus_tag="SeHA_C0272"
FT   CDS_pept        283755..285896
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0272"
FT                   /product="lysine decarboxylase, constitutive"
FT                   /EC_number="4.1.1.18"
FT                   /note="identified by match to protein family HMM PF01276;
FT                   match to protein family HMM PF03709; match to protein
FT                   family HMM PF03711"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0272"
FT                   /db_xref="EnsemblGenomes-Tr:ACF69666"
FT                   /protein_id="ACF69666.1"
FT                   /translation="MNIIAIMGPHGVYYKDEPIKELERALQSLGFQIIWPQNSVDLLKF
FT                   IEHNPRICGVIFDWDEYSLDLCSEINQLNEYLPLYAFINTNSTLDVSVHDMRMALWFFE
FT                   YALGLAEDIATRIHQYTNEYLDNITPPFTKALFTYAKEGKYTFCTPGHMAGTAYQKSPP
FT                   GCLFYDFFGGNTLKADVSISVTELGSLLDHTGPHLEAEEYIARTFGAEQSYMVTNGTST
FT                   SNKIVGMYAAPAGSTLLIDRNCHKSLAHLLMMSDVVPLWLKPTRNALGILGGIPRREFT
FT                   RASIESKIEETPQAQWPVHAVITNSTYDGLLYNTNWIKQMLDVPSIHFDSAWVPYTHFH
FT                   PIYQGKSGMSGDRVPGKVIFETQSTHKMLAAFSQASLIHIKGEYDEETFNEAFMMHTST
FT                   SPSYPIVASIETAAAMLRGNPGKRLINRSVERALHFRKEVQRLREESDSWFFDIWQPEE
FT                   VDEAECWPVTPGETWHGFADADDDHMFLDPVKVTILTPGMDEQGNMSEEGIPAALVAKF
FT                   LDERGVVVEKTGPYNLLFLFSIGIDKTRAMGLLRGLTEFKRAYDLNLRVKNMLPDLYAE
FT                   DPDFYRNMRIQDLAQGIHKLIRQHDLPGLMLRAFEVLPEMIMTPHQAWQRQIKGEVETV
FT                   ALDQLPGRVSANMILPYPPGVPLLMPGERITQQSRAVLDFLLMLCSIGQHYPGFETDIH
FT                   GAKRNEDGVYQVRVLKHAC"
FT   gene            285952..286341
FT                   /locus_tag="SeHA_C0273"
FT   CDS_pept        285952..286341
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0273"
FT                   /product="glyoxylase family protein"
FT                   /note="identified by match to protein family HMM PF00903"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0273"
FT                   /db_xref="EnsemblGenomes-Tr:ACF70314"
FT                   /protein_id="ACF70314.1"
FT                   /translation="MLGLKQVHHIAIIATDYAVSKAFYCDILGFNLLSEAWREERDSWK
FT                   GDLALNGQYVIELFSFPFPPARPSRPEACGLRHLAFSVENVENAVAHLEKHQVKCEPIR
FT                   IDPYTGKRFTFFNDPDGLPLELYEQ"
FT   gene            286404..287696
FT                   /locus_tag="SeHA_C0274"
FT   CDS_pept        286404..287696
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0274"
FT                   /product="tRNA(Ile)-lysidine synthase
FT                   (tRNA(Ile)-lysidinesynthetase) (tRNA(Ile)-2-lysyl-cytidine
FT                   synthase)"
FT                   /EC_number="6.3.4.-"
FT                   /note="identified by match to protein family HMM PF01171;
FT                   match to protein family HMM PF09179; match to protein
FT                   family HMM TIGR02432; match to protein family HMM
FT                   TIGR02433"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0274"
FT                   /db_xref="EnsemblGenomes-Tr:ACF65993"
FT                   /db_xref="GOA:B4TK64"
FT                   /db_xref="InterPro:IPR011063"
FT                   /db_xref="InterPro:IPR012094"
FT                   /db_xref="InterPro:IPR012795"
FT                   /db_xref="InterPro:IPR012796"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015262"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4TK64"
FT                   /protein_id="ACF65993.1"
FT                   /translation="MTTLTLNTSLLSSCRILAAFSGGLDSTVLLHQLVLWRERHPDVTL
FT                   RAIHIHHGLSPHADSWVRHCETVCERWQVPLVVERVTLADNGLGIEAHAREARYRAFAQ
FT                   TLLPGEVLATAQHLDDQCETFLLALKRGSGPAGLSAMGECSPFAGTLLLRPLLRETRKT
FT                   LEQWAVRHGLCWIEDESNQDDAYDRNFLRLRALPLLQQRWPHFPAAVARSATLCAEQER
FT                   LLDELLASDLTDCITAEGTLRLSPLMLMSDVRRAAILRRWLAMRNAPMPSRDALERIWQ
FT                   EVALARDDASPCLRFGDHEIRRYQSQLWWIKTVAGQHETTVVWPVWQTPLALPAGLGTV
FT                   QLVPGGELRRPREEESVSIRFKAPGVLHIVGRNGGRKLKKIWQEQGIPPWRRDTTPLLF
FT                   YGETLIAAAGVFVTREGAAEDKEGVSLVWHA"
FT   gene            complement(287780..288040)
FT                   /gene="rof"
FT                   /locus_tag="SeHA_C0275"
FT   CDS_pept        complement(287780..288040)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rof"
FT                   /locus_tag="SeHA_C0275"
FT                   /product="rof protein"
FT                   /note="identified by match to protein family HMM PF07073"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0275"
FT                   /db_xref="EnsemblGenomes-Tr:ACF66139"
FT                   /protein_id="ACF66139.1"
FT                   /translation="MSMNETYQPINCDDYDSLELACMHHLILTLTLKDGEVLQAKANDL
FT                   ILRKNVEYLLAEVSGESCELRLDKIASFSHPEIGTVVVSES"
FT   gene            complement(288027..288227)
FT                   /locus_tag="SeHA_C0276"
FT   CDS_pept        complement(288027..288227)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0276"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF06786"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0276"
FT                   /db_xref="EnsemblGenomes-Tr:ACF66284"
FT                   /db_xref="InterPro:IPR009624"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4TK66"
FT                   /protein_id="ACF66284.1"
FT                   /translation="MEKYCELVRKRYAEIASGDLGYVPDALGCVLKVLNEVAADSALSE
FT                   SVREKAAYAAANLLVSDYVNE"
FT   gene            288425..288970
FT                   /locus_tag="SeHA_C0277"
FT   CDS_pept        288425..288970
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0277"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF07152"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0277"
FT                   /db_xref="EnsemblGenomes-Tr:ACF68033"
FT                   /protein_id="ACF68033.1"
FT                   /translation="MALKATIYKAVVNVADLDRNRFLDAALTLARHPSETQERMMLRLL
FT                   AWIKYADERLQFTRGLSAEDEPEAWLRNDHLGIDLWIELGLPDERRIKKACTQASDVAL
FT                   FAYNSRAAQIWWQQHQSKCAQFANLSVWYLDDGQLAQLSEFADRTMTLQATIQDGAIWL
FT                   SDARNNLEIQLTAWQQPS"
FT   gene            288967..289389
FT                   /locus_tag="SeHA_C0278"
FT   CDS_pept        288967..289389
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0278"
FT                   /product="peptidyl-tRNA hydrolase domain protein"
FT                   /note="identified by match to protein family HMM PF00472"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0278"
FT                   /db_xref="EnsemblGenomes-Tr:ACF68789"
FT                   /protein_id="ACF68789.1"
FT                   /translation="MIAISRTVSIADNELEITAIRAQGAGGQHVNKTSSAIHLRFDIRA
FT                   SGLPEYYKQRLLTASHHLISDDGVIIIKAQEFRSQELNREAAIARLVAVIKELTAEQKS
FT                   RRATRPTRASKERRLSSKAQKSSVKALRGKVRRPLD"
FT   gene            289421..290122
FT                   /locus_tag="SeHA_C0279"
FT   CDS_pept        289421..290122
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0279"
FT                   /product="copper homeostasis protein CutF"
FT                   /note="identified by match to protein family HMM PF04170"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0279"
FT                   /db_xref="EnsemblGenomes-Tr:ACF67215"
FT                   /protein_id="ACF67215.1"
FT                   /translation="MVRTAILSVAAACTLFALIGCNNRAEVDALQPAQAAELKPMQQSW
FT                   RGVLPCADCEGIETSLFLEKDGTWVMNERYQGVREEPSSFASYGTWARTADKLVLTDSN
FT                   GEKSYYRAKGNELEMLDREGNPVASQLNYTLVPVTASLPVTPMPLRGMYVYRADAATFT
FT                   DCATGKRLPVASNAQLERGYLAAKGEAEKPVLLTVEGHFVLAANPDTGEPVKTLIADKN
FT                   VKFAPGKDCTH"
FT   gene            complement(290196..291914)
FT                   /gene="proS"
FT                   /locus_tag="SeHA_C0280"
FT   CDS_pept        complement(290196..291914)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="proS"
FT                   /locus_tag="SeHA_C0280"
FT                   /product="prolyl-tRNA synthetase"
FT                   /EC_number="6.1.1.15"
FT                   /note="identified by match to protein family HMM PF00587;
FT                   match to protein family HMM PF03129; match to protein
FT                   family HMM PF04073; match to protein family HMM TIGR00409"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0280"
FT                   /db_xref="EnsemblGenomes-Tr:ACF68125"
FT                   /db_xref="GOA:B4TK70"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002316"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR004500"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR007214"
FT                   /db_xref="InterPro:IPR023717"
FT                   /db_xref="InterPro:IPR033730"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="InterPro:IPR036754"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4TK70"
FT                   /protein_id="ACF68125.1"
FT                   /translation="MRTSQYLLSTLKETPADAEVISHQLMLRAGMIRKLASGLYTWLPT
FT                   GLRVLKKVENIVREEMNNAGAIEVSMPVVQPADLWQESGRWEQYGPELLRFVDRGERPF
FT                   VLGPTHEEVITDLVRNELSSYKQLPLNFFQIQTKFRDEVRPRFGVMRSREFLMKDAYSF
FT                   HTSQESLQETYDAMYAAYSRIFSRMGLDFRAVQADTGSIGGNASHEFQVLAQSGEDDIV
FT                   FSDVSDYAANIELAEAIAPQTPRAAATQEMTLVDTPNAKTIAELVEQFNLPIEKTVKTL
FT                   LVKAVKDSKSPLVALLVRGDHELNEVKAEKLPHVASPLTFATEEEIRAVINAGPGSLGP
FT                   VNMPIPVIIDRTVAAMSDFAAGANIDGKHYFGINWDRDVATPVVADIRNVVAGDPSPDG
FT                   QGTLLIKRGIEVGHIFQLGTKYSEALKASVQGEDGRNQILTMGCYGIGVTRVVAAAIEQ
FT                   NFDERGIVWPDAIAPFQVAILPMNMHKSFRVQELAEKLYSELRAQGIEVLMDDRKERPG
FT                   VMFADMELIGIPHTIVIGDRNLDNDDIEYKYRRSGEKSLIKTGDIVDYLVKAIKG"
FT   gene            complement(292025..292765)
FT                   /locus_tag="SeHA_C0281"
FT   CDS_pept        complement(292025..292765)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0281"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF01980;
FT                   match to protein family HMM TIGR00104"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0281"
FT                   /db_xref="EnsemblGenomes-Tr:ACF68482"
FT                   /protein_id="ACF68482.1"
FT                   /translation="MYRVRPEYFGEMSSFQFEQIGVIRSPYKEKFAVPRQPGLVKSACG
FT                   ELHLIAPYNQADAVRGLEAFSHLWVLFVFHQTMDGGWRPTVRPPRLGGNARMGVFATRS
FT                   TFRPNPIGMSLVALKGIECRKESVILKLGSLDLVDGTPVVDIKPYLPFAEALPDAAASY
FT                   AQQAPIAEMPVSFTAEVAQQLTTLERRYPQLRTFICDVLAQDPRPAYRKGEETGKTYAV
FT                   WLHDFNVRWRVVNTGFEVFALEPR"
FT   gene            complement(292729..293133)
FT                   /gene="rcsF"
FT                   /locus_tag="SeHA_C0282"
FT   CDS_pept        complement(292729..293133)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rcsF"
FT                   /locus_tag="SeHA_C0282"
FT                   /product="exopolysaccharide synthesis regulator RcsF"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0282"
FT                   /db_xref="EnsemblGenomes-Tr:ACF68237"
FT                   /protein_id="ACF68237.1"
FT                   /translation="MRALPICLLALMLGGCSMLSRSPVEPVQSTATPPKAEPEKPKAPR
FT                   AAPVRIYTNAEDLVGKPFRDLGEVSGESCQATNQDSPPNIPTARKRMQINASKMKANAV
FT                   LLHSCEITSGTPGCYRQAVCIGSALNISAK"
FT   gene            complement(293252..294067)
FT                   /gene="metQ"
FT                   /locus_tag="SeHA_C0283"
FT   CDS_pept        complement(293252..294067)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metQ"
FT                   /locus_tag="SeHA_C0283"
FT                   /product="D-methionine ABC transporter, periplasmic
FT                   D-methionine-binding lipoprotein"
FT                   /note="identified by match to protein family HMM PF03180;
FT                   match to protein family HMM TIGR00363"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0283"
FT                   /db_xref="EnsemblGenomes-Tr:ACF68870"
FT                   /protein_id="ACF68870.1"
FT                   /translation="MAFKFKTFAAVGALIGSLALAGCGQDEKDPNHIKVGVIVGAEQQV
FT                   AEVAQKVAKEKYGLDVELVTFNDYVLPNEALSKGDIDANAFQHKPYLDQQIKDRGYKLV
FT                   SVGKTFVYPIAGYSKKIKSLDELKDGSQVAVPNDPTNLGRSLLLLQKVGLIKLKDGVGL
FT                   LPTSLDIVENPKNLKIVELEAPQLPRSLDDAQIALAVINTTYASQIGLTPAKDGIFVED
FT                   KDSPYVNLIVTREDNKDAENVKKFVQAYQSDEVYEAANKVFNGGAVKGW"
FT   gene            complement(294106..294759)
FT                   /gene="metI"
FT                   /locus_tag="SeHA_C0284"
FT   CDS_pept        complement(294106..294759)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metI"
FT                   /locus_tag="SeHA_C0284"
FT                   /product="D-methionine ABC transporter, permease protein"
FT                   /note="identified by match to protein family HMM PF00528"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0284"
FT                   /db_xref="EnsemblGenomes-Tr:ACF69517"
FT                   /protein_id="ACF69517.1"
FT                   /translation="MSEAMMWLLVRGVWETLAMTFVSGFFGFVIGLPVGVLLYVTRPGQ
FT                   IMENARLYRSLSAVVNIFRSIPFIILLVWMIPFTRIIVGTSIGLQAAIVPLTVGAAPFI
FT                   ARMVENALLEIPAGLIEASRAMGATPLQIVRKILLPEALPGLVNAATITLITLVGYSAM
FT                   GGAVGAGGLGQIGYQYGYIGYNATVMNTVLVLLVVLVYLIQLSGDRIVRAVTHK"
FT   gene            complement(294752..295783)
FT                   /gene="metN"
FT                   /locus_tag="SeHA_C0285"
FT   CDS_pept        complement(294752..295783)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metN"
FT                   /locus_tag="SeHA_C0285"
FT                   /product="D-methionine ABC transporter, ATP-binding
FT                   protein"
FT                   /note="identified by match to protein family HMM PF00005;
FT                   match to protein family HMM PF09383; match to protein
FT                   family HMM TIGR02314"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0285"
FT                   /db_xref="EnsemblGenomes-Tr:ACF70139"
FT                   /protein_id="ACF70139.1"
FT                   /translation="MIKLSNITKVFQQGTRTIQALNNVSLHVPAGQIYGVIGASGAGKS
FT                   TLIRCVNLLERPTEGSVMVGGQELTTLSESELTKARRQIGMIFQHFNLLSSRTVFGNVA
FT                   LPLELDNTPKEEIKRRVTELLDLVGLGDKHDSYPANLSGGQKQRVAIARALASNPKVLL
FT                   CDEATSALDPATTRSILELLKDINRRLGLTILLITHEMDVVKRICDCVAVISNGELIEQ
FT                   DTVSEVFSHPKTPLAQKFIQSTLHLDIPEDYQARLKASPETDSVPMLRMEFTGQSVDAP
FT                   LLSETARRFNVNNNIISAQMDYAGGVKFGIMLTEMHGTQEETQAAIAWLQDHHVKVEVL
FT                   GYV"
FT   gene            295973..296539
FT                   /locus_tag="SeHA_C0286"
FT   CDS_pept        295973..296539
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0286"
FT                   /product="D,D-heptose 1,7-bisphosphate phosphatase"
FT                   /note="identified by match to protein family HMM PF08645;
FT                   match to protein family HMM TIGR00213; match to protein
FT                   family HMM TIGR01656; match to protein family HMM
FT                   TIGR01662"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0286"
FT                   /db_xref="EnsemblGenomes-Tr:ACF66349"
FT                   /protein_id="ACF66349.1"
FT                   /translation="MAKSVPAIFLDRDGTINVDHGYVHEIDAFEFIDGVIDAMRELKKM
FT                   GYALVVVTNQSGIARGKFTEAQFETLTEWMDWSLADRDVDLDGIYYCPHHPQGSIEEFR
FT                   QVCDCRKPHPGMLISARDFLHIDMAASYMVGDKLEDMQAAAAANVGTKVLVRTGKPVTA
FT                   EAENAADWVLNSLADLPSAIKKQQK"
FT   gene            complement(296610..296732)
FT                   /pseudo
FT                   /locus_tag="SeHA_C0287"
FT                   /note="conserved hypothetical protein; this gene contains a
FT                   frame shift which may be the result of sequencing error"
FT   gene            296917..298450
FT                   /gene="rrs"
FT                   /locus_tag="SeHA_C0288"
FT   rRNA            296917..298450
FT                   /gene="rrs"
FT                   /locus_tag="SeHA_C0288"
FT                   /product="16S ribosomal RNA"
FT   gene            298521..298597
FT                   /locus_tag="SeHA_C0289"
FT   tRNA            298521..298597
FT                   /locus_tag="SeHA_C0289"
FT                   /product="tRNA-Ile"
FT   gene            298706..298783
FT                   /locus_tag="SeHA_C0290"
FT   tRNA            298706..298783
FT                   /locus_tag="SeHA_C0290"
FT                   /product="tRNA-Ala"
FT   gene            302288..302403
FT                   /gene="rrf"
FT                   /locus_tag="SeHA_C0291"
FT   rRNA            302288..302403
FT                   /gene="rrf"
FT                   /locus_tag="SeHA_C0291"
FT                   /product="5S ribosomal RNA"
FT   gene            302594..302672
FT                   /locus_tag="SeHA_C0292"
FT   tRNA            302594..302672
FT                   /locus_tag="SeHA_C0292"
FT                   /product="tRNA-Asp"
FT   gene            302815..303639
FT                   /gene="dkgB"
FT                   /locus_tag="SeHA_C0293"
FT   CDS_pept        302815..303639
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dkgB"
FT                   /locus_tag="SeHA_C0293"
FT                   /product="2,5-didehydrogluconate reductase B"
FT                   /EC_number="1.1.1.274"
FT                   /note="identified by match to protein family HMM PF00248"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0293"
FT                   /db_xref="EnsemblGenomes-Tr:ACF66558"
FT                   /protein_id="ACF66558.1"
FT                   /translation="MIKKRNSMTIPAFGLGTFRLKDDVVIASVKTALELGYRAVDTAQI
FT                   YDNEAAVGQAITESGVPRSELYITTKIWIENLSKDKLIPSLKESLKKLRTDYVDLTLIH
FT                   WPSPGDAVSVEEFMLALLEAKKQGLTREIGISNFTIPLMKKAIAAVGADNIATNQIELS
FT                   PYLQNRKVVDWAKAHGIHITSYMTLAYGKALKDEVIARIAAKHNATPAQVILAWAMGEG
FT                   YSVIPSSTRRENLASNLLAQDLHLDAEDKNAIAALDCNDRLVSPEGLAPAWD"
FT   gene            complement(303660..304574)
FT                   /locus_tag="SeHA_C0294"
FT   CDS_pept        complement(303660..304574)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0294"
FT                   /product="LysR substrate binding domain protein"
FT                   /note="identified by match to protein family HMM PF00126;
FT                   match to protein family HMM PF03466"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0294"
FT                   /db_xref="EnsemblGenomes-Tr:ACF67353"
FT                   /protein_id="ACF67353.1"
FT                   /translation="MKATSEELAIFVAVVESGSFSRAAEQLGQANSAVSRAVKKLEMKL
FT                   GVSLLNRTTRQLSLTEEGERYFRRVQQILQEMAAAETEIMESRNTPRGLLRIDAATPVM
FT                   LHFLMPLIKPFRERYPEITLSLVSSETFINLIERKVDVAIRAGTLTDSSLRARPLFTSY
FT                   RKIIASPDYIARFGKPETVEELKRHLCLGFSEPVSLNTWPIACSDGQLHEIKCGISSNS
FT                   GETLKQLCLNGNGIACLSDYMIDKEIARGELVELLADKRLPVEMPFSAVYYSDRAVSTR
FT                   IRAFIDFLSEYIRTAPAGAVKEG"
FT   gene            304679..305854
FT                   /locus_tag="SeHA_C0295"
FT   CDS_pept        304679..305854
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0295"
FT                   /product="inner membrane transport protein YdhP"
FT                   /note="identified by match to protein family HMM PF07690"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0295"
FT                   /db_xref="EnsemblGenomes-Tr:ACF66669"
FT                   /protein_id="ACF66669.1"
FT                   /translation="MPLALFALTISAFAIGTTEFVIVGLVPTIAQQLAISLPSAGMLVS
FT                   IYALGVAIGAPVLTALTGRLPRKQLLVALMVLFTAGNLLAWQAPGYMTLIVARLLTGLA
FT                   HGVFFSIGSTIATSLVPKEKAASAIAIMFGGLTVALVTGVPLGTFIGQHFGWRETFLAV
FT                   SLLGVIALMSSQLLIPANIPGRAAASIRDQVKVLTHPRLLLIYAVTALGYGGVFTAFTF
FT                   LAPMMQDLAGFSPAAVSWILLGYGVSVAIGNIWGGKLADKHGAVPALKFIFAALFVLLM
FT                   VFQVTASTQYAALATILVMGVFAFGNVPGLQVYVVQKAEQFTPNAVDVASGLNIAAFNI
FT                   GIALGSVIGGQTVEHYGLAQTPWIGALIVLVAFLLMGVSGRLDKPVRIALE"
FT   gene            305986..306786
FT                   /locus_tag="SeHA_C0296"
FT   CDS_pept        305986..306786
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0296"
FT                   /product="protein YafD"
FT                   /note="identified by match to protein family HMM PF03372"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0296"
FT                   /db_xref="EnsemblGenomes-Tr:ACF68372"
FT                   /db_xref="GOA:B4TK80"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR022958"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4TK80"
FT                   /protein_id="ACF68372.1"
FT                   /translation="MRKNTYAMRYVAGQPAERILPPGSFASIGQALPAGEPLSSEERIR
FT                   ILVWNIFKQQRAEWLSVLKNYGKDAHLVLLQEAQTTPELVQFATANYLAADQVPAFVLP
FT                   QHPSGVMTLSAAHPVYCCPLREREPILRLAKSALVTVYPLPDTRLLMVVNVHAVNFSLG
FT                   VDVYSKQLLPIGDQIAHHSGPVIMAGDFNAWSRPRMNALYRFAREMSLRQVRFTDDQRR
FT                   RAFGRPLDFVFYRGLNVNEASVLVTRASDHNPLLVEFSPGKPEQ"
FT   gene            306864..307634
FT                   /locus_tag="SeHA_C0297"
FT   CDS_pept        306864..307634
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0297"
FT                   /product="methyltransferase, UbiE/COQ5 family"
FT                   /note="identified by match to protein family HMM PF01209;
FT                   match to protein family HMM PF08241; match to protein
FT                   family HMM PF08242"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0297"
FT                   /db_xref="EnsemblGenomes-Tr:ACF67699"
FT                   /protein_id="ACF67699.1"
FT                   /translation="MTTHSHHDNVEKQFGSQANAYLHSAVHASGRDLARLAQRLSDFSH
FT                   ANVLDMGCGAGHASFVAAQHAYSVVAYDLSASMLEVVAGAAEERHLSNITLRQGYAEKL
FT                   PFEDASFEVVISRYSAHHWHDVGQALREVYRVLKPGGVLIIMDVMSPGHPVRDIWLQTV
FT                   EALRDTSHVRNYSSGEWLTMVNNAMLVTNTVITDRLSLEFRSWVTRMRTPAPLVEAIRL
FT                   YQASAPVEVKRYFELQDDGSFSSDTIMLEAHKAV"
FT   gene            complement(307690..308910)
FT                   /gene="mltD"
FT                   /locus_tag="SeHA_C0298"
FT   CDS_pept        complement(307690..308910)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mltD"
FT                   /locus_tag="SeHA_C0298"
FT                   /product="membrane-bound lytic murein transglycosylase D"
FT                   /EC_number="2.4.-.-"
FT                   /note="identified by match to protein family HMM PF01464;
FT                   match to protein family HMM PF01476"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0298"
FT                   /db_xref="EnsemblGenomes-Tr:ACF66281"
FT                   /protein_id="ACF66281.1"
FT                   /translation="MDDGTSIAPDQDLWAFIGDELKMGIPENSRIREQKQKYLRNKSYL
FT                   HDVTLRAEPYMYWIAGQVKKRNMPMELVLLPIVESAFDPHATSGANAAGIWQIIPSTGR
FT                   NYGLKQTRNYDARRDVVASTTAALDMMQRLNKMFDGDWLLTVAAYNSGEGRVMRAIKAN
FT                   KARGKPTDFWSLSLPRETKLYVPKMLALSEILKNSKRYGVRLPTTDESRALARVRLNSP
FT                   VEMAQVADMAGMSISKLKTFNAGVKGSTLGVSGPQYVMVPKKHAEQLRESLASGEIDAV
FT                   QSQLIADNTPLNSRSYKVRSGDTLSGIASRLGVSTKDLQQWNNLRGSRLKIGQSLTVDA
FT                   GSSAQRLANNSDSITYRVRKGDSLSSIARRHGVNIKDVMRWNHDTDNLQPGDQLTLFVK
FT                   DNSTPDS"
FT   gene            complement(309129..309884)
FT                   /gene="gloB"
FT                   /locus_tag="SeHA_C0299"
FT   CDS_pept        complement(309129..309884)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gloB"
FT                   /locus_tag="SeHA_C0299"
FT                   /product="hydroxyacylglutathione hydrolase"
FT                   /EC_number="3.1.2.6"
FT                   /note="identified by match to protein family HMM PF00753;
FT                   match to protein family HMM TIGR03413"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0299"
FT                   /db_xref="EnsemblGenomes-Tr:ACF66976"
FT                   /db_xref="GOA:B4TK83"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR017782"
FT                   /db_xref="InterPro:IPR032282"
FT                   /db_xref="InterPro:IPR035680"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4TK83"
FT                   /protein_id="ACF66976.1"
FT                   /translation="MNLNSIPAFQDNYIWVLTNDEGRCVIVDPGEAAPVLKAIAEHKWM
FT                   PEAIFLTHHHHDHVGGVKELLQHFPQMTVYGPAETQDKGATHLVGDGDTIRVLGEKFTL
FT                   FATPGHTLGHVCYFSHPYLFCGDTLFSGGCGRLFEGTPSQMYQSLMKINSLPDDTLICC
FT                   AHEYTLANIKFALSILPHDSFINEYYRKVKELRVKKQMTLPVILKNERKINLFLRTEDI
FT                   DLINEINKETILQQPEARFAWLRSKKDTF"
FT   gene            309919..310641
FT                   /locus_tag="SeHA_C0300"
FT   CDS_pept        309919..310641
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0300"
FT                   /product="putative methyltransferase"
FT                   /note="identified by match to protein family HMM PF08241"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0300"
FT                   /db_xref="EnsemblGenomes-Tr:ACF65945"
FT                   /protein_id="ACF65945.1"
FT                   /translation="MKPARLSQTVVAPGCWGELPWGNYYREALEQQLNPWFAKMYGFHL
FT                   LKIGNLSAEINSEACAVSHQVNVSSQGSPMQVLADPLHLPFADKSVDVCLLAHTLPWCT
FT                   DPHRLLREADRVLIDDGWLVISGFNPLSLMGLRKLVPVLRKTPPYNSRMFTLMRQLDWL
FT                   SLLNFEVLHYSRFHVLPWKKQGGRLLNTHIPALGCLQLIVARKRTIPLTLNPLRHNKSK
FT                   TPIRQTVGATRQYRKPDG"
FT   gene            complement(310638..311105)
FT                   /gene="rnhA"
FT                   /locus_tag="SeHA_C0301"
FT   CDS_pept        complement(310638..311105)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rnhA"
FT                   /locus_tag="SeHA_C0301"
FT                   /product="ribonuclease HI"
FT                   /EC_number="3.1.26.4"
FT                   /note="identified by match to protein family HMM PF00075"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0301"
FT                   /db_xref="EnsemblGenomes-Tr:ACF66340"
FT                   /db_xref="GOA:B4TK85"
FT                   /db_xref="InterPro:IPR002156"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR022892"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4TK85"
FT                   /protein_id="ACF66340.1"
FT                   /translation="MLKQVEIFTDGSCLGNPGPGGYGAILRYRGHEKTFSEGYTLTTNN
FT                   RMELMAAIVALEALKEHCEVTLSTDSQYVRQGITQWIHNWKKRGWKTAEKKPVKNVDLW
FT                   KRLDAALGQHQIKWVWVKGHAGHPENERCDELARAAAMNPTQEDSGYQAEA"
FT   gene            311160..311900
FT                   /gene="dnaQ"
FT                   /locus_tag="SeHA_C0302"
FT   CDS_pept        311160..311900
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaQ"
FT                   /locus_tag="SeHA_C0302"
FT                   /product="DNA polymerase III, epsilon subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="identified by match to protein family HMM PF00929;
FT                   match to protein family HMM TIGR00573; match to protein
FT                   family HMM TIGR01406"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0302"
FT                   /db_xref="EnsemblGenomes-Tr:ACF68042"
FT                   /protein_id="ACF68042.1"
FT                   /translation="MTDMSTAITRQIVLDTETTGMNQIGAHYEGHKIIEIGAVEVINRR
FT                   LTGNNFHVYLKPDRLVDPEAFGVHGIADEFLLDKPVFADVVDEFLDYIRGAELVIHNAS
FT                   FDIGFMDYEFGLLKRDIPKTNTFCKVTDSLALARKMFPGKRNSLDALCSRYEIDNSKRT
FT                   LHGALLDAQILAEVYLAMTGGQTSMTFAMEGETQRQQGEATIQRIVRQASRLRVVFASE
FT                   EELAAHESRLDLVQKKGGSCLWRA"
FT   gene            312033..312111
FT                   /locus_tag="SeHA_C0303"
FT   tRNA            312033..312111
FT                   /locus_tag="SeHA_C0303"
FT                   /product="tRNA-Asp"
FT   gene            complement(312432..313481)
FT                   /locus_tag="SeHA_C0304"
FT   CDS_pept        complement(312432..313481)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0304"
FT                   /product="ImpA-related N-family protein"
FT                   /note="identified by match to protein family HMM PF06812"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0304"
FT                   /db_xref="EnsemblGenomes-Tr:ACF67414"
FT                   /protein_id="ACF67414.1"
FT                   /translation="MSLTKPVSAEQPCGPDPEYDPEYLLLFSRAAPQAEAQYGDFVSTP
FT                   EAVNWPEIERDARRLLTRSKDIRVLILLLRSRIQQAGAQGLAEILTQLAELSVIWSDAL
FT                   HPQLLTGEGASAESIEDAALARSNALAALLDHEGVMADIRGITLSNSAVLRLQVRDVER
FT                   ALSAPRPADALAPESVRQQLADLEARGALPLAAFREAQESAERLQVWARETLGDLAPDF
FT                   SRLRQLLALLPDVVQTTTPEIPPSPAPVPDPAGTVMDNAVPARAEDVPPVNAPPGISLP
FT                   HNAEPGPIRDRNDALERLRCIRRWFESSEPSSPTIPLLRQAERLVGKRFSEVINEIPVE
FT                   LLEKWDALE"
FT   gene            complement(313498..314493)
FT                   /locus_tag="SeHA_C0305"
FT   CDS_pept        complement(313498..314493)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0305"
FT                   /product="type VI secretion protein, family"
FT                   /note="identified by match to protein family HMM PF06996;
FT                   match to protein family HMM TIGR03347"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0305"
FT                   /db_xref="EnsemblGenomes-Tr:ACF68477"
FT                   /protein_id="ACF68477.1"
FT                   /translation="MTGALDQAQKTPWRYGFLNLMRRVDAQLCDTPAGSIWQPRMEKFR
FT                   LGQTPTMTFAPREIAQVSWQDGRLHLSLYSLGLWGPNGPLPLHYTELALNRSESRHDPT
FT                   LVHFSNIFHHRWLTQFWQAWRSAQSAGGGLDKPEHDRFAFYIASLSGQDLRESAESPLS
FT                   DHVRLAASAHLVRESRNPDGLAATLAHYFSVPFAVKEFALHWITVANDEITRLGTPAQS
FT                   SVLGNGALIGQAVPDMQYKFRLIIGPLTLEDYLRFLPGGNNLPVLTELVRTFIGFEYCW
FT                   EIELQLKPHAAPPAVIGGAQRLGWTAWAGKAMHDRPVTGMIFEPEHGLTH"
FT   gene            complement(314490..316373)
FT                   /gene="vasA"
FT                   /locus_tag="SeHA_C0306"
FT   CDS_pept        complement(314490..316373)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="vasA"
FT                   /locus_tag="SeHA_C0306"
FT                   /product="type VI secretion protein, family"
FT                   /note="identified by match to protein family HMM PF05947;
FT                   match to protein family HMM TIGR03359"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0306"
FT                   /db_xref="EnsemblGenomes-Tr:ACF69109"
FT                   /protein_id="ACF69109.1"
FT                   /translation="MDPRLLEYYNRELSYLRETGAEFATLHPKIAARLGMQRTDIADPY
FT                   VERMIEAFSFLSARTQLKIDAEFPRFTQRLLEVVSPNYVTPTPSMAVAKLYPDTQEGDL
FT                   AKGVTVPRDTAFVSPIPEGENTACQFRSSQDVTLWPLSIEEVRLTAAPPDMPALHRYLP
FT                   PNIHVAGALRITLRTFGELTFSELAGPARLPFYLCGEERIASHLFELLHTSAVATLAGE
FT                   PGHFDGELNVNLQHPVAHEGLEPGQGLLPLAWNVFHGHNLLHEFFACPERFYFFTPTGL
FT                   SAGLQKVQGNVAEIVILLNRLPPDWLIHQTDAAQFSLFCTPVINLFPRTTTRIEVTHSV
FT                   TEQHLVVDRTRPLDYEVFSVQEVEGLEAETTRKMIFRPLYHTRNNDEGNHGRYFSLRRE
FT                   PRRSSENARRYGTRTPYTGSEVFLSLVDQHEAPYPENLRHITVTAMVTNRDLPCLIPRN
FT                   GRDDLTVDAAIPVAGVGLIRPPRPPQPPLAEREMAWRLIRQLSFNYLPLADLDHRTGGQ
FT                   ALRDLLNLFIPAHDSPQSRQVRSLIGCKTTPVTRRLPGSGLLVYGRGVSCELTVDEEGF
FT                   SGISPYLFGLVLEHYIARHVSINTFSQMTLHSMQRGHVMTWPVRTGQRGSV"
FT   gene            complement(316389..316883)
FT                   /locus_tag="SeHA_C0307"
FT   CDS_pept        complement(316389..316883)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0307"
FT                   /product="type VI secretion system lysozyme-related
FT                   protein"
FT                   /note="identified by match to protein family HMM PF04965;
FT                   match to protein family HMM TIGR03357"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0307"
FT                   /db_xref="EnsemblGenomes-Tr:ACF66528"
FT                   /protein_id="ACF66528.1"
FT                   /translation="MSTSRFTPANHLLPTLFDRLCDNAPYQKIDRDISVTPVQLKEIIR
FT                   RDLSFLLNTISHEGDIDARRYPQAAASVLNYGLPPLAGSFMYEHKWDDISEAIRRAIIR
FT                   FEPRLNAATLRVTPLLDEARQGSYNTLQFEIRGQILTQPYPTEFLVRSALDMELSRITF
FT                   F"
FT   gene            complement(316880..317704)
FT                   /locus_tag="SeHA_C0308"
FT   CDS_pept        complement(316880..317704)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0308"
FT                   /product="SciE protein"
FT                   /note="identified by match to protein family HMM PF07024"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0308"
FT                   /db_xref="EnsemblGenomes-Tr:ACF67186"
FT                   /protein_id="ACF67186.1"
FT                   /translation="MKKTDTLPATLSALIQEYSFAEGIQMAEQQVRENPAKALCRHSLF
FT                   QLLCVAGDWSRALHQLQLCARMEANYTQEARLYRELVRCEMFRHTVFQGEQRPGFLLPQ
FT                   PVWVESLLAALACHDDTGEVDKHRNTALEAITDTGGQWNGGAFDWASDSDSRLGPVLEL
FT                   VTGGVYIWLPFSQIRSLESPQPTRLTDLLWKPVNITLVNGDTHGAWLFTRYSGSESASD
FT                   ALRLCRETAWQDGPGETTVRALGQKVWLTSHGDISLLDMAHCTFHAQENDGA"
FT   gene            complement(317691..318581)
FT                   /locus_tag="SeHA_C0309"
FT   CDS_pept        complement(317691..318581)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0309"
FT                   /product="putative cytoplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0309"
FT                   /db_xref="EnsemblGenomes-Tr:ACF70425"
FT                   /protein_id="ACF70425.1"
FT                   /translation="MWELRKIQSQGITDNAQYPAGTYIVFTAAAPYIPLFEQHGKDDIA
FT                   LSLVRHEEAWWIVNHSDELCCAVNEQVMEPHHRMRLNDGDTIEWGLSSWCLARTNDESR
FT                   PDVSFPQLVQSSESVAEYLDLDWFKQQQLNPQNPFDIIPVRETASSYTGHEADSTLHQL
FT                   YQEYQQALRPSGQEKPLRPKPFPRNEDAVTQDLTSLYDKKGDTDTLQDMVAGAPGIDAI
FT                   LDTLDTTGEGEMHWLAMESMPDILQLLPPEQAGKTAHSEILPDLTRREHRIIGIDSHYR
FT                   ITPTQKNGNTAHEKN"
FT   gene            318961..321600
FT                   /gene="clpV"
FT                   /locus_tag="SeHA_C0310"
FT   CDS_pept        318961..321600
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="clpV"
FT                   /locus_tag="SeHA_C0310"
FT                   /product="type VI secretion ATPase, ClpV1 family"
FT                   /note="identified by match to protein family HMM PF00004;
FT                   match to protein family HMM PF07724; match to protein
FT                   family HMM PF07728; match to protein family HMM TIGR03345"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0310"
FT                   /db_xref="EnsemblGenomes-Tr:ACF65835"
FT                   /protein_id="ACF65835.1"
FT                   /translation="METPVSRSALYGKLAGPLFRSLESATAFCKLRSNPWVELTHWLHQ
FT                   LTQQPDNDILHVLRHYQIPLSDVEKALLRQLDMLPAGASAISDFSHHIDLSVEKAWMLA
FT                   SVRYGDNKIRSGWLLLALLTTPELRRVLSSICAPLATLPVDELTEILPSLIETSPEAQE
FT                   RPYDGSGLASAIPGESSQAIPNGGQDGKSALAKYCQDMTAQARDGKIDPVTGREHEIRT
FT                   MTDILLRRRQNNPLLTGEAGVGKTAVVEGFALAIAQGEVPPALREVRLLALDVGALLAG
FT                   ASMKGEFESRLKGLLEEAGRSPQPVILFVDEVHTLVGAGGASGTGDAANLLKPALARGT
FT                   LRTIGATTWSEYKRHIEKDPALTRRFQVLQIAEPEEIPAMEMVRGLVDTLEKHHNVLIL
FT                   DEAVRAAVQLSHRYIPARQLPDKAISLLDTAAARVALTLHTPPASVQFLRQQLKAAEME
FT                   RSLLQKQEKMGIQSDERRDALTARIFSLNNELTASESRWQRELELVHTLQELRVAESDA
FT                   DDKTTLQQAETALREWQGDAPVVFPEVSAAVVAAIVADWTGIPAGRMVKDEASQVLELP
FT                   ARLAQRVTGQDGALAQIGERIQTARAGLGDPRKPVGVFMLAGPSGVGKTETALALAEAI
FT                   YGGEQNLVTINMSEFQEAHTVSTLKGAPPGYVGYGEGGVLTEAVRRHPWSVVLLDEIEK
FT                   AHHDVHELFYQVFDKGGMEDGEGTHVDFKNTTLLLTTNVGSDLISQMCEDPALMPDATG
FT                   LKEALMPELRKHFPAAFLGRVTVIPYLPLDEPSRGVIARLHLDRLVARMGEQHGVTLTY
FT                   SEELVAHIVACCPMHETGARLLIGYIEQHILPRLSRYWLQAMTEKAAIRQIDIGVNGDE
FT                   QIVFEIVC"
FT   gene            321700..322242
FT                   /locus_tag="SeHA_C0311"
FT   CDS_pept        321700..322242
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0311"
FT                   /product="type VI secretion protein, family"
FT                   /note="identified by match to protein family HMM PF05591;
FT                   match to protein family HMM TIGR03358"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0311"
FT                   /db_xref="EnsemblGenomes-Tr:ACF69269"
FT                   /protein_id="ACF69269.1"
FT                   /translation="MAINNSAQKFIARNRAPRVQIEYDVEIYGSEKKIELPFVMAVLAD
FT                   LAGKPREELPPVTDRKFLDIDIDNFNERMKAIAPRVAFAVPNTLTGEGQLMVDITLENM
FT                   DDFSPAQIARKVDALNQLLEARTQLANLQTYMDGKAGAENLVNKLLQDPTLLKTLANAP
FT                   KPAATQQGVSADNESAE"
FT   gene            322266..323774
FT                   /locus_tag="SeHA_C0312"
FT   CDS_pept        322266..323774
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0312"
FT                   /product="type VI secretion protein, EvpB/family"
FT                   /note="identified by match to protein family HMM PF05943;
FT                   match to protein family HMM TIGR03355"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0312"
FT                   /db_xref="EnsemblGenomes-Tr:ACF69746"
FT                   /protein_id="ACF69746.1"
FT                   /translation="MANSNMQATDAVAQDTVSASGEFDTLLNQAFRPKTTQAAKAVEAA
FT                   VQTLAQQALANTITVSDDAYKSISAIIAQIDFKLTEQIKLILQHPDWQKLESSWRGMEH
FT                   LVYNTETDEKLKIRFMNLSKDELRRNMKRYKGIAWDQSPMFKKLYEAEYGQLGGEPYGC
FT                   IIADYYFDHTPPDVDLLGSIAKVAASAHAPFIAGASPSVLQMDSWQELANPRDLTKIVT
FT                   QNLEYAPWNSLRASEDSRYIGLTMPRFLARLPYGAKTNPVDEFDFEEDADGSDHTKYVW
FT                   SNAAYAMGVNINRSFKHYGWCTLIRGVESGGAVENLPCHTFPTDDGGVDMKCPTEIAIS
FT                   DRREAELAKNGFIPLIHRKNSDYAAFIGAQSLQKPQEYYDPDATANANLSARLPYLFAC
FT                   SRFAHFLKCIVRDKIGSFKEREDMQRWLNEWIMNYVDADPVNSSQETKARRPLAAAEVV
FT                   VEEVEGNPGYYDAKFFLRPHFQLEGLTGSLRLVTKLPSVKQGNA"
FT   gene            324200..324625
FT                   /locus_tag="SeHA_C0313"
FT   CDS_pept        324200..324625
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0313"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0313"
FT                   /db_xref="EnsemblGenomes-Tr:ACF67842"
FT                   /protein_id="ACF67842.1"
FT                   /translation="MQKPILLLNSTCIVGGILWLLPVIVVHADEIVCPAVIHFSQAPII
FT                   SSAEGWNVSSRAARMLNDGGFLSSGDPKEQADLKGEDAVVDGKKGRLWEIDPEDNRRGI
FT                   WFSCSYGQWAVLLARKVQGTVATCWSPDVLPAKLICK"
FT   gene            324862..325347
FT                   /locus_tag="SeHA_C0314"
FT   CDS_pept        324862..325347
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0314"
FT                   /product="hemolysin-coregulated protein"
FT                   /note="identified by match to protein family HMM PF05638;
FT                   match to protein family HMM TIGR03344"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0314"
FT                   /db_xref="EnsemblGenomes-Tr:ACF67933"
FT                   /protein_id="ACF67933.1"
FT                   /translation="MAYDIFLKIDGIDGESMDDKHKNEIEVLSWRWNIHQESTMHAGSG
FT                   LGSGKVSVTNLDFDHYIDRASPNLFKYCASGKHIPQAILVMRKAGGNPLEYLKYTFTDL
FT                   IVAVVSPSGSHDGEIASRETVELSFSTVKQEYVVQNQQGGSGGTITAGYDFKANKEI"
FT   gene            325650..326135
FT                   /locus_tag="SeHA_C0315"
FT   CDS_pept        325650..326135
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0315"
FT                   /product="putative cytoplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0315"
FT                   /db_xref="EnsemblGenomes-Tr:ACF70196"
FT                   /protein_id="ACF70196.1"
FT                   /translation="MNRPSFNEAWLAFRKVNHSVADVGSIIGGNVGKNITGSYFQNACP
FT                   IRMSYVLNATGFPIARNSPYAKVSGADNKFYIYRVNDMIDYLTHTMGKPDLIVNNPKQS
FT                   DFIGKKGIIVVKGHGWSNARGHVTLWNGSICSDQCHLLNDPDNGPFVPEVGTLWILP"
FT   gene            326171..326503
FT                   /locus_tag="SeHA_C0316"
FT   CDS_pept        326171..326503
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0316"
FT                   /product="putative periplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0316"
FT                   /db_xref="EnsemblGenomes-Tr:ACF69385"
FT                   /protein_id="ACF69385.1"
FT                   /translation="MLVWQPSFAQEALTTQYSQSELLKNWALSHCLALVYKDDVVKNDA
FT                   RATASAYLEYGKQSVEIYHEIDEIAKKYSGLKYNGSISSDFNTMKCIDFIHDRELNELI
FT                   KRRVEK"
FT   gene            326646..327131
FT                   /locus_tag="SeHA_C0317"
FT   CDS_pept        326646..327131
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0317"
FT                   /product="hemolysin-coregulated protein"
FT                   /note="identified by match to protein family HMM PF05638;
FT                   match to protein family HMM TIGR03344"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0317"
FT                   /db_xref="EnsemblGenomes-Tr:ACF68812"
FT                   /protein_id="ACF68812.1"
FT                   /translation="MSYDIFLKIDGIDGESMDDKHKNEIEVLSWRWNIHQESTMHAGSG
FT                   LGSGKVSVTNLSFEHYIDRASPNLFKYCSSGKHIPQAILVMRKAGGNPLEYLKYTFTDL
FT                   IIAMVSPSGSQGGEIASRESIELSFSTVKQEYVVQNQQGGSGGTITAGYDFKANKEI"
FT   gene            327244..327735
FT                   /locus_tag="SeHA_C0318"
FT   CDS_pept        327244..327735
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0318"
FT                   /product="type VI secretion lipoprotein, family"
FT                   /note="identified by match to protein family HMM TIGR03352"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0318"
FT                   /db_xref="EnsemblGenomes-Tr:ACF69210"
FT                   /protein_id="ACF69210.1"
FT                   /translation="MPFALLLLSGCGSSDALPDLESQRLDLSVKASDKVNPDNQKKAAP
FT                   IEIRVYELKNDAAFTTADYWSLHDNDKSVLTDDLVRRDSFILRPGEEKKLRRPLNAQTT
FT                   AIGVLAGYRNLAKSVWRVTYKIPEAPEKAWYSSFIPGKGKVQLEAELEQSAIVITERDK
FT                   "
FT   gene            327739..329082
FT                   /locus_tag="SeHA_C0319"
FT   CDS_pept        327739..329082
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0319"
FT                   /product="type VI secretion protein, family"
FT                   /note="identified by match to protein family HMM PF05936;
FT                   match to protein family HMM TIGR03353"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0319"
FT                   /db_xref="EnsemblGenomes-Tr:ACF68144"
FT                   /protein_id="ACF68144.1"
FT                   /translation="MSWNDRVVWSEGQFLLPQMFQQQERYLEHVMHYRSLPLTPFFWGF
FT                   SHYNIDGEALNIGKLILKEASGIFPDGTPFNAPDHTPLPPPLTILPEHLNQQICLAVPV
FT                   RAPNSEETTFDNNPESLARFSVHEHDIRDANSLGRGAQLLQLSHLRLRLLPEKAVTGAW
FT                   IGLPLTRITGLNPDGRIDIDHDLIPPIINYQASSLMCTWLSWINDLIRMRADSLAERLT
FT                   GSDNHGHEAAEVSDYLLLQILNRFEPLLTHLAKTPLAPEVLYRYLSELAGELSTYVRPQ
FT                   TRRPAEYKEYKHLTPYAGLKSLVDEVQFLLNAVLIRGAQRIELKEGTYGILNAVVAPSD
FT                   LADFSTLVLAIKASMPTDVLLQHFAAQTKIGPSDRLPELIRSHLPGLALQVLPVPPRQI
FT                   PFQAGYIYYDIRREGALWEHIARYGGMAMHTAGEFPGLETELWGVRDK"
FT   gene            329079..330383
FT                   /locus_tag="SeHA_C0320"
FT   CDS_pept        329079..330383
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0320"
FT                   /product="SciP protein"
FT                   /note="identified by match to protein family HMM PF00691;
FT                   match to protein family HMM TIGR03349; match to protein
FT                   family HMM TIGR03350"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0320"
FT                   /db_xref="EnsemblGenomes-Tr:ACF67352"
FT                   /protein_id="ACF67352.1"
FT                   /translation="MTDSTLTPPAADMMSFLSTTPEHKDSEYETPVHTSQRTELNVIVE
FT                   DGPDSKLRLAEISAAANPLLAAARPLLCALAAMPAKLDAALVEPYRNLLVREMHLYQTL
FT                   CDQANLRREHVLAVRYCLCTALDEAANNTTWGRRGIWAGKSLLVTFHGESEGGIKLFQI
FT                   IGRLAASFQEHGNVLEVIYHLLGLGFEGRYSVQPDGRKQLDNIRQQLLTQLSQRRDPVM
FT                   PALSPDFQGAISGRLRRMRRVPVWLSAGIALLAMLTLFGLYSHRMDVQTVTVQQHIDAI
FT                   GIKLPPPPVPVHKLRLKILLANEIARGLLTVDEDDQHSRVVFRGDAMFVPGQKTVSDAI
FT                   RPVINKAAREIARVGGAVTVTGHTDSQPIHSAEFPSNLVLSEKRAAEVAALLTSGGVPA
FT                   GRVHIVGKGDTVPVADNGSKAGRAKNRRVEILVVE"
FT   gene            330388..331161
FT                   /locus_tag="SeHA_C0321"
FT   CDS_pept        330388..331161
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0321"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0321"
FT                   /db_xref="EnsemblGenomes-Tr:ACF66638"
FT                   /protein_id="ACF66638.1"
FT                   /translation="MMKKSTYDVSHHSAVCGVTGDYYRISATYHIKRSIRVFLIILCCL
FT                   LPGGVFAGSLINAGFISPDNVNLSIRDFLGFYASDNLQEKDNTLMYVLGVADATEGKTW
FT                   CGYGQVDSITINHTVLAWLDRYSVKKPDARASVLIEEALVKNFPCQGTEPSVKIASRSS
FT                   PVLSLTPDALNLSGNDFFKFWVSGNQRDKLRAGIYLLGVEDATENKLWCGYALFKTLTL
FT                   NELVYVSLKNKTNEELNSRAAELIINKLIEYPCKI"
FT   gene            331439..331795
FT                   /locus_tag="SeHA_C0322"
FT   CDS_pept        331439..331795
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0322"
FT                   /product="SciR protein"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0322"
FT                   /db_xref="EnsemblGenomes-Tr:ACF65990"
FT                   /protein_id="ACF65990.1"
FT                   /translation="MESSLFDAIKNDLNIDVATIIKDKTKVEILDISPVSKVYAESLAR
FT                   MDYEKDKAKNKVAILDKKSYFDSYYENQVKSIVAKYTYINKDKEKDIFIASSFMNADEC
FT                   SVRFNGYITLSREF"
FT   gene            331829..335698
FT                   /gene="icmF"
FT                   /locus_tag="SeHA_C0323"
FT   CDS_pept        331829..335698
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="icmF"
FT                   /locus_tag="SeHA_C0323"
FT                   /product="type VI secretion protein IcmF"
FT                   /note="identified by match to protein family HMM PF06744;
FT                   match to protein family HMM PF06761; match to protein
FT                   family HMM TIGR03348"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0323"
FT                   /db_xref="EnsemblGenomes-Tr:ACF68350"
FT                   /protein_id="ACF68350.1"
FT                   /translation="MQKFLSLLFSRRALAIVGVLVLALLVWFVGPLVSFDTLRPLASVG
FT                   SRVVTIALLLMLLVLWLVNWSMSIIGISVLCLAIGFVTPLLALGDVHPFAPLWVRLTLI
FT                   GFILLMYALYGLYRLWRALRMDEQLLRRFLHPRGEEVPVAGEIKADLRTVNHIVTQAIR
FT                   QLRQLRVDMPGWRKIFEGKRFLYELPWFMVVGSPGDGKTTALLNTGLQFPLAEQMEQTS
FT                   RILTVPGGGTLHCDWWFTNEAVLIDTAGRYARHDDGGEASAAQRNAGEWQGFLGLLRKH
FT                   RPGAPLNGVILTLNVADLTAQSPAERLAACAALRARLAELRETLGIRFPVYLVVTKMDL
FT                   LPGFSEYFRTLTSHLRAQIWGFTLPYSRRRKTGDPQALHAACAQELARLTLRLDQGLDT
FT                   RLQEEYDLKSLQRLYTFPREFAALGEPLLEAIEQIFLDSKFDATQLNNTLRGVFFTSAA
FT                   QAQADAVADQLSIWQRFVRAIKTARGESSASLPHALPDGNRSYFLHDLLTQFIFREAHL
FT                   VEPNLQWAWRYRLLRLGGHLLVLVLAFLLWQGMQTSQQTNGDYLNEISARATRLDGEVK
FT                   AYTGKPAMAPVPTLLDSARELSAWPELDPDAPPLTWRYGLYSVPPVTDSVASLYNRLLD
FT                   QLLLPPLVKRMEYVLADAIARQDSKAAYDALRIYLLLNLDKDHEDKYNAAEIQSWVIND
FT                   LGNSDSVAGFGGRAAVLTHIEALFDGSRVVHSPYEKNEALIRQARAFLDGHTSTERIYA
FT                   RALAAMESEAPQEFTLVRAVGADAGTVFVRSNGAPLDRGVPGIFTREGYRELFDKRLPE
FT                   FVAAATANDGWVMGRESTPKKLTDSLRSQIPGQEQSVAREVRRLYLTEYARRWQDFLDS
FT                   IHSINSAGEEGSSGLAYDLQVLRTLASPDSPLMRLGKAVVEQTTLVPPPDPQARQKQLA
FT                   QRASGNAGKVVQTAKLFQDIHPEERLEKTLVDDRFAALREVIAGRTDGGQSGGGTMQIA
FT                   SLLTMLNEYYTQLTIADSALAAGTLPARITAADKLQLEAAKLPAPLKNILLDLTKQGTR
FT                   KINAGTGDVLNTQMEAMMGDDCRDAIDGRYPFADSPQEVSAEDFNRIFASGGVLDAFWS
FT                   KQLAPLADTASDPWRYKPTEGNMTLQGPDLTPFQQAKQIRSVFFNSEGGKKFSWSMQIS
FT                   VVDMDPAITELVIDIDGQVLRYAHGPDRPLKVTWPGPRNGSMAEITASPRIRQDTSTLL
FT                   TGGPWALFHLLDAGMVQETAVRGRQLVEYDFDGRRVVLEITAGRDFNPVSRELLQNFSC
FT                   PARAL"
FT   gene            335698..336465
FT                   /locus_tag="SeHA_C0324"
FT   CDS_pept        335698..336465
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0324"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0324"
FT                   /db_xref="EnsemblGenomes-Tr:ACF70300"
FT                   /protein_id="ACF70300.1"
FT                   /translation="MRRPAVVSAPAMFGRLPDQRDYVRWRVGAEEGRIWQDWLNRQTWV
FT                   GSGRHIVLPEGQTTDEERDGWMHLSPRGEHDMPAPEHHPLPWSFVMSPGFLPMGGTTDW
FT                   LTGVLMASRDSVGRPWPLVIYQRCGREWLDESLQETQGWLYWLARLAAQHITPDTMRRG
FT                   RLTEQVDQLWAMWQPGPWWAQWLRGLRRTSQRSRELTGLPDEAPVVELPGVRYLPWPGW
FT                   PGKTLGQATPGQGWFWQQNSEGRYVDALRLAEK"
FT   gene            337068..337424
FT                   /locus_tag="SeHA_C0325"
FT   CDS_pept        337068..337424
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0325"
FT                   /product="probable secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0325"
FT                   /db_xref="EnsemblGenomes-Tr:ACF70090"
FT                   /protein_id="ACF70090.1"
FT                   /translation="MTKVQAEKLLIIALKYQKYDLSLDGVFVDGDLQDKHGNPPHPGYY
FT                   DFSLGYDTPTAGAIDYWGLFSVSSQTGDIWEINKCERIIFPQLQKIQQEIMKKTGATFA
FT                   SEVVQRRGLGCTDE"
FT   gene            337433..337555
FT                   /locus_tag="SeHA_C0326"
FT   CDS_pept        337433..337555
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0326"
FT                   /product="putative cytoplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0326"
FT                   /db_xref="EnsemblGenomes-Tr:ACF69444"
FT                   /protein_id="ACF69444.1"
FT                   /translation="MDLPGIRYLPGQGWFWQQNSEGRYVDALRLVDEENRGQML"
FT   gene            337582..337968
FT                   /locus_tag="SeHA_C0327"
FT   CDS_pept        337582..337968
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0327"
FT                   /product="putative periplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0327"
FT                   /db_xref="EnsemblGenomes-Tr:ACF66950"
FT                   /protein_id="ACF66950.1"
FT                   /translation="MSACAGMFLPVFAWGETDVNIDNPLAECVDIHPVHRQEMDNLTIL
FT                   KTTVTLKKSTGECGCFSTLINYTSLLAQDVEGYGRGSAYSLQEGNISLAKMQGRYPFSF
FT                   VLSVDNQSVRDQKLALMIRCTPPL"
FT   gene            337995..338513
FT                   /locus_tag="SeHA_C0328"
FT   CDS_pept        337995..338513
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0328"
FT                   /product="putative cytoplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0328"
FT                   /db_xref="EnsemblGenomes-Tr:ACF66280"
FT                   /protein_id="ACF66280.1"
FT                   /translation="MAVRLTFDGQKLTWPGIGIFKATTGLPDLQWPDKQCVPDAAIPEG
FT                   NYKLFIQFQGEAPIRNAADCDLGPSWGWSTIPRGQAAGTCEIYWANWGYNRIRLESADE
FT                   KTRKACGGKRGGFYIHDSTKGYSHGCIEVEPVFFRILKQETEKENGEKTFTVNVKYVSG
FT                   QQTNGGTKQ"
FT   gene            338910..341141
FT                   /locus_tag="SeHA_C0329"
FT   CDS_pept        338910..341141
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0329"
FT                   /product="Rhs-family protein"
FT                   /note="identified by match to protein family HMM PF04524;
FT                   match to protein family HMM TIGR01646; match to protein
FT                   family HMM TIGR03361"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0329"
FT                   /db_xref="EnsemblGenomes-Tr:ACF68646"
FT                   /protein_id="ACF68646.1"
FT                   /translation="MSFVSTNNKSGIGGLTTTTPPITGESGGVTADSVAGSVADAAEAA
FT                   VEQAAGSLFGALPEPSGLVKAAVAAAQAAAAGMAQDAVSAIVSAVAGGPGAHNVTVSGS
FT                   AVPPGALLFASLDGGETLSELFSYVVQLKTPDTLNLGYVSPAANLPLKPMVGKDLCVNI
FT                   ELDGGGKRHISGLVTAARVVGHEGRSVTYELRMEPWLKLLTHTSDYKAFQNKSVVDILD
FT                   EVLAEYPYPVEKRLVESYPVRTWQVQYGETDFDFLQRLMQEWGIYWWFEHSEDSHTLVL
FT                   ADAISAHKACPDSPLVEWHQEGLKLDKEFIHTITANESLRTGQWVLDDFDFTKPRSLLA
FT                   NTVANPRETGHATYEHYEWPGDYFDKSEGEMLTRIRMEAQRSPGSRVLGGGNIRTLMTG
FT                   YTFTLENYPTAEVNQEYLLMQTLLFVQDNAQHSGQDQHFTFSTRFELHPTREVFRPQRT
FT                   VSKPHTKGPQSAIVTGPAGQEIWTDQYGRVKVQFGWDRYGKMDENSSCWIRVSYPWAGK
FT                   GFGMIQIPRIGQEVLVDFKNGDPDLPIIVGRTYNQDTMPPWGLPGAATQSGIYSHTIGG
FT                   GPTNANALRFEDKPGSEEVWLHAEKDQRIEVNNNESHWVGNNRVKVIDQSEIATIGAVR
FT                   DHKVQYDDTSLAGGNKTIQTVKELYLAAGDSITLSCGDTVLYMSSKGEFYVTCKTFNIT
FT                   ATDADGQINTIKGQLDLNMDKREPKVGTFGESEKTAMAAVIKETFPPKE"
FT   gene            341201..341659
FT                   /locus_tag="SeHA_C0330"
FT   CDS_pept        341201..341659
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0330"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF08786"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0330"
FT                   /db_xref="EnsemblGenomes-Tr:ACF68015"
FT                   /protein_id="ACF68015.1"
FT                   /translation="MTNYYINEAILSFSGNISQDSTLNMIRLSDPDAALIISRGKMQDG
FT                   DELASQVEQQMKKLEKQVKELRYTPAQVVRLGIDGKMEGLEIQSQFIRGNEHVYQYQAV
FT                   FVLQSSRVMMALTYARSTALTEADRGRWADIKKNLRFRLDPENTATGQ"
FT   gene            341675..346381
FT                   /locus_tag="SeHA_C0331"
FT   CDS_pept        341675..346381
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0331"
FT                   /product="Rhs-family protein"
FT                   /note="identified by match to protein family HMM PF03527;
FT                   match to protein family HMM PF05488; match to protein
FT                   family HMM PF05593; match to protein family HMM TIGR01643"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0331"
FT                   /db_xref="EnsemblGenomes-Tr:ACF69679"
FT                   /protein_id="ACF69679.1"
FT                   /translation="MGEAFWAAREGDALLHTSFLADLVGSALEFAINAVIDFAALAVVA
FT                   LATGATVATLGCSAVLLVGTVVGATMLLSGAGEKISKACEDIANSLFPPKIEGYILTGS
FT                   GDTRINSKRAARAAATALSRHDVETLDAQAQAEAEEEKRRQDAKSMWDVAGEYLDAVKG
FT                   RAENMAKGVVSVVSRMGSAEGWASLGNDALAEAGDMLSDTGHFISEMWQPTVATAYPGS
FT                   DPKQDDKIDCHKHPSSFTQFMAQKLQALTDDPVGTVLGAMNTFDVLEAGFQAASALIGS
FT                   VSNLFKGDDEPPAAEYIAEGTRDVRINSQPAARSGVRCTCEAKVVDEPENGVHVSGDVR
FT                   IGGPLLVVRDIKSGKSQITLVTTIALTFMQPGRASAKSACFMMGLGINMMVQKAGSALN
FT                   RPVNAATGAKYLAGDDDVDFSLPGHFPLEWQRTYSSRDERTEGMFGRGWSVLYEVCLER
FT                   TPDNPDENCMTYVSPMGRRIDLQAVEPGSGFYSPGEGLAVRRSEQGHWLISSDDGVYRL
FT                   FEADPFSPQRRRLKMLGDRNSNCQHLTYDNHGRLVEISGDRQRPCIRLHYELAAHPQRV
FT                   TRIFRHYPEGEPELLRRYRYDEAGRLNGVVDNAGQYQREFAYDDNDCMTMHREPGGERY
FT                   YYSWAWFEGPDDAAWRVTGHHTDSGEQYRLDWNLAERSLCVTDSLGRTRCHWWDAQGLV
FT                   TAYRDEAGQMTTFRWSDEERLLLGMTDAQGGKWRYVYDRLGHLTETHDPLGRVEQTQWH
FT                   PVWHQPETEVDAAGAAWRYEYDERGNLQAVSDPLHQRTVYGYDRHGQVVRITDARGGDK
FT                   YLQWNEDGQLMRHTDCSGSQTAWFYDERTRLERVTDAESNSTRYSYDGNGHLTEVMFAD
FT                   GRTERYQPDAAGRLVKYTSPAGQITRWQRDGQGRVRRQTDATGRRTAYEYDAYGRLTTL
FT                   TNENGESYRFRYDVLDRVTEQTDPGGSRRAYGYNALNAVTAVIYGGERGGEIRHGLERD
FT                   AAGRLTVKITPETRTEYRYDAADRLLEIRRRQHDAAEGGEPEVIRFSYDSAGNLLSEET
FT                   AQGVLQNRYDVQGNRTETQMPDGRTLRYLYYGSGHLQQINLGRDVISEFTRDHLHREVQ
FT                   RSQGRLDTRRMYDRTGRLTRKLTCKGMRGVVPETFIDREYAYSGQDELLKKRHSRQGVT
FT                   DYFYDTTGRITACRNEAYLDSWQYDAAANLLDRRQGETAQAGAGSVVPFNRITSYRGLH
FT                   YRYDEYGRVVEKRGRNGTQHYRWDAEHRLTEVAVIRGSTVRRYGYVYDAPGRRVEKHEL
FT                   DAEGKPYNRTTFLWDGMRLAQECRLGRSSSLYIYSDQGSHEPLARVDRAAPGEADEVLY
FT                   YHTDVNGAPEEMTDGGGNIVWEAGYQVWGNLTHEKETRPVQQNLRFQGQYLDRETGLHY
FT                   NLYRFYDPDIGKFISGDPISLRGGINLYAYAQNPLSWIDPLGLTGEWVNPKDINFSQRT
FT                   ISPHDYAEIMRNGGWDWDRSPLRVIDIDGQLVSYDNRRLDAALEAGLDKVKVIRIDPNA
FT                   PHPDSSTGKTWLQKFRERFRDRRNIKAGGIVPDKGLNSRPERTSRGCK"
FT   gene            346378..346812
FT                   /locus_tag="SeHA_C0332"
FT   CDS_pept        346378..346812
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0332"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0332"
FT                   /db_xref="EnsemblGenomes-Tr:ACF68446"
FT                   /protein_id="ACF68446.1"
FT                   /translation="MKNIIQLWEDNLLPIKDAIYFSNGRSFLCKIMDYPTLHIERNGEF
FT                   DFSAFYEKNKDEVTDIDKFREIKLANNCYCCVGEGSYGSEGFVAYLDENKNLVWVLYSE
FT                   ESNPFINVSEYIPDIIIVESSSNIRLKININNPMDLELVV"
FT   gene            complement(346859..347122)
FT                   /locus_tag="SeHA_C0333"
FT   CDS_pept        complement(346859..347122)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0333"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0333"
FT                   /db_xref="EnsemblGenomes-Tr:ACF65952"
FT                   /protein_id="ACF65952.1"
FT                   /translation="MNASGASVRHINSETCMTTCYSQIPSGDCQEEAGFETGASVVVKI
FT                   SERGLILIAETDEVRDLRKELYQVKKSMKHIKAGVNNVVNGN"
FT   gene            347184..347303
FT                   /locus_tag="SeHA_C0334"
FT   CDS_pept        347184..347303
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0334"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0334"
FT                   /db_xref="EnsemblGenomes-Tr:ACF70072"
FT                   /protein_id="ACF70072.1"
FT                   /translation="MSEYGRDILALSPPLPGQLRAVMSNRLPGPYFDDETGLH"
FT   gene            347793..348260
FT                   /locus_tag="SeHA_C0335"
FT   CDS_pept        347793..348260
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0335"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0335"
FT                   /db_xref="EnsemblGenomes-Tr:ACF69552"
FT                   /protein_id="ACF69552.1"
FT                   /translation="MANLIFGEPSLFSINISTDDRFASVSIFCASEEIGDSSEYVLLST
FT                   FISLIKNKIDNYDYSLSNELFNLEKNDVFSYVVDGFEKAESWRESQRLESILITLNLAP
FT                   CFDGETFILLSTDEYDRIIWKTFNSEIISEAFLPAGYVLKQFDLLFNNFSN"
FT   gene            complement(348325..348498)
FT                   /locus_tag="SeHA_C0336"
FT   CDS_pept        complement(348325..348498)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0336"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0336"
FT                   /db_xref="EnsemblGenomes-Tr:ACF66783"
FT                   /protein_id="ACF66783.1"
FT                   /translation="MARLCGILTAEAGFKTGRGVTVKISQGCIVLMADCNEVQELREQL
FT                   YQAKQGIKDVLV"
FT   gene            complement(348777..349154)
FT                   /pseudo
FT                   /locus_tag="SeHA_C0337"
FT                   /note="transposition helper protein, IS21 family; this
FT                   region contains one or more premature stops and/or
FT                   frameshifts; identified by match to protein family HMM
FT                   PF01695"
FT   gene            350370..351080
FT                   /locus_tag="SeHA_C0338"
FT   CDS_pept        350370..351080
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0338"
FT                   /product="putative fimbrial protein"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0338"
FT                   /db_xref="EnsemblGenomes-Tr:ACF70186"
FT                   /protein_id="ACF70186.1"
FT                   /translation="MNFKDTLPGVFLCVAMFACGHARANMLVYPMAAEINSSREEATSL
FT                   FVYSKSDHVQYIRTRIMRIEHPGMPQEKEVPAGNDIETGLVVSPEKFALSPGTKKTIRV
FT                   ITTQAPEREEAWRVYFEAVPELEDDPQAGGKQNSSVSVNLVWGVLLRVSPSDPRPALVT
FT                   DGHHLLNTGNTRLSLIRAGNCDTTCHWQNIGKSIYPGGSADIPAGIKSNAFRVEYRTGA
FT                   NSPVISADLTAAGK"
FT   gene            351131..351706
FT                   /locus_tag="SeHA_C0339"
FT   CDS_pept        351131..351706
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0339"
FT                   /product="putative fimbrial subunit"
FT                   /note="identified by match to protein family HMM PF04449"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0339"
FT                   /db_xref="EnsemblGenomes-Tr:ACF68075"
FT                   /protein_id="ACF68075.1"
FT                   /translation="MYTECTYITVINNKARLFFMNMKTSFIAAAVALATVYSFSVSAVQ
FT                   KDITVTANIDSTLELLQADGSSLPSTMKLDFMPGKGLVHKSLQTRLYSNDQTKSVNVKL
FT                   LNAPQLINVLDPTKTIDMEVTLGGRSLTTTNSVLEAKTLFPDGKTGDASALLNLDIGQK
FT                   AGAALQNLPAGEYSGLVSLVISQAVTAG"
FT   gene            351815..354502
FT                   /locus_tag="SeHA_C0340"
FT   CDS_pept        351815..354502
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0340"
FT                   /product="TcfC protein"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0340"
FT                   /db_xref="EnsemblGenomes-Tr:ACF68869"
FT                   /protein_id="ACF68869.1"
FT                   /translation="MSRYFWMYYLLGLCSFTSQATLIPPPGFESLLEGQTEQIEVLLPG
FT                   HSLGLFPVVVKPDTVQFMSPLMVLESSGLAALPVAERQKALAALSRPLLRNSNLVCGVS
FT                   EAKDSSECGYVATDKEDVAVIFDENNGQLSLFLNRDWLPDEERRDKRWLTPTPEGVSAF
FT                   IHRQTLYLSDDLHSRNMTLNGSGALGLGDGRYLGGNWAAIWNQSEHYNNSQAWFDNLFV
FT                   RQDLGNQYYLQAGRMDQRNLSSATGGDFGFSLLPLSRFDGLRTGTTQAYVNHEVDQNAT
FT                   PVMVQVTRNARIDIYRGSELLGSQFLTPGMHTLDTHSLPPGSYPLALRVYEDGILRRTE
FT                   TQPFSKGGNSFSAQTQWFIQSGLEDTGDKASHYDGETVMAAGFRTGLRKNISLTEGISL
FT                   AHEAWYSETRLNSQHAVLDGTLDLSAGILHGTDSTSGNTEQVTYNDGFSASLWRNHTES
FT                   DACSGRHPQSVHASMTCQTSMNASLSVPVGNWYALLGYSTSRTEGRPVYRGYDDNSDKE
FT                   NVFWRQAYIPASHRESAQASATYSLNMAGMNINTHGGVWRTRNDGVNDDGLFMSVSVSY
FT                   ASQPPTMTGSNGYTSAGTDIHSSRNQKTQTSWNVNHVRSWQQDLYRELSVGFSGYNDDS
FT                   WSGSLGGRMSGRMGELSATISNSHQRNAGSASSLTAGYSSSLALSRNGLFWGGGQDGEP
FT                   ASGMAVNVESEGDEGSSGKVVSVRGSSQPFSLGFGQQSLLLMEGYNATEVTIEDAGVSS
FT                   QGMAGVKAGGGSRRYFLTPGHLLVHNISASMSRLYVGRVLDKDGRPLLDAQPLNHPFLS
FT                   LGPSGRFSLQSEHKESSLWLLSKNRILRCPMSVHKRRDVMQVVGDVRCELSDVDALPQA
FT                   LQISPRVIRLLNVAGLLRHSVQEA"
FT   gene            354552..355604
FT                   /locus_tag="SeHA_C0341"
FT   CDS_pept        354552..355604
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0341"
FT                   /product="putative fimbrail protein"
FT                   /note="identified by match to protein family HMM PF07434"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0341"
FT                   /db_xref="EnsemblGenomes-Tr:ACF66730"
FT                   /protein_id="ACF66730.1"
FT                   /translation="MTAYWSAIINFIRKYVYPARIIAILLMAGATLPQVADAITVDLNY
FT                   DKNNVPVITPVWSQEWSVANVLGGWVCRSNRNENEGACEETHLVWWYAFGAYSKIRLRF
FT                   REQISHAEITLILLGSVRNACYTGVVNMNAAACQWGRSLKLRIPSEELAKIPTSGTWKA
FT                   TLVLDYLQWGGDDPLGTSTTDITLNVTDHFAENAAIYFPQFGTATPRVDLNLHRLNASQ
FT                   MSGRANLDMCLYDGGVKARSLQMKIEGSNKSGTGFQVIKSDSADTIDYAVSMNYGGRSI
FT                   PVTRGVEFSLDNVDKAATRPVLLPGQRQAVRCVPVPLTLTTQPFNIREKRSGEYQGTLT
FT                   VTMLMGTQTP"
FT   gene            355737..356192
FT                   /locus_tag="SeHA_C0342"
FT   CDS_pept        355737..356192
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0342"
FT                   /product="transcriptional regulator"
FT                   /note="identified by match to protein family HMM PF01037"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0342"
FT                   /db_xref="EnsemblGenomes-Tr:ACF66366"
FT                   /protein_id="ACF66366.1"
FT                   /translation="MTEYLDDKDKELLKEIQKDCAQTLWQLAYKVGLTPTPCFKRLKKL
FT                   KDRGVIIGQFALLDKEKLGLSLNVFIMINISEEQYASISEKIKSMPEVIAFYRISGSFN
FT                   YLMHTVFTDMNDYYSFYEKIILTNSSISGSASSFVLEQIKETNELPV"
FT   gene            complement(356236..356355)
FT                   /locus_tag="SeHA_C0344"
FT   CDS_pept        complement(356236..356355)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0344"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0344"
FT                   /db_xref="EnsemblGenomes-Tr:ACF66451"
FT                   /protein_id="ACF66451.1"
FT                   /translation="MHGVIFNHVIFRCVILCRLISPLLIKILVQQPQSAVVVP"
FT   gene            356332..356949
FT                   /locus_tag="SeHA_C0343"
FT   CDS_pept        356332..356949
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0343"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0343"
FT                   /db_xref="EnsemblGenomes-Tr:ACF66085"
FT                   /protein_id="ACF66085.1"
FT                   /translation="MVKYHPVHVTKNRIKTDDVTDIYFVEPFWKEGENHIIESLMFFEE
FT                   LQKSFNLFNHKYGLNKYILRIPWEFVLIHMERISKLNSVGLFAVSVDFNNNHKFLSEYI
FT                   RSRRDYGMEVWFDFCGKHSYSSEIKNLGFFFQACVVPRDPNFISSVYHYHKFQKILVGD
FT                   INDVEQRAVYQNEVDYMYGMQWPSSYDGFFFRDHKKNETWCI"
FT   gene            357327..357485
FT                   /locus_tag="SeHA_C0345"
FT   CDS_pept        357327..357485
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0345"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0345"
FT                   /db_xref="EnsemblGenomes-Tr:ACF66588"
FT                   /protein_id="ACF66588.1"
FT                   /translation="MNSKYFREVFFVSVVVILLFYLVLFAASAHAEGGFSSGGIGLFMT
FT                   GTREMLL"
FT   gene            357745..357915
FT                   /locus_tag="SeHA_C0346"
FT   CDS_pept        357745..357915
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0346"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0346"
FT                   /db_xref="EnsemblGenomes-Tr:ACF67803"
FT                   /protein_id="ACF67803.1"
FT                   /translation="MGSRKLSPYQKRCSVLKNGARLHLFNDFLKAQEYSLLISSIAPSG
FT                   THRTSYFTDSV"
FT   gene            complement(357912..358631)
FT                   /locus_tag="SeHA_C0347"
FT   CDS_pept        complement(357912..358631)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0347"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0347"
FT                   /db_xref="EnsemblGenomes-Tr:ACF66101"
FT                   /protein_id="ACF66101.1"
FT                   /translation="MKNFFAVCIIPLVVAWSATASAKEGIYITGKAGTSVVNVYGINST
FT                   FSQDEIVNGHATLPDRTKGVFGGGVAIGYDFYDPFQLPVRLELDTTFRGETDAKGGQDI
FT                   IAFGDPVHINVKNQVRMTTYMVNGYYDFHNSTAFTPYISAGVGLAHVKLSNNTIPVGFG
FT                   INETLSASKNNFAWGAGIGAKYAVTDNIMIDASYKYINAGKVSISKNHYAGDEHTAYDA
FT                   DTKAASNDFMLGITYAF"
FT   gene            complement(358962..359369)
FT                   /locus_tag="SeHA_C0348"
FT   CDS_pept        complement(358962..359369)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0348"
FT                   /product="periplasmic protein"
FT                   /note="identified by match to protein family HMM PF07813"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0348"
FT                   /db_xref="EnsemblGenomes-Tr:ACF67015"
FT                   /protein_id="ACF67015.1"
FT                   /translation="MKNFVRTTLLAATLAGVSFGAFATAVPNPPLPAQDPIVQHLKLTN
FT                   DQITRIKKLHQQLETDVSQISMKGIKDGALIEVIKSGKWDDAAVKQQLAAFSNIEQQAR
FT                   YYRVKYYFDLSKVLTPEQRQQVQQDLAQALE"
FT   gene            complement(359679..360446)
FT                   /locus_tag="SeHA_C0349"
FT   CDS_pept        complement(359679..360446)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0349"
FT                   /product="hydrolase YafV"
FT                   /EC_number="3.5.-.-"
FT                   /note="identified by match to protein family HMM PF00795"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0349"
FT                   /db_xref="EnsemblGenomes-Tr:ACF69339"
FT                   /protein_id="ACF69339.1"
FT                   /translation="MSGLKITLLQQPLVWMDGPANLRHFDRQLELVSGRDVIVLPEMFT
FT                   TGFAMEAANNSLSQDSVITWMQAKARQTDALIAGSAALQTERGAVNRFLLVEPEGKVHL
FT                   YDKRHLFRMADEHQHYAAGDKRIIVQWRGWRILPLICYDLRFPIWSRNRNDYDLALYVA
FT                   NWPAPRSLHWQTLLTARAIENQAYVAGCNRVGTDGNGLHYRGDSRIINPQGDIIATAEP
FT                   HQATRIDADLSLVALQDYREKFPAWRDADPFTL"
FT   gene            complement(360555..362999)
FT                   /pseudo
FT                   /gene="fadE"
FT                   /locus_tag="SeHA_C0350"
FT                   /note="acyl-coenzyme A dehydrogenase; this gene contains a
FT                   frame shift which may be the result of sequencing error;
FT                   identified by match to protein family HMM PF00441; match to
FT                   protein family HMM PF09317"
FT   gene            363239..363817
FT                   /gene="gmhA"
FT                   /locus_tag="SeHA_C0351"
FT   CDS_pept        363239..363817
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gmhA"
FT                   /locus_tag="SeHA_C0351"
FT                   /product="phosphoheptose isomerase"
FT                   /EC_number="5.3.1.-"
FT                   /note="identified by match to protein family HMM TIGR00441"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0351"
FT                   /db_xref="EnsemblGenomes-Tr:ACF70447"
FT                   /db_xref="GOA:B4T7P3"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR004515"
FT                   /db_xref="InterPro:IPR035461"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4T7P3"
FT                   /protein_id="ACF70447.1"
FT                   /translation="MYQDLIRNELNEAAETLANFLKDDANIHAIQRAAVLLADSFKAGG
FT                   KVLSCGNGGSHCDAMHFAEELTGRYRENRPGYPAIAISDVSHISCVSNDFGYDYIFSRY
FT                   VEAVGREGDVLLGISTSGNSGNVIKAIAAAREKGMKVITLTGKDGGKMAGTADIEIRVP
FT                   HFGYADRIQEIHIKVIHILIQLIEKEMVK"
FT   gene            364030..364797
FT                   /locus_tag="SeHA_C0352"
FT   CDS_pept        364030..364797
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0352"
FT                   /product="glutamine amidotransferase, class II"
FT                   /note="identified by match to protein family HMM PF00310"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0352"
FT                   /db_xref="EnsemblGenomes-Tr:ACF67526"
FT                   /protein_id="ACF67526.1"
FT                   /translation="MCELLGMSANVPTDICFSFTGLVQRGGGTGPHKDGWGITFYEGKG
FT                   CRTFKDPQPSYHSPIAKLVQNYPIKSCSVIAHIRQANRGEVALENTHPFTRELWGRNWT
FT                   YAHNGQLNGYKSLETGNFRPVGETDSEKAFCWLLHKLTQRYPRTPGNMTAVFKYIATLA
FT                   TVLREKGVFNMLLSDGRYVMAFCSTHLHWITRRAPFGVATLVDQDMEIDFSSQTTPNDV
FT                   VTVIATQPLTGNETWQKIMPGEWALFCLGERII"
FT   gene            complement(364768..365508)
FT                   /locus_tag="SeHA_C0353"
FT   CDS_pept        complement(364768..365508)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0353"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF06104"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0353"
FT                   /db_xref="EnsemblGenomes-Tr:ACF69637"
FT                   /protein_id="ACF69637.1"
FT                   /translation="MRKIAFFLAMLLMPCVSFAGLLSSSSPVTPVSKEYKQQLMGSPVY
FT                   IQIFKEERTLDLYVKMGEQYQLLDSYKICNYSGGLGPKRRQGDFKSPEGFYSVQRNQLK
FT                   PDSRFYKAINIGFPNAYDRAHGYDGKYLMIHGACVSVGCYAMTDSGIDEIFQFVTAALV
FT                   FGQPSVQVSIYPFRMTDANMQRHKYSYYKDFWAQLKPGYDYFEQTHKPPTVSIVDGRYV
FT                   VSKPLSHEVVQPQLASNYTLSEAK"
FT   gene            365758..366813
FT                   /locus_tag="SeHA_C0354"
FT   CDS_pept        365758..366813
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0354"
FT                   /product="DNA polymerase IV"
FT                   /EC_number="2.7.7.7"
FT                   /note="identified by match to protein family HMM PF00817"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0354"
FT                   /db_xref="EnsemblGenomes-Tr:ACF68013"
FT                   /protein_id="ACF68013.1"
FT                   /translation="MRKIIHVDMDCFFAAVEMRDNPALRDIPIAIGGSRERRGVISTAN
FT                   YPARQFGVRSAMPTAMALKLCPHLTLLPGRFDAYKEASRHVRDIFSRYTSLIEPLSLDE
FT                   AWLDVTDSPHCYGSATLIAREIRQTIFNELQLTASAGVAPVKFLAKIASDLNKPNGQYV
FT                   ITPADVPDFLKTLPLAKIPGVGKVSAAKLENIGLRTCGDIQQCDLAMLLKRFGKFGRVL
FT                   WERSQGIDERDVNSERLRKSVGVERTLAEDIHEWSDCEAIIEHLYPELERRLAIVKPDL
FT                   LIARQGVKLKFNDFQQTTQEHVWPQLNKEDLITTARKTWDERRGERGVRLVGLHVTLLD
FT                   PQLERQLVLGL"
FT   gene            367032..368171
FT                   /locus_tag="SeHA_C0355"
FT   CDS_pept        367032..368171
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0355"
FT                   /product="release factor H-coupled RctB family protein"
FT                   /note="identified by match to protein family HMM PF01139;
FT                   match to protein family HMM TIGR03073"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0355"
FT                   /db_xref="EnsemblGenomes-Tr:ACF67085"
FT                   /protein_id="ACF67085.1"
FT                   /translation="MGNYIRPLSDVVFSIASDNLWIEDSAIQQLYTTAKLTGMKRVIGM
FT                   PDLHPGRGYPIGAAFFSRGRFYPALVGNDIGCGMALWQTDILGRKYNADKLEKRLASLT
FT                   DVADAQWLEENVPVAMQHHSWRSALGSIGGGNHFAELQQVDRIVDADSFALSGLQKAQL
FT                   LLLVHSGSRGLGQAILRRHVEAFSHNGLPEDSDDARRYLAEHDDALAFARSNRALIARR
FT                   ILQQLRAEGEPRLDVAHNFVEPCTVAGEAGWLHRKGATPDGQGLVIIPGSRGDYSWLVK
FT                   PVVSEESLFSLAHGAGRKWMRTECKDRLSAKFTPRQLCRTGMGSRVICRDRQLIYEEAP
FT                   QAYKSIDSVVDCLADAGLITPVACLRPVLTLKTSGEKSA"
FT   gene            368168..368782
FT                   /locus_tag="SeHA_C0356"
FT   CDS_pept        368168..368782
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0356"
FT                   /product="putative peptide chain release factor H"
FT                   /note="identified by match to protein family HMM PF00472;
FT                   match to protein family HMM TIGR03072"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0356"
FT                   /db_xref="EnsemblGenomes-Tr:ACF67608"
FT                   /protein_id="ACF67608.1"
FT                   /translation="MILLQLSSAQGPDECCLAVKKALDCLTKEAAREKVSLTRLETEPG
FT                   RLPDTLRSALVSLDGEKAMAFSERWCGTLLWICTSPYRPHHGRKNWYVGIGRFSADEHI
FT                   QSDEIRFETLRSSGPGGQHVNKTDSAVRATHLVSGISVKVQSERSQHANKRLARLLIAW
FT                   RLEQQRQNECAALKSERRLFHHQIERGNPLRIFKGMAFTPQ"
FT   gene            complement(368937..370394)
FT                   /gene="pepD"
FT                   /locus_tag="SeHA_C0357"
FT   CDS_pept        complement(368937..370394)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pepD"
FT                   /locus_tag="SeHA_C0357"
FT                   /product="aminoacyl-histidine dipeptidase"
FT                   /note="identified by match to protein family HMM PF01546;
FT                   match to protein family HMM PF07687; match to protein
FT                   family HMM TIGR01893"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0357"
FT                   /db_xref="EnsemblGenomes-Tr:ACF66933"
FT                   /protein_id="ACF66933.1"
FT                   /translation="MSELSQLSPQPLWDIFAKICSIPHPSYHEEQLAEHIVSWAKEKGL
FT                   YVDRDQVGNILIRKPATAGMENRKPVVLQAHLDMVPQKNSDTVHDFTTDPIQPYIDGEW
FT                   VKARGTTLGADNGIGMASALAVLADDNVVHGPLEVLLTMTEEAGMDGAFGLQSGWLQAD
FT                   ILINTDSEEEGEIYMGCAGGIDFTSNLPLTREAVPAGFACFKLTLKGLKGGHSGGEIHL
FT                   GLGNANKLLARFLAGHAEELDLRLIDFNGGTLRNAIPREAFATLAVAADNVGALKTLVN
FT                   AYQDILKNELAEKEKNLTLQLNEVASDKAALTAPSRDTFVRLLNATPNGVIRNSDVAKG
FT                   VVETSLNVGVVTMSDANVEIHCLIRSLIDSGKDYVVSMLDSLGKLAGAKTEAKGSYPGW
FT                   QPDANSPVMHLVRETYQRLFNKTPNIQIIHAGLECGLFKKPYPDMDMVSIGPTITGPHS
FT                   PDEQVHIESVGHYWTLLTELLKAIPAK"
FT   gene            370643..371101
FT                   /gene="gpt"
FT                   /locus_tag="SeHA_C0358"
FT   CDS_pept        370643..371101
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gpt"
FT                   /locus_tag="SeHA_C0358"
FT                   /product="xanthine phosphoribosyltransferase"
FT                   /EC_number="2.4.2.22"
FT                   /note="identified by match to protein family HMM PF00156"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0358"
FT                   /db_xref="EnsemblGenomes-Tr:ACF67330"
FT                   /db_xref="GOA:B4T7Q0"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR023747"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4T7Q0"
FT                   /protein_id="ACF67330.1"
FT                   /translation="MSEKYVVTWDMLQIHARKLASRLMPSEQWKGIIAVSRGGLVPGAL
FT                   LARELGIRHVDTVCISSYDHDNQRELKVLKRAEGDGEGFIVIDDLVDTGGTAVAIREMY
FT                   PKAHFVTIFAKPAGRPLVDDYVIDIPQNTWIEQPWDMGVVFVPPISGR"
FT   gene            371190..372434
FT                   /locus_tag="SeHA_C0359"
FT   CDS_pept        371190..372434
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0359"
FT                   /product="esterase FrsA"
FT                   /EC_number="3.1.-.-"
FT                   /note="identified by match to protein family HMM PF06500"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0359"
FT                   /db_xref="EnsemblGenomes-Tr:ACF70303"
FT                   /db_xref="GOA:B4T7Q1"
FT                   /db_xref="InterPro:IPR010520"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4T7Q1"
FT                   /protein_id="ACF70303.1"
FT                   /translation="MTQANLSETLFKPRFKHTETSTLVRRFNRGSQPPMQSALDGKNVP
FT                   HWYRMINRLMWIWRGVDPREILDVQARIVMSDAERTDDDLYDTVIGYRGGNWIYEWAKQ
FT                   AMDWQQKACQEQDAMRSGRYWLHASTLYNIAAYPHLKGDELAEQAQALANRAYEEAAQR
FT                   LPGSLREMEFAVPGGSPVTAFLHMPKGDGPFPTVLMCGGLDAMQTDYYTLYERYFAPRG
FT                   IAMLTLDMPSVGFSSKWKLTQDSSLLHQHVLKALPNVPWVDHTRVAAFGFRFGANVAVR
FT                   LAYLEAPRLKAVACLGPVVHALLSDPQRQSTVPEMYLDVLASRLGMHDASDEALRVELN
FT                   RYSLKVQGLLGRRCPTPMLSGFWKNDPFSPEEESRLITTSSSDGKLIEIPFNPVYRNFD
FT                   RALQEITDWINHRLC"
FT   gene            372492..372893
FT                   /locus_tag="SeHA_C0360"
FT   CDS_pept        372492..372893
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0360"
FT                   /product="sigma factor-binding protein crl"
FT                   /note="identified by match to protein family HMM PF07417"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0360"
FT                   /db_xref="EnsemblGenomes-Tr:ACF66013"
FT                   /db_xref="GOA:B4T7Q2"
FT                   /db_xref="InterPro:IPR009986"
FT                   /db_xref="InterPro:IPR038208"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4T7Q2"
FT                   /protein_id="ACF66013.1"
FT                   /translation="MTLPSGHPKSRLIKKFTALGPYIREGQCEDNRFFFDCLAVCVNVK
FT                   PAPEKREFWGWWMELEAQEKRFTYRYQFGLFDKEGNWTVVPINETEVVERLEYTLREFH
FT                   EKLRDLLISMELALEPSDDFNDEPVKLSA"
FT   gene            complement(372944..373996)
FT                   /locus_tag="SeHA_C0361"
FT   CDS_pept        complement(372944..373996)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0361"
FT                   /product="outer membrane pore protein E"
FT                   /note="identified by match to protein family HMM PF00267"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0361"
FT                   /db_xref="EnsemblGenomes-Tr:ACF68993"
FT                   /protein_id="ACF68993.1"
FT                   /translation="MNKSTLAIVVSIIASASVHAAEVYNKNGNKLDVYGKVKAMHYMSD
FT                   YDSKDGDQSYVRFGFKGETQINDQLTGYGRWEAEFAGNKAESDSSQQKTRLAFAGLKLK
FT                   DIGSFDYGRNLGALYDVEAWTDMFPEFGGDSSAQTDNFMTKRASGLATYRNTDFFDIVD
FT                   GLDLTLQYQGKNEDRDVKKQNGDGFGTSVSYDFGGSDFAVSGAYTLSDRTREQNLQRRG
FT                   TGDKAEAWATGVKYDANDIYIATFYSETRNMTPVSGGFANKTQNFEAVIQYQFDFGLRP
FT                   SLGYVLSKGKDIEGVGSEDLVNYIDVGATYYFNKNMSAFVDYKINQLDSDNTLGINDDD
FT                   IVAIGLTYQF"
FT   gene            complement(374062..374214)
FT                   /locus_tag="SeHA_C0362"
FT   CDS_pept        complement(374062..374214)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0362"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0362"
FT                   /db_xref="EnsemblGenomes-Tr:ACF69363"
FT                   /protein_id="ACF69363.1"
FT                   /translation="MPTTCTRSVKFCCAGSASVAAEFDHFITATIKHIFLKKFSLCHKS
FT                   FITER"
FT   gene            374279..375382
FT                   /gene="proB"
FT                   /locus_tag="SeHA_C0363"
FT   CDS_pept        374279..375382
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="proB"
FT                   /locus_tag="SeHA_C0363"
FT                   /product="glutamate 5-kinase"
FT                   /EC_number="2.7.2.11"
FT                   /note="identified by match to protein family HMM PF00696;
FT                   match to protein family HMM PF01472; match to protein
FT                   family HMM TIGR01027"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0363"
FT                   /db_xref="EnsemblGenomes-Tr:ACF68760"
FT                   /db_xref="GOA:B4T7Q5"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001057"
FT                   /db_xref="InterPro:IPR002478"
FT                   /db_xref="InterPro:IPR005715"
FT                   /db_xref="InterPro:IPR011529"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR019797"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR036974"
FT                   /db_xref="InterPro:IPR041739"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4T7Q5"
FT                   /protein_id="ACF68760.1"
FT                   /translation="MSDSQTLVVKLGTSVLTGGSRRLNRAHIVELVRQCAQLHAAGHRI
FT                   VIVTSGAIAAGREHLGYPELPATIASKQLLAAVGQSRLIQLWEQLFSIYGIHIGQMLLT
FT                   RADMEDRERFLNARDTLRALLDNHIVPVINENDAVATAEIKVGDNDNLSALAAILAGAD
FT                   KLLLLTDQQGLFTADPRSNPQAELIKDVYGVDDALRSIAGDSVSGLGTGGMSTKLQAAD
FT                   VACRAGIDTIIASGSKPGVIGDVMEGISVGTRFHAQASPLENRKRWIFGAPPAGEITVD
FT                   EGATAAMLERGSSLLPKGIKSVTGNFSRGEVIRICNLQGRDIAHGVSRYNSDALRRIAG
FT                   HHSQQIDAILGYEYGPVAVHRDDMITR"
FT   gene            375394..376644
FT                   /gene="proA"
FT                   /locus_tag="SeHA_C0364"
FT   CDS_pept        375394..376644
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="proA"
FT                   /locus_tag="SeHA_C0364"
FT                   /product="glutamate-5-semialdehyde dehydrogenase"
FT                   /EC_number="1.2.1.41"
FT                   /note="identified by match to protein family HMM TIGR00407"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0364"
FT                   /db_xref="EnsemblGenomes-Tr:ACF69594"
FT                   /db_xref="GOA:B4T7Q6"
FT                   /db_xref="InterPro:IPR000965"
FT                   /db_xref="InterPro:IPR012134"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR020593"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4T7Q6"
FT                   /protein_id="ACF69594.1"
FT                   /translation="MLEQMGIAAKAASYKLALLSSGEKNRVLEKIADELEAQMESILSA
FT                   NVQDVEQARANGLSEAMLDRLALTPARLKAIADDVRQVCNLADPVGQVIDGGLLDSGLR
FT                   LERRRVPLGVVGVIYEARPNVTVDVASLCLKTGNAVILRGGKETHRTNAATVRVIQKAL
FT                   KACGLPEAAVQAIDNPDRSLVNEMLRMDKYIDMLIPRGGAGLHKLCREQSTIPVITGGI
FT                   GVCHIFVDSSADIAPALKIIVNAKTQRPSTCNTVETLLVHQDIAERFLPALSKQMAESG
FT                   VTLHGDETVMQALHGPAKLVPLKPEELDNEFLSLDLNVVVVENMDGAIAHIREHGTQHS
FT                   DAILTCDMHNAARFVNEVDSAAVYVNASTRFTDGGQFGLGAEVAVSTQKLHARGPMGLE
FT                   ALTTYKWIGFGDGTIRA"
FT   gene            376760..376835
FT                   /locus_tag="SeHA_C0365"
FT   tRNA            376760..376835
FT                   /locus_tag="SeHA_C0365"
FT                   /product="tRNA-Thr"
FT   gene            complement(376850..378013)
FT                   /locus_tag="SeHA_C0366"
FT   CDS_pept        complement(376850..378013)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0366"
FT                   /product="site-specific recombinase, phage integrase
FT                   family"
FT                   /note="identified by match to protein family HMM PF00589"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0366"
FT                   /db_xref="EnsemblGenomes-Tr:ACF68935"
FT                   /protein_id="ACF68935.1"
FT                   /translation="MSLFRRGETWYASFTLPNGKRFKQSLGTKDKRQATELHDKLKAEA
FT                   WRVSKLGETPDMTFEGACVRWLEEKAHKKSLDDDKSRIGFWLQHFAGMQLKDITETKIY
FT                   SAIQKITNRRHEENWKLMDEACRKNGKQPPVFKPKPAAVATKATHLSFIKALLRAAERE
FT                   WKMLDKAPIIKVPQPKNKRIRWLEPHEAKRLIDECQEPLKSVVEFALSTGLRRSNIINL
FT                   EWQQIDMQRKVAWIHPEQSKSNHAIGVALNDTACRVLKKQIGNHHKWVFVYKESSTKPD
FT                   GTKSPVVRKMRYDANTAWRAALKRAGIEDFRFHDLRHTWASWLVQAGVPISVLQEMGGW
FT                   ESIEMVRRYAHLAPNHLTEHARQIDSIFGTSVPNMSHSKNKEGTNNT"
FT   gene            complement(378243..378545)
FT                   /locus_tag="SeHA_C0367"
FT   CDS_pept        complement(378243..378545)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0367"
FT                   /product="EaC"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0367"
FT                   /db_xref="EnsemblGenomes-Tr:ACF68438"
FT                   /protein_id="ACF68438.1"
FT                   /translation="MHNANAKLKSLPEWNYYITNHYGIMRTGIGGQSGRGFGFVMLSTY
FT                   GGKHPQRDDCLIFAIPNNKEERHGVVVIPDAFKKITYGQFYDIANAKEDEEETAE"
FT   gene            complement(379255..379941)
FT                   /locus_tag="SeHA_C0368"
FT   CDS_pept        complement(379255..379941)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0368"
FT                   /product="Eaa protein"
FT                   /note="identified by match to protein family HMM PF04447;
FT                   match to protein family HMM PF04448"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0368"
FT                   /db_xref="EnsemblGenomes-Tr:ACF69991"
FT                   /protein_id="ACF69991.1"
FT                   /translation="MTTITKERIELFIKNPLENGLTRGEQMELARIALASLKREQIRHE
FT                   HAKWSDSTFGCVGPIGPLKHLSKEALEAAAEPDDLSEWADMQFLLWDAQRRAGISDAEI
FT                   TAAMEDKLKINMERQWPEPKDGEPRLHIKEPGNSPVITDGWISCSERMPVIGELNWRTS
FT                   FPLLVTCEIGVMPAYYGFVSVNGDRHYGFMESLKYGDDSGNHPQTNEYGLISNVTHWMP
FT                   LPEPPL"
FT   gene            complement(379952..380215)
FT                   /locus_tag="SeHA_C0369"
FT   CDS_pept        complement(379952..380215)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0369"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0369"
FT                   /db_xref="EnsemblGenomes-Tr:ACF69452"
FT                   /protein_id="ACF69452.1"
FT                   /translation="MATLTKKEQAWLSELQNVLDRCPSPKKIGFYTIGDKSIYLYDLRR
FT                   MDEIMEALDNRSSMDWCVAVHDMNAGFEEKILFPSSVESTAG"
FT   gene            complement(380217..380702)
FT                   /locus_tag="SeHA_C0370"
FT   CDS_pept        complement(380217..380702)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0370"
FT                   /product="protein ea22"
FT                   /note="identified by match to protein family HMM PF04447"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0370"
FT                   /db_xref="EnsemblGenomes-Tr:ACF67333"
FT                   /protein_id="ACF67333.1"
FT                   /translation="MSEINYQALREVAERAIPAMERLLMLPADDDLLSEQELKDYGVDI
FT                   DALNAFKFLTGPETVLALLDERERNRQYIKSRDQENEDIALTVGKLRVELEAEKQRAKD
FT                   LFMENARLKSGIAGLIHLGIRYADVEVMRIAGDAQLSTPCTDSIINSIATGIRIKGE"
FT   gene            complement(380699..381316)
FT                   /locus_tag="SeHA_C0371"
FT   CDS_pept        complement(380699..381316)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0371"
FT                   /product="Gp37"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0371"
FT                   /db_xref="EnsemblGenomes-Tr:ACF66993"
FT                   /protein_id="ACF66993.1"
FT                   /translation="MSLIEMDGFLKGKCIPRDLKVNETNAEYLVRKFGELESKLETALR
FT                   ECRSAGITIDNLEAKCTALAAENAGMKSVIEYCINPDNQPEYHDQGMGCGVEDHGYQRD
FT                   GYSACYYGWESAMERVYSEVIPDAIPETPATDAFLAEVRAQGVDAAIEAAKNLVAQEYE
FT                   YKDFKAAQSDCCMYPGSDLVGKVEMTEWLVDFAAQLRKGGNQ"
FT   gene            complement(381497..381793)
FT                   /locus_tag="SeHA_C0372"
FT   CDS_pept        complement(381497..381793)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0372"
FT                   /product="anti-RecBCD protein 2"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0372"
FT                   /db_xref="EnsemblGenomes-Tr:ACF68335"
FT                   /protein_id="ACF68335.1"
FT                   /translation="MPAPLYGADDPRRCSGNSVSEVLENIKNNIDAFLALPPETKAERK
FT                   YRRDIQLAEKQEKDRINETAIRPFRKATYTHFPEYIDPRLRNYRSRYGAISND"
FT   gene            complement(382124..382741)
FT                   /locus_tag="SeHA_C0373"
FT   CDS_pept        complement(382124..382741)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0373"
FT                   /product="essential recombination function protein"
FT                   /note="identified by match to protein family HMM PF04404"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0373"
FT                   /db_xref="EnsemblGenomes-Tr:ACF68018"
FT                   /protein_id="ACF68018.1"
FT                   /translation="MSKEFYARLAEIQEHLNAPKNQYNSFGKYKYRSCEDILEGVKPLL
FT                   KGLFLSISDEIVLIGDRYYVKATATITDGENSHSASAIAREEENKKGMDAAQVTGATSS
FT                   YARKYCLNGLFGIDDAKDADTEEHKQQQNAAPAKQTKSSPSSPAPEQVLKAFSEYAATE
FT                   TDKKKLIERYQHDWQLLTGHDDEQTKCVQVMNIRINELKQVA"
FT   gene            complement(382738..382881)
FT                   /locus_tag="SeHA_C0374"
FT   CDS_pept        complement(382738..382881)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0374"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0374"
FT                   /db_xref="EnsemblGenomes-Tr:ACF68431"
FT                   /protein_id="ACF68431.1"
FT                   /translation="MQHEFSDEEFIALISPEIEEEVEQQINLAAERQNPIIGWDEFAGY
FT                   YS"
FT   gene            complement(382871..383059)
FT                   /locus_tag="SeHA_C0375"
FT   CDS_pept        complement(382871..383059)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0375"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0375"
FT                   /db_xref="EnsemblGenomes-Tr:ACF67967"
FT                   /protein_id="ACF67967.1"
FT                   /translation="MTIVPVNGTILVQQGNREFNKLYEASFPDTKEGNSAAYAWASSIA
FT                   MGWEDCQDEDWNRNHAA"
FT   gene            complement(383040..383168)
FT                   /locus_tag="SeHA_C0376"
FT   CDS_pept        complement(383040..383168)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0376"
FT                   /product="lambda phage ciii"
FT                   /note="identified by match to protein family HMM PF02061"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0376"
FT                   /db_xref="EnsemblGenomes-Tr:ACF68127"
FT                   /protein_id="ACF68127.1"
FT                   /translation="MGVSQLHESLLDRITRKLRAGWKRLADILNQPGVPSHDYCAC"
FT   gene            complement(383284..383511)
FT                   /locus_tag="SeHA_C0377"
FT   CDS_pept        complement(383284..383511)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0377"
FT                   /product="superinfection exclusion protein"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0377"
FT                   /db_xref="EnsemblGenomes-Tr:ACF67245"
FT                   /protein_id="ACF67245.1"
FT                   /translation="MMDALADYDAFQYDNNIKPDYCNANGLQMFDESLTDQDLEDMELD
FT                   DRWIDWYSECQCYDDPREYLESLKEETTAA"
FT   gene            complement(383602..383677)
FT                   /locus_tag="SeHA_C0378"
FT   ncRNA           complement(383602..383677)
FT                   /locus_tag="SeHA_C0378"
FT                   /product="suhB"
FT                   /ncRNA_class="other"
FT   gene            complement(383946..384182)
FT                   /locus_tag="SeHA_C0379"
FT   CDS_pept        complement(383946..384182)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0379"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0379"
FT                   /db_xref="EnsemblGenomes-Tr:ACF68776"
FT                   /protein_id="ACF68776.1"
FT                   /translation="MKDIPHWDVDEDYIVDVTEGHILFSAENANKQEIKLASAAPELLE
FT                   ALLSIIDMEHDVSEWDAVYATARAAIGKALGKE"
FT   gene            complement(384219..384371)
FT                   /locus_tag="SeHA_C0380"
FT   CDS_pept        complement(384219..384371)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0380"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0380"
FT                   /db_xref="EnsemblGenomes-Tr:ACF69089"
FT                   /protein_id="ACF69089.1"
FT                   /translation="MKCKGCKLDAECMVKPEEMALVREDGKIVDKWAIRTTEMIARELE
FT                   KLKAI"
FT   gene            384655..385206
FT                   /locus_tag="SeHA_C0381"
FT   CDS_pept        384655..385206
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0381"
FT                   /product="superinfection exclusion protein B"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0381"
FT                   /db_xref="EnsemblGenomes-Tr:ACF68586"
FT                   /protein_id="ACF68586.1"
FT                   /translation="MRFFLQGMTLKQLIHMLIILIVLIIVMPVSVKEWINLHNPEILPH
FT                   YWMYYILLFCVSYVLNGVVNSVYHAVTERIEASTAQRRKDREEKVVRDLFDSLTLGERA
FT                   YLAFAVAANNQLKTEKGSPEAISLLKKGIITRLPSAIGYPDIDRFIIPEKYFNECYMRF
FT                   AGKSDILMNELIVQDEQLKK"
FT   gene            complement(385883..386533)
FT                   /gene="c2"
FT                   /locus_tag="SeHA_C0382"
FT   CDS_pept        complement(385883..386533)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="c2"
FT                   /locus_tag="SeHA_C0382"
FT                   /product="P22 repressor protein c2"
FT                   /note="identified by match to protein family HMM PF00717"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0382"
FT                   /db_xref="EnsemblGenomes-Tr:ACF70392"
FT                   /protein_id="ACF70392.1"
FT                   /translation="MNTQLMGERIRARRKKLKIRQAALGKMVGVSNVAISQWERSETEP
FT                   NGENLLALSKALQCSPDYLLKGDLSQTNVAYHSRHEPRGSYPLISWVSAGQWMEAVEPY
FT                   HKRAIENWHDTTVDCSEDSFWLDVQGDSMTAPAGLSIPEGMIILVDPEVEPRNGKLVVA
FT                   KLEGENEATFKKLVMDAGRKFLKPLNPQYPMIEINGNCKIIGVVVDAKLANLP"
FT   gene            386906..387184
FT                   /locus_tag="SeHA_C0383"
FT   CDS_pept        386906..387184
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0383"
FT                   /product="transcriptional activator protein C1"
FT                   /note="identified by match to protein family HMM PF05269"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0383"
FT                   /db_xref="EnsemblGenomes-Tr:ACF69864"
FT                   /protein_id="ACF69864.1"
FT                   /translation="MELTSTRKKANAITSSILNRIAIRGQRKVADALGINESQISRWKG
FT                   DFIPKMGMLLAVLEWGVEDEELAELAKKVAHLLTKEKPQDCGNSFEA"
FT   gene            387358..388173
FT                   /locus_tag="SeHA_C0384"
FT   CDS_pept        387358..388173
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0384"
FT                   /product="DNA replication protein gp18"
FT                   /note="identified by match to protein family HMM PF04492;
FT                   match to protein family HMM TIGR01610"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0384"
FT                   /db_xref="EnsemblGenomes-Tr:ACF66463"
FT                   /protein_id="ACF66463.1"
FT                   /translation="MSNLATVTPIKPHLEVVEHRVAELDDGYTRTANTLLEAVMLSGLT
FT                   QHQLLIVMAVWRKTYGYNKKIDWIGNEQFAELTGMAPTKCSTAKNELIRMGVLTQVGRQ
FT                   VGMNKNISEWKTKVNGFGKTFTRSVKLTFTKSVKTNLPNQSNTKDNIQKTINTNTPLPP
FT                   KGGCDEGSKPEKRKPTKINYSEYLAAYNEIVGDRLPHAVEVNSERQRKLKKLIDSLATK
FT                   NIDGFRAYVKAFMAAARPFHFGDNDRDWVANFDYLLRPKVLIAIREGTL"
FT   gene            388170..389546
FT                   /locus_tag="SeHA_C0385"
FT   CDS_pept        388170..389546
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0385"
FT                   /product="replicative DNA helicase"
FT                   /EC_number="3.6.1.-"
FT                   /note="identified by match to protein family HMM PF00772;
FT                   match to protein family HMM PF03796"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0385"
FT                   /db_xref="EnsemblGenomes-Tr:ACF65964"
FT                   /protein_id="ACF65964.1"
FT                   /translation="MRQDIEASVIGGLLIGGLTPTASDVLATLEPEAFSIPLYRKAFEV
FT                   IRKQARNRNLIDGLMVAEECGDEYATAVMMTARSCPSAANLKGYAGMVADSYQRRQVLQ
FT                   LLDEMREPISNGTLDASGRAMDELVKRLSSIRKPRNEVKPVRLGEIINDYTDTLDRRLR
FT                   NGEESDTLKTGIEELDAITGGMNAEDLVIIAARPGMGKTELALKIAEGVASRVIPGSGV
FT                   RRGVLIFSMEMSAIQVVERGIAGAGMMSVSVLRNPSRMDDEGWARVASGMKLLAELDVW
FT                   VVDASRLSVEEIRSISERHKQEHPNLSLIMADYLGLIEKPKAERNDLAIAHISGSLKAM
FT                   AKDLKTPVISLSQLSRDVEKRPNKRPTNADLRDSGSIEQDADSIIMLYREAVYDENSSA
FT                   APFAEIIVTKNRFGSLGTVYQRFCNGHFVACDQDEARQICTASNAPAGRRKRYAQGADV
FT                   "
FT   gene            390373..390705
FT                   /locus_tag="SeHA_C0386"
FT   CDS_pept        390373..390705
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0386"
FT                   /product="NinX"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0386"
FT                   /db_xref="EnsemblGenomes-Tr:ACF66858"
FT                   /protein_id="ACF66858.1"
FT                   /translation="MDYSQLSDFEINKRVAIATGHKKFNGLGWQGTQEDSCSAVIVRGP
FT                   TKIGAFDPCNNPADAWPIIEKYRISFLDQLTEWCVDAKGVSPIFDIRPLRAAMIVFLLM
FT                   QDANNA"
FT   gene            390698..390874
FT                   /locus_tag="SeHA_C0387"
FT   CDS_pept        390698..390874
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0387"
FT                   /product="conserved domain protein"
FT                   /note="identified by match to protein family HMM PF05810"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0387"
FT                   /db_xref="EnsemblGenomes-Tr:ACF69967"
FT                   /protein_id="ACF69967.1"
FT                   /translation="MLSPSQSLQYQKESVERALTCANCGQKLHVLEVHVCEACCAELMS
FT                   DPNSSMYEEEDDG"
FT   gene            391326..391478
FT                   /locus_tag="SeHA_C0388"
FT   CDS_pept        391326..391478
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0388"
FT                   /product="gp69"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0388"
FT                   /db_xref="EnsemblGenomes-Tr:ACF68883"
FT                   /protein_id="ACF68883.1"
FT                   /translation="MLIERIGIAAVDEIESDHKRHRWTTEECKAIKAEYQQKLKDLRDS
FT                   RSEAA"
FT   gene            391475..391699
FT                   /locus_tag="SeHA_C0389"
FT   CDS_pept        391475..391699
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0389"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0389"
FT                   /db_xref="EnsemblGenomes-Tr:ACF67058"
FT                   /protein_id="ACF67058.1"
FT                   /translation="MSKIQYPMTTAAIFDDVVYPLHFDNAGKVRQEMEGAVNWFCRWCN
FT                   EEKAAVKARLLVSCWGQYLSHEQVIREAA"
FT   gene            391696..391899
FT                   /locus_tag="SeHA_C0390"
FT   CDS_pept        391696..391899
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0390"
FT                   /product="conserved domain protein"
FT                   /note="identified by match to protein family HMM PF06322"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0390"
FT                   /db_xref="EnsemblGenomes-Tr:ACF67929"
FT                   /protein_id="ACF67929.1"
FT                   /translation="MTHTVKTIPDMLIETYGNQTEVARRLSCHRNTVRRYLYDKEARYH
FT                   AIVNGVLMIHQGGRGIYDRNQH"
FT   gene            391880..392059
FT                   /locus_tag="SeHA_C0391"
FT   CDS_pept        391880..392059
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0391"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0391"
FT                   /db_xref="EnsemblGenomes-Tr:ACF66009"
FT                   /protein_id="ACF66009.1"
FT                   /translation="MTVTSINQAKHQRERDEAELRSVREMTEQHQKAMDYLHERERELV
FT                   NRIGLNKPAGDDAA"
FT   gene            392518..392679
FT                   /locus_tag="SeHA_C0392"
FT   CDS_pept        392518..392679
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0392"
FT                   /product="antitermination protein Q"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0392"
FT                   /db_xref="EnsemblGenomes-Tr:ACF69725"
FT                   /protein_id="ACF69725.1"
FT                   /translation="MPASAAYRAITMLIPNLTQPTWSRTVKPLYDALVVQCHKEESIAD
FT                   NILNAVTR"
FT   gene            393178..393321
FT                   /locus_tag="SeHA_C0393"
FT   CDS_pept        393178..393321
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0393"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0393"
FT                   /db_xref="EnsemblGenomes-Tr:ACF70263"
FT                   /protein_id="ACF70263.1"
FT                   /translation="MGGILSLNDWAVIIGILCTVGTFGINWYYKRKEREDRLNGNVTGT
FT                   TK"
FT   gene            393293..393796
FT                   /locus_tag="SeHA_C0394"
FT   CDS_pept        393293..393796
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0394"
FT                   /product="phage lysozyme"
FT                   /EC_number="3.2.1.17"
FT                   /note="identified by match to protein family HMM PF00959"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0394"
FT                   /db_xref="EnsemblGenomes-Tr:ACF68708"
FT                   /protein_id="ACF68708.1"
FT                   /translation="MAMSPALRNSVIAAISGGAIAIASVLITGPGGNDGLEGVRYKPYK
FT                   DVVGVLTVCYGHTGKDIMPGKTYTEAECKALLNKDLATVARQINPYIKVDIPETTRGAI
FT                   YSFVYNVGAGNFRTSTLLRKINQVDIKGACDQLRRWTYAGGKQWKGLMTRREIEREVCL
FT                   WGQQ"
FT   gene            393885..394322
FT                   /locus_tag="SeHA_C0395"
FT   CDS_pept        393885..394322
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0395"
FT                   /product="bacteriophage lysis protein"
FT                   /note="identified by match to protein family HMM PF03245"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0395"
FT                   /db_xref="EnsemblGenomes-Tr:ACF69257"
FT                   /protein_id="ACF69257.1"
FT                   /translation="MSRLTAIISALVICIIVCLSWAVNHYRDNAIAYKDQRDKATSIIA
FT                   DMQKRQRDVAELDARYTKELADANATIESLRADVSAGRKRLQVSATCPKSTTGASGMGD
FT                   GESPRLTADAELNYYRLRSGIDKITAQVNYLQDYIRTQCLK"
FT   gene            394535..395221
FT                   /locus_tag="SeHA_C0396"
FT   CDS_pept        394535..395221
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0396"
FT                   /product="gp79"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0396"
FT                   /db_xref="EnsemblGenomes-Tr:ACF69744"
FT                   /protein_id="ACF69744.1"
FT                   /translation="MQLVEIKKLDLVTNSAVIATGVKKDHKPVIQLIRKYKSDLEEFGR
FT                   VEFEMRPFQTDGGMQKQEIALLNEQQTTLLITYMRNNEVVREFKKRLVAEFFTMRSALA
FT                   KKKMDRNSARLEYKPMTDAIKHEREAQGKQIAPHHFSNEADLINRLALGMTAAKFRVHH
FT                   EIGKKEPIRDYLTPEQIHCITELQRANTVFISMGWDFEQRKEVLSGMFERNHRQPLIEE
FT                   QHRLAA"
FT   gene            395524..395766
FT                   /locus_tag="SeHA_C0397"
FT   CDS_pept        395524..395766
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0397"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0397"
FT                   /db_xref="EnsemblGenomes-Tr:ACF68653"
FT                   /protein_id="ACF68653.1"
FT                   /translation="MAEIIPMTEEQKFQLEIYKLVMNQNAAAEEAFQFIGTDELKLELF
FT                   KIHFQSGGANSDITIRTFEAVRKSKEALDLFTTGA"
FT   gene            395768..395947
FT                   /locus_tag="SeHA_C0398"
FT   CDS_pept        395768..395947
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0398"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0398"
FT                   /db_xref="EnsemblGenomes-Tr:ACF69299"
FT                   /protein_id="ACF69299.1"
FT                   /translation="MSCVINLGKEKKFPITQELYERLESVIHYYDGEISLCEAVGTLEL
FT                   LKQLLIEGAKEQST"
FT   gene            396169..396459
FT                   /locus_tag="SeHA_C0399"
FT   CDS_pept        396169..396459
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0399"
FT                   /product="packaging protein gp3"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0399"
FT                   /db_xref="EnsemblGenomes-Tr:ACF69669"
FT                   /protein_id="ACF69669.1"
FT                   /translation="MTITGLTLFLDVTLETWRTYRMREDLSEVVTRAEQIIYDQKFSGA
FT                   AADLLNANIIARDLGLKEQSQVEDVTPDKGDRDKRRSRIKELFNRGTGRDS"
FT   gene            396437..397936
FT                   /locus_tag="SeHA_C0400"
FT   CDS_pept        396437..397936
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0400"
FT                   /product="DNA packaging protein gp2"
FT                   /note="identified by match to protein family HMM PF03237"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0400"
FT                   /db_xref="EnsemblGenomes-Tr:ACF70340"
FT                   /protein_id="ACF70340.1"
FT                   /translation="MELDAILDNLSDEEQIELLELLEEEENYRNTHLLYEFTPYSKQRE
FT                   FIDAGHDYPERCFMAGNQLGKSFTGAAEVAFHLTGRYPGTKGYPADGKYGGEWKGKRFY
FT                   EPVVFWIGGETNETVTKTTQRILCGRIEENDEPGYGSIPKEDIISWKKSPFFPNLVDHL
FT                   LVKHHTADGVEDGISICYFKPYSQGRARWQGDTIHGVWFDEEPPYSIYGEGLTRTNKYG
FT                   QFSILTFTPLMGMSDVVTKFLKNPSKSQKVVNMTIYDAEHYTDEQKEQIIASYPEHERE
FT                   ARARGIPTMGSGRIFQIPEETIKCQPFECPDHFYVIDAQDFGWNHPQAHIQLWWDKDAD
FT                   VFYLARVWKKSENTAVQAWGAVKSWANKIPVAWPHDGHQHEKGGGEQLKTQYADAGFSM
FT                   LPDHATFPDGGNSVESGISELRDLMLEGRFKVFNTCEPFFEEFRLYHRDENGKIVKTND
FT                   DVLDATRYGYMMRRFARMMRDIRKPKEKKIPAPIRPVRRGR"
FT   gene            397936..400113
FT                   /locus_tag="SeHA_C0401"
FT   CDS_pept        397936..400113
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0401"
FT                   /product="portal protein"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0401"
FT                   /db_xref="EnsemblGenomes-Tr:ACF66602"
FT                   /protein_id="ACF66602.1"
FT                   /translation="MADNENRLESILSRFDADWTASDEARREAKNDLFFSRVSQWDDWL
FT                   SQYTTLQYRGQFDVVRPVVRKLVSEMRQNPIDVLYRPKDGASPDAADVLMGMYRTDMRH
FT                   NTAKIAVNVAVREQIESGVGAWRLVTDYEDQSPTSNNQVIRREPIHSACSHVIWDSNSK
FT                   LMDKSDARHCTVIHSMSQNGWEDFAEKYDLDADDIPSFQNPNDWVFPWLTQDTIQIAEF
FT                   YEVVEKKETAFIYQDPVTGEPVSYFKRDIKDVIDDLADSGFIKIAERQIKRRRVYKSII
FT                   TCTAVLKDKQLIAGEHIPIVPVFGEWGFVEDKEVYEGVVRLTKDGQRLRNMIMSFNADI
FT                   VARTPKKKPFFWPEQIAGFEHMYDGNDDYPYYLLNRTDENSGDLPTQPLAYYENPEVPQ
FT                   ANAYMLEAATSAVKEVATLGVDTEAVNGGQVAFDTVNQLNMRADLETYVFQDNLATAMR
FT                   RDGEIYQSIVNDIYDVPRNVTITLGDGSEKDVQLMAEVVDLATGEKQVLNDIRGRYECY
FT                   TDVGPSFQSMKQQNRAEILELLGKTPQGTPEYQLLLLQYFTLLDGKGVEMMRDYANKQL
FT                   IQMGVKKPETPEEQQWLVEAQQAKQGQQDPAMVQAQGVLLQGQAELAKAQNQTLSLQID
FT                   AAKVEAQNQLNAARIAEIFNNMDLSKQSEFREFLKTVASFQQDRSEDARANAELLLKGD
FT                   EQTHKQRMDIANILQSQRQNQPSGSVAETPQ"
FT   gene            400127..401038
FT                   /locus_tag="SeHA_C0402"
FT   CDS_pept        400127..401038
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0402"
FT                   /product="scaffolding protein"
FT                   /note="identified by match to protein family HMM PF09306"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0402"
FT                   /db_xref="EnsemblGenomes-Tr:ACF67256"
FT                   /protein_id="ACF67256.1"
FT                   /translation="MEPTTEIQATEDLTLSGDHAAASADSLVVDNANDNAGQEEGFEIV
FT                   LKDDETAPKQDPAKNAEFARRRIERKRQRELEQQMEAVKRGELPESLRVNPDLPPQPDI
FT                   NAYLSEEGLAKYDYDNSRALAAFNAANTEWLMKAQDARSNAVAEQGRKTQEFTQQSAQY
FT                   VEAARKHYDAAEKLNIPDYQEKEDAFMQLVPPAVGADIMRLFPEKSAALMYHLGANPEK
FT                   ARQLLAMDGQSALIELTRLSERLTLKPRGKQISSAPPADQPITGDVSAANKDAIRKQMD
FT                   AAASKGDVETYRKLKAKLKGIR"
FT   gene            401038..402330
FT                   /locus_tag="SeHA_C0403"
FT   CDS_pept        401038..402330
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0403"
FT                   /product="coat protein"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0403"
FT                   /db_xref="EnsemblGenomes-Tr:ACF67708"
FT                   /protein_id="ACF67708.1"
FT                   /translation="MALNEGQIVTLAVDEIIETISAITPMAQKAKKYTPPAASMQRSSN
FT                   TIWMPVEQESPTQEGWDLTDKATGLLELNVAVNMGEPDNDFFQLRADDLRDETAYRRRI
FT                   QSAARKLANNVELKVANMAAEMGSLVITSPDAIGTNTADAWNFVADAEEIMFSRELNRD
FT                   MGTSYFFNPQDYKKAGYDLTKRDIFGRIPEEAYRDGTIQRQVAGFDDVLRSPKLPVLTK
FT                   STATGITVSGAQSFKPVAWQLDNDGNKVNVDNRFATVTLSATTGMKRGDKISFAGVKFL
FT                   GQMAKNVLAQDATFSVVRVVDGTHVEITPKPVALDDVSLSPEQRAYANVNTSLADAMAV
FT                   NILNVKDARTNVFWADDAIRIVSQPIPANHELFAGMKTTSFSIPDVGLNGIFATQGDIS
FT                   TLSGLCRIALWYGVNATRPEAIGVGLPGQTA"
FT   gene            402369..402578
FT                   /locus_tag="SeHA_C0404"
FT   CDS_pept        402369..402578
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0404"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0404"
FT                   /db_xref="EnsemblGenomes-Tr:ACF68267"
FT                   /protein_id="ACF68267.1"
FT                   /translation="MKIAIYKPGGSIMVWGVMAQMKVIDSSELPEYVKDGWLDHPSKLL
FT                   PVEADDVKPRKGRKPKAVSDADKD"
FT   gene            402562..403062
FT                   /locus_tag="SeHA_C0405"
FT   CDS_pept        402562..403062
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0405"
FT                   /product="packaged DNA stabilization protein gp4"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0405"
FT                   /db_xref="EnsemblGenomes-Tr:ACF69303"
FT                   /protein_id="ACF69303.1"
FT                   /translation="MQIKTKGDLVRAALRKLGVASDATLTDVEPQSMQDAVDDLEAMMA
FT                   EWYQDGKGIITGYVFSDDDNPPAEGDDHGLRSSAVSAVFHNLACRIAPDYALEATAKII
FT                   ATAKYGKELLYKQTAISRAKRAPYPSRMPTGSGNSFANLNEWHYFPGEQNADSTTPHDE
FT                   GNG"
FT   gene            403022..404440
FT                   /locus_tag="SeHA_C0406"
FT   CDS_pept        403022..404440
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0406"
FT                   /product="packaged DNA stabilization protein gp10"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0406"
FT                   /db_xref="EnsemblGenomes-Tr:ACF67048"
FT                   /protein_id="ACF67048.1"
FT                   /translation="MPIQQLPMMKGMGKDFKNADYIDYLPVNMLATPKEILNSSGYLRS
FT                   FPGITKRYDMNGVSRGVEYNTAQNAVYRVCGGKLYKGESEVGDVAGSGRVSMAHGRTSQ
FT                   AVGVNGQLVEYRYDGTVKTVSNWPADSGFTQYELGSVRDITRLRGRYAWSKDGTDSWFI
FT                   TDLEDESHPDRYSAQYRAESQPDGIIGIGTWRDFIVCFGSSTIEYFSLTGATTAGAALY
FT                   VAQPSLMVQKGIAGTYCKTPFADSYAFISHPATGAPSVYIIGSGQASPIATASIEKIIR
FT                   SYTAEEMATGVMETLRFDSHELLIIHLPRHVLVYDASSSQNGPQWCVLKTGLYDDVYRG
FT                   VDFMYEGNQITCGDKSEAVVGQLQFDISSQYDKQQEHLLFTPLFKADNARCFDLEVESS
FT                   TGVAQYADRLFLSATTDGINYGREQMIEQNEPFVYDKRVLWKRVGRIRRLIGFKLRVIT
FT                   KSPVTLSGCQIRLE"
FT   gene            404444..405145
FT                   /locus_tag="SeHA_C0407"
FT   CDS_pept        404444..405145
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0407"
FT                   /product="head completion protein"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0407"
FT                   /db_xref="EnsemblGenomes-Tr:ACF67786"
FT                   /protein_id="ACF67786.1"
FT                   /translation="MADPSLNNPVVIQATRLDASILPRNVFSKSYLLYVIAQGTDVGAI
FT                   AGKANEAGQGAYDAQVKNDEQDVELADHEARIKQLRIDVDDHESRITANTKAITALNVR
FT                   VTTAEGEIASLQTNVSALDGRVTTAENNISALQADYVSKTATTSQSLASPLNVTTSYSV
FT                   GGKKVVGARQTGWTAATGTANKGVFDADLTFAVSDTYTQSEIQAIANALITERRRTKAL
FT                   EDALRAHGLID"
FT   gene            405187..405600
FT                   /locus_tag="SeHA_C0408"
FT   CDS_pept        405187..405600
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0408"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0408"
FT                   /db_xref="EnsemblGenomes-Tr:ACF67033"
FT                   /protein_id="ACF67033.1"
FT                   /translation="MVGNHPDIIAGSNNGDGYDYKPECRYFEVNVHGQFGGIVYYNEIQ
FT                   PMTFDCHAMYLPEIRGFSKEIGLAFWRYILTNTTVQCVTSFAARKFRHGQMYCAMIGLK
FT                   RVGTIKKYFKGVDDVTFYAATREELTELLNNGR"
FT   gene            405603..406295
FT                   /locus_tag="SeHA_C0409"
FT   CDS_pept        405603..406295
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0409"
FT                   /product="putative DNA transfer protein gp7"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0409"
FT                   /db_xref="EnsemblGenomes-Tr:ACF67528"
FT                   /protein_id="ACF67528.1"
FT                   /translation="MLYAFTLGRKLRGEEPSYPEKGGKGGSSDKSAKYAAEAQKYAADL
FT                   QNQQWQTIMKNLAPFTPLAEQYVNQLQNLSSLEGQGQALNQYYNSQQYKDLAGQARYQS
FT                   LAAAEATGGLGSTATSNQLATIAPTLGQSWLSNQMSNYNNLANVGLGALQGQANAGQTY
FT                   ANNMSSIAQQSAALAAANANKPSSLQTAISGGTSGAIAGAGLASLLGTSTPWGAGIGAG
FT                   IGLLGSLF"
FT   gene            406335..407600
FT                   /locus_tag="SeHA_C0410"
FT   CDS_pept        406335..407600
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0410"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0410"
FT                   /db_xref="EnsemblGenomes-Tr:ACF66855"
FT                   /protein_id="ACF66855.1"
FT                   /translation="MLAGIGGVNSNAPSVNDIGNTLQLIRQNNDIERSGANNVGLTALQ
FT                   GLSGIAGVFQQEKQAQRQKEFQQAYANAYASGDRGALRQLATQYPDQIESVRKGMGFID
FT                   EDQRNSIGTLAAGARLASSSPEAMQSWLQNNAKELTRVGVDPNNVVQMYQQNPSGFGEF
FT                   VDHLGMAALGPIDYFNVQDKMAGREIDRGRLAETIRSNQAGEALQQRGQDITVRGQNIS
FT                   AQNAALSREIQRAELQDKVLDRQIARETNQIKLDELKQKQADVRQKAEIAKADRQASAQ
FT                   GAVDTFSTALDSLNEIEQSPGLSKAVGIRSAFPTVPGSDAANFEARLDTFKAQTFLPMV
FT                   QSLKGMGALSDAEGKKLSDAVGALSPKMSEKAFRDSIGKIRNQLESKLSTVKKQFDYQE
FT                   PVQNAPVQQSPAGSNFSSLWGD"
FT   gene            407600..409597
FT                   /locus_tag="SeHA_C0411"
FT   CDS_pept        407600..409597
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0411"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0411"
FT                   /db_xref="EnsemblGenomes-Tr:ACF66135"
FT                   /protein_id="ACF66135.1"
FT                   /translation="MAKAWKDVIASPQYQALAPEQKAQAQEQYFNEVVAPQAGENAEQA
FT                   KQAFYAAYPLPSVQPVETQQPVAQQQPQQSGFMSDLGEAVKETGRGLVQAGVNVANIPA
FT                   SVTDAVTSAAAWAGGKLGIGDGTYQPAPRVTTQGLEQDFGLQQGSLTPQTTEGMVFAEA
FT                   LPYLTPAGVERAATQAPTLAGRIAQGATRLLAENAVGSLAANSTKDDAEALATDLGVGV
FT                   LAGGAINAVGRGLGAAYRGVRGAIAPEAQQAIRFAEREGLPLHTTDLLQPTSRVGKMAQ
FT                   TTAENIPLAGTSGVRATQQEARSQLAQRFADKFGEYDPVVVIDSLKAKTSGIRRAAGNR
FT                   LEKVKNAMAGVNIQPARAIQQIDTEISNLQKLGKVADNETISKLQSYRDELVRNTGPDG
FT                   PVNLDLKQLSDLRSQFRMDVKGERPVLPNRSDAAIQRVYKAMTDDINGAIGQNLGNDTL
FT                   RKYQQANAVYADEAAKLKNTRLKNVLMKGDLTPEVVNNMLFSKNKSEIKTLYNSVGRVG
FT                   REQMRNGIIGKAMEKSGGSPDQFLRQLNILQNQTGITFKGQDAAYLKGLKNYLQSTQQA
FT                   AKAAVTTPTGQQTIPFIIGYGTAMNPATTGAAVSYGLLTRAYESEPFRNAMLRMANTPR
FT                   GSTAFEKAMQQAQKAINALTQGAKSDALSE"
FT   gene            complement(410576..410749)
FT                   /locus_tag="SeHA_C0412"
FT   CDS_pept        complement(410576..410749)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0412"
FT                   /product="Mnt"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0412"
FT                   /db_xref="EnsemblGenomes-Tr:ACF70131"
FT                   /protein_id="ACF70131.1"
FT                   /translation="MNNRSINAEIVATMEESLSKPSPVRGYRDEEERLASLISEQVKEV
FT                   AADILRKEKTRS"
FT   gene            410966..412969
FT                   /locus_tag="SeHA_C0413"
FT   CDS_pept        410966..412969
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0413"
FT                   /product="bifunctional tail protein"
FT                   /EC_number="3.2.1.-"
FT                   /note="identified by match to protein family HMM PF09008;
FT                   match to protein family HMM PF09251"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0413"
FT                   /db_xref="EnsemblGenomes-Tr:ACF69542"
FT                   /protein_id="ACF69542.1"
FT                   /translation="MTDITANVVVSNPRPIFTESRSFKAVANGKIYIGQIDTDPVNPAN
FT                   QIPVYIENEDGSHVQIAQPLIINAAGKIVYNGQLVKIVTVQGHSMAIYDSYGSQVDYIA
FT                   NVLKYDPDQYSIEADKKFKYSVKLSDYLTLQDAASAAVDGLLIDVDYHFYSGETVDFGG
FT                   KALTIDCKAKFIGDGNLIFTKLGKGSRIAGVFMESTTTPWVIKPWTDDNQWLTDAAAVV
FT                   ATLKQSKTDGYQPTVSDYVKFPGIETLLPPNAKGQNITSTLEIRECIGVEVHRASGLMA
FT                   GFLFRGCHFCKMVDANNPSGGKDGIITFENLSGDWGKGNYVIGGRTSYGSVSSAQFLRN
FT                   NGGFERDGGVIGFTSYRAGESGVKTWQGTVGSTTSRNYNLQFRDSVVIYPVWDGFDLGA
FT                   DTDMNPELDRPGDYPITQYPLHQLPLNHLIDNLLVRGALGVGFGMDGKGMYVSNITVED
FT                   CAGSGAYLLTHESVFTNIAIIDTNTKDFQANQIYISGACRVNGLRLIGIRSTDGQGLTI
FT                   DAPNSTVSGITGMVDPSRINVANLAEEGLGNIRANSFGYDSAAIKLRIHKLSKTLDSGA
FT                   LYSHINGGAGSGSAYTQLTAISGSTPDAVSLKVNHKDCRGAEIPFVPDIASDDFIKDSS
FT                   CFLPYWENNSTSLKALVKKPNGELVRLTLATL"
FT   gene            complement(413028..414485)
FT                   /locus_tag="SeHA_C0414"
FT   CDS_pept        complement(413028..414485)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0414"
FT                   /product="O-antigen conversion protein"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0414"
FT                   /db_xref="EnsemblGenomes-Tr:ACF68882"
FT                   /protein_id="ACF68882.1"
FT                   /translation="MKFNSNDRIFISIFLGLAIIYTFPLLTHQSFFVDDLGRSLYGGLG
FT                   WSGNGRPLSDFIFYIINFGTPIIDASPLPLMLGIVILALALSCIREKLFGDDYITASLC
FT                   FMMILANPFFIENLSYRYDSLTMCMSVAISIISSYVAYQYKPINIIISSILTIAFLSLY
FT                   QAALNTYAIFLLAFIISDVVKKNSISNITKNTASSVAGLIVGYFAYSYFIAKRLVTGSY
FT                   NIEHSKIIEINSSLFEGIISNVLSFYRMFSTILNGDNYLIYYSLFFALIISLIVIVLKA
FT                   IKRDENKKTKLLLVVLILLASMFFIIGPMIFLKSPIYAPRVLIGMGGFMFFCCLCVFYA
FT                   FEDKQLISRIYFSFILLISTIFSYGAYNAINAQFQLEESIVNRISQDIDYLGFGRDKKN
FT                   IKFIGTEPYAPINENIVIKHPLMRELIPRIINNDWMWSEVLMQRNVFSRNYRLYDKEVK
FT                   LENGWKKSGNNVYDIGVVGETIVVRFN"
FT   gene            complement(414475..415407)
FT                   /locus_tag="SeHA_C0415"
FT   CDS_pept        complement(414475..415407)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0415"
FT                   /product="bactoprenol glucosyl transferase"
FT                   /EC_number="2.4.1.-"
FT                   /note="identified by match to protein family HMM PF00535"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0415"
FT                   /db_xref="EnsemblGenomes-Tr:ACF68198"
FT                   /protein_id="ACF68198.1"
FT                   /translation="MKISLVVPVFNEEDTIPIFYKTVREFNELKEYEIEIVFINDGSKD
FT                   ATESIINKIAASDPLVIPLSFTRNFGKEPALFAGLDHATGDAVIPIDVDLQDPIEVIPH
FT                   LIEKWQAGADMVLAKRSDRSTDGRMKRKTAEWFYKLHNKISNPKIEENVGDFRLMSRAV
FT                   VENIKQMPERNLFMKGVLSWVGGKTDVVKYARAERVAGDSKFNGWKLWNLALEGITSFS
FT                   TFPLRIWTYIGLFIAGMSFLYGAWMIIDKLIFGNNVPGYPSLLVSVLFLGGVQLIGIGI
FT                   LGEYIGRIYIETKQRPKYILKRKGFKSEI"
FT   gene            complement(415404..415766)
FT                   /locus_tag="SeHA_C0416"
FT   CDS_pept        complement(415404..415766)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0416"
FT                   /product="bactoprenol-linked glucose translocase"
FT                   /note="identified by match to protein family HMM PF04138"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0416"
FT                   /db_xref="EnsemblGenomes-Tr:ACF69672"
FT                   /protein_id="ACF69672.1"
FT                   /translation="MLKLFAKYTSIGVLNTLIHWGVFAFCVYGMHTHQALANFSGFVIA
FT                   VSFSFYANARFTFNATTTTLRYMMYVGFMGTLSAVVGWMADQCSLPPLITLITFSAISL
FT                   VCGFIYSRFIVFRDIR"
FT   gene            complement(416536..417006)
FT                   /pseudo
FT                   /locus_tag="SeHA_C0417"
FT                   /note="transposase InsF for insertion sequence
FT                   IS3A/B/C/D/E/fA; this gene contains a premature stop which
FT                   may be the result of sequencing error; identified by match
FT                   to protein family HMM PF00665"
FT   gene            417314..417682
FT                   /pseudo
FT                   /locus_tag="SeHA_C0418"
FT                   /note="glycerol dehydratase reactivation factor large
FT                   subunit; this gene contains a frame shift which may be the
FT                   result of sequencing error"
FT   gene            418036..418188
FT                   /locus_tag="SeHA_C0419"
FT   CDS_pept        418036..418188
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0419"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0419"
FT                   /db_xref="EnsemblGenomes-Tr:ACF67102"
FT                   /protein_id="ACF67102.1"
FT                   /translation="MARGEQEGWNPEFTKKVAGWAEKVASGNRILIKNPEYFSTYMQEQ
FT                   LKELV"
FT   gene            418536..419768
FT                   /locus_tag="SeHA_C0420"
FT   CDS_pept        418536..419768
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0420"
FT                   /product="putative permease"
FT                   /note="identified by match to protein family HMM PF07690"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0420"
FT                   /db_xref="EnsemblGenomes-Tr:ACF66551"
FT                   /protein_id="ACF66551.1"
FT                   /translation="MKNNIEETIGKYLPILMILPLAGLAELASLYSIQALLPKLSEVYN
FT                   IPLNQVGMILSAEVGFLALAMLFSGTLSDRFGRKPIIFYSLLAGGILTLLCATASSWPM
FT                   LVVYRALLGIAVSGITAAVTVYISEEVSPALAGIVTGYFIFGNSLGSMSGRVFATLMME
FT                   HVSIDTIFFIFGGVLIAMALAVKLFLPTSRQFVPTPSLQLGAVLKGGLEHFKNIRVSLC
FT                   FVIGFILFGSFTSIFNFLAFYLHRPPYELSYTWIGLIPVSFSLTFFLAPYAARVALNIG
FT                   SMNALSILIICMMVGAFLTLIAPSLWVFISGIVLLSVAFFSAHSTVLAWVSSRSPNAKG
FT                   QATSFYLLCYYSGGAVMGYLNGYLFSWQGWNAIAASCLMMLGIGLFICRFIFAKYEKQP
FT                   QIKKQSVQESF"
FT   gene            419900..421321
FT                   /gene="leuC"
FT                   /locus_tag="SeHA_C0421"
FT   CDS_pept        419900..421321
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="leuC"
FT                   /locus_tag="SeHA_C0421"
FT                   /product="3-isopropylmalate dehydratase, large subunit"
FT                   /EC_number="4.2.1.33"
FT                   /note="identified by match to protein family HMM PF00330;
FT                   match to protein family HMM TIGR00170"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0421"
FT                   /db_xref="EnsemblGenomes-Tr:ACF66048"
FT                   /protein_id="ACF66048.1"
FT                   /translation="MSAKTLYEKLVESHTIRELDNEGHVLLYIDRSILNEYTSPQAFSG
FT                   LRERGRTVRHPDTFLLNIDHVNPTRSQRDVLMTDPGGQLQVDYFRENAADFGITLFDVL
FT                   DPRQGIEHVVAHEQGLVMPGMVIAAGDSHTTTYGAFGALGFGIGTSEIEHLLATQTLVY
FT                   RKLKTMRVSVQGELPFACSAKDIVLELLERIGADGATGYAIEFVGEAISALSVEGRMTL
FT                   CNMAVEAGARGAIIAPDKKVFDYIYGKPQMPVGELWQQALLEWSQLSSDADAVFDKTVA
FT                   INCHDLEPKVTWGISPDQTGSITGRVPFPEQETNPLKRLALEKALHYMGLTAGMLLKDI
FT                   RISHAFIGSCTNGRIEDLRAVAKVLEGRKIASHVRGIIVPGSTMVRRQAEEEGLAKIFI
FT                   AAGFEWRQSGCSMCLAMNEDVLSPGDRCASGTNRNFPGRQGAGARTHLMSPAMVAAAAV
FT                   AGHLVDVRSLLQAGE"
FT   gene            421323..421949
FT                   /gene="leuD"
FT                   /locus_tag="SeHA_C0422"
FT   CDS_pept        421323..421949
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="leuD"
FT                   /locus_tag="SeHA_C0422"
FT                   /product="3-isopropylmalate dehydratase, small subunit"
FT                   /EC_number="4.2.1.33"
FT                   /note="identified by match to protein family HMM PF00694;
FT                   match to protein family HMM TIGR00171"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0422"
FT                   /db_xref="EnsemblGenomes-Tr:ACF69693"
FT                   /protein_id="ACF69693.1"
FT                   /translation="MDTFKQISGRIAPMLEPNIDTDVIMPKQFLKGIDRQGLDKGVFFD
FT                   RRFMAGGQPNPDFILNMPGWQSATFLLVGPNFGCGSSREHAVWGLKQLGVRGLIGSTFA
FT                   GIFDDNCQRNGILTVSLDEPALARLAQLAASADTNSITVSLDRCEITTAEETISFVISE
FT                   LKRAMLAAGEDAIAWTLQYLPEIENFEVAHYSRRPWLKRPASPRG"
FT   gene            421964..422842
FT                   /locus_tag="SeHA_C0423"
FT   CDS_pept        421964..422842
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0423"
FT                   /product="5-oxopent-3-ene-1,2,5-tricarboxylate
FT                   decarboxylase"
FT                   /note="identified by match to protein family HMM PF01557"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0423"
FT                   /db_xref="EnsemblGenomes-Tr:ACF69275"
FT                   /protein_id="ACF69275.1"
FT                   /translation="MKLVQYLVNGGKRYGIMQEIGIIDLSQRLGDKYPTLKSLLCANAL
FT                   TDAALWCDEPADYYYQEVTFLPVIDDPQKIICVGMNYADKRIEFNETNPAPTLFVRFAD
FT                   SQTGHNGLLLKPENTNEFDYEGELAVVIGRRCSRVSAEDALDYVAGYSCYMDGSVRDWQ
FT                   HSWFTAGKNWPSTGSFGPCLVTTDDIPDPQMLRLLTRLNGREVQNESTANMIHPIASLI
FT                   AYISTFTLLSPGDTILTGSPGGVGKKRVPPLFLHDGDVIEVEIEHIGTLRNVVRDSRYL
FT                   TSSVSWHDGRK"
FT   gene            422842..423366
FT                   /pseudo
FT                   /locus_tag="SeHA_C0424"
FT                   /note="haloacetate dehalogenase H-1; this gene contains a
FT                   frame shift which may be the result of sequencing error"
FT   gene            423363..423755
FT                   /pseudo
FT                   /locus_tag="SeHA_C0425"
FT                   /note="alpha/beta hydrolase fold; this gene contains a
FT                   frame shift which may be the result of sequencing error"
FT   gene            423789..424754
FT                   /locus_tag="SeHA_C0426"
FT   CDS_pept        423789..424754
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0426"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="identified by match to protein family HMM PF00126;
FT                   match to protein family HMM PF03466"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0426"
FT                   /db_xref="EnsemblGenomes-Tr:ACF67007"
FT                   /protein_id="ACF67007.1"
FT                   /translation="MKTTPVGKKHRQPLEGWPSVEDLFVFVTVARNGGFARAALELGLS
FT                   PSYISKRIAILEKCLNARLFFRNNRVMRLTPEGENALCGAMQVVSEMDGFVSRLDNQRG
FT                   VLAGNITINCSFGFGHKYVAEALSSFMIAYPDITVKLTLTDREVDLVEEGIDIEIRVGD
FT                   DINELYIARQLATNRRILCASPEYLERHGKPESVSALVQHDCLMIQEKNSAFGNWILTD
FT                   GKQQTHCRLNGFHSSNSGSVVLIWALKGHGITLRSEWDVAQYIERGELVRVLPQWYQEA
FT                   NIWAVYTRRSSSSDRIKICIDFLTEHLAQCLPGGKAPGVL"
FT   gene            424852..424965
FT                   /locus_tag="SeHA_C0427"
FT   CDS_pept        424852..424965
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0427"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0427"
FT                   /db_xref="EnsemblGenomes-Tr:ACF69321"
FT                   /protein_id="ACF69321.1"
FT                   /translation="MVARFCFRYRGEVIFYPTTRPNLHIDTSIITGFLTWF"
FT   gene            425867..426061
FT                   /locus_tag="SeHA_C0428"
FT   CDS_pept        425867..426061
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0428"
FT                   /product="putative outer membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0428"
FT                   /db_xref="EnsemblGenomes-Tr:ACF68788"
FT                   /protein_id="ACF68788.1"
FT                   /translation="MTTGIENNFRGYMMRNNNTFYTLIESDNENVWDMSVEEKGTQQNK
FT                   DAVQKVKYQLNAIFDNGTC"
FT   gene            complement(426108..426866)
FT                   /locus_tag="SeHA_C0429"
FT   CDS_pept        complement(426108..426866)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0429"
FT                   /product="fimbrial chaperone protein"
FT                   /note="identified by match to protein family HMM PF00345;
FT                   match to protein family HMM PF02753"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0429"
FT                   /db_xref="EnsemblGenomes-Tr:ACF67082"
FT                   /protein_id="ACF67082.1"
FT                   /translation="MRNYRQWLVFSKVILTLLGLTGWYGPAQAAVNIDRTRIIFASDDV
FT                   AQSLTLSNDNTTPMLLQVWTDAGNIDASPDNSKTPLVALPPVFKMQPGELRTLRLLLSS
FT                   RQQLATDRESLFWLNIYQIPPVTQDIKNHPRKLVLPLRLRLKILIRPTGLKAPTEAEEK
FT                   KLRFIAKENTIRIVNPTSWYMSLTLTMDNKKSIGDIMVAPKTALDVPLTRSPTPGASIN
FT                   YAVINDSGNWRQYTAILEKYISKSDFIPEF"
FT   gene            complement(426832..428157)
FT                   /locus_tag="SeHA_C0430"
FT   CDS_pept        complement(426832..428157)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0430"
FT                   /product="putative fimbrial usher"
FT                   /note="identified by match to protein family HMM PF00419"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0430"
FT                   /db_xref="EnsemblGenomes-Tr:ACF67480"
FT                   /protein_id="ACF67480.1"
FT                   /translation="MLFSFRTLLFITSLFVSAGTWSSCIKVTDKSALSDAAIKAGYTAQ
FT                   NWIGATDTNTGNIGLPTVISISNSETFQPSGTLLASGIGNFLTAATGTPYSSKQVLYRC
FT                   DSADAGKLYEMYSTNGDSAFAGAFFTPEVEGAYYDVERNVAVRMTNLSTGEYYSRFWKE
FT                   RQLTADSWFQDDKYIYIPASAFSNVLYEMFKIDSRKYFAYQNPMDRDTWTQPRGYIAFK
FT                   GPGLITERIKAGLDHASDYYGWPSYWPGAWSTYNSVTYVRGALCKITDYPAIVKIPPVA
FT                   VGILAAGGNSQAPFHVSLECESGAVSSALPSTSAANVAMGFVVNQPTAVAAARRLGLTT
FT                   SAGGLSWLLDTHYGEPGVASGVGIRIYNDAGTPINLLPDRIKTGTGNARGWYGYKDLTT
FT                   RVSSGSVETYSGDFTASLEAIGGQTVTAGSVNAQLQAVVSFQ"
FT   gene            complement(428162..430723)
FT                   /locus_tag="SeHA_C0431"
FT   CDS_pept        complement(428162..430723)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0431"
FT                   /product="outer membrane fimbrial usher protein"
FT                   /note="identified by match to protein family HMM PF00577"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0431"
FT                   /db_xref="EnsemblGenomes-Tr:ACF68108"
FT                   /protein_id="ACF68108.1"
FT                   /translation="MSPTINLNRKSLALLIAIVCSGSAQGEEYYFDPALLQGATYGQNI
FT                   ARFNERQTPSGDYLADVYVNGTLVASSTNIRFNAVKEGQQAEPCLPLSVMKAAQIKSLP
FT                   ATDAATECRPLREWVPHAGWQFDSATLRLLLTIPMTELTHKPRGYISPSEWDSGALALF
FT                   LRHNTNWTHTENTDSHYRYQYLWSGLNMGVNLGLWQVRHQSNLRYANSNQSGSAWRYNS
FT                   VRTWVQRPVSSINSILSLGDSYTDSSLFGSLSFNGAKLVTDERMRPQGKRGYAPEVRGV
FT                   AASSAHVVVKQLGKVIYETNVPPGPFYIDDLYNTRYQGDLEVEVIEASGKTSRFTVPYS
FT                   SVPDSVRPGNWHYSLAFGRVRQYYDIENRFFEGTFQHGVNNTITLNLGSRIAQRYQAWL
FT                   AGGVWATGMGAFGLNATWSNARAEHNDRQQGWRAELSYSKTFTTGTNLVLAAYRYSTNG
FT                   FRDLQDVLGVRREAKTGIDYYSDTLHQRNRLSATVSQPLGRLGTLNLSASTADYYNNQS
FT                   RITQLQMGYSNQWRNISYGVNIARQRTTWDYDRFYHGVNEPLDVSSRQKYTETTMSFNV
FT                   SIPLDWGENRTSVAMNYNQSSQSRSSTVSMTGSSGENSDLSWSVYGGYERYRNSNSDSS
FT                   APTTFGGNLQQNTRFGALRANYDQGDNYRQEGLGASGTLVLHPGGLTAGPYTSDTFALI
FT                   HADGAQGAIVQNGQGAVVDRFGYAILPSLSPYRVNNVTLDTRKMRSDAELTGGSQQIVP
FT                   YAGAIARVNFATISGKAVLISVKMPDGGIPPMGADVFNGEGTNIGMVGQSGQIYARIAH
FT                   PSGSLLVRWGTGANQRCRVAYQLDLHTKEPFLYLNKICEKE"
FT   gene            complement(430707..431510)
FT                   /locus_tag="SeHA_C0432"
FT   CDS_pept        complement(430707..431510)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0432"
FT                   /product="fimbrial chaperone protein"
FT                   /note="identified by match to protein family HMM PF00345"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0432"
FT                   /db_xref="EnsemblGenomes-Tr:ACF66800"
FT                   /protein_id="ACF66800.1"
FT                   /translation="MKRQTIFNRQGVVEMKMDTRHSALYYLIVFLLLALPATASWASVT
FT                   ILGSRIIYPSTASSVDVQLKNNDAIPYIVQTWFDDGDMNTSPENSSAMPFIATPPVFRI
FT                   QPKAGQVVRVIYNNTKKLPQDRESVFWFNVLQVPPTNIGSDSGQNKMLVMLRSRIKLFY
FT                   RPDGLGKPDNLAKKLQIKTVNKGSGKSGIVIVNPQPWFASLSNLNVKVNGASYNLDADM
FT                   IAPFSSQTWWLPGKRSLKSFSGTVTVTLVNDLGARISESYDVPHH"
FT   gene            complement(431530..432066)
FT                   /locus_tag="SeHA_C0433"
FT   CDS_pept        complement(431530..432066)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0433"
FT                   /product="fimbrial protein"
FT                   /note="identified by match to protein family HMM PF00419"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0433"
FT                   /db_xref="EnsemblGenomes-Tr:ACF69629"
FT                   /protein_id="ACF69629.1"
FT                   /translation="MSMKKYLAMITGSLLVSSSAMAVSDNTITFQGEVSDETCSVVING
FT                   NQAKPVVLLPTVSTKDLSEQGKTAGPITFDIGLSGCTGSQDKTTKISTVFVGNQVTSNG
FT                   NLGNTGSAKNVEVQLLDTSGEPINLTGGFTGDGDLQLEPNASEASATYTARYYSTGKAE
FT                   AGTVAATLQYAVSYK"
FT   gene            432730..433464
FT                   /locus_tag="SeHA_C0434"
FT   CDS_pept        432730..433464
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0434"
FT                   /product="putative transmembrane regulator"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0434"
FT                   /db_xref="EnsemblGenomes-Tr:ACF70366"
FT                   /protein_id="ACF70366.1"
FT                   /translation="MNESIFLLDKRVVFDSTKMTLSHGNEIIRISEAETHLLLAFWHGL
FT                   YKKEDIIHFVWENRGGCVSESSYYKLINQMRNDFSSIGLQSSDIVTRPRVGVSLSVAIE
FT                   PIKKITSLKVSDENVKGTPTRENIFYKIKRHSVFVVLTGAILLALLYGVFTIYKAPVRN
FT                   SPDSFFTYLGEYNDYAIYKTKEDKVTLSEVVFAFNSLKIKIYRQNGRHLYYIREPNMNI
FT                   FLQCLNPVEMAVPKCITVKERY"
FT   gene            433437..433937
FT                   /pseudo
FT                   /locus_tag="SeHA_C0435"
FT                   /note="conserved hypothetical protein; this gene contains a
FT                   frame shift which may be the result of sequencing error"
FT   gene            434261..435811
FT                   /locus_tag="SeHA_C0436"
FT   CDS_pept        434261..435811
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0436"
FT                   /product="cyclic diguanylate phosphodiesterase (EAL) domain
FT                   protein"
FT                   /note="identified by match to protein family HMM PF00563"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0436"
FT                   /db_xref="EnsemblGenomes-Tr:ACF67124"
FT                   /protein_id="ACF67124.1"
FT                   /translation="MLFIAVPLIVMILVGLLAGIFQLKRDIAVSANTLLRFSADISAAS
FT                   WQVARKAARLAESSCTDTLKELSRTRAFTPYVRDIGFLENGDITCSFVTGTERYHFSRL
FT                   AGLSLPASYPERWLRSIGSMAEGPDRLVVVYVKKVAANKAAFVIVDSQYVQELMEILAA
FT                   ERASAFSLTFGAGEAITSAATLRGKAFLTQRFTSTDHTIQLMVRTPFSTLSAYWLQNLF
FT                   IFIPLSLCLSVGMMLFYRRWYLKRLSLAREIARGITHNEFTVHYQPVFNVEDGSCGGVE
FT                   ALMRWPQPDGRFITPDIFITAAENEGMIIPLSRHLFELIAHDVINWTVSDDFYISVNIS
FT                   PAHLMDDGFIQDIEALRTRLGTITLMLELTERSLIVEPSQVAEKLSTLREKGVLIAIDD
FT                   FGTGYCSLSYLQQLPVDSLKIDRTFIDTIDTSSDDVPVLDTIITLSQRLGLNVVAEGVS
FT                   TQHQLRYILSHGVGFVQGFLYARPMGANDFMSWLGKSAQRQNGLLKGENESASGLVAE"
FT   gene            435911..436654
FT                   /locus_tag="SeHA_C0437"
FT   CDS_pept        435911..436654
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0437"
FT                   /product="putative response regulator"
FT                   /note="identified by match to protein family HMM PF00486"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0437"
FT                   /db_xref="EnsemblGenomes-Tr:ACF70260"
FT                   /protein_id="ACF70260.1"
FT                   /translation="MSQNNYLIDKRVILDCERMTLSCAGESITISESERSLLIAFYEGL
FT                   FKKDDLINYVWGRKGVVVSDASYYKLINQLRGSFDKIGLKGASVVTRPRVGVLLSVSIE
FT                   PLSDEAQNTPLPAVAETELSTVEVRRDDTIIPPIPGAVNKKDWLYFCLAALLMFFMMYK
FT                   VKGENIDYFTLQGSYDGYTFYSVGHDKTHLTDIVEAYSEMSNEIHKQNGKIIYYIRVPN
FT                   TNIFVQCLNQLDIAEPKCISIKERY"
FT   gene            436627..437115
FT                   /locus_tag="SeHA_C0438"
FT   CDS_pept        436627..437115
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0438"
FT                   /product="putative inner membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0438"
FT                   /db_xref="EnsemblGenomes-Tr:ACF69985"
FT                   /protein_id="ACF69985.1"
FT                   /translation="MHFHKRTLLSVATLGMLAVSVVLMVVWVRNSSHSSINTNEFLCTT
FT                   RTVTTIQPKDIHADGSLVLDFKMKRITLQYEIKTKDNGVKILYRDVYMKNLHRTAPGVY
FT                   TFEVSQVKVFATDTAGDLLSYLRVLHPEAANEIRISKVGEKTFFYSLNRQLYNVCTAQ"
FT   gene            437515..438039
FT                   /locus_tag="SeHA_C0439"
FT   CDS_pept        437515..438039
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0439"
FT                   /product="attachment invasion locus protein"
FT                   /note="identified by match to protein family HMM PF06316;
FT                   match to protein family HMM TIGR03304"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0439"
FT                   /db_xref="EnsemblGenomes-Tr:ACF69485"
FT                   /protein_id="ACF69485.1"
FT                   /translation="MKRRSSFLVFLGLLLASPLALANDQHTVSFGYAQTHLSSLKNSDS
FT                   KDLRGFNFKYRYEFNETWGMLGSFTATRNEMENYTWKEGKLHKNGSDSVDYGSLMFGPT
FT                   YRFNDYVSLYGNAGIATMKFNKHSKEESFAYGAGVIFNPVKSISIDASWEASRFFAVDT
FT                   NTFGVSVGYRF"
FT   gene            438183..438824
FT                   /locus_tag="SeHA_C0440"
FT   CDS_pept        438183..438824
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0440"
FT                   /product="putative response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0440"
FT                   /db_xref="EnsemblGenomes-Tr:ACF68925"
FT                   /protein_id="ACF68925.1"
FT                   /translation="MINSLSEQLPLKTIGIVLTDDYYTYLGIASLFEDGKCFMFPLNGE
FT                   YNSCQISASEDIIIIIDGRVLIQGVWKGFKALMQHYPHARRIWLTRRDIGKLYPHGCDR
FT                   DPDIDPDLAKPVFIEHFIKYACANEVAVGELAPLTKKEEELLWHFLYKKSMSQIASSYG
FT                   MSRKTLYIHRLRICRKYGFKRFFHLLFIYQRSRHIFASKICRVDKNADQA"
FT   gene            438880..439059
FT                   /locus_tag="SeHA_C0441"
FT   CDS_pept        438880..439059
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0441"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0441"
FT                   /db_xref="EnsemblGenomes-Tr:ACF68418"
FT                   /protein_id="ACF68418.1"
FT                   /translation="MLLAIKILISALDEKTKIRLREHIEKTEQEIASSIHDSIMTETFL
FT                   QQMKDIRYIFNIVP"
FT   gene            439093..439476
FT                   /locus_tag="SeHA_C0442"
FT   CDS_pept        439093..439476
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0442"
FT                   /product="cytochrome c type biogenesis protein CycH"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0442"
FT                   /db_xref="EnsemblGenomes-Tr:ACF66063"
FT                   /protein_id="ACF66063.1"
FT                   /translation="MINRPGISMKKILVCFVGLALTACSANSLNYGAEQVRVMTSEPGK
FT                   ECSYLGDITGSQGNFFTGGWTSNSNLETGARNDLKNKAYKMGGNTVVLLTQRAGQTGSS
FT                   WHGSGSSKQTNVTLSGNVYRCPR"
FT   gene            complement(439546..441003)
FT                   /gene="oprA"
FT                   /locus_tag="SeHA_C0443"
FT   CDS_pept        complement(439546..441003)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="oprA"
FT                   /locus_tag="SeHA_C0443"
FT                   /product="outer membrane efflux protein OprA"
FT                   /note="identified by match to protein family HMM PF02321;
FT                   match to protein family HMM TIGR01845"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0443"
FT                   /db_xref="EnsemblGenomes-Tr:ACF67327"
FT                   /protein_id="ACF67327.1"
FT                   /translation="MKITFRGYRQTATLATLAFVTTLAGCTMAPKHERPASPTAMVYPY
FT                   ATSTVSGAPDAADIGWRDFFHDPLLQELIAIALRNNRDLRKAGLNVEAARALYRIQRAE
FT                   MLPTLGIATAMDAGRTPADLSVTDEPEINRRYEMAGATTAWELDLWGRVRSLSDQALAA
FT                   YMALDETYIAARMSLVSEVASAWLTLRADRELLRLTEDTLAAQKSSYTLTTQLARTGNA
FT                   TQLDLRMAEIALRSAEINRAAYTRQLARDRNALELLLGQPLTPELSRRLNEAVTLTEGA
FT                   IPTTLPGGLPSDLLVRRPDIRAAEYRLRGANARIGAARAAFFPTISLTGAAGTASASLS
FT                   GLFEPGSGSWRFLPQITLPLFHGGALRADLDRAHVQKQIEIARYENVIQQAFRDVADGL
FT                   AGQRTLNDQVQSEQRAVEASQIAYELAGLRFQEGVDDYLTLLDTHRMLYGAQQRLVRTR
FT                   LMQQLNIINLYKALGGGWREYSEKKQG"
FT   gene            complement(441020..444187)
FT                   /locus_tag="SeHA_C0444"
FT   CDS_pept        complement(441020..444187)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0444"
FT                   /product="OqxB"
FT                   /note="identified by match to protein family HMM PF00873;
FT                   match to protein family HMM TIGR00915"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0444"
FT                   /db_xref="EnsemblGenomes-Tr:ACF66840"
FT                   /protein_id="ACF66840.1"
FT                   /translation="MKFTHFFIARPIFAIVLSLLMLLAGAIAFLKLPLSEYPAVTPPTV
FT                   QVSASYPGANPQVIADTVAAPLEQVINGVDGMLYMNTQMAIDGRMVISIAFEQGTDPDM
FT                   AQIQVQNRVSRALPRLPEEVQRIGIVTEKTSPDMLMVVHLVSPQKRYDSLYLSNFAIRQ
FT                   VRDELARLPGVGDVLVWGAGEYAMRVWLDPAKIANRGLTASDIVTALREQNVQVAAGSV
FT                   GQQPEASAAFQMTVNTLGRLTSEEQFGEIVVKIGADGEVTRLRDVARVTLGADAYTLRS
FT                   LLNGEAAPALQIIQSPGANAIDVSNAIRGKMDELQQNFPQDIEYRIAYDPTVFVRASLQ
FT                   SVAITLLEALVLVVLVVVLFLQTWRASIIPLVAVPVSLVGTFALMHLFGFSLNTLSLFG
FT                   LVLSIGIVVDDAIVVVENVERHISQGKSPGEAAKKAMDEVTGPILSITSVLTAVFIPSA
FT                   FLAGLQGEFYRQFALTIAISTILSAINSLTLSPALAAILLRPHHDTAKADWLTRLMGTV
FT                   TGGFFHRFNRFFDSASNRYVSAVRRAVRGSVIVMVLYAGFVGLTWLGFHQVPNGFVPAQ
FT                   DKYYLVGIAQLPSGASLDRTEAVVKQMSAIALAEPGVESVVVFPGLSVNGPVNVPNSAL
FT                   MFAMLKPFDEREDPSLSANAIAGKLMHKFSHIPDGFIGIFPPPPVPGLGATGGFKLQIE
FT                   DRAELGFEAMTKVQSEIMSKAMQTPELANMLASFQTNAPQLQVDIDRVKAKSMGVSLTD
FT                   IFETLQINLGSLYVNDFNRFGRTWRVMAQADAPFRMQQEDIGLLKVRNAKGEMIPLSAF
FT                   VTIMRQSGPDRIIHYNGFPSVDISGGPAPGFSSGQATDAIEKIVRETLPEGMVFEWTDL
FT                   VYQEKQADNSALAIFALAVLLAFLILAAQYNSWSLPFAVLLIAPMSLLSAIVGVWVSGG
FT                   DNNIFTQIGFVVLVGLAAKNAILIVEFARAKEHDGADPLTAVLEASRLRLRPILMTSFA
FT                   FIAGVVPLVLATGAGAEMRHAMGIAVFAGMLGVTLFGLLLTPVFYVVVRRMALKRENRV
FT                   DSHDQQA"
FT   gene            complement(444184..445410)
FT                   /locus_tag="SeHA_C0445"
FT   CDS_pept        complement(444184..445410)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0445"
FT                   /product="putative auxiliary transport protein, membrane
FT                   fusion protein (MFP) family"
FT                   /note="identified by match to protein family HMM PF00529;
FT                   match to protein family HMM TIGR01730"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0445"
FT                   /db_xref="EnsemblGenomes-Tr:ACF66243"
FT                   /protein_id="ACF66243.1"
FT                   /translation="MRRTFKIMLIAGVIATIGGVIYITGEALWDKGNAVGPPASAPPPP
FT                   SVPVAKALSRTLAPTAEFTGFLAAPETVELRSRVGGTLDAVSVPEGRLVSRGQLLFQID
FT                   PRPFEVALDTAVAQLRQAEVLARQAQADFDRIQRLVASGAVSRKNADDVTATRNARQAQ
FT                   MQSAKAAVAAARLELSWTRITAPIAGRVDRILVTRGNLVSGGVAGNATLLTTIVSHNPM
FT                   YVYFDIDEATWLKALRHTRSDKNPPVVNMGLTTDNGLPYQGVLDFMGNQMNRSTGTIRA
FT                   RAVIPDPDGMLSPGLFARISLPIGEPRETVLIDDLAVSADQGKNYVLIVGKENQVEYRP
FT                   VELGQMVDGLRVVTQGVQPGEKIILKGLVRPGMTVAPRLVPMRQNVTDKQTATLTKADG
FT                   DSASKAVRQ"
FT   gene            445554..445667
FT                   /locus_tag="SeHA_C0446"
FT   CDS_pept        445554..445667
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0446"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0446"
FT                   /db_xref="EnsemblGenomes-Tr:ACF68728"
FT                   /protein_id="ACF68728.1"
FT                   /translation="MSRIILFYEPSHILAEPCSLNTLDLPTMASFRLSDTE"
FT   gene            445687..447975
FT                   /locus_tag="SeHA_C0447"
FT   CDS_pept        445687..447975
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0447"
FT                   /product="copper-translocating P-type ATPase"
FT                   /EC_number="3.6.3.4"
FT                   /note="identified by match to protein family HMM PF00122;
FT                   match to protein family HMM PF00403; match to protein
FT                   family HMM PF00702; match to protein family HMM TIGR01494;
FT                   match to protein family HMM TIGR01511; match to protein
FT                   family HMM TIGR01525"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0447"
FT                   /db_xref="EnsemblGenomes-Tr:ACF69113"
FT                   /protein_id="ACF69113.1"
FT                   /translation="MSQSENRHDTISLLIEGMTCASCVARVEKGIKAVPGVTDATVNLA
FT                   TERATVRGTASAEAVIAAIEKTGYEARPVETAGQGEDDSEEKKEAERVRLKRDLILASV
FT                   LALPVFVLEMGSHLIPGMHEWVIKTIGLQQSWYWQFALTLLVLTIPGRRFYLKGFPALA
FT                   RLAPDMNSLVAVGTAAAFGYSLVATFTPDLLPEGTVNVYYEAAAVIVALILLGRFLEAR
FT                   AKGRTSEAIKRLVGLQARVAHVLREGRIVDIPVDEVVLGDCVEVRPGERIPVDGEVTEG
FT                   RSFVDESMITGEPIPVEKSAGSAVVGGTVNQKGALTLRATAVGGQTMLAQIIRLVEQAQ
FT                   GSKLPIQAVVDKVTLWFVPMVMLIAALTFVVWLAFGPSPALTFALINGVAVLIIACPCA
FT                   MGLATPTSIMVGTGRGAEMGVLFRKGEALQLLKDAKVVAVDKTGTLTEGRPVLTDLDVA
FT                   SGFERREVLAKVAAVESRSEHPIARAIVVSAEEEGIALPGMGGFESVTGMGVYATVAGT
FT                   RVDVGADRYMREIGVDISGFATTAERLGQEGKSPLYAAIDGQLAAIIAVADPIKPSTPA
FT                   AINALHQLGIKVAMITGDNARTAQAIARQLGIDDVVAEVLPEGKVEAIRRLKAAYGQVA
FT                   FVGDGINDAPALAESDVGLAIGTGTDVAVESADVVLMSGNLQGVPNAIALSKATIRNIH
FT                   QNLFWAFAYNTALIPVAAGALFPVWGILLSPVFAAGAMAMSSVFVLGNALRLRRFRAPM
FT                   ATPSDTSTT"
FT   gene            447987..448451
FT                   /gene="cueR"
FT                   /locus_tag="SeHA_C0448"
FT   CDS_pept        447987..448451
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cueR"
FT                   /locus_tag="SeHA_C0448"
FT                   /product="Cu(I)-responsive transcriptional regulator"
FT                   /note="identified by match to protein family HMM PF00376;
FT                   match to protein family HMM PF09278; match to protein
FT                   family HMM TIGR02044"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0448"
FT                   /db_xref="EnsemblGenomes-Tr:ACF67149"
FT                   /protein_id="ACF67149.1"
FT                   /translation="MNIGKAAKASKVSAKMIRYYEQIGLIPAASRTDSGYRAYTQADVN
FT                   QLHFIRRARDLGFSVAEISDLLNLWNNQSRQSADVKRLAQTHIDELDRRIQNMQHMAQT
FT                   LKALIHCCAGDALPDCPILHTLGQPDDSEPEARTGAVLRRPRRHGLAKRL"
FT   gene            448529..448723
FT                   /locus_tag="SeHA_C0449"
FT   CDS_pept        448529..448723
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0449"
FT                   /product="conserved domain protein"
FT                   /note="identified by match to protein family HMM PF00403"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0449"
FT                   /db_xref="EnsemblGenomes-Tr:ACF67373"
FT                   /protein_id="ACF67373.1"
FT                   /translation="MQFHIDDMTCGGCASTVKKTILTLDANATVRTDPATRLVDVETSL
FT                   SAEQIAAALQKAGFPPRER"
FT   gene            complement(448767..448880)
FT                   /locus_tag="SeHA_C0450"
FT   CDS_pept        complement(448767..448880)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0450"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0450"
FT                   /db_xref="EnsemblGenomes-Tr:ACF70330"
FT                   /protein_id="ACF70330.1"
FT                   /translation="MLAKIDKSLHIINKAYWHMICHSFYGDYLMQRKAKRG"
FT   gene            449015..450268
FT                   /locus_tag="SeHA_C0451"
FT   CDS_pept        449015..450268
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0451"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="identified by match to protein family HMM PF00083;
FT                   match to protein family HMM PF07690"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0451"
FT                   /db_xref="EnsemblGenomes-Tr:ACF68661"
FT                   /protein_id="ACF68661.1"
FT                   /translation="MYTPLNWTTTQRHVAFASFTSWMLDAFDFFILVFVLSDLAEWFHA
FT                   SVSDVSIAIMLTLAVRPIGALLFGRMAEKYGRRPILMLNILFFTVFELLSAWSPTFMAF
FT                   LIFRVMYGVAMGGIWGVASSLAMETIPDRSRGLMSGIFQAGYPCGYLFASVIFGLFYSM
FT                   VGWRGMFLIGALPVVLLPYIWFKVPESPVWLAARARKENTALLPVLRKQWKLCLYLVLV
FT                   MAFFNFFSHGTQDLYPTFLKMQHGFDPHLISIIAIFYNIAAMLGGIFYGTLSERIGRKK
FT                   AIMIAAFLALPVLPLWAFSSGSFTIGLGAFLMQFMVQGAWGVVPTWLNELVPANARAVL
FT                   PGFVYQLGNLLASVNATLQARIAETHGGNYGLAMAIVAGAVAILICVFVAFGRETRGVV
FT                   ISGTDSDALPESAVGHRT"
FT   gene            450457..452415
FT                   /locus_tag="SeHA_C0452"
FT   CDS_pept        450457..452415
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0452"
FT                   /product="type III restriction-modification system StyLTI
FT                   enzyme mod"
FT                   /EC_number="2.1.1.72"
FT                   /note="identified by match to protein family HMM PF01555"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0452"
FT                   /db_xref="EnsemblGenomes-Tr:ACF69831"
FT                   /protein_id="ACF69831.1"
FT                   /translation="MLKDNQKHNESVAPNSVFLSELQRALPEFFTADCYNEQGELIAKG
FT                   GFDLAKFERALKARNIDELTSGYQIDFIGKDYAKKQAGEKSVTVIVPDVEHNTLAENKN
FT                   SHNLFLTGDNLDVLRHLQNNYADTVDMIYIDPPYNTGSDGFVYPDHFEYSDRALQDMFG
FT                   LNDTELARLKSIQGKSTHSAWLSFMYPRLFLARKLLKDTGFIFISIDDNEYANLKLMMD
FT                   EIFGEGGFVTNVMWKRKKEISNDSDNVSIQGEYILVYAKTGQGALRLEPLSKEYIQKSY
FT                   KEPTEQFPEGKWRPVPLTVSKGLSGGGYTYKITTPNGTVHERLWAYPEASYQKLVADNL
FT                   VYFGKDNGGIPQRVMYAHHSKGQPTTNYWDNVASNKEGKKEILDLFGDNVFDTPKPTAL
FT                   LKKIIKLAIDKDGVVLDFFAGSGTTAHAVMALNEEDGGQRTFILCTIDQALSNNTIAKK
FT                   AGYNTIDEISRERITRVAAKIRANNPATNSDLGFKHYRFATPTQQTLDDLDSFDIATGH
FT                   FINTSGQLAAFTESGFTDMINPFSARGLGVPGGASGEETLLTTWLVADGYKMDIDVQTI
FT                   DFSGYCARYVDNTRLYLIDERWGTEQTRDLLNHIGTHQLPVQTIVIYGYSFDLESIREL
FT                   EIGLKQLDQKVNLVKRY"
FT   gene            452428..455397
FT                   /locus_tag="SeHA_C0453"
FT   CDS_pept        452428..455397
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0453"
FT                   /product="type III restriction-modification system StyLTI
FT                   enzyme res"
FT                   /EC_number="3.1.21.5"
FT                   /note="identified by match to protein family HMM PF04851;
FT                   match to protein family HMM PF08774"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0453"
FT                   /db_xref="EnsemblGenomes-Tr:ACF70459"
FT                   /protein_id="ACF70459.1"
FT                   /translation="MNILLEELPHQEQALAAILASFTGIDHAQADHNHYANPLIKERYD
FT                   DKANIDVKMETGTGKTYVYTRLMYELHQKYGLFKFVLVVPTPAIKEGARNFITSDYARQ
FT                   HFSQFYENTRMELCTINAGDFKVKSGRKNFPAQLLSFTDASRRDSHTIQVLLINAQMLN
FT                   SASMTRDDYDQTLLGGLTSPVKGLQMTRPVVIIDEPHRFARDNKFYRAIQAIQPQMIVR
FT                   FGATFPDIVEGKGKNKCVRKDYYRRQPQFDLNAVDSFNDGLVKGIDIYYPNLPEEQANN
FT                   RYIVDSVTAKKLILRRGSKIAEVGVGENLADVDAGFEGSIEYAGSKMLSNDLELEAGMA
FT                   LVPGTFGASYQELIIQEAIDKHFDTEQANFLRSNEPENNAPRIKTLSLFFIDSIKSYRD
FT                   DEGWLKLKFECLLKKKLTQLIDDYQRKTLPREVEYLSFLQATLASLHSDNQNVHAGYFG
FT                   EDRGSGDEAIQAEVDDILKNKEKLLSFSDHHGNWETRRFLFSKWTLREGWDNPNVFVIA
FT                   KLRSSGSESSKIQEVGRGLRLPVDENGHRVHQEEWPSRLSFLIGYDEKAFASMLVDEIN
FT                   RDSKVQLNEQKLDEAMITLIVTERQKVDPAFTELRLLEDLDDKKLINRSNEFKPSVTLN
FT                   GETKSGFAWLLEFYPELTQARVRADRIRDNKPASRLRVRLRKENWEQLSSIWEQFSRRY
FT                   MLQFERSGASLEQIAAEVLRDPALYIRQKPSQVQQRLVSNEDNGRFEVAQREGELAASE
FT                   FMAGMKYGHFLKQLALRTSLPVNVLHPVLMAMLRDVLHGDSRYLSEISLDNMTRALQAR
FT                   INAHFAQRHDYLPLDFQASTSVFDSTARQFREEISAEIVGKNVDENAIDDPRSLYQIPP
FT                   LRYDSVDPELPLLKYDYPQQVSVFGKLPKRAIQIPKYTGGSTTPDFVYRIERQDADSVY
FT                   LLVETKAENMRVGDQVILDAQRKFFDMLRRQNINVEFAEATSAPAVFSTINGLIEGKAN
FT                   "
FT   gene            455892..457295
FT                   /locus_tag="SeHA_C0454"
FT   CDS_pept        455892..457295
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0454"
FT                   /product="cytochrome bd-II oxidase subunit 1"
FT                   /EC_number="1.10.3.-"
FT                   /note="identified by match to protein family HMM PF01654"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0454"
FT                   /db_xref="EnsemblGenomes-Tr:ACF65921"
FT                   /protein_id="ACF65921.1"
FT                   /translation="MEFDAFFLARLQFAFTVSFHIIFPAITIGLASYLVVLEGLWLKTR
FT                   NPVWRSLYQFWLKIFAVNFGMGVVSGLVMAYQFGTNWSGFSQFAGSITGPLLTYEVLTA
FT                   FFLEAGFLGVMLFGWNKVGPGLHFLSTCMVALGTLMSTFWILASNSWMHTPQGFEIHNG
FT                   QVVPVDWFAVIFNPSFPYRLLHMSVAAFLSSAMFVGASAAWHLLKGNDTPAIRRMFSMA
FT                   LWMAVVVAPVQALIGDMHGLNTLKHQPVKIAAIEGHWENTPGEPTPLTLVGWPDMEAER
FT                   TRYALEIPALGSLILTHSLDKQVPALKDYPKEDRPNSTVVFWSFRLMVGMGVLMIFLGL
FT                   ASLWLRYRRRLYHSRPFMHFALWMGPSGLIAILAGWVTTEVGRQPWVVYGLLRTRDAVS
FT                   AHSTLQMSISLLAFFVVYSLVFGVGYIYMIRLIQKGPQPAETPTAETDGRPARPISAVG
FT                   ESLEQEKRE"
FT   gene            457292..458302
FT                   /gene="cydB"
FT                   /locus_tag="SeHA_C0455"
FT   CDS_pept        457292..458302
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cydB"
FT                   /locus_tag="SeHA_C0455"
FT                   /product="cytochrome D ubiquinol oxidase, subunit II"
FT                   /EC_number="1.10.3.-"
FT                   /note="identified by match to protein family HMM PF02322;
FT                   match to protein family HMM TIGR00203"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0455"
FT                   /db_xref="EnsemblGenomes-Tr:ACF66577"
FT                   /protein_id="ACF66577.1"
FT                   /translation="MTIDLPVIWFAIIVFATLMYIVMDGFDLGVGILFPFIRDKHDRDV
FT                   MVNSVAPVWDGNETWLVLGGAGLFGAFPLAYAVITDALTIPLVVMLLGLIFRGVAFEFR
FT                   FKATESHRAFWDKSFIVGSILATFAQGVVVGAVVSGFQVEGRTFSGSQLDWLTPFNLFC
FT                   GVGLVVTYALLGATWLIMKSEDPLHSRMCALSRPLLIVLLLVMGGVSVWTPLTHDDIAG
FT                   RWFTLPNLYYFLPVPVLVLAFSVWLWRSVKKPESHARPFILTLGLIFLGFSGLGISIWP
FT                   NIIPPDISLYAAAAPPQSQSFMLVGALIIIPIILAYTFWSYYVFRGKVRHGEGYH"
FT   gene            458302..458433
FT                   /locus_tag="SeHA_C0456"
FT   CDS_pept        458302..458433
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0456"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0456"
FT                   /db_xref="EnsemblGenomes-Tr:ACF68927"
FT                   /protein_id="ACF68927.1"
FT                   /translation="MVKVKKWSRRVVWMVAIWCASVLLLAGVGMLFRLLMTSAGFRS"
FT   gene            458640..459644
FT                   /locus_tag="SeHA_C0457"
FT   CDS_pept        458640..459644
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0457"
FT                   /product="AraC-family transcriptional regulator"
FT                   /note="identified by match to protein family HMM PF00165"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0457"
FT                   /db_xref="EnsemblGenomes-Tr:ACF68493"
FT                   /protein_id="ACF68493.1"
FT                   /translation="MSPISCHSSAAPAMKKIFSVSDFIAFGERYGIDYRFPALPQYTQS
FT                   SPVLHGDIEEIALPGGICITRSDVHVLQPYETTSRHSSPLYMLVVLEGNVALAVNEQTF
FT                   LLSAGMAFCSQLSEQQTIRAHHGADSKLRTLSLGMYPDGGWRERLPVSLADEWENSATS
FT                   ARVWQVPEFLLSGLRYAQQPGPHAASRQLMLEGIMLQLLGYALNLCQPATQKRGLPVTG
FT                   EYQRLELIRRLLEQTPEKAYTLNELARRAAMSPSSLRCKFRHAYGCTVFDYLRDCRLAR
FT                   ARRYLMEGYSVQQAAWMSGYQHATNFATAFRRRYGCSPGELRDASLTASRHCA"
FT   gene            459808..461898
FT                   /locus_tag="SeHA_C0458"
FT   CDS_pept        459808..461898
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0458"
FT                   /product="ferrichrome-iron receptor"
FT                   /note="identified by match to protein family HMM PF00593;
FT                   match to protein family HMM PF07715; match to protein
FT                   family HMM TIGR01783"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0458"
FT                   /db_xref="EnsemblGenomes-Tr:ACF66410"
FT                   /protein_id="ACF66410.1"
FT                   /translation="MFATTRMALLIGGAIGGATFPLFAQETTKNDTVIVTSPVQSGATK
FT                   LATPDIETPQSVSIITRQQFEEQGATSVRQAVSYTPGVYSNQIGASNRFDYIVLRGFSD
FT                   GSLDNVYLDGLKMMGDTNSHSSLVVDPWFLEDIEVVRGPASVLYGRSSPGGIVSLTSRK
FT                   PAFDAGGEVKLFAGNNNQRGAAFDVTGPLDDNERVAARLSGMTRYADSQFTPLKEERYA
FT                   LMPSLTWRITDRTRLDLMAYLHRDPEGGSHSGLPYQGTVVPYNGGKISNTFFEGEDDYD
FT                   KYDRRENMVGYNIEHLFDNGWSVRQKLRYLHTKVTLNQVYAAGWLNETALNRGYSGSGE
FT                   KMSAIALDNQLDGSVDTGAINHRLLVGIDYQDRSNHTTGYYGAFPPIDAFNPVYGAQPD
FT                   YITLYSREQHKLRQTGYYLQDQMSWDRWRFTLGGRYDRVSVSNIDKLHDSRSDLDKNNV
FT                   STRAALLYLFDNGVAPYLSYSTAFTPTSFADENGNVLEPMKGKQWEAGVKYEPPGGNSQ
FT                   FSAAVYRINQTNIATKEEPTDPYRSIGEIESKGVELEAISHLSDSVRLQAAYTYTDIRY
FT                   KKSSPQEQGKRAVYAPRNQASAWLSYDVKSGLLEGLTLGSGIRYVNGVTSDRLNTHTLP
FT                   SYTLVDMVVGYDLSSIGLNGLSAQLNVNNLTDKRYVAACNSLSYCYFGAERSIVGSVSW
FT                   AF"
FT   gene            complement(461939..462571)
FT                   /locus_tag="SeHA_C0459"
FT   CDS_pept        complement(461939..462571)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0459"
FT                   /product="putative transport protein"
FT                   /note="identified by match to protein family HMM PF01810;
FT                   match to protein family HMM TIGR00949"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0459"
FT                   /db_xref="EnsemblGenomes-Tr:ACF65951"
FT                   /protein_id="ACF65951.1"
FT                   /translation="MEPFHAVVLTVSLFVLTFFNPGANLFVVVQTSLASGRRAGVITGL
FT                   GVATGDAFYSGLGLFGLATLITQCEAVFSLIKIVGGAYLLWFAWNSIRHQATPQMSTLQ
FT                   TPIAAPWTIFFRRGLMTDLSNPQTVLFFISIFSVTLSAETPTWARLMAWAGIVLSSVIW
FT                   RIFLSQAFSLPAVRRAYGRIQRIASRVIGAIIGMFALRLLYEGVTHR"
FT   gene            462803..463078
FT                   /locus_tag="SeHA_C0460"
FT   CDS_pept        462803..463078
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0460"
FT                   /product="protein YahO"
FT                   /note="identified by match to protein family HMM PF07338"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0460"
FT                   /db_xref="EnsemblGenomes-Tr:ACF70381"
FT                   /protein_id="ACF70381.1"
FT                   /translation="MKTGYKVMLGALAFVVTNVYAAEIMKKTDFDKVASEYTKIGTIST
FT                   TGEMSPLDAREDLIKKADEKGADVVVLTSGQTENKIHGTADIYKKK"
FT   gene            complement(463214..464839)
FT                   /gene="prpR"
FT                   /locus_tag="SeHA_C0461"
FT   CDS_pept        complement(463214..464839)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prpR"
FT                   /locus_tag="SeHA_C0461"
FT                   /product="propionate catabolism operon regulatory protein
FT                   PrpR"
FT                   /note="identified by match to protein family HMM PF00158;
FT                   match to protein family HMM PF02954; match to protein
FT                   family HMM PF06506; match to protein family HMM TIGR02329"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0461"
FT                   /db_xref="EnsemblGenomes-Tr:ACF69890"
FT                   /protein_id="ACF69890.1"
FT                   /translation="MTTAHSAPRDNSDKPVIWTVSVTRLFELFRDISLEFDHLATITPI
FT                   QLGFEKAVTYIRKKLATERCDAIIAAGSNGAYLKSRLSIPVILIKPSGFDVLQALAKAG
FT                   KLTSSIGIVTYQETIPALLAFQKTFHLRLEQRSYVTEEDARGQINELKANGIEAVVGAG
FT                   LITDLAEEAGMTAIFIYSAATVRQAFHDALDMTRLTRRQRVDYPSGKGLQTRYELGDIR
FT                   GQSPQMEQLRQTITLYARSRAAVLIQGETGTGKELAAQAIHQTFFHRQPHRQNKPSPPF
FT                   VAVNCGAITESLLEAELFGYEEGAFTGSRRGGRAGLFEIAHGGTLFLDEIGEMPLPLQT
FT                   RLLRVLEEKAVTRVGGHQPIPVDVRVISATHCDLDREIMQGRFRPDLFYRLSILRLTLP
FT                   PLRERQADILPLAESFLKQSLAAMEIPFTESIRHGLTQCQPLLLAWRWPGNIRELRNMM
FT                   ERLALFLSVDPAPTLDRQFMRQLLPELMVNTAELTPSTVDANALQDVLARFKGDKSAAA
FT                   RYLGISRTTLWRRLKAGAKDQSDN"
FT   gene            465105..465992
FT                   /gene="prpB"
FT                   /locus_tag="SeHA_C0462"
FT   CDS_pept        465105..465992
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prpB"
FT                   /locus_tag="SeHA_C0462"
FT                   /product="methylisocitrate lyase"
FT                   /EC_number="4.1.3.30"
FT                   /note="identified by match to protein family HMM TIGR02317"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0462"
FT                   /db_xref="EnsemblGenomes-Tr:ACF68733"
FT                   /protein_id="ACF68733.1"
FT                   /translation="MSLHSPGQAFCAALAKENPLQIVGAINANHALLAQRAGYQAIYLS
FT                   GGGVAAGSLGLPDLGISTLDDVLTDIRRITDVCPLPLLVDADIGFGSSAFNVARTVKSI
FT                   AKAGAAALHIEDQVGAKRCGHRPNKAIVSKEEMVDRIRAAVDARTDPNFVIMARTDALA
FT                   VEGLEAALDRAQAYVDAGADMLFPEAITELSMYRQFADVAQVPILANITEFGATPLFTT
FT                   DELRSANVAMALYPLSAFRAMNRAAEKVYTVLRQEGTQKNVIDIMQTRNELYESINYYQ
FT                   FEEKLDALYRNKKS"
FT   gene            466115..467284
FT                   /gene="prpC"
FT                   /locus_tag="SeHA_C0463"
FT   CDS_pept        466115..467284
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prpC"
FT                   /locus_tag="SeHA_C0463"
FT                   /product="2-methylcitrate synthase"
FT                   /EC_number="2.3.3.5"
FT                   /note="identified by match to protein family HMM PF00285;
FT                   match to protein family HMM TIGR01800"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0463"
FT                   /db_xref="EnsemblGenomes-Tr:ACF70240"
FT                   /protein_id="ACF70240.1"
FT                   /translation="MTDTTILQNNTHVIKPKKSVALSGVPAGNTALCTVGKSGNDLHYR
FT                   GYDILDLAEHCEFEEVAHLLIHGKLPTRDELNAYKSKLKALRGLPANVRTVLEALPAAS
FT                   HPMDVMRTGVSALGCTLPEKEGHTVSGARDIADKLLASLSSILLYWYHYSHNGERIQPE
FT                   TDDDSIGGHFLHLLHGEKPTQSWEKAMHISLVLYAEHEFNASTFTSRVIAGTGSDVYSA
FT                   IIGAIGALRGPKHGGANEVSLEIQQRYETPDEAEADIRKRVENKEVVIGFGHPVYTIAD
FT                   PRHQVIKRVAKQLSEEGGSLKMYHIADRLETVMWETKKMFPNLDWFSAVSYNMMGVPTE
FT                   MFTPLFVIARVTGWAAHIIEQRQDNKIIRPSANYTGPDDRQFVPIEKRC"
FT   gene            467322..468773
FT                   /gene="prpD"
FT                   /locus_tag="SeHA_C0464"
FT   CDS_pept        467322..468773
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prpD"
FT                   /locus_tag="SeHA_C0464"
FT                   /product="2-methylcitrate dehydratase"
FT                   /EC_number="4.2.1.79"
FT                   /note="identified by match to protein family HMM PF03972;
FT                   match to protein family HMM TIGR02330"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0464"
FT                   /db_xref="EnsemblGenomes-Tr:ACF67768"
FT                   /protein_id="ACF67768.1"
FT                   /translation="MSAHISNIRPDFDREIVDIVDYVMNYEITSKVAYDTAHYCLLDTL
FT                   GCGLEALEYPACKKLLGPIVPGTVVPNGARVPGTQFQLDPVQAAFNIGAMIRWLDFNDT
FT                   WLAAEWGHPSDNLGGILAIADWLSRNAVAAGKAPLTMKQVLSGMIKAHEIQGCIALENA
FT                   FNRVGLDHVLLVKVASTAVVAEMLGLTRDEILNAVSLAWVDGQSLRTYRHAPNTGTRKS
FT                   WAAGDATSRAVRLALMAKTGEMGYPSALTAKTWGFYDVSFKGETFRFQRPYGSYVMENV
FT                   LFKISFPAEFHSQTAVEAAMTLYEQMQAAGKTAADIEKVTIRTHEACLRIIDKKGPLNN
FT                   PADRDHCIQYMVAVPLLFGRLTAADYEDEVAQDKRIDALREKIVCYEDPAFTADYHDPE
FT                   KRAIGNAISVEFTDGSRFDEVVVEYPIGHARRRADGIPKLIEKFKINLARQFPTRQQQR
FT                   ILDVSLDRARLEQMPVNEYLDLYVI"
FT   gene            468814..470700
FT                   /gene="prpE"
FT                   /locus_tag="SeHA_C0465"
FT   CDS_pept        468814..470700
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prpE"
FT                   /locus_tag="SeHA_C0465"
FT                   /product="propionate--CoA ligase"
FT                   /EC_number="6.2.1.17"
FT                   /note="identified by match to protein family HMM PF00501;
FT                   match to protein family HMM TIGR02316"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0465"
FT                   /db_xref="EnsemblGenomes-Tr:ACF67241"
FT                   /protein_id="ACF67241.1"
FT                   /translation="MSFSEFYQRSINEPEAFWAEQARRIDWRQPFTQTLDHSRPPFARW
FT                   FCDGTTNLCHNAVDRWLDKQPEALALIAVSSETDEERTFTFSQLHDEVNIVAAMLLSLG
FT                   VQRGDRVLVYMPMIAEAQITLLACARIGAIHSVVFGGFASHSVAARIDDARPALIVSAD
FT                   AGARGGKILPYKKLLDDAIAQAQHQPKHVLLVDRGLAKMAWVDGRDLDFATLRQQHLGA
FT                   SVPVAWLESNETSCILYTSGTTGKPKGVQRDVGGYAVALATSMDTIFGGKAGGVFFCAS
FT                   DIGWVVGHSYIVYAPLLAGMATIVYEGLPTYPDCGVWWKIVEKYQVNRMFSAPTAIRVL
FT                   KKFPTAQIRNHDLSSLEALYLAGEPLDEPTASWVTETLGVPVIDNYWQTESGWPIMALA
FT                   RALDDRPSRLGSPGVPMYGYNVQLLNEVTGEPCGINEKGMLVIEGPLPPGCIQTIWGDD
FT                   ARFVKTYWSLFNRQVYATFDWGIRDAEGYYFILGRTDDVINIAGHRLGTREIEESISSY
FT                   PNVAEVAVVGIKDALKGQVAVAFVIPKQSDTLADREAARDEENAIMALVDNQIGHFGRP
FT                   AHVWFVSQLPKTRSGKMLRRTIQAICEGRDPGDLTTIDDPASLQQIRQAIEE"
FT   gene            complement(470804..471778)
FT                   /gene="hemB"
FT                   /locus_tag="SeHA_C0466"
FT   CDS_pept        complement(470804..471778)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemB"
FT                   /locus_tag="SeHA_C0466"
FT                   /product="delta-aminolevulinic acid dehydratase"
FT                   /EC_number="4.2.1.24"
FT                   /note="identified by match to protein family HMM PF00490"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0466"
FT                   /db_xref="EnsemblGenomes-Tr:ACF69226"
FT                   /protein_id="ACF69226.1"
FT                   /translation="MTDLIHRPRRLRKSAALRAMFEETTLSLNDLVLPIFVEEELDDYK
FT                   AIDAMPGVMRIPEKQLAREIERIANAGIRSVMTFGISHHTDDTGSDTWKEDGLVARMSR
FT                   ICKQTVPEMIVMSDTCFCEYTSHGHCGVLCEHGVDNDATLANLGKQAVIAAAAGADFIA
FT                   PSAAMDGQVQAIRQALDAAGFTDTAIMSYSTKFASSFYGPFREAAGTALKGDRKTYQMN
FT                   PMNRREAIRESLLDEAQGADCLMVKPAGAYLDVLREIRERTELPLGAYQVSGEYAMIKF
FT                   AAMAGAIDEEKVVLESLGSIKRAGADLIFSYFALDLAEKNILR"
FT   gene            471998..472117
FT                   /locus_tag="SeHA_C0467"
FT   CDS_pept        471998..472117
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0467"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0467"
FT                   /db_xref="EnsemblGenomes-Tr:ACF66458"
FT                   /protein_id="ACF66458.1"
FT                   /translation="MWVSTLFMFILFFFNPYLSYMCFVFLFSCKAMKKNAFQL"
FT   gene            complement(472108..472224)
FT                   /locus_tag="SeHA_C0468"
FT   CDS_pept        complement(472108..472224)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0468"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0468"
FT                   /db_xref="EnsemblGenomes-Tr:ACF68354"
FT                   /protein_id="ACF68354.1"
FT                   /translation="MFSKKDYAASLLKGSIILYPQSGFGHELKGRNKRKIYN"
FT   gene            472630..475236
FT                   /locus_tag="SeHA_C0469"
FT   CDS_pept        472630..475236
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0469"
FT                   /product="putative autotransporter/pertactin"
FT                   /note="identified by match to protein family HMM PF03797;
FT                   match to protein family HMM TIGR01414"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0469"
FT                   /db_xref="EnsemblGenomes-Tr:ACF65919"
FT                   /protein_id="ACF65919.1"
FT                   /translation="MWDDTAYVDHDWDDGDTFTLNIANSTIDDDYEYFYFTDDYNNADG
FT                   KVTTEDWRTSELASLGTAVTLDVESNINITNNSRVAGITLSQGDTYDATYATGGDSAYV
FT                   HTWDNTIVVDNSTVTSGAVTPLEGSGWFGNSSEPSDYSGNAVYDTTTGTWYHNPNDTAL
FT                   SFSDDPDSYYSMKNNVTFTNGSTLMGDVVFTSNFNNADDANADSNGDGVISASDGFSPI
FT                   GYDTNNDGVEDTNGGWSHDNDNVDELNLKLDNGSKWVGDAYFSYEYIAPADMYDLEDGT
FT                   NSLEPSSTVDKWGNVVDDKTFQSGIFTVALDNGSEWDTVNASNVDTLTVNNGSQVNVAD
FT                   SSSLIADTITLTNGSTMNLSSYGEVDTDHLTVDSYSKVDLTNETAYLYANTITVSNGGE
FT                   FSIGAGEFDADSFGTDTLELTNAGVFNINNSDYVLDADLVNGHTNTTDTSNATYGYGVI
FT                   AMTSDGHLTVNGNGDYYNGDNTADTTYSANGEADNSYTDNVVAATGNYKVRIDNATGAG
FT                   SVADYKGNELIRVNDVNTDATFSAANKADLGAYTYQAKQEGNTVVLEQMELTDYANMAL
FT                   SIPSANTNIWNLEQDTVGTRLTNARHGLADNGGAWVSYFGGNFNGDNGTINYDQDVNGI
FT                   MVGVDTKVDGNNAKWIVGAAAGFAKGDLSDRTGQVDQDSQSAYIYSSARFANNIFVDGN
FT                   LSYSHFNNDLSANMSDGTYVDGNTSSDAWGFGLKLGYDLKLGDAGYVTPYGSVSGLFQS
FT                   GDDYQLSNDMKVDGQSYDSMRYELGVDAGYTFTYSEDQALTPYFKLAYVYDDSNNDADV
FT                   NGDSIDNGVEGSAVRVGLGTQFSFTKNFSAYTDANYLGGGDVDQDWSANVGVKYTW"
FT   gene            475322..475945
FT                   /pseudo
FT                   /locus_tag="SeHA_C0470"
FT                   /note="putative inner membrane protein; this gene contains
FT                   a frame shift which may be the result of sequencing error;
FT                   identified by match to protein family HMM PF00027"
FT   gene            complement(475990..477147)
FT                   /locus_tag="SeHA_C0471"
FT   CDS_pept        complement(475990..477147)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0471"
FT                   /product="beta-lactamase"
FT                   /note="identified by match to protein family HMM PF00144"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0471"
FT                   /db_xref="EnsemblGenomes-Tr:ACF67291"
FT                   /protein_id="ACF67291.1"
FT                   /translation="MKRSLLFTAMLFAASLTSVQAAQPIADPVFASDIVDRYAEHIFYG
FT                   SGATGMALVVIDGNQRVFRSFGDTRPGNNVRPQLDSVIRIASLTKLMTSEMLVKLLDQG
FT                   TVKLNDPLSKYAPPGARVPTYQGTPITLVNLATHTSALPREQPGGAAHRPVFVWPTREQ
FT                   RWNWLSTATLKVAPGSQAAYSNLAFDLLADALATASGKPYTQLFEEKITRPLGMKDTTF
FT                   TPSPDQCKRLMVAEKGASPCNNTLAAIGSGGVYSTPGDMMRWMQQYLSSDFYHRSQQAD
FT                   RMQTLIYQRTQLKKIIGMDVPGKADALGLGWVYMAPKDGRPGIIQKTGGGGGFITYMAM
FT                   IPQYNIGAFVVVTRSPLTRFTNMSDGINDLVTELSGNKPIAIPAS"
FT   gene            477494..478714
FT                   /gene="smbA"
FT                   /locus_tag="SeHA_C0472"
FT   CDS_pept        477494..478714
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="smbA"
FT                   /locus_tag="SeHA_C0472"
FT                   /product="protein SbmA"
FT                   /note="identified by match to protein family HMM PF05992;
FT                   match to protein family HMM PF06472"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0472"
FT                   /db_xref="EnsemblGenomes-Tr:ACF69065"
FT                   /protein_id="ACF69065.1"
FT                   /translation="MFKSFFPKPGPFFMSAFVWALIAVIFWQAGGGDWVARLVGASDEV
FT                   PISAARFWSLDYLIFYAYYLICVGLFATFWFIYSPHRWQYWSILGTSLIIFVTWFLVEV
FT                   GVAVNAWYAPFYDLIQTALSSPHKVTLGQFYHEVGVFLGIALIAVVIGVLNNFFVSHYV
FT                   FRWRTAMNEHYMAHWQYLRHIEGAAQRVQEDTMRFASTLENMGVSFINAIMTLIAFLPV
FT                   LVTLSAHVPNLPIVGHIPYGLVIAAIVWSLMGTGLLAVVGIKLPGLEFKNQRVEAAYRK
FT                   ELVYGEDDASRATPPTVRELFSAVRHNYFRLYFHYMYFNIARILYLQVDNVFGLFLLFP
FT                   SIVAGTITLGLMTQITNVFGQVRGSFQYLINSWTTLVELMSIYKRLRSFERQLDGQPVQ
FT                   EVTHSFS"
FT   gene            478729..479823
FT                   /locus_tag="SeHA_C0473"
FT   CDS_pept        478729..479823
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0473"
FT                   /product="putative outer membrane lipoprotein"
FT                   /note="identified by match to protein family HMM PF07759"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0473"
FT                   /db_xref="EnsemblGenomes-Tr:ACF67812"
FT                   /protein_id="ACF67812.1"
FT                   /translation="MSAASRLYPLPFLAVAILAGCSSQSGQPVSKGEKPVDVASVVRQK
FT                   MPASVKDREAWAKDIATTFKSQGLAPTVENICSVLAVAQQESGYQADPVVPGLSKIAWQ
FT                   EIDRRAERLHIPLFLVHTALKINSPNGKSYSERLDTVKTEKQLSAIFDDFINMVPMGQT
FT                   LFGAYNPVHTGGPMQVSIAFAEQHAKGYPWKMTGTVRQEVFTRRGGLWFGTYHLLNYPA
FT                   NYSAPVFRFADFNAGWYASRNAAFQNAVSKASGVKLALDGDLIRYNSKEPGKTELAVRK
FT                   LAGQLGMSEREIRSQLEKGDSLAFEKTALYKKVYKLAEAKTGKTLAREMLPGIQLESPK
FT                   ITRKLTTAWFAKRVDERRARCMGR"
FT   gene            complement(479861..480169)
FT                   /locus_tag="SeHA_C0474"
FT   CDS_pept        complement(479861..480169)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0474"
FT                   /product="inner membrane protein YaiY"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0474"
FT                   /db_xref="EnsemblGenomes-Tr:ACF70370"
FT                   /protein_id="ACF70370.1"
FT                   /translation="MADFTLSKSLFSGKHRETSSTPGNIAYAIFVLFCFWAGAQLLNLL
FT                   VHAPGIYEHLMQVQDTGRPRVEIGLGVGTIFGLVPFLTGCLIFAVIAAFLRWRHRHQ"
FT   gene            480437..480652
FT                   /locus_tag="SeHA_C0475"
FT   CDS_pept        480437..480652
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0475"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0475"
FT                   /db_xref="EnsemblGenomes-Tr:ACF69854"
FT                   /protein_id="ACF69854.1"
FT                   /translation="MRLPVKIRRDWHYYAFSIGLIFILNGVVGLLGFEAKGWQTYGVGL
FT                   VTWIISFWLAGFIIRRREDDEVKDAR"
FT   gene            complement(480678..481772)
FT                   /locus_tag="SeHA_C0476"
FT   CDS_pept        complement(480678..481772)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0476"
FT                   /product="D-alanine--D-alanine ligase"
FT                   /EC_number="6.3.2.4"
FT                   /note="identified by match to protein family HMM PF01820;
FT                   match to protein family HMM PF02222; match to protein
FT                   family HMM PF07478; match to protein family HMM PF08443;
FT                   match to protein family HMM TIGR01205"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0476"
FT                   /db_xref="EnsemblGenomes-Tr:ACF69787"
FT                   /protein_id="ACF69787.1"
FT                   /translation="MAKLRVGIVFGGKSAEHEVSLQSAKNIVDAIDKTRFDVVLLGIDK
FT                   AGQWHVNDAENYLQNADDPAHIALRPSAISLAQVPGKHQHQLINAQNGQPLPTVDVIFP
FT                   IVHGTLGEDGSLQGMLRVANLPFVGSDVLSSAACMDKDVAKRLLRDAGLNIAPFITLTR
FT                   TNRHAFSFAEVESRLGLPLFVKPANQGSSVGVSKVANEAQYQQAVALAFEFDHKVVVEQ
FT                   GIKGREIECAVLGNDNPQASTCGEIVLNSEFYAYDTKYIDDNGAQVVVPAQLPSGVNDK
FT                   IRAIAIQAYQTLGCAGMARVDVFLTADNEVVINEINTLPGFTNISMYPKLWQASGLGYT
FT                   DLISRLIELALERHAANNALKTTM"
FT   gene            481880..482563
FT                   /locus_tag="SeHA_C0477"
FT   CDS_pept        481880..482563
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0477"
FT                   /product="extensin family protein"
FT                   /note="identified by match to protein family HMM PF06904"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0477"
FT                   /db_xref="EnsemblGenomes-Tr:ACF67034"
FT                   /protein_id="ACF67034.1"
FT                   /translation="MRGKGFLIIVLLGGIGGLGYRYLPSYYNPFAPLQLADPPGWITTF
FT                   KLQRLTPSQCRELLTAANQQGLISSQPVADSAGECPLSHVVRVRDFGLVKLSSSFLASC
FT                   PLALRSALFVEQQAKPLTETWMKRRLTRIEHLGSYACRNIYHRPDARRSEHASAEALDV
FT                   SGFQLSDGRKITVLRGWGREETGPWLRAMLNASCHYYGNGLGPDYNAAHANHFHLGMRG
FT                   YGVCR"
FT   gene            482732..483943
FT                   /locus_tag="SeHA_C0478"
FT   CDS_pept        482732..483943
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0478"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="identified by match to protein family HMM PF07690"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0478"
FT                   /db_xref="EnsemblGenomes-Tr:ACF69237"
FT                   /protein_id="ACF69237.1"
FT                   /translation="MESWKVNLISVWFGCFFTGLAISQILPFLPLYISQLGVSSHEALS
FT                   MWSGLTFSITFLISAIVSPMWGSLADRKGRKLMLLRASLGMAIAILLQAFATHVWQLFL
FT                   LRGIMGLTSGYIPNAMALVASQVPRERSGWALSTLSTAQISGVIGGPLMGGFVADHIGL
FT                   RAVFLITAMLLVVSFLVTLFLIKEGVRPVIKKSERLSGKAVFASLPYPALVISLFFTTM
FT                   VIQLCNGSISPILALFIKSMMPDSNNIAFLSGLIASVPGISALISAPRLGKLGDRIGTE
FT                   RILMATLICAVLLFFAMSWVTTPFQLGLLRFLLGFADGAMLPAVQTLLVKYSSDQITGR
FT                   IFGYNQSFMYLGNVVGPLMGATVSAMAGFRWVFIATAAIVLINIGQLTLALRRRRNAQK
FT                   AKGQ"
FT   gene            484240..484500
FT                   /locus_tag="SeHA_C0479"
FT   CDS_pept        484240..484500
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0479"
FT                   /product="putative cytoplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0479"
FT                   /db_xref="EnsemblGenomes-Tr:ACF66745"
FT                   /db_xref="GOA:B4T8M0"
FT                   /db_xref="InterPro:IPR019732"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4T8M0"
FT                   /protein_id="ACF66745.1"
FT                   /translation="MKNLIAELLLKLAQKEEESKELVAQVEALEIIVTAMLRNMAQNEQ
FT                   EMLIRQVEGALEGVKPDASVPDHDTELLRQYVKKLLRHPRH"
FT   gene            complement(484524..484685)
FT                   /locus_tag="SeHA_C0480"
FT   CDS_pept        complement(484524..484685)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0480"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0480"
FT                   /db_xref="EnsemblGenomes-Tr:ACF66658"
FT                   /protein_id="ACF66658.1"
FT                   /translation="MQFDYPQLHWQDAEEQRITLHCYYHSRFVFILLCITQKKIKTKRL
FT                   CYFIKVTL"
FT   gene            484852..485172
FT                   /locus_tag="SeHA_C0481"
FT   CDS_pept        484852..485172
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0481"
FT                   /product="phosphate starvation-inducible protein PsiF"
FT                   /note="identified by match to protein family HMM PF07769"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0481"
FT                   /db_xref="EnsemblGenomes-Tr:ACF68566"
FT                   /protein_id="ACF68566.1"
FT                   /translation="MKITLLVTLLFGLVFLTAVGATEKPLTPQQQRMTTCNQQATAQAL
FT                   KGDARKTYLSDCLKNSQSAPGEKSLTPQQQKMRECNVQATEQSLKGDDRSKFMSACLKK
FT                   AA"
FT   gene            485264..486376
FT                   /locus_tag="SeHA_C0482"
FT   CDS_pept        485264..486376
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0482"
FT                   /product="AdrA protein"
FT                   /note="identified by match to protein family HMM PF00990;
FT                   match to protein family HMM PF05230; match to protein
FT                   family HMM TIGR00254"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0482"
FT                   /db_xref="EnsemblGenomes-Tr:ACF70410"
FT                   /protein_id="ACF70410.1"
FT                   /translation="MFPKIMNDENFYRKAVEQAVAPPDPPDDRQRSGLRFARRIRLPRA
FT                   VGLGGMFLPVAAVLVTQPVFGGWWLLLVGWSFVWPHLAWQWAAKALDPLRQEIYNLKVD
FT                   AILSGMWIALMGVNMLPAAALFMMMSMNLMGAGGRRLFTVGMGLLLASCLVTLQLTGLP
FT                   VAMRSSSLEVTLSLPVIILYPLLFAWVSYQTAIKLAEHKRRLQAMSSRDGMTGVYNRRH
FT                   WEILLRNEFDHSRRHHREATLLIIDIDHFKSINDTWGHDVGDEAIIALTRQLQITLRGS
FT                   DIIGRFGGDEFAVIMCGTPADSAITAMSRVHERLNTLRLPGAPQVMLRISVGVAPLTPQ
FT                   IGHYREWLKSADMALYKAKNAGRNRTEVAA"
FT   gene            complement(486391..487200)
FT                   /gene="proC"
FT                   /locus_tag="SeHA_C0483"
FT   CDS_pept        complement(486391..487200)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="proC"
FT                   /locus_tag="SeHA_C0483"
FT                   /product="pyrroline-5-carboxylate reductase"
FT                   /EC_number="1.5.1.2"
FT                   /note="identified by match to protein family HMM PF03446;
FT                   match to protein family HMM PF03807; match to protein
FT                   family HMM TIGR00112"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0483"
FT                   /db_xref="EnsemblGenomes-Tr:ACF68825"
FT                   /protein_id="ACF68825.1"
FT                   /translation="MEKKIGFIGCGNMGKAILGGLIASGQVLPGQIWVYTPSPDKVAAL
FT                   HDQYGINAAQSAQEVAQVADIVFGAVKPGIMVKVLSEISSSLNKDSLVVSIAAGVTLDQ
FT                   LARALGHDRKIIRAMPNTPSLVNAGMTSVTPNALVTPEDTADVLNIFRCFGEAEVIAEP
FT                   MIHPVVGVSGSSPAYVFMFIEAMADAAVLGGMPRAQAYKFAAQAVMGSAKMVLETGKHP
FT                   GELKDMVCSPGGTTIEAVRVLEERGFRAAVIEAMTKCMEKSEALSKS"
FT   gene            487234..487383
FT                   /locus_tag="SeHA_C0484"
FT   CDS_pept        487234..487383
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0484"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0484"
FT                   /db_xref="EnsemblGenomes-Tr:ACF68304"
FT                   /protein_id="ACF68304.1"
FT                   /translation="MVSLTRIENGQKEKQHFDERQKRETIKDCIPYGRHYDHLGGCGCV
FT                   SECH"
FT   gene            487340..487795
FT                   /locus_tag="SeHA_C0485"
FT   CDS_pept        487340..487795
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0485"
FT                   /product="protein YaiI"
FT                   /note="identified by match to protein family HMM PF02639"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0485"
FT                   /db_xref="EnsemblGenomes-Tr:ACF68068"
FT                   /db_xref="InterPro:IPR003791"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4T8M6"
FT                   /protein_id="ACF68068.1"
FT                   /translation="MTIWVDADACPNVIKEILYRAAERMQLPLILVANQALRVPPSRFI
FT                   RTLRVAAGFDVADNEIVRQCEAGDLVITADIPLAAEVLEKGAAALNPRGERYSDATIRE
FT                   RLTMRDFMDTLRASGVQTGGPNTLSPRDRQHFAAELDKWWLESQRKK"
FT   gene            487980..488525
FT                   /gene="aroK"
FT                   /locus_tag="SeHA_C0486"
FT   CDS_pept        487980..488525
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroK"
FT                   /locus_tag="SeHA_C0486"
FT                   /product="shikimate kinase"
FT                   /EC_number="2.7.1.71"
FT                   /note="identified by match to protein family HMM PF01202"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0486"
FT                   /db_xref="EnsemblGenomes-Tr:ACF67555"
FT                   /db_xref="GOA:B4T8M7"
FT                   /db_xref="InterPro:IPR000623"
FT                   /db_xref="InterPro:IPR023000"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR027544"
FT                   /db_xref="InterPro:IPR031322"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4T8M7"
FT                   /protein_id="ACF67555.1"
FT                   /translation="MMQPLYLVGPRGCGKTTIGMALAQATGFRFADTDRWLQSHVQMSV
FT                   ADIVEKEGWGGFRARETAALEAVSAPSTVVATGGGIILTEYNRRYMHRVGVVIYLCAPV
FT                   STLVNRLEAEPEADLRPTLTGKPLSEEVREVLEQRDALYRETAHYIIDATKTPAQVVSE
FT                   IIAALPPSTQRLQGDVYT"
FT   gene            488552..488743
FT                   /locus_tag="SeHA_C0487"
FT   CDS_pept        488552..488743
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0487"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0487"
FT                   /db_xref="EnsemblGenomes-Tr:ACF66582"
FT                   /protein_id="ACF66582.1"
FT                   /translation="MPTRPPYPREAYIVTIEKGTPGQTVTWYQLRADHPKPDSLISEHP
FT                   TAEEAMDVKKRYEDPDKS"
FT   gene            488994..489671
FT                   /locus_tag="SeHA_C0488"
FT   CDS_pept        488994..489671
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0488"
FT                   /product="aro operon protein"
FT                   /note="identified by match to protein family HMM PF07302"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0488"
FT                   /db_xref="EnsemblGenomes-Tr:ACF65924"
FT                   /protein_id="ACF65924.1"
FT                   /translation="MSASLAILTIGVVPMSEVLPLLTEYIDEQHITHHSLLGKMSREDV
FT                   MADYAVEPGDDPLLTLLNDNQIAHVSRQKVERDLQSVVEVLDNQGYDVIILMSTAAIKS
FT                   MAARNSILLEPLRIIPPLVASIVDGHQVGVIVPVAELLAAQEKKWQVLQMPPVYSLANP
FT                   VHGSEQQLIDAGQALLDQGADVIMLDCLGFHQRHRDILQQALDVPVLLSNVLIARLASE
FT                   LLV"
FT   gene            489742..490026
FT                   /locus_tag="SeHA_C0489"
FT   CDS_pept        489742..490026
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0489"
FT                   /product="protein YaiE"
FT                   /note="identified by match to protein family HMM PF06865"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0489"
FT                   /db_xref="EnsemblGenomes-Tr:ACF69926"
FT                   /db_xref="GOA:B4T8N0"
FT                   /db_xref="InterPro:IPR009664"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4T8N0"
FT                   /protein_id="ACF69926.1"
FT                   /translation="MLQSNEYFSGKVKSIGFTSSSTGRASVGVMAEGEYTFGTAEPEEM
FT                   TVVSGALKVLLPGTVEWKVYAAGEVFNVPGHSEFHLQVAEPTSYLCRYL"
FT   gene            complement(490064..490975)
FT                   /gene="rdgC"
FT                   /locus_tag="SeHA_C0490"
FT   CDS_pept        complement(490064..490975)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rdgC"
FT                   /locus_tag="SeHA_C0490"
FT                   /product="recombination-associated exonuclease RdgC"
FT                   /note="identified by match to protein family HMM PF04381"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0490"
FT                   /db_xref="EnsemblGenomes-Tr:ACF69407"
FT                   /db_xref="GOA:B4T8N1"
FT                   /db_xref="InterPro:IPR007476"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4T8N1"
FT                   /protein_id="ACF69407.1"
FT                   /translation="MLWFKNLMVYRLSRDITLRAEEMEKQLASMTFTPCGSQDMAKMGW
FT                   VPPMGSHSDALTHTANGQIIICARKEEKILPSPVIKQALEAKIQKLEADQGRKLKKTEK
FT                   DSLKDEVLHSLLPRAFSRFSQTMMWIDTVNGLIMVDCASAKKAEDTLALLRKSLGSLPV
FT                   VPLALENPIELTLTEWVRSGTVAQGFQLLDEAELKAMLEDGGVIRAKKQDLVSDEIAVH
FT                   IEAGKVVTKLALDWQQRIQFVMCDDGSIKRLKFCDELRDQNEDIDREDFAQRFDADFIL
FT                   MTGELAALIQSLVEGLGGEAQR"
FT   gene            491101..492009
FT                   /locus_tag="SeHA_C0491"
FT   CDS_pept        491101..492009
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0491"
FT                   /product="N-acetyl-D-glucosamine kinase"
FT                   /EC_number="2.7.1.59"
FT                   /note="identified by match to protein family HMM PF00480"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0491"
FT                   /db_xref="EnsemblGenomes-Tr:ACF68903"
FT                   /protein_id="ACF68903.1"
FT                   /translation="MRIGIDLGGTKTEVIALDDAGEQRFRHRLPTPREDYQQTIETIAT
FT                   LVDMAEQATGQTGSVGIGIPGSLSPYTGVVKNANSTWLNGQPFDSDVSRRLKREVRLAN
FT                   DANCLAVSEAVDGAAAGAQTVFAVIIGTGCGAGVALNGRAHIGGNGTAGEWGHNPLPWM
FT                   DDDELCYREEIPCYCGKQGCIETFISGTGFATDYQRLSGNALKGDEIIRLVDAQDAVAE
FT                   LALSRYELRLAKALSHVVNILDPDVIVLGGGMSNVERLYKTVPSLMKSFVFGGECETPV
FT                   RKARHGDSSGVRGAAWLWPLA"
FT   gene            complement(492031..493203)
FT                   /locus_tag="SeHA_C0492"
FT   CDS_pept        complement(492031..493203)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0492"
FT                   /product="protein AraJ"
FT                   /note="identified by match to protein family HMM PF07690"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0492"
FT                   /db_xref="EnsemblGenomes-Tr:ACF68447"
FT                   /protein_id="ACF68447.1"
FT                   /translation="MKKVIFSLALGTFGLGMAEFGIMGVLTELARDVGITIPAAGHMIS
FT                   FYAFGVVLGAPVMALFSSRFSLKHILLFLVMLCVMGNAIFTFSSSYLMLAVGRLVSGFP
FT                   HGAFFGVGAIVLSKIIRPGKVTAAVAGMVSGMTVANLVGIPVGTYLSQEFSWRYTFLLI
FT                   AVFNIAVLTAIFFWVPDIHDKAQGSLREQFHFLRSPAPWLIFAATMFGNAGVFAWFSYI
FT                   KPFMMYISGFSETSMTFIMMLVGLGMVLGNLLSGKLSGRYTPLRIAVVTDLVIVLSLMA
FT                   LFFFSGYKTTSLTFAFICCAGLFALSAPLQILLLQNAKGGELLGAAGGQIAFNLGSAIG
FT                   AWCGGLMLTLGFAYHYVALPAALLSFSAMSSLLVYGRLKHKQPSVTPVAG"
FT   gene            complement(493376..496516)
FT                   /locus_tag="SeHA_C0493"
FT   CDS_pept        complement(493376..496516)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0493"
FT                   /product="exonuclease SbcC"
FT                   /note="identified by match to protein family HMM PF02463;
FT                   match to protein family HMM TIGR00618"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0493"
FT                   /db_xref="EnsemblGenomes-Tr:ACF66206"
FT                   /protein_id="ACF66206.1"
FT                   /translation="MKILSLRLKNLNSLKGEWKVDFTAEPFASNGLFAITGPTGAGKTT
FT                   LLDAICLALYHETPRLNTVSQSQNDLMTRDTAECLAEVEFEVKGEAWRAFWSQNRARNQ
FT                   PDGNLQAPRVELARCSDGKIFADKVKDKLEMIATLTGLDYGRFTRSMLLSQGQFAAFLN
FT                   AKAKERAELLEELTGTEIYGQISAQVFEKHKSARLELEKLQAQASGVALLADEQLQQLE
FT                   ASLQALTDEEKRLLADQQVQQQHLHWLTRKNELHTELHARQQALYAAQEAREKAQPQLA
FT                   ALTLAQPARQLRPHWERIQEQTRAVERVRQHSDEVNARLQSAYRLRQRIRACAHRQFTQ
FT                   LNATGQRLKTWLAEHDGIRIWRSELAGWRALLTQQSHDRAQLSQWQQQLLSDTRQRDAL
FT                   PPLTLDLTPQALAEARALHTRQRPLRHRLAALQGQILPKQKRQAQLQAAIARHHQEQAQ
FT                   YTQRLADKRLSYKTKAQELADVRTICEQEARIKDLESQRAHLQSGQPCPLCGSTTHPAI
FT                   AAYQALELSANQTRRDALEKEVKTLAEEGAALRGQLDALTQQLQRDESEAQSLLQEEQA
FT                   LTEEWQTLCATLGVQLQPQEDLAGWLAAAEEHEQQLDQLSQRHALQTQIAAHTEQVARF
FT                   TAQIAQRQASLTADLAQYTLSLPAPEDEASWLNERADEAKIWQQRQTEFADLQTQIDRL
FT                   APLLETLPQTDTADSDDDVPLDNWRQAHDECVSLQSQLQTLQEQTTQEQQRAAEAIAHF
FT                   DAALKNSPFDSQATFLAALLDEETVTRLEKQQQTLESQLQQAKALSAQSAQALADHQQQ
FT                   PPAGLDPTCTAEQLAQRLAQLAQQLRENTTRQGEIRQQIKQDADNRQRQRALMAEMKQA
FT                   SQQVEDWGYLNALIGSKEGDKFRKFAQGLTLDNLVWLANHQLTRLHGRYLLQRKASDAL
FT                   ELEVVDTWQADAVRDTRTLSGGESFLVSLALALALSDLVSHKTRIDSLFLDEGFGTLDS
FT                   ETLDAALDALDALNASGKTIGVISHVEAMKERIPVQIKVKKINGLGYSKLDKAFAVE"
FT   gene            complement(496513..497715)
FT                   /locus_tag="SeHA_C0494"
FT   CDS_pept        complement(496513..497715)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0494"
FT                   /product="ATP-dependent dsDNA exonuclease"
FT                   /note="identified by match to protein family HMM PF00149;
FT                   match to protein family HMM TIGR00619"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0494"
FT                   /db_xref="EnsemblGenomes-Tr:ACF68062"
FT                   /protein_id="ACF68062.1"
FT                   /translation="MRILHTSDWHLGQNFYSKSRAAEHQAFLDWLLETAQAHQVDAIIV
FT                   AGDIFDTGSPPSYARELYNRFVVNLQQTGCHLVVLAGNHDSVATLNESRDILAFLNTTV
FT                   IASAGYAPRLLHRRDGSPGAVLCPIPFLRPRDIITSQAGLSGSEKQQQLLHAIADYYQQ
FT                   QHQEACQLRGERKLPVIATGHLTTVGASKSDAVRDIYIGTLDAFPAQHFPPADYIALGH
FT                   IHRAQCVGGTEHIRYCGSPIALSFDECGKSKCVHLVTFDQGKWQSTESLAVPVTQPLAV
FT                   LKGDLASITEQLEQWRGVEQSPPVWLDIEITTDDYLHDIQRRIQTLTESLPVEVLLVRR
FT                   SREQRERSLANERRETLSELSVEEVFARRLALEALDHPQRERLNQLFSSTLYALNEEHE
FT                   A"
FT   gene            complement(497757..497888)
FT                   /pseudo
FT                   /locus_tag="SeHA_C0495"
FT                   /note="conserved hypothetical protein; this gene contains a
FT                   frame shift which may be the result of sequencing error"
FT   gene            497930..498619
FT                   /gene="phoB"
FT                   /locus_tag="SeHA_C0496"
FT   CDS_pept        497930..498619
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phoB"
FT                   /locus_tag="SeHA_C0496"
FT                   /product="phosphate regulon transcriptional regulatory
FT                   protein PhoB"
FT                   /note="identified by match to protein family HMM PF00072;
FT                   match to protein family HMM PF00486; match to protein
FT                   family HMM TIGR02154"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0496"
FT                   /db_xref="EnsemblGenomes-Tr:ACF69483"
FT                   /protein_id="ACF69483.1"
FT                   /translation="MARRILVVEDEAPIREMVCFVLEQNGFQPVEAEDYDSAVNKLNEP
FT                   WPDLILLDWMLPGGSGLQFIKHLKREAMTRDIPVVMLTARGEEEDRVRGLETGADDYIT
FT                   KPFSPKELVARIKAVMRRISPMAVEEVIEMQGLSLDPGSHRVMTGDSPLDMGPTEFKLL
FT                   HFFMTHPERVYSREQLLNHVWGTNVYVEDRTVDVHIRRLRKALEHSGHDRMVQTVRGTG
FT                   YRFSTRF"
FT   gene            498689..499984
FT                   /gene="phoR"
FT                   /locus_tag="SeHA_C0497"
FT   CDS_pept        498689..499984
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phoR"
FT                   /locus_tag="SeHA_C0497"
FT                   /product="phosphate regulon sensor protein PhoR"
FT                   /EC_number="2.7.3.-"
FT                   /note="identified by match to protein family HMM PF00512;
FT                   match to protein family HMM PF00989; match to protein
FT                   family HMM PF02518; match to protein family HMM TIGR02966"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0497"
FT                   /db_xref="EnsemblGenomes-Tr:ACF66926"
FT                   /protein_id="ACF66926.1"
FT                   /translation="MLERLSWKRLVLELVLCCIPALILSAFFGYLPWFLLAAVTGLLVW
FT                   HFWNLLRLSWWLWVDRSMTPPPGRGSWEPLLYGLHQMQLRNKKRRRELGNLIKRFRSGA
FT                   ESLPDAVVLTTEEGGIFWCNGLAQQILGLRWPDDNGQNILNLLRYPEFTQYLKTRDFTR
FT                   PLHLVLNTGRHLEIRVMPYTDKQLLMVARDVTQMHQLEGARRNFFANVSHELRTPLTVL
FT                   QGYLEMMQEQALEGATREKALHTMREQTYRMEGLVKQLLTLSKIEAAPALLLNEKVDVP
FT                   MMLRVVEREAQTLSQQKHTFTFEVDDSLSVLGNEEQLRSAISNLVYNAVNHTPAGTHIT
FT                   VSWRRVAHGAEFCIQDNGPGIAAEHIPRLTERFYRVDKARSRQTGGSGLGLAIVKHALN
FT                   HHESRLEIDSSPGKGTRFSFVLPERLIAKNSD"
FT   gene            complement(500197..500346)
FT                   /locus_tag="SeHA_C0498"
FT   CDS_pept        complement(500197..500346)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0498"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0498"
FT                   /db_xref="EnsemblGenomes-Tr:ACF69780"
FT                   /protein_id="ACF69780.1"
FT                   /translation="MPFPEDYKAAFFINFSGKSSRTDAAKNCFSIYRANAVVMTAPEAQ
FT                   FKRL"
FT   gene            500393..501712
FT                   /gene="brnQ"
FT                   /locus_tag="SeHA_C0499"
FT   CDS_pept        500393..501712
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="brnQ"
FT                   /locus_tag="SeHA_C0499"
FT                   /product="branched-chain amino acid transport system II
FT                   carrier protein"
FT                   /note="identified by match to protein family HMM PF05525;
FT                   match to protein family HMM TIGR00796"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0499"
FT                   /db_xref="EnsemblGenomes-Tr:ACF66394"
FT                   /protein_id="ACF66394.1"
FT                   /translation="MTHQLKSRDIIALGFMTFALFVGAGNIIFPPMVGLQAGEHVWTAA
FT                   IGFLITAVGLPVLTVVALAKVGGGVDSLSTPIGKVAGLLLATVCYLAVGPLFATPRTAT
FT                   VSFEVGIAPLTGDSAMPLLIYSVVYFAIVILVSLYPGKLLDTVGNFLAPLKIIALVILS
FT                   VAAIVWPAGPISNALDAYQNAAFSNGFVNGYLTMDTLGAMVFGIVIVNAARSRGVTEAR
FT                   LLTRYTVWAGLMAGVGLTLLYLALFRLGSDSATLVDQSANGAAILHAYVQHTFGGAGSF
FT                   LLAALIFIACLVTAVGLTCACAEFFAQYIPLSYRTLVFILGGFSMVVSNLGLSHLIQIS
FT                   IPVLTAIYPPCIALVVLSFTRSWWHNSTRIIAPAMFISLLFGILDGIKASAFGDMLPAW
FT                   SQRLPLAEQGLAWLMPTVVMVILAIIWDRAAGRQVTSSAH"
FT   gene            501727..503157
FT                   /locus_tag="SeHA_C0500"
FT   CDS_pept        501727..503157
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0500"
FT                   /product="proline-specific permease ProY"
FT                   /note="identified by match to protein family HMM PF00324;
FT                   match to protein family HMM PF03845"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0500"
FT                   /db_xref="EnsemblGenomes-Tr:ACF66775"
FT                   /protein_id="ACF66775.1"
FT                   /translation="MYTTGLNAPWFFIVLIGQKLMESNNKLKRGLSTRHIRFMALGSAI
FT                   GTGLFYGSADAIKMAGPSVLLAYIIGGVAAYIIMRALGEMSVHNPAASSFSRYAQENLG
FT                   PLAGYITGWTYCFEILIVAIADVTAFGIYMGVWFPAVPHWIWVLSVVLIICAINLMSVK
FT                   VFGELEFWFSFFKVATIIIMIIAGIGIIVWGIGNGGQPTGIHNLWSNGGFFSNGWLGMI
FT                   MSLQMVMFAYGGIEIIGITAGEAKDPEKSIPRAINSVPMRILVFYVGTLFVIMSIYPWN
FT                   QVGTNGSPFVLTFQHMGITFAASILNFVVLTASLSAINSDVFGVGRMLHGMAEQGSAPK
FT                   VFAKTSRRGIPWVTVLVMTIALLFAVYLNYIMPENVFLVIASLATFATVWVWIMILLSQ
FT                   IAFRRRLPPEEVKALKFKVPGGVVTTIAGLIFLVFIIALIGYHPDTRISLYVGFAWIVL
FT                   LLIGWIFKRRRDRQLAQA"
FT   gene            503319..505136
FT                   /locus_tag="SeHA_C0501"
FT   CDS_pept        503319..505136
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0501"
FT                   /product="maltodextrin glucosidase"
FT                   /EC_number="3.2.1.20"
FT                   /note="identified by match to protein family HMM PF00128"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0501"
FT                   /db_xref="EnsemblGenomes-Tr:ACF67331"
FT                   /protein_id="ACF67331.1"
FT                   /translation="MLNAWHLPVAPFVKQHNDKLTITLWLSGENPPSRVTLRSEFDNEE
FT                   ISLAMRKQRRQPQPGVTAWRATLNIALGQPRRRYSFKLLWHDRQLWFTPQGFSRFPPAR
FT                   LEQFAVDVPDSGPQWVADQIFYQIFPDRFARSQSREAGQDKVYYHHAAGHDIVRKEWDE
FT                   PLTPQAGGSTFYGGCLNGICEKLPYLKTLGVTALYLNPVFTAPSVHKYDTEDYRHVDPQ
FT                   FGGDRALLRLRRETQAQGMRLVLDGVFNHSGDSHAWFDRHNRSTGGACHHPDSPWRDWY
FT                   SFSPQGVALDWLGYPSLPKLDYQSETLVDEIYRGEDSIVRHWLKAPWNMDGWRLDVVHM
FT                   LGEAGGARHNLQHVAGITRAAKEAQPEAYIVGEHFGDARQWLQADAEDAAMNYRGFTFP
FT                   LWGFLANTDIAYEPQHIDARTCIAWMDNYRAGLSHQQQLRMFNQLDSHDTARFKTLLGK
FT                   DAARLPLAVVWLFTWPGVPCIYYGDEVGVDGANDPMCRKPFPWDERKQDGNLLALYQRM
FT                   AKLRQRSLALRRGGCQALYAEGDVVVFVRVYQQQRALVAINRGEACEVALEALPLLNVA
FT                   GWQCKTGSGDIREGRLSLPAISATVWMNR"
FT   gene            complement(505208..505810)
FT                   /locus_tag="SeHA_C0502"
FT   CDS_pept        complement(505208..505810)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0502"
FT                   /product="peroxiredoxin-2"
FT                   /EC_number="1.11.1.15"
FT                   /note="identified by match to protein family HMM PF00578;
FT                   match to protein family HMM PF08534"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0502"
FT                   /db_xref="EnsemblGenomes-Tr:ACF67824"
FT                   /protein_id="ACF67824.1"
FT                   /translation="MVLVTRQAPDFTAAAVLGSGEIVDKFNFKQHTNGKTTVLFFWPMD
FT                   FTFVCPSELIAFDKRYEEFQKRGVEVVGVSFDSEFVHNAWRNTPVDKGGIGPVKYAMVA
FT                   DVKREIQKAYGIEHPDEGVALRGSFLIDANGIVRHQVVNDLPLGRNIDEMLRMVDALQF
FT                   HEEHGDVCPAQWEKGKEGMNASPDGVAKYLAENISSL"
FT   gene            complement(506020..506601)
FT                   /gene="acpH"
FT                   /locus_tag="SeHA_C0503"
FT   CDS_pept        complement(506020..506601)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="acpH"
FT                   /locus_tag="SeHA_C0503"
FT                   /product="[acyl-carrier-protein] phosphodiesterase"
FT                   /EC_number="3.1.4.14"
FT                   /note="identified by match to protein family HMM PF04336"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0503"
FT                   /db_xref="EnsemblGenomes-Tr:ACF69952"
FT                   /db_xref="GOA:B4T8P3"
FT                   /db_xref="InterPro:IPR007431"
FT                   /db_xref="InterPro:IPR023491"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4T8P3"
FT                   /protein_id="ACF69952.1"
FT                   /translation="MNFLAHLHLAHLADSSLSGNLLADFVRGNPATHYPPDVVEGIYMH
FT                   RRIDVMTDNLPEVREAREWFRHETRRVAPITLDVMWDHFLSRHWTQISPDFPLQAFVGY
FT                   AHAQVATILPDSPPRFVNLNDYLWSEKWLERYRDMDFIQNVLNGMANRRPRLDALRDSW
FT                   YDLDAHYDALEERFWHFYPRMMAQAARKAL"
FT   gene            506695..507759
FT                   /gene="queA"
FT                   /locus_tag="SeHA_C0504"
FT   CDS_pept        506695..507759
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="queA"
FT                   /locus_tag="SeHA_C0504"
FT                   /product="S-adenosylmethionine:tRNA
FT                   ribosyltransferase-isomerase"
FT                   /EC_number="5.-.-.-"
FT                   /note="identified by match to protein family HMM PF02547;
FT                   match to protein family HMM TIGR00113"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0504"
FT                   /db_xref="EnsemblGenomes-Tr:ACF68315"
FT                   /db_xref="GOA:B4T8P4"
FT                   /db_xref="InterPro:IPR003699"
FT                   /db_xref="InterPro:IPR036100"
FT                   /db_xref="InterPro:IPR042118"
FT                   /db_xref="InterPro:IPR042119"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4T8P4"
FT                   /protein_id="ACF68315.1"
FT                   /translation="MRVTDFSFELPESLIAHYPQPERSRCRLLSLEGPTGALTHGTFTD
FT                   LLDKLNPGDLLVFNNTRVIPARLFGRKASGGKIEVLVERMLDDKRILAHIRASKAPKPG
FT                   TELLLGDDESIHATMTARHGALFEVEFNDPRPVLDILNAIGHMPLPPYIDRPDEDADRE
FT                   LYQTVYSEKPGAVAAPTAGLHFDEPLLAALREKGVEMAFVTLHVGAGTFQPVRVDTIED
FT                   HIMHSEYAEVPQEVVDAVLAAKARGNRVIAVGTTSVRSLESAAQAAKSDLIEPFFGDTQ
FT                   IFIYPGYQYKVIDALITNFHLPESTLIMLVSAFAGYQHTMNAYKTAVEQKYRFFSYGDA
FT                   MFITYNPQAISERP"
FT   gene            507956..509083
FT                   /gene="tgt"
FT                   /locus_tag="SeHA_C0505"
FT   CDS_pept        507956..509083
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tgt"
FT                   /locus_tag="SeHA_C0505"
FT                   /product="queuine tRNA-ribosyltransferase"
FT                   /EC_number="2.4.2.29"
FT                   /note="identified by match to protein family HMM PF01702;
FT                   match to protein family HMM TIGR00430; match to protein
FT                   family HMM TIGR00449"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0505"
FT                   /db_xref="EnsemblGenomes-Tr:ACF66259"
FT                   /db_xref="GOA:B4T8P5"
FT                   /db_xref="InterPro:IPR002616"
FT                   /db_xref="InterPro:IPR004803"
FT                   /db_xref="InterPro:IPR036511"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4T8P5"
FT                   /protein_id="ACF66259.1"
FT                   /translation="MKFELDTTDGRARRGRLVFDRGVVETPAFMPVGTYGTVKGMTPEE
FT                   VEATGAQIILGNTFHLWLRPGQEIMKLHGDLHDFMQWKGPILTDSGGFQVFSLGDIRKI
FT                   TEQGVHFRNPINGDPIFLDPEKSMEIQYDLGSDIVMIFDECTPYPADWDYAKRSMEMSL
FT                   RWAKRSRDRFDSLGNKNALFGIIQGSVYEDLRDISVKGLVEIGFDGYAVGGLAVGEPKA
FT                   DMHRILEHVCPQIPADKPRYLMGVGKPEDLVEGVRRGIDMFDCVMPTRNARNGHLFVTD
FT                   GVVKIRNAKHKSDTSPLDAECDCYTCRNYSRAYLHHLDRCNEILGARLNTIHNLRYYQR
FT                   LMAGLRKAIEEGKLESFVTEFYQRQGRPVPPLNVD"
FT   gene            509106..509438
FT                   /gene="yajC"
FT                   /locus_tag="SeHA_C0506"
FT   CDS_pept        509106..509438
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yajC"
FT                   /locus_tag="SeHA_C0506"
FT                   /product="preprotein translocase, YajC subunit"
FT                   /note="identified by match to protein family HMM PF02699;
FT                   match to protein family HMM TIGR00739"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0506"
FT                   /db_xref="EnsemblGenomes-Tr:ACF67001"
FT                   /protein_id="ACF67001.1"
FT                   /translation="MSFFISDAVAATGAPAQGSPMSLILMLVVFGLIFYFMILRPQQKR
FT                   TKEHKKLMDSIAKGDEVLTNGGLVGRVTKVAEAGYIAIALNDTTEVVIKRDFVAAVLPK
FT                   GTMKAL"
FT   gene            509466..511313
FT                   /gene="secD"
FT                   /locus_tag="SeHA_C0507"
FT   CDS_pept        509466..511313
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secD"
FT                   /locus_tag="SeHA_C0507"
FT                   /product="protein-export membrane protein SecD"
FT                   /note="identified by match to protein family HMM PF02355;
FT                   match to protein family HMM PF07549; match to protein
FT                   family HMM TIGR00916; match to protein family HMM
FT                   TIGR01129"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0507"
FT                   /db_xref="EnsemblGenomes-Tr:ACF70365"
FT                   /protein_id="ACF70365.1"
FT                   /translation="MLNRYPLWKYIMLVVVIIVGLLYALPNLYGEDPAVQITGVRGVAA
FT                   SEQTLIQVQKTLQEEKIPAKSVALEEGAILARFDTTDTQLRAREALMSVLGDKYVVALN
FT                   LAPATPRWLAAIHADPMKLGLDLRGGVHFLMEVDMDTALGKLQEQNIDSLRSDLREKGI
FT                   PYTTVRKENNYGLSITFRDSKARDEAIAYLTPRHRDLVISSQSGNQLRAVMTDARLSEA
FT                   REYAVQQNINILRNRVNQLGVAEPVVQRQGADRIVVELPGIQDTARAKEILGATATLEF
FT                   RLVNTNVDQAAAAAGRVPGDSEVKQTREGQPVVLYKRVILTGDHITDSTSSQDEYNQPQ
FT                   VNISLDSAGGNIMSNFTKDNIGKPMATLFVEYKDSGKKDANGRAVLVKQEEVINIANIQ
FT                   SRLGNSFRITGISNPNEARQLSLLLRAGALIAPIQIVEERTIGPTLGMQNIKQGLEACL
FT                   AGLVVSILFMIFFYKKFGLIATSALVANLVLIVGIMSLLPGATLSMPGIAGIVLTLAVA
FT                   VDANVLINERIKEELSNGRTVQQAINEGYAGAFSSIFDANITTLIKVIILYAVGTGAIK
FT                   GFAITTGIGVATSMFTAIIGTRAIVNLLYGGKRVTKLSI"
FT   gene            511324..512295
FT                   /gene="secF"
FT                   /locus_tag="SeHA_C0508"
FT   CDS_pept        511324..512295
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secF"
FT                   /locus_tag="SeHA_C0508"
FT                   /product="protein-export membrane protein SecF"
FT                   /note="identified by match to protein family HMM PF02355;
FT                   match to protein family HMM PF07549; match to protein
FT                   family HMM TIGR00916; match to protein family HMM
FT                   TIGR00966"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0508"
FT                   /db_xref="EnsemblGenomes-Tr:ACF66200"
FT                   /protein_id="ACF66200.1"
FT                   /translation="MAQEYTVEQLNHGRKVYDFMRWDFWAFGISGLLLIAAIVIMGVRG
FT                   FNWGLDFTGGTVIEITLEKPAEMDVMREALQKAGYEEPQLQNFGSSHDIMVRMPPTEGE
FT                   TGGQVLGSKVVTIINEATNQNAAVKRIEFVGPSVGADLAQTGAMALLVALISILVYVGF
FT                   RFEWRLAAGVVIALAHDVIITLGILSLFHIEIDLTIVASLMSVIGYSLNDSIVVSDRIR
FT                   ENFRKIRRGTPYEIFNVSLTQTLHRTLITSGTTLVVILMLYLFGGPVLEGFSLTMLIGV
FT                   SIGTASSIYVASALALKLGMKREHMLQQKVEKEGADQPSILP"
FT   gene            512440..512805
FT                   /locus_tag="SeHA_C0509"
FT   CDS_pept        512440..512805
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0509"
FT                   /product="glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="identified by match to protein family HMM PF00903"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0509"
FT                   /db_xref="EnsemblGenomes-Tr:ACF69976"
FT                   /protein_id="ACF69976.1"
FT                   /translation="MKNLINWFEIPVTDMARAIAFYEQVMQISLRRETMDGADLAVFPY
FT                   VEPGPGGALIKQDDVAPVAQGVVIYLHTADLLASIERVVLAGGKCVLEPMVPGDDIGTI
FT                   ALFIDSEGNRIGLHQPA"
FT   gene            512831..513523
FT                   /locus_tag="SeHA_C0510"
FT   CDS_pept        512831..513523
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0510"
FT                   /product="helix-turn-helix, type 11"
FT                   /note="identified by match to protein family HMM PF08279"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0510"
FT                   /db_xref="EnsemblGenomes-Tr:ACF66097"
FT                   /protein_id="ACF66097.1"
FT                   /translation="MTRRADRLFQIVQILRGRRLTTAALLAQRLAVSERTIYRDIRDLS
FT                   LSGVPVEGEAGSGYRLMAGFDLPPLMLTHRESEALMVAIRLLKTWGGDSLSRELESAQE
FT                   KVLAILPEESRRKAEQTRIYAPDLGASPHSRSAFDLIHQAVSAQQVLALHYRDEAGHLS
FT                   SRDIQPLGLFFWGEHWLLVAWCERREDYRCFRLDRCLQITPLNRRFRETIDRSLRDFLR
FT                   KVEHEKMP"
FT   gene            513693..514040
FT                   /locus_tag="SeHA_C0511"
FT   CDS_pept        513693..514040
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0511"
FT                   /product="HNH endonuclease"
FT                   /note="identified by match to protein family HMM PF01844"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0511"
FT                   /db_xref="EnsemblGenomes-Tr:ACF68988"
FT                   /protein_id="ACF68988.1"
FT                   /translation="MAIIPKNYARLESGYREKALKLFPWVCGRCSREFVYSNLRELTVH
FT                   HIDHDHTNNPEDGSNWELLCLYCHDHEHSKYTEADQYGSTVIAGEDAQKDVGEATYNPF
FT                   ADLKAMMNKKK"
FT   gene            514433..514585
FT                   /pseudo
FT                   /locus_tag="SeHA_C0512"
FT                   /note="conserved hypothetical protein; this gene contains a
FT                   frame shift which may be the result of sequencing error"
FT   gene            complement(514669..515532)
FT                   /locus_tag="SeHA_C0513"
FT   CDS_pept        complement(514669..515532)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0513"
FT                   /product="nucleoside-specific channel-forming protein tsx"
FT                   /note="identified by match to protein family HMM PF03502"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0513"
FT                   /db_xref="EnsemblGenomes-Tr:ACF68587"
FT                   /protein_id="ACF68587.1"
FT                   /translation="MKKTLLAVSAALALTSSFTANAAENDQPQYLSDWWHQSVNVVGSY
FT                   HTRFSPKLNNDVYLEYEAFAKKDWFDFYGYIDIPKTFDWGNGNDKGIWSDGSPLFMEIE
FT                   PRFSIDKLTGADLSFGPFKEWYFANNYIYDMGDNKASRQSTWYMGLGTDIDTGLPMGLS
FT                   LNVYAKYQWQNYGASNENEWDGYRFKVKYFVPITDLWGGKLSYIGFTNFDWGSDLGDDP
FT                   NRTSNSIASSHILALNYDHWHYSVVARYFHNGGQWQNGAKLNWGDGDFSAKSTGWGGYL
FT                   VVGYNF"
FT   gene            complement(515720..515857)
FT                   /locus_tag="SeHA_C0514"
FT   CDS_pept        complement(515720..515857)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0514"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0514"
FT                   /db_xref="EnsemblGenomes-Tr:ACF68954"
FT                   /protein_id="ACF68954.1"
FT                   /translation="MIFSLLINKRSGGAFCAFRNIPRATFVALLTFPSFMTWIGNIHER
FT                   "
FT   gene            complement(515832..516329)
FT                   /locus_tag="SeHA_C0515"
FT   CDS_pept        complement(515832..516329)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0515"
FT                   /product="lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0515"
FT                   /db_xref="EnsemblGenomes-Tr:ACF67307"
FT                   /protein_id="ACF67307.1"
FT                   /translation="MSLTACAPQSEVRQMHQSISTLNKEMTQLNQETVKITQQNKLNAE
FT                   STRGVYLLLGANTPARLESQIGTLRMTLLEITPVADGAHATLHIQGESRDPLPAFSATV
FT                   EYGQLQGTTENYQEVNAQSLLVNAPASLRAPSDVNISLPLKGITPAQLGFIRIHDIQPV
FT                   NQ"
FT   gene            516404..516550
FT                   /locus_tag="SeHA_C0516"
FT   CDS_pept        516404..516550
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0516"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0516"
FT                   /db_xref="EnsemblGenomes-Tr:ACF68090"
FT                   /protein_id="ACF68090.1"
FT                   /translation="MVVRYTHKGTDPLSQKRSAFVVAPVQGKIAFPKSSGQDAVCIAHF
FT                   VSP"
FT   gene            516523..516972
FT                   /gene="nrdR"
FT                   /locus_tag="SeHA_C0517"
FT   CDS_pept        516523..516972
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nrdR"
FT                   /locus_tag="SeHA_C0517"
FT                   /product="transcriptional regulator, NrdR family"
FT                   /note="identified by match to protein family HMM PF03477;
FT                   match to protein family HMM TIGR00244"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0517"
FT                   /db_xref="EnsemblGenomes-Tr:ACF66945"
FT                   /db_xref="GOA:B4T8Q6"
FT                   /db_xref="InterPro:IPR003796"
FT                   /db_xref="InterPro:IPR005144"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4T8Q6"
FT                   /protein_id="ACF66945.1"
FT                   /translation="MHCPFCFAVDTKVIDSRLVGEGSSVRRRRQCLVCNERFTTFEVAE
FT                   LVMPRVIKSNDVREPFNEDKLRSGMLRALEKRPVSADDVEMALNHIKSQLRATGEREVP
FT                   SKMIGNLVMEQLKKLDKVAYIRFASVYRSFEDIKDFGEEIARLQD"
FT   gene            516976..518079
FT                   /gene="ribD"
FT                   /locus_tag="SeHA_C0518"
FT   CDS_pept        516976..518079
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ribD"
FT                   /locus_tag="SeHA_C0518"
FT                   /product="riboflavin biosynthesis protein RibD"
FT                   /EC_number="3.5.4.26"
FT                   /EC_number="1.1.1.193"
FT                   /note="identified by match to protein family HMM PF00383;
FT                   match to protein family HMM PF01872; match to protein
FT                   family HMM TIGR00227; match to protein family HMM
FT                   TIGR00326"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0518"
FT                   /db_xref="EnsemblGenomes-Tr:ACF67611"
FT                   /protein_id="ACF67611.1"
FT                   /translation="MQDEFYMARALKLAQRGRFTTHPNPNVGCVIVNNGDIVGEGYHHR
FT                   AGEPHAEVHALRMAGAKAKGATAYVTLEPCSHHGRTPPCCDALIAAGVARVVAAMQDPN
FT                   PQVAGRGLYRLQQAGIAVSHGLMMSEAEALNKGFLKRMRTGFPYLQLKLGASVDGRTAM
FT                   ASGESQWITSPQARRDVQRLRAQSHAILTSSATVLADDPALTVRWAELDASTQASYPQE
FT                   NLRQPVRIVIDSQNRVTPAHRIVQQPGETWIARTQEDSRAWPDAVRTISVPAHNGHLDL
FT                   VVLMMQLGRQQINSIWVEAGPGLAGALLQAGLVDELIVYVAPKLLGTQARGLCELPGLE
FT                   KLADAPQFTFSEIRHVGPDVCLHMVSA"
FT   gene            518168..518638
FT                   /gene="ribH"
FT                   /locus_tag="SeHA_C0519"
FT   CDS_pept        518168..518638
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ribH"
FT                   /locus_tag="SeHA_C0519"
FT                   /product="6,7-dimethyl-8-ribityllumazine synthase"
FT                   /EC_number="6.3.3.-"
FT                   /note="identified by match to protein family HMM PF00885;
FT                   match to protein family HMM TIGR00114"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0519"
FT                   /db_xref="EnsemblGenomes-Tr:ACF66041"
FT                   /db_xref="GOA:B4T8Q8"
FT                   /db_xref="InterPro:IPR002180"
FT                   /db_xref="InterPro:IPR034964"
FT                   /db_xref="InterPro:IPR036467"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4T8Q8"
FT                   /protein_id="ACF66041.1"
FT                   /translation="MNIIKANVAAPDARVAITIARFNQFINDSLLDGAVDALTRIGQVK
FT                   DDNITVVWVPGAYELPLATEALAKSGKYDAVVALGTVIRGGTAHFEYVAGGASNGLASV
FT                   AQGSGVPVAFGVLTTESIEQAIERAGTKAGNKGAEAALTALEMINVLKAIKA"
FT   gene            518659..519078
FT                   /gene="nusB"
FT                   /locus_tag="SeHA_C0520"
FT   CDS_pept        518659..519078
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nusB"
FT                   /locus_tag="SeHA_C0520"
FT                   /product="transcription termination/antitermination factor
FT                   NusB"
FT                   /note="identified by match to protein family HMM PF01029;
FT                   match to protein family HMM TIGR01951"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0520"
FT                   /db_xref="EnsemblGenomes-Tr:ACF67753"
FT                   /db_xref="GOA:B4T8Q9"
FT                   /db_xref="InterPro:IPR006027"
FT                   /db_xref="InterPro:IPR011605"
FT                   /db_xref="InterPro:IPR035926"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4T8Q9"
FT                   /protein_id="ACF67753.1"
FT                   /translation="MKPAARRRARECAVQALYSWQLSQNDIADVEYQFLAEQDVKDVDV
FT                   LYFRELLSGVATNSAYLDGLMKPYLSRLLEELGQVEKAVLRIALFELSKRSDVPYKVAI
FT                   NEAIELAKTFGAEDSHKFVNGVLDKAAPVIRPNKK"
FT   gene            519157..520137
FT                   /gene="thiL"
FT                   /locus_tag="SeHA_C0521"
FT   CDS_pept        519157..520137
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiL"
FT                   /locus_tag="SeHA_C0521"
FT                   /product="thiamine-monophosphate kinase"
FT                   /EC_number="2.7.4.16"
FT                   /note="identified by match to protein family HMM PF02769;
FT                   match to protein family HMM TIGR01379"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0521"
FT                   /db_xref="EnsemblGenomes-Tr:ACF69797"
FT                   /protein_id="ACF69797.1"
FT                   /translation="MACGEFSLIARYFDRVKSSRLDVETGIGDDCALLNIPEKQTLAIS
FT                   TDTLVAGIHFLPDIDPADLAYKALAVNLSDLAAMGADPAWLTLALTLPDVDEAWLAAFS
FT                   DSLFEQLDYYDMQLIGGDTTRGPLSMTLGIHGLVPVGRALKRSGAKPGDWIYVTGTLGD
FT                   SAAGLAILRGDFRVGSWGDADYLVKRHLRPTPRILQGQALRDLASSAIDLSDGLISDLG
FT                   HILQASNCGARIDLEALPDSEELWGHANDPEQKLRWMLSGGEDYELCFTVPELNRGALD
FT                   VALGHLGVPFTCIGQMTADIEGIAFVRDGEPVTFDWKGYDHFATP"
FT   gene            520124..520630
FT                   /gene="pgpA"
FT                   /locus_tag="SeHA_C0522"
FT   CDS_pept        520124..520630
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pgpA"
FT                   /locus_tag="SeHA_C0522"
FT                   /product="phosphatidylglycerophosphatase A"
FT                   /EC_number="3.1.3.27"
FT                   /note="identified by match to protein family HMM PF04608"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0522"
FT                   /db_xref="EnsemblGenomes-Tr:ACF66705"
FT                   /protein_id="ACF66705.1"
FT                   /translation="MPRHKDVAKSRLNLRNPWHLLATGFGSGLSPVVPGTMGSLAAIPF
FT                   WYLMTFLPWQLYSLVVMFGICIGVYLCHQTAKDMGVHDHGSIVWDEFIGMWITLMALPT
FT                   TDWQWVAAGFVIFRILDMWKPWPIRWFDRNVHGGMGIMIDDIVAGVISAGILYFIGHHW
FT                   PLGII"
FT   gene            complement(520734..521708)
FT                   /locus_tag="SeHA_C0523"
FT   CDS_pept        complement(520734..521708)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0523"
FT                   /product="oxidoreductase, aldo/keto reductase family"
FT                   /note="identified by match to protein family HMM PF00248"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0523"
FT                   /db_xref="EnsemblGenomes-Tr:ACF69936"
FT                   /protein_id="ACF69936.1"
FT                   /translation="MQYNTLGNTDLRVSRLCLGCMTFGEPSRGNHAWTLPEESSRPIIK
FT                   RALEGGINFFDTANSYSDGSSEEIVGRALRDFARRDEVVVATKVFHRVGDLPEGLSRAQ
FT                   ILRSIDDSLTRLGMEYVDILQIHRWDYTTPIEETLEALNDVVKAGKARYIGASSMHASQ
FT                   FAQALALQKQHGWAPFVTMQDHYNLIYREEEREMLPLCWQEGVAVIPWSPLARGRLTRP
FT                   WGETTARLVSDDVGKNLYDESDKNDAQIAERLAGVSEALGATRAQVALAWLLSKRGVAA
FT                   PIIGTSREEQLDELLNAVDLTLKPEQIAELETPYKQHPVVGFK"
FT   gene            complement(521765..523627)
FT                   /gene="dxs"
FT                   /locus_tag="SeHA_C0524"
FT   CDS_pept        complement(521765..523627)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dxs"
FT                   /locus_tag="SeHA_C0524"
FT                   /product="1-deoxy-D-xylulose-5-phosphate synthase"
FT                   /EC_number="2.2.1.7"
FT                   /note="identified by match to protein family HMM PF02779;
FT                   match to protein family HMM PF02780; match to protein
FT                   family HMM TIGR00204"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0524"
FT                   /db_xref="EnsemblGenomes-Tr:ACF70423"
FT                   /db_xref="GOA:B4T8R3"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR005477"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR020826"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4T8R3"
FT                   /protein_id="ACF70423.1"
FT                   /translation="MSFDIAKYPTLALVDSTQELRLLPKESLPKLCDELRRYLLDSVSR
FT                   SSGHFASGLGTVELTVALHYVYNTPFDQLIWDVGHQAYPHKILTGRRDKIGTIRQKGGL
FT                   HPFPWRGESEYDVLSVGHSSTSISAGIGIAVAAEKEGKDRRTVCVIGDGAITAGMAFEA
FT                   MNHAGDIRPDMLVILNDNEMSISENVGALNNHLAQLLSGKLYSSLREGGKKVFSGVPPI
FT                   KELLKRTEEHIKGMVVPGTLFEELGFNYIGPVDGHDVMGLISTLKNMRDLKGPQFLHIM
FT                   TKKGRGYEPAEKDPITFHAVPKFDPSSGCLPKSSGGLPGYSKIFGDWLCETAAKDSKLM
FT                   AITPAMREGSGMVEFSRKFPDRYFDVAIAEQHAVTFAAGLAIGGYKPVVAIYSTFLQRA
FT                   YDQVIHDVAIQKLPVMFAIDRAGIVGADGQTHQGAFDLSYLRCIPDMVIMTPSDENECR
FT                   QMLLTGYHYNDGPTAVRYPRGNAQGVALTPLEKLPIGKGLVKRHGEKLAILNFGTLMPE
FT                   AAKVAEALNATLVDMRFVKPLDDTLILEMAAQHDALVTLEENAIMGGAGSGVNEVLMAH
FT                   RKPVPVLNIGLPDFFIPQGTQEEARAELGLDAAGIEAKIKAWLA"
FT   gene            complement(523651..524550)
FT                   /gene="ispA"
FT                   /locus_tag="SeHA_C0525"
FT   CDS_pept        complement(523651..524550)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ispA"
FT                   /locus_tag="SeHA_C0525"
FT                   /product="geranyltranstransferase"
FT                   /EC_number="2.5.1.10"
FT                   /note="identified by match to protein family HMM PF00348"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0525"
FT                   /db_xref="EnsemblGenomes-Tr:ACF69008"
FT                   /protein_id="ACF69008.1"
FT                   /translation="MDFTQQLQACVTQANQALSRFIAPLPFQNTPVVEAMQYGALLGGK
FT                   RLRPFLVYATGQMFGVSTATLDAPAAAVECIHAYSLIHDDLPAMDDDDLRRGLPTCHIK
FT                   FGEANAILAGDALQTLAFAIISDAPMPEVTDRDRIAMIAELANASGIAGMCGGQALDLA
FT                   AEGQRITLDALERIHRHKTGALIRAAVRLGALSAGDKGRNTLPILDRYAESIGLAFQVQ
FT                   DDILDVVGDTATLGKRQGADQQLGKSTYPALLGLEQARNKARDLIEDARQSLHQLAAQS
FT                   LDTSALEALANYIIQRDK"
FT   gene            complement(524551..524793)
FT                   /gene="xseB"
FT                   /locus_tag="SeHA_C0526"
FT   CDS_pept        complement(524551..524793)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="xseB"
FT                   /locus_tag="SeHA_C0526"
FT                   /product="exodeoxyribonuclease VII, small subunit"
FT                   /EC_number="3.1.11.6"
FT                   /note="identified by match to protein family HMM PF02609;
FT                   match to protein family HMM TIGR01280"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0526"
FT                   /db_xref="EnsemblGenomes-Tr:ACF68377"
FT                   /db_xref="GOA:B4T8R5"
FT                   /db_xref="InterPro:IPR003761"
FT                   /db_xref="InterPro:IPR037004"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4T8R5"
FT                   /protein_id="ACF68377.1"
FT                   /translation="MPKKNEAPASFETALSELEHIVTRLESGDLPLEDALNEFERGVQL
FT                   ARQGQAKLQQAEQRVQILLSDNEEASPEPFIADNE"
FT   gene            525003..526451
FT                   /gene="thiI"
FT                   /locus_tag="SeHA_C0527"
FT   CDS_pept        525003..526451
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiI"
FT                   /locus_tag="SeHA_C0527"
FT                   /product="thiamine biosynthesis/tRNA modification protein
FT                   ThiI"
FT                   /note="identified by match to protein family HMM PF02568;
FT                   match to protein family HMM PF02926; match to protein
FT                   family HMM TIGR00342"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0527"
FT                   /db_xref="EnsemblGenomes-Tr:ACF67201"
FT                   /db_xref="GOA:B4T8R6"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR003720"
FT                   /db_xref="InterPro:IPR004114"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020536"
FT                   /db_xref="InterPro:IPR026340"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4T8R6"
FT                   /protein_id="ACF67201.1"
FT                   /translation="MKFIIKLFPEITIKSQSVRLRFIKILTGNIRNVLKHYDETLAVVR
FT                   HWDNIEVRAKDENQRLAIRDALTRIPGIHHILEVEDVPFTDMHDIFEKALAQYREQLEG
FT                   KTFCVRVKRRGKHEFSSIEVERYVGGGLNQHIESARVKLTNPDVTVHLEVEDDRLLLIK
FT                   GRYEGIGGFPIGTQEDVLSLISGGFDSGVSSYMLMRRGCRVHYCFFNLGGAAHEIGVRQ
FT                   VAHYLWNRFGSSHRVRFVAINFEPVVGEILEKVDDGQMGVVLKRMMVRAASKVAERYGV
FT                   QALVTGEALGQVSSQTLTNLRLIDNVSDTLILRPLISYDKEHIINLARQIGTEDFARTM
FT                   PEYCGVISKSPTVKAIKAKIEAEEENFDFSILDKVVEEANNVDIREIAQQTQQEVVEVE
FT                   TVSGFGPNDVILDIRSVDEQDDKPLKVEGVDVVSLPFYKLSTKFGDLDQSKTWLLWCER
FT                   GVMSRLQALYLREQGFANVKVYRP"
FT   gene            complement(526495..527292)
FT                   /gene="phnV"
FT                   /locus_tag="SeHA_C0528"
FT   CDS_pept        complement(526495..527292)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phnV"
FT                   /locus_tag="SeHA_C0528"
FT                   /product="2-aminoethylphosphonate ABC transport system,
FT                   membrane component PhnV"
FT                   /note="identified by match to protein family HMM PF00528;
FT                   match to protein family HMM TIGR03255"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0528"
FT                   /db_xref="EnsemblGenomes-Tr:ACF66576"
FT                   /protein_id="ACF66576.1"
FT                   /translation="MLIWSPKGRAAAGVVASVLFIVFFFLPLAVILMSSLSQQWNGILP
FT                   SGFTLNHFVNALHGAAWDALLASLTIGFCASLFALLCGVWAALALRQYGVKTQKWLSMV
FT                   FYLPSAIPSVSVGLGILVAFSQGPLQMNGTLWIVLTAHFVLISAFTFSNVSTGLARISA
FT                   DIENVASSLGASPWYRLRHVTLPLLMPWMVSALALSLSLSMGELGATMMIYPPGWTTLP
FT                   VAIFSLTDRGNIADGAALTIVLVAITLLLMMKLERIAKRLGQK"
FT   gene            complement(527286..528155)
FT                   /gene="phnU"
FT                   /locus_tag="SeHA_C0529"
FT   CDS_pept        complement(527286..528155)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phnU"
FT                   /locus_tag="SeHA_C0529"
FT                   /product="2-aminoethylphosphonate ABC transporter, permease
FT                   protein"
FT                   /note="identified by match to protein family HMM PF00528;
FT                   match to protein family HMM TIGR03226"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0529"
FT                   /db_xref="EnsemblGenomes-Tr:ACF68280"
FT                   /protein_id="ACF68280.1"
FT                   /translation="MSLILPLEKPALNLRPLLWLLLPLLVLATLFFWPLSLIVEQALRG
FT                   ANGEIGLETFRQVVDSKRFVGALLNTLQIAFFATAGCLLLGSVMSLILVFIPFPGSELI
FT                   GRVVDTFIALPTFLITLAFTFIYGSAGLLNGALMSLFAFELPPVDFLYSMQGVILAEIT
FT                   VFTPLVMRPLMAALRQIDKSQLEAASILGAHPLRVIGQVIFPAALPALMAGGSLCLLLT
FT                   TNEFGIVLFIGAKGVNTLPMMVYSKAILESDYTVACMIALINIVLSLGLFSLYRLAASR
FT                   TGVRSQPC"
FT   gene            complement(528158..529267)
FT                   /gene="phnT"
FT                   /locus_tag="SeHA_C0530"
FT   CDS_pept        complement(528158..529267)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phnT"
FT                   /locus_tag="SeHA_C0530"
FT                   /product="2-aminoethylphosphonate ABC transport system,
FT                   ATP-binding component PhnT"
FT                   /note="identified by match to protein family HMM PF00005;
FT                   match to protein family HMM PF08402; match to protein
FT                   family HMM TIGR03258"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0530"
FT                   /db_xref="EnsemblGenomes-Tr:ACF67625"
FT                   /protein_id="ACF67625.1"
FT                   /translation="MLMKTTAVHVPASQGTSGIVLDSLRVAYHGNVVLKPLSLTIEPGE
FT                   VLALIGPSGSGKTTVLRAVAGFVQPAGGRILIGDTDVTHLPPYKRGLAMVVQNYALFPH
FT                   LKVEDNVAFGLRAQKQPKALINERVTQALKTVGMSDYAARYPHQLSGGQQQRVAIARAI
FT                   AVRPRVLLLDEPLSALDAQIRHNMVEEIACLHRELPELTILYVTHDQTEALTLADKIGI
FT                   MKDGSLIAHGETRALYQHPPNRFAAEFLGRANILSAIALGITEAPGLVDVSCGGAVIRA
FT                   FSRGSHHGYNKLLCIRPQHLSLTPRSAYSNRFNATLQSVHWQGDLTHLLCDVAGETVRM
FT                   VLTHVNPLPRVGDKLALWFEPDDAVLIEV"
FT   gene            complement(529273..530286)
FT                   /gene="phnS"
FT                   /locus_tag="SeHA_C0531"
FT   CDS_pept        complement(529273..530286)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phnS"
FT                   /locus_tag="SeHA_C0531"
FT                   /product="2-aminoethylphosphonate ABC transporter,
FT                   2-aminoethylphosphonate binding protein"
FT                   /note="identified by match to protein family HMM PF01547;
FT                   match to protein family HMM TIGR03227"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0531"
FT                   /db_xref="EnsemblGenomes-Tr:ACF69291"
FT                   /protein_id="ACF69291.1"
FT                   /translation="MKLSRLALLSVFALASAPSWAESVVTVYSIDGLHDGDNSWYQVQF
FT                   DAFTKATGITVRYVEGGGGVVVERLAKERTNPQADVLVTAPPFIQRAAAEKLLANFNTD
FT                   AASAIPDANNLYSPLVKNYLSFIYNSKLLKTAPASWQDLLDGNFKNKLQYSTPGQAADG
FT                   TAVMLQAFHSFGSKDAGFAYLGKLQANNVGPSASTGKLTALVNKGEIYVANGDLQMNLA
FT                   QMERNPNVKIFWPANDKGERSALAIPYVIGLVQGAPQSENGKKLINFLLSKEAQTRVSE
FT                   LSWGMPVRSDVTPSDEHYKTATAALEGVQSWQPNWDDVAVSLSADISRWHKVTESE"
FT   gene            complement(530484..531203)
FT                   /locus_tag="SeHA_C0532"
FT   CDS_pept        complement(530484..531203)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0532"
FT                   /product="transcriptional regulator protein"
FT                   /note="identified by match to protein family HMM PF00392;
FT                   match to protein family HMM PF07702; match to protein
FT                   family HMM TIGR03337"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0532"
FT                   /db_xref="EnsemblGenomes-Tr:ACF68644"
FT                   /protein_id="ACF68644.1"
FT                   /translation="MKSIPGDIPQYLLIKAQLQARIQSGALKSGDKLPSERELCAIFNT
FT                   TRITIRESLAQLESSGLIWRADRRGWFVTPERLWLDPTQNTNFHKLCREQGREPKTALL
FT                   SGVLTTVPVEVMEPLQLQPFDQIYLLTRLRYADGRAVCYCENHCLPARVPELLQYDLNG
FT                   SLTEVYESHYNLVYTSMHLSFYPTAMPAQAAQALGVMEGRPALLLRRLNYDQHGRVLDL
FT                   DIEYWRHDSLRIEVDTH"
FT   gene            531343..532446
FT                   /gene="phnW"
FT                   /locus_tag="SeHA_C0533"
FT   CDS_pept        531343..532446
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phnW"
FT                   /locus_tag="SeHA_C0533"
FT                   /product="2-aminoethylphosphonate--pyruvate transaminase"
FT                   /EC_number="2.6.1.37"
FT                   /note="identified by match to protein family HMM PF00266;
FT                   match to protein family HMM TIGR02326; match to protein
FT                   family HMM TIGR03301"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0533"
FT                   /db_xref="EnsemblGenomes-Tr:ACF66903"
FT                   /db_xref="GOA:B4T9C6"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR012703"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR024169"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4T9C6"
FT                   /protein_id="ACF66903.1"
FT                   /translation="MTSRNYLLLTPGPLTTSRTVKEAMLFDSCTWDDDYNIGVVEQIRQ
FT                   QLTELATASEGYTSVLLQGSGSYAVEAVLGSALGPQDKVLIVSNGAYGARMVEMAGLMG
FT                   IAHHAYDCGEVARPDVQAIDAILNADPTISHIAMVHSETTTGMLNPIDEVGALAHRYGK
FT                   TYIVDAMSSFGGIPMDIAALHIDYLISSANKCIQGVPGFAFVIAREQKLAACKGHSRSL
FT                   SLDLYAQWRCMEDNHGKWRFTSPTHTVLAFAQALKELAKEGGVAARHQRYQQNQRSLVA
FT                   GMRALGFNTLLDDELHSPIITAFYSPEDPQYRFSEFYRRLKEQGFVIYPGKVSQSDCFR
FT                   IGNIGEVYAADITALLTAIRTAMYWMK"
FT   gene            532456..533265
FT                   /gene="phnX"
FT                   /locus_tag="SeHA_C0534"
FT   CDS_pept        532456..533265
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phnX"
FT                   /locus_tag="SeHA_C0534"
FT                   /product="phosphonoacetaldehyde hydrolase"
FT                   /EC_number="3.11.1.1"
FT                   /note="identified by match to protein family HMM PF00702;
FT                   match to protein family HMM TIGR01422; match to protein
FT                   family HMM TIGR01509"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0534"
FT                   /db_xref="EnsemblGenomes-Tr:ACF66343"
FT                   /db_xref="GOA:B4T9C7"
FT                   /db_xref="InterPro:IPR006323"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4T9C7"
FT                   /protein_id="ACF66343.1"
FT                   /translation="MNRIHAVILDWAGTTVDFGSFAPTQIFVEAFRQAFDVEITLAEAR
FT                   VPMGLGKWQHIEALGKLPAVDARWQAKFGRSMSAADIDAIYAAFMPLQIAKVVDFSSPI
FT                   AGVIDTIAALRAEGIKIGSCSGYPRAVMERLVPAAAEHGYRPDHWVATDDLAAGGRPGP
FT                   WMALQNVIALGIDAVAHCVKVDDAAPGISEGLNAGMWTVGLAVSGNEFGATWDAYQTMS
FT                   KEDVAVRREHAASKLYAAGAHYVVDSLADLPGVIAHINARLAQGERP"
FT   gene            complement(533362..533952)
FT                   /locus_tag="SeHA_C0535"
FT   CDS_pept        complement(533362..533952)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0535"
FT                   /product="protein ThiJ"
FT                   /note="identified by match to protein family HMM PF01965;
FT                   match to protein family HMM TIGR01383"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0535"
FT                   /db_xref="EnsemblGenomes-Tr:ACF67911"
FT                   /protein_id="ACF67911.1"
FT                   /translation="MSAQALVCLAPGSEETEAVTTIDLLVRGGIHVTTASVASDGNLTI
FT                   VCSRGVKLLADAPLVEVADGDYDIIVLPGGIKGAECFRDSPLLVETVKQFHRSGRIVAA
FT                   ICAAAATVLVPHDIFPIGNMTGFPALKDKIPAEQWQDKRVVWDARVKLLTSQGPGTAID
FT                   FGLKIIDLLAGREKAHEVASQLVMAAGIYNYYE"
FT   gene            complement(533915..534826)
FT                   /gene="panE"
FT                   /locus_tag="SeHA_C0536"
FT   CDS_pept        complement(533915..534826)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="panE"
FT                   /locus_tag="SeHA_C0536"
FT                   /product="2-dehydropantoate 2-reductase"
FT                   /EC_number="1.1.1.169"
FT                   /note="identified by match to protein family HMM PF02558;
FT                   match to protein family HMM PF08546; match to protein
FT                   family HMM TIGR00745"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0536"
FT                   /db_xref="EnsemblGenomes-Tr:ACF67418"
FT                   /protein_id="ACF67418.1"
FT                   /translation="MKITVLGCGALGQLWLSALCKHGHDVQGWLRVPQPYCSVNLIDTD
FT                   GSFFNESLTANDPDFLAKSELLLVTLKAWQVSDAVRTLASTLPVTSPILLIHNGMGTIE
FT                   ELQNIQQPMLMGTITHAARRDGNIIIHVANGTTHIGPAREQDGDYSYLADILQGVLPDV
FT                   AWHNNIRAEMWRKLAVNCVINPLTALWNCPNGELRHHTDEINAICEEVAAVIEREGYHT
FT                   SADDLRYYVEQVIDSTAENISSMLQDVRAMRHTEIDYITGYLLKRARVHGLAVPENSRL
FT                   FEMVKRKESEYERSGTGMPRPW"
FT   gene            534952..535443
FT                   /locus_tag="SeHA_C0537"
FT   CDS_pept        534952..535443
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0537"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF04461"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0537"
FT                   /db_xref="EnsemblGenomes-Tr:ACF67583"
FT                   /db_xref="InterPro:IPR007551"
FT                   /db_xref="InterPro:IPR035570"
FT                   /db_xref="InterPro:IPR035571"
FT                   /db_xref="InterPro:IPR036183"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4T9D0"
FT                   /protein_id="ACF67583.1"
FT                   /translation="MPSFDIVSEVDLQEARNGVDNAVREVESRFDFRGVEATIELNDAN
FT                   KTIKVLSESDFQVNQLLDILRAKLLKRGIEGASLDVSDEFVHSGKTWYVEAKLKQGIES
FT                   AVQKKIVKLIKDSKLKVQAQIQGEEIRVTGKSRDDLQSVMALVRGGDLGQPFQFKNFRD
FT                   "
FT   gene            complement(535490..536854)
FT                   /locus_tag="SeHA_C0538"
FT   CDS_pept        complement(535490..536854)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0538"
FT                   /product="inner membrane transport protein YajR"
FT                   /note="identified by match to protein family HMM PF07690"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0538"
FT                   /db_xref="EnsemblGenomes-Tr:ACF65899"
FT                   /protein_id="ACF65899.1"
FT                   /translation="MNDYKMTPGELRATWGLGTVFSLRMLGMFMVLPVLTTYGMALQGA
FT                   SEALIGIAIGIYGLAQAIFQIPFGLLSDRIGRKPLIVGGLAVFVAGSVIAALSHSIWGI
FT                   ILGRALQGSGAIAAAVMALLSDLTREQNRTKAMAFIGVSFGITFAIAMVLGPIVTHSLG
FT                   LNALFWMIAALATLGILLTIWVVPNSTNHVLNRESGMVKGSFSKVLAEPRLLKLNFGIM
FT                   CLHILLMSTFVALPGQLADAGFPAAEHWKVYLATMVIAFAAVVPFIIYAEVKRRMKQVF
FT                   LFCVGLIVVAEIVLWGAGQHFWELVIGVQLFFLAFNLMEALLPSLISKESPAGYKGTAM
FT                   GVYSTSQFLGVALGGSLGGWIDGTFDGQTVFLAGAVLAMVWLAVASTMKEPPYVSSLRV
FT                   EIPADIVADDRLKQRLLAMKGVSEALIVAEEHSAYVKIDSKVTNRFEVEQLISKG"
FT   gene            537379..538890
FT                   /locus_tag="SeHA_C0539"
FT   CDS_pept        537379..538890
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0539"
FT                   /product="putative periplasmic protein"
FT                   /note="identified by match to protein family HMM PF08238"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0539"
FT                   /db_xref="EnsemblGenomes-Tr:ACF66590"
FT                   /protein_id="ACF66590.1"
FT                   /translation="MKIKFLSLCILAGVLFVSQVNASANNGKDDVKYAALTQKDLDALP
FT                   VEKRASVLDELGFIHEYGIGVPMNRERALQYYKQACELGGNYGCYNVKYAYQYGDGVAK
FT                   DSAQANKYAKKMNLDNLLIEQEYIDKFSQEIYMAKALADTDKSQRAAFISILIHALNNR
FT                   PESDALFFSRIGFNQEKTFRLATLWSQDGDPQMDYQMGRLTLNDFSGRYADEPYQARPA
FT                   SLKWFRAAAEKGVVEAQSLLGSIYSGGEGDEWGIKPDIQEAQKWYGQAAKQGDSDAQIA
FT                   LGKIYYSGATGRTDYAKALALFTQVENDGTNSRSTMPLSWMYYNGLGTAPDCDKAWSYY
FT                   KKASRYVGKMVEEKIFLSKCAADIQSRKNNADALPKVTLKKESVFSRGITAKPKECALI
FT                   FQIGTDKIRNMANLHITLELKNDDGMATEETLMIPPFGLNTLGIDMQNHDVDPLITTYD
FT                   LPLYTQDFCHGIGDIHFTLKSATATINGKNVDLLKADSVRFLDKE"
FT   gene            538902..540395
FT                   /locus_tag="SeHA_C0540"
FT   CDS_pept        538902..540395
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0540"
FT                   /product="tetratricopeptide repeat protein"
FT                   /note="identified by match to protein family HMM PF08238"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0540"
FT                   /db_xref="EnsemblGenomes-Tr:ACF69445"
FT                   /protein_id="ACF69445.1"
FT                   /translation="MIKRKWSILFLLGLSFASVCQAGDDIDALYSRIAQKDIQALNELK
FT                   ALAKDNNAQALAELGFIYEYGVSVSVDIPQAIKYYEQACDLDGDYGCFNAAYFYEYGIG
FT                   TQKDITQAKTLAKQLREKINLSNINLDKKVSERIIGSVYSNKLEAYRDLSFRPHFIQGL
FT                   SFYFYAPQSDERKLLSRIGFDSSHLARIAILWAREGDPEVAYQTAKLVSTLYFNNETKT
FT                   IDIAEALKWLRISAEKGDADSQTLLGFLYEHAGLGLQPDGEKARKWYEMAAQQGNGEAL
FT                   YTLGRMYYSGVMVNVDYDKALYFFKKAYEKELQAAADYLAQMYFNGQSVDVDCQQSWHY
FT                   YDNSYIKKMTQRDYLDYCEKDRKRRNDFSQQLPELTLEKYAGLFGRIDNIPLCQIGFVV
FT                   NTNKLIHVANLRVELILKNDAGVSDERMVAFPPLGLNTLGAEQGMGDSFKSMGYLLMKN
FT                   GDLCDYHKLTFTVKSATATINGKKVDLLKTDNLHIIQNR"
FT   gene            complement(540477..541364)
FT                   /gene="cyoE"
FT                   /locus_tag="SeHA_C0541"
FT   CDS_pept        complement(540477..541364)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cyoE"
FT                   /locus_tag="SeHA_C0541"
FT                   /product="protoheme IX farnesyltransferase"
FT                   /EC_number="2.5.1.-"
FT                   /note="identified by match to protein family HMM PF01040;
FT                   match to protein family HMM TIGR01473"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0541"
FT                   /db_xref="EnsemblGenomes-Tr:ACF70271"
FT                   /protein_id="ACF70271.1"
FT                   /translation="MFKQYLQVTKPGIIFGNLISVIGGFLLASKGSIDYPLFIYTLVGV
FT                   SLVVASGCVFNNYIDRDIDRKMERTKNRVLVKGLISPGVSLVYATLLGIAGFMLLWFGA
FT                   NPLACWLGVMGFVVYVGVYSLYMKRHSVYGTLIGSLSGAAPPVIGYCAVTGDFDSGAAI
FT                   LLAIFSLWQMPHSYAIAIFRFKDYQAANIPVLPVVKGISVAKNHITLYIIAFAVATLML
FT                   TLGGYAGYKYLVVAAAVSVWWLGMALRGYKVEDDKVWARKLFGFSIIAITALSIMMSVD
FT                   FMVPNSQNLLTYVW"
FT   gene            complement(541379..541708)
FT                   /gene="cyoD"
FT                   /locus_tag="SeHA_C0542"
FT   CDS_pept        complement(541379..541708)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cyoD"
FT                   /locus_tag="SeHA_C0542"
FT                   /product="cytochrome o ubiquinol oxidase, subunit IV"
FT                   /EC_number="1.10.3.-"
FT                   /note="identified by match to protein family HMM PF03626;
FT                   match to protein family HMM TIGR02847"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0542"
FT                   /db_xref="EnsemblGenomes-Tr:ACF69111"
FT                   /protein_id="ACF69111.1"
FT                   /translation="MSHSTESGGASHGSVKTYMTGFILSVILTVIPFWMVMTGAASPAV
FT                   ILGSILAMAVVQILVHLVCFLHMNTKSDEGWNMTAFIFTVLIIAILVVGSIWIMWNLNY
FT                   NMMMH"
FT   gene            complement(541708..542322)
FT                   /gene="cyoC"
FT                   /locus_tag="SeHA_C0543"
FT   CDS_pept        complement(541708..542322)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cyoC"
FT                   /locus_tag="SeHA_C0543"
FT                   /product="cytochrome o ubiquinol oxidase, subunit III"
FT                   /EC_number="1.10.3.-"
FT                   /note="identified by match to protein family HMM PF00510;
FT                   match to protein family HMM TIGR02842"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0543"
FT                   /db_xref="EnsemblGenomes-Tr:ACF69208"
FT                   /protein_id="ACF69208.1"
FT                   /translation="MATDTLTHATAHAHEHGHHDAGQNKIFGFWVYLMSDCILFSILFA
FT                   TYAVLVNGTAGGPTGKDIFELPFVLVETFLLLFSSITYGMAAIAMHKNNKSQVISWLAL
FT                   TFLFGAGFIGMELYEFHHLIVNGMGPDRSGFLSAFFALVGTHGLHVTSGLIWMAVLMVQ
FT                   VARRGLTSTNRTRIMCLSLFWHFLDVIWICVFTVVYLMGAM"
FT   gene            complement(542312..544303)
FT                   /gene="cyoB"
FT                   /locus_tag="SeHA_C0544"
FT   CDS_pept        complement(542312..544303)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cyoB"
FT                   /locus_tag="SeHA_C0544"
FT                   /product="cytochrome o ubiquinol oxidase, subunit I"
FT                   /EC_number="1.10.3.-"
FT                   /note="identified by match to protein family HMM PF00115;
FT                   match to protein family HMM TIGR02843"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0544"
FT                   /db_xref="EnsemblGenomes-Tr:ACF67385"
FT                   /protein_id="ACF67385.1"
FT                   /translation="MFGKLSLDAVPFHEPIVMVTIAAIIVGGLAILAAITYFGKWTYLW
FT                   KEWLTSVDHKRLGIMYIIVAIVMLLRGFADAIMMRSQQALASAGEAGFLPPHHYDQIFT
FT                   AHGVIMIFFVAMPFVIGLMNLVVPLQIGARDVAFPFLNNLSFWFTVVGVILVNLSLGVG
FT                   EFAQTGWLAYPPLSGIEYSPSVGVDYWIWALQLSGIGTTLTGINFFVTILKMRAPGMTM
FT                   FKMPVFTWASLCANVLIIASFPILTVTVALLTLDRYLGTHFFTNDMGGNMMMYINLIWA
FT                   WGHPEVYILILPVFGVFSEIAATFSRKRLFGYTSLVWATVCITVLSFIVWLHHFFTMGA
FT                   GANVNAFFGITTMIIAIPTGVKIFNWLFTMYQGRIVFHSAMMWTIGFIVTFSVGGMTGV
FT                   LLAVPGADFVLHNSLFLIAHFHNVIIGGVVFGCFAGMTYWWPKAFGFKLNETWGKRAFW
FT                   FWIIGFFVAFMPLYVLGFMGMTRRLSQQIDPQFHTMLMVAAAGAALIALGILCQLIQIF
FT                   VSIRDRDQNRDLTGDPWGGRTLEWSTSSPPPFYNFAVVPHVHERDAFWEMKEKGEAYQQ
FT                   PGQYEEIHMPKNSGAGIVIAAFATVFGFAMIWHIWWLAIVGFAGMIISWIVKSFDEDVD
FT                   YYVPVPEVEKLENQHFDEITKAGLKNGN"
FT   gene            complement(544314..545243)
FT                   /gene="cyoA"
FT                   /locus_tag="SeHA_C0545"
FT   CDS_pept        complement(544314..545243)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cyoA"
FT                   /locus_tag="SeHA_C0545"
FT                   /product="ubiquinol oxidase, subunit II"
FT                   /EC_number="1.10.3.-"
FT                   /note="identified by match to protein family HMM PF00116;
FT                   match to protein family HMM PF06481; match to protein
FT                   family HMM TIGR01433"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0545"
FT                   /db_xref="EnsemblGenomes-Tr:ACF67039"
FT                   /protein_id="ACF67039.1"
FT                   /translation="MGWLSLIAGTALLSGCNSALLDPKGQIGLEQRSLILTAFGLMLIV
FT                   VIPAILMAVGFAWKYRASNKDAKYSPNWSHSNKVEAVVWTVPILIIIFLAVLTWKTTHA
FT                   LEPSKPLAHDEKPITIEVVSMDWKWFFIYPEQGIATVNEIAFPANTPVYFKVTSNSVMN
FT                   SFFIPRLGSQIYAMAGMQTRLHLIANEPGTYDGISASYSGPGFSGMKFKAIATKDRAEF
FT                   DQWVAKAKQSPNTMNDMAAFEKVAMPSEYNKVEYFSSVKPDLFKDVINKFMDHGKSMDM
FT                   TQPEGEHSSHEGMEGMDMSHAESANSKG"
FT   gene            complement(545517..545639)
FT                   /locus_tag="SeHA_C0546"
FT   CDS_pept        complement(545517..545639)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0546"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0546"
FT                   /db_xref="EnsemblGenomes-Tr:ACF66353"
FT                   /protein_id="ACF66353.1"
FT                   /translation="MRNRILEIIGNFYATYFLYTIQPIKFKFLPLIVLLLIINC"
FT   gene            complement(545723..547198)
FT                   /locus_tag="SeHA_C0547"
FT   CDS_pept        complement(545723..547198)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0547"
FT                   /product="muropeptide transporter"
FT                   /note="identified by match to protein family HMM PF07690;
FT                   match to protein family HMM TIGR00901"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0547"
FT                   /db_xref="EnsemblGenomes-Tr:ACF68969"
FT                   /protein_id="ACF68969.1"
FT                   /translation="MSSQYLRIFQQPRSAILLILGFASGLPLALTSGTLQAWMTVENID
FT                   LKTIGFFSLVGQAYVFKFLWSPLMDRYTPPFLGRRRGWLLATQLLLLAAIAAMGFLEPG
FT                   TQLRWMAALAVVIAFCSASQDIVFDAWKTDVLPAEERGAGAAISVLGYRLGMLVSGGLA
FT                   LWLADRWLGWQGMYWLMAALLIPCIIATLLAPEPTDTIPSPKSLEQAVVAPLRDFFGRN
FT                   NAWLILLLIVLYKLGDAFAMSLTTTFLIRGVGFDAGEVGVVNKTLGLLATIVGALYGGI
FT                   LMQRLSLFRALLIFGILQGASNAGYWLLSITDKNMFSMGAAVFFENLCGGMGTAAFVAL
FT                   LMTLCNKSFSATQFALLSALSAVGRVYVGPVAGWFVEAHGWPTFYLFSVVAAVPGLLLL
FT                   LVCRQTLEYSWQSERFIPRTQYRGAYNFALSILLAGVALLAVWVLLLTMNAVDYTNFSF
FT                   LPELLETAVVVAVCGIVFGGLLDYLALRKTRLL"
FT   gene            complement(547242..547874)
FT                   /pseudo
FT                   /locus_tag="SeHA_C0548"
FT                   /note="putative lipoprotein; this gene contains a frame
FT                   shift which may be the result of sequencing error;
FT                   identified by match to protein family HMM PF03923"
FT   gene            548124..548441
FT                   /locus_tag="SeHA_C0549"
FT   CDS_pept        548124..548441
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0549"
FT                   /product="protein BolA"
FT                   /note="identified by match to protein family HMM PF01722"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0549"
FT                   /db_xref="EnsemblGenomes-Tr:ACF65840"
FT                   /protein_id="ACF65840.1"
FT                   /translation="MMIREQIEEKLRTAFDPVFLEVVDESYRHNVPAGSESHFKVVLVS
FT                   DRFTGERFLNRHRMIYGTLTAELSTTVHALALHTYTLKEWEGLQDTIFASPPCRGAGSI
FT                   A"
FT   gene            548788..550086
FT                   /gene="tig"
FT                   /locus_tag="SeHA_C0550"
FT   CDS_pept        548788..550086
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tig"
FT                   /locus_tag="SeHA_C0550"
FT                   /product="trigger factor"
FT                   /EC_number="5.2.1.8"
FT                   /note="identified by match to protein family HMM PF00254;
FT                   match to protein family HMM PF05697; match to protein
FT                   family HMM PF05698; match to protein family HMM TIGR00115"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0550"
FT                   /db_xref="EnsemblGenomes-Tr:ACF66619"
FT                   /db_xref="GOA:B4T9E2"
FT                   /db_xref="InterPro:IPR001179"
FT                   /db_xref="InterPro:IPR005215"
FT                   /db_xref="InterPro:IPR008880"
FT                   /db_xref="InterPro:IPR008881"
FT                   /db_xref="InterPro:IPR027304"
FT                   /db_xref="InterPro:IPR036611"
FT                   /db_xref="InterPro:IPR037041"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4T9E2"
FT                   /protein_id="ACF66619.1"
FT                   /translation="MQVSVETTQGLGRRVTITIAADSIETAVKSELVNVAKKVRIDGFR
FT                   KGKVPMNIVAQRYGASVRQDVLGDLMSRNFVDAIIKEKINPAGAPNYVPGEYKVGEDFT
FT                   YSVEFEVYPEVELTGLESIEVEKPVVEVTDADVDVMLDTLRKQQATWKEKDGAADAEDR
FT                   VTIDFTGSVDGEEFEGGKATDFVLAMGQGRMIPGFEDGVKGHKAGEEFTIDVTFPEEYH
FT                   AENLKGKAAKFVINLKKVEERELPELTEEFIKRFGVEDGSVAGLRAEVRKNMERELKGA
FT                   VRNRVKSQAIEGLVKANDIDVPSALIDSEIDVLRRQAAQRFGGNEKQALELPRELFEEQ
FT                   AKRRVVVGLLLGEVIRTNELKADEERVKGLIEEMASAYEDPKEVIEFYSKNKELMDNMR
FT                   NVALEEQAVEAVLAKAKVSEKATSFNELMNQQA"
FT   gene            550332..550955
FT                   /gene="clpP"
FT                   /locus_tag="SeHA_C0551"
FT   CDS_pept        550332..550955
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="clpP"
FT                   /locus_tag="SeHA_C0551"
FT                   /product="ATP-dependent Clp protease, proteolytic subunit
FT                   ClpP"
FT                   /EC_number="3.4.21.92"
FT                   /note="identified by match to protein family HMM PF00574;
FT                   match to protein family HMM TIGR00493"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0551"
FT                   /db_xref="EnsemblGenomes-Tr:ACF69880"
FT                   /db_xref="GOA:B4T9E3"
FT                   /db_xref="InterPro:IPR001907"
FT                   /db_xref="InterPro:IPR018215"
FT                   /db_xref="InterPro:IPR023562"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR033135"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4T9E3"
FT                   /protein_id="ACF69880.1"
FT                   /translation="MSYSGERDNLAPHMALVPMVIEQTSRGERSFDIYSRLLKERVIFL
FT                   TGQVEDHMANLIVAQMLFLEAENPEKDIYLYINSPGGVITAGMSIYDTMQFIKPDVSTI
FT                   CMGQAASMGAFLLTAGAKGKRFCLPNSRVMIHQPLGGYQGQATDIEIHAREILKVKGRM
FT                   NELMAHHTGQSLEQIERDTERDRFLSAPEAVEYGLVDSILTHRN"
FT   gene            551207..552478
FT                   /gene="clpX"
FT                   /locus_tag="SeHA_C0552"
FT   CDS_pept        551207..552478
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="clpX"
FT                   /locus_tag="SeHA_C0552"
FT                   /product="ATP-dependent Clp protease, ATP-binding subunit
FT                   ClpX"
FT                   /note="identified by match to protein family HMM PF00004;
FT                   match to protein family HMM PF06689; match to protein
FT                   family HMM PF07724; match to protein family HMM TIGR00382"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0552"
FT                   /db_xref="EnsemblGenomes-Tr:ACF70005"
FT                   /db_xref="GOA:B4T9E4"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004487"
FT                   /db_xref="InterPro:IPR010603"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038366"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4T9E4"
FT                   /protein_id="ACF70005.1"
FT                   /translation="MTDKRKDGSGKLLYCSFCGKSQHEVRKLIAGPSVYICDECVDLCN
FT                   DIIREEIKEVAPHRERSALPTPHEIRTHLDDYVIGQEQAKKVLAVAVYNHYKRLRNGDT
FT                   SNGVELGKSNILLIGPTGSGKTLLAETLARLLDVPFTMADATTLTEAGYVGEDVENIIQ
FT                   KLLQKCDYDVQKAQRGIVYIDEIDKISRKSDNPSITRDVSGEGVQQALLKLIEGTVAAV
FT                   PPQGGRKHPQQEFLQVDTSKILFICGGAFAGLDKVIANRVETGSGIGFGATVKAKSDKA
FT                   SEGELLSQVEPEDLIKFGLIPEFIGRLPVVATLNELSEEALIQILKEPKNALTKQYQAL
FT                   FNLEGVDLEFRDEALDAIARKAMARKTGARGLRSIVEAALLDTMYDLPSMEDVEKVVID
FT                   ESVIAGQSKPLLIYGKPEAQASGE"
FT   gene            552664..555018
FT                   /gene="lon"
FT                   /locus_tag="SeHA_C0553"
FT   CDS_pept        552664..555018
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lon"
FT                   /locus_tag="SeHA_C0553"
FT                   /product="ATP-dependent protease La"
FT                   /EC_number="3.4.21.53"
FT                   /note="identified by match to protein family HMM PF00004;
FT                   match to protein family HMM PF02190; match to protein
FT                   family HMM PF05362; match to protein family HMM PF07728;
FT                   match to protein family HMM TIGR00763"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0553"
FT                   /db_xref="EnsemblGenomes-Tr:ACF69096"
FT                   /protein_id="ACF69096.1"
FT                   /translation="MNPERSERIEIPVLPLRDVVVYPHMVIPLFVGREKSIRCLEAAMD
FT                   HDKKIMLVAQKEASTDEPGVNDLFTVGTVASILQMLKLPDGTVKVLVEGLQRARISALS
FT                   DNGEHFSAKAEYLDSPAIDEREQEVLVRTAISQFEGYIKLNKKIPPEVLTSLNSIDDPA
FT                   RLADTIAAHMPLKLADKQSVLEMSDVNERLEYLMAMMESEIDLLQVEKRIRNRVKKQME
FT                   KSQREYYLNEQMKAIQKELGEMDDAPDENEALKRKIDAAKMPKEAKEKAEAELQKLKMM
FT                   SPMSAEATVVRGYIDWMVQVPWNARSKVKKDLRQAQEILDTDHYGLERVKDRILEYLAV
FT                   QSRVNKIKGPILCLVGPPGVGKTSLGQSIAKATGRKYIRMALGGVRDEAEIRGHRRTYI
FT                   GSMPGKLIQKMAKVGVKNPLFLLDEIDKMSSDMRGDPASALLEVLDPEQNVAFSDHYLE
FT                   VDYDLSDVMFVATSNSMNIPAPLLDRMEVIRLSGYTEDEKLNIAKRHLLPKQIERNALK
FT                   KGELTVDDSAIIGIIRYYTREAGVRSLEREISKLCRKAVKQLLLDKSLKHIEINGDNLH
FT                   DYLGVQRFDYGRADSENRVGQVTGLAWTEVGGDLLTIETACVPGKGKLTYTGSLGEVMQ
FT                   ESIQAALTVVRARAEKLGINPDFYEKRDIHVHVPEGATPKDGPSAGIAMCTALVSCLTG
FT                   NPVRADVAMTGEITLRGQVLPIGGLKEKLLAAHRGGIKTVLIPFENKRDLEEIPDNVIA
FT                   DLDIHPVKRIEEVLTLALQNEPSGMQVVTAK"
FT   gene            555227..555499
FT                   /gene="hupB"
FT                   /locus_tag="SeHA_C0554"
FT   CDS_pept        555227..555499
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hupB"
FT                   /locus_tag="SeHA_C0554"
FT                   /product="DNA-binding protein HU-beta"
FT                   /note="identified by match to protein family HMM PF00216"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0554"
FT                   /db_xref="EnsemblGenomes-Tr:ACF67582"
FT                   /protein_id="ACF67582.1"
FT                   /translation="MNKSQLIEKIAAGADISKAAAGRALDAIIASVTESLKEGDDVALV
FT                   GFGTFAVKERAARTGRNPQTGKEITIAAAKVPSFRAGKALKDAVN"
FT   gene            555790..557661
FT                   /gene="ppiD"
FT                   /locus_tag="SeHA_C0555"
FT   CDS_pept        555790..557661
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ppiD"
FT                   /locus_tag="SeHA_C0555"
FT                   /product="peptidylprolyl isomerase"
FT                   /EC_number="5.2.1.8"
FT                   /note="identified by match to protein family HMM PF00639"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0555"
FT                   /db_xref="EnsemblGenomes-Tr:ACF67272"
FT                   /protein_id="ACF67272.1"
FT                   /translation="MMDSLRTAANSLVLKIIFVIIIVSFILTGVSGYLIGGSNNYAAKV
FT                   NGQEISRAQFENAFNNERNRMQQQLGDRYSELAANEGYMKSLRQQVLNRLIDEALLDQY
FT                   SRELKLGISDEQVKQAIFATPAFQVDGKFDNNRYNAIVNQMGMTADQYAQALRNQLTTQ
FT                   QLINGVAGTDFMLKGETDELAALVSQQRVVREAVIDVNALAAKQQVTDQEVSSYYDQNK
FT                   VRFMTPEQFRVSYIKLDAATMQAPVSDADIQAYYDQHVDQFTQPERIRYSIIQTKTEDD
FT                   AKAVLDALNKGEDFATLAKEKSTDIISARNGGDMGWLEESATVPELKNAGLKEKGQISG
FT                   VIKSSVGFLVARLDDIQPAKVKPLSEVRDDIAAKVKQEKALDAYYALQQKVSDAASNDN
FT                   ESLAGAEQVAGVKAVETGWFSRDTLPEELNFKPVADAIFNGGLVGENGTPGPNSDIITV
FT                   DGDRAFVVRVSEHKPEAVKPLAEVKEQVTALVKHNKAEQQAKLDAEKLLVELKAGKGAE
FT                   AMKAAGLSFGEPKTLSRTSQDPVSQAAFALSLPTKDKPVYGVANDMQGNVVLLAFDEVK
FT                   AGAMPEAQKKAMVQGITQNNAQIVFEALMSNLRKEAKIKIGDALEQQ"
FT   gene            557811..558185
FT                   /locus_tag="SeHA_C0556"
FT   CDS_pept        557811..558185
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0556"
FT                   /product="competence protein ComEA"
FT                   /note="identified by match to protein family HMM TIGR00426"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0556"
FT                   /db_xref="EnsemblGenomes-Tr:ACF67811"
FT                   /protein_id="ACF67811.1"
FT                   /translation="MKHGIKALLITLSLTCAGMAHSALAATPVAKNAAVETKADTPSSS
FT                   SAKAALPAKASDDEGTRVSINTASAEDLARVMNGVGLKKAQAIVSYREEYGPFKTVDDL
FT                   KQVPGMGNALVERNLAVLTL"
FT   gene            558289..558687
FT                   /locus_tag="SeHA_C0557"
FT   CDS_pept        558289..558687
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0557"
FT                   /product="thioesterase superfamily protein"
FT                   /note="identified by match to protein family HMM PF03061;
FT                   match to protein family HMM TIGR00051"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0557"
FT                   /db_xref="EnsemblGenomes-Tr:ACF66947"
FT                   /protein_id="ACF66947.1"
FT                   /translation="MQTQIKVRGYHLDVYQHVNNARYLEFLEEARWDGLENSDSFQWMT
FT                   ARNIAFVVVNININYRRPAVLSDLLTVTSQVQQLNGKSGVLSQTITLEPEGQVVADALI
FT                   TFVCIDLKTQKALPLEGELREKLEQMVQ"
FT   gene            complement(558793..559488)
FT                   /locus_tag="SeHA_C0558"
FT   CDS_pept        complement(558793..559488)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0558"
FT                   /product="ExsB protein"
FT                   /note="identified by match to protein family HMM PF06508;
FT                   match to protein family HMM TIGR00364"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0558"
FT                   /db_xref="EnsemblGenomes-Tr:ACF66266"
FT                   /db_xref="GOA:B4T9F0"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR018317"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4T9F0"
FT                   /protein_id="ACF66266.1"
FT                   /translation="MKRAVVVFSGGQDSTTCLAQARHQYDEVHCVTFDYGQRHRAEIDV
FT                   ARALALKLGTRAHKVLDVTLLNELAVSSLTRDSIPVPDYEPNADGIPNTFVPGRNILFL
FT                   TLAAIYAYQVKAEAVITGVCETDFSGYPDCRDEFVKALNHAVNLGMAKDIRFETPLMWI
FT                   DKAETWALADYWGQLDLVREETLTCYNGIKGDGCGHCAACNLRANGLNHYLSNKAAVMA
FT                   AMKQKTGLR"
FT   gene            complement(559553..561253)
FT                   /locus_tag="SeHA_C0559"
FT   CDS_pept        complement(559553..561253)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0559"
FT                   /product="bacterial extracellular solute-binding protein,
FT                   family 5"
FT                   /note="identified by match to protein family HMM PF00496"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0559"
FT                   /db_xref="EnsemblGenomes-Tr:ACF70274"
FT                   /protein_id="ACF70274.1"
FT                   /translation="MRLLNRLNQYQRLWQPSAGETQHVTVSELAERCFCSERHLRTLLR
FT                   QAQQAGWLRWEAQSGRGKRGRLQFLVTPESLRTAMMEQALEKGQQLNVLELAQLAPGEL
FT                   RAMLQPFMGGQWQNDTPTLRIPYYRPLDPLQPGFLPGRAEQHLAGQVFSGLTRFDRDSQ
FT                   YPCGDLAHHWEVSADGLRWDFYIRSTLHWHNGDAVDTAQLHERLERLLTLPALSKLFIS
FT                   VARIEVTHPQCLTFLLHRPDYWLAHRLASYCSGLAHPDLPLIGTGPFRLALFTPELVRL
FT                   ESHDHYHLSHPLLKAIEFWITPQLFAQDLGTSCRHPVQIAIGKPEELATLSQVSSGISL
FT                   GFCYLTLKKGSRLNVQQARRLIHIIHHTSLLKTLPVDENLIMPSQGLLPGWTIPQWQDV
FT                   DETPLPKKLTLAYHLPVELHTMAEQLRHYLATLGCELTLIFHNAKNWDNCPALAQADLM
FT                   MGDRLIGEAPEYTLEQWLRCDQIWSHVLDAPAFSHLQATLDALQIQPNEKDRRAALQQV
FT                   FANLMDDATLTPLFNYHYRISAPPGVNGVRLTPRGWFEFSEAWLPPPSP"
FT   gene            561354..562172
FT                   /locus_tag="SeHA_C0560"
FT   CDS_pept        561354..562172
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0560"
FT                   /product="protein cof"
FT                   /note="identified by match to protein family HMM PF00702;
FT                   match to protein family HMM PF05116; match to protein
FT                   family HMM PF08282; match to protein family HMM TIGR00099;
FT                   match to protein family HMM TIGR01484"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0560"
FT                   /db_xref="EnsemblGenomes-Tr:ACF69491"
FT                   /db_xref="GOA:B4T9F2"
FT                   /db_xref="InterPro:IPR000150"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023938"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4T9F2"
FT                   /protein_id="ACF69491.1"
FT                   /translation="MARLAAFDMDGTLLMPDHHLGRETIATLARLRERDITLTFATGRH
FT                   VLEMRHILGTLSLDAYLITGNGTRIHSLEGDVLHRQDLDPQVADTVMHHAWDTRASMHV
FT                   FNDNGWFTGQEIPALLQAHVYSGFRYQVIDIKSIPAHQVTKICFCGDHDDLIRLRIQLN
FT                   EALEERAHLCFSAVDCLEVLPLGCNKGSALAVLSNHLGLSLADCMAFGDAMNDREMLGS
FT                   VGRGLIMGNAMPQLIAALPHLSVIGHCGNQAVSHFLTHWLDNPHLPYSPE"
FT   gene            complement(562222..563277)
FT                   /locus_tag="SeHA_C0561"
FT   CDS_pept        complement(562222..563277)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0561"
FT                   /product="pyridoxal-5'-phosphate-dependent enzyme, beta
FT                   subunit"
FT                   /note="identified by match to protein family HMM PF00291"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0561"
FT                   /db_xref="EnsemblGenomes-Tr:ACF68998"
FT                   /protein_id="ACF68998.1"
FT                   /translation="MMSSNWVKNAINEINADHQRSADTHLIRLPLSAFPGIQLYLKDES
FT                   THPTGSLKHRLARSLFLYGLCNGWIKEGTPIIEASSGSTAISEAWFARLLGLPFIAVMP
FT                   ACTAKRKIEQIQFYGGHCHFVESACEIYAASERLAHELNGHYMDQFTYAERATDWRGNN
FT                   NIADSIFRQMRNELHPVPRFIVMSAGTGGTSATIGRYIRCQGYDTQLMVVDPENSVFLP
FT                   YWQDRDASLRSPVGSKIEGIGRPRVEPSFIPDVVDEMLRVPDAASVATAHWLETQLGRK
FT                   VGASTGTNMWGALQLAARMREAGETGAIVTLLCDSGDRYLDTYYHPAWVSDHIGDLTPW
FT                   SAAIAKLLTGD"
FT   gene            563390..563848
FT                   /locus_tag="SeHA_C0562"
FT   CDS_pept        563390..563848
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0562"
FT                   /product="glutamate uptake regulatory protein"
FT                   /note="identified by match to protein family HMM PF01037"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0562"
FT                   /db_xref="EnsemblGenomes-Tr:ACF68192"
FT                   /protein_id="ACF68192.1"
FT                   /translation="MLDKIDRKLLCLLQQDCTLSLQALADAVNLTTTPCWKRLKRLEDD
FT                   GILLGRVALLDPEKLGLGLTAFVLIKTQHHSSEWYCRFVTVVSEMPEVLGFWRMAGEYD
FT                   YLMRVQVADMKRYDDFYKRLVNSVPGLSDVTSSFAMEQIKYTTSLPIE"
FT   gene            563889..565661
FT                   /locus_tag="SeHA_C0563"
FT   CDS_pept        563889..565661
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0563"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005;
FT                   match to protein family HMM PF00664"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0563"
FT                   /db_xref="EnsemblGenomes-Tr:ACF67144"
FT                   /protein_id="ACF67144.1"
FT                   /translation="MRLFAQLSWYFRREWRRYLGAVALLMLIAMLQLIPPKVVGIVVDG
FT                   VTAQQFTPGRIAMWIGTIALIAVVVYLLRYVWRVLLFGASYQLAVELREDYYRQLSRQH
FT                   PEFYQRHRTGDLIARATNDVDRVVFAAGEGVLTLVDSLVMGCAVLIVMSTQISWQLTLL
FT                   ALLPMPIMALMIKRYGDRLHDYFKLAQAAFSSLNDRTQESLTSIRMIKAFGLEDRQSSL
FT                   FAADAEDTGKKNMRVARIDARFDPTIYIAIGMANLLAISGGSWMVVNGSLTLGELTSFM
FT                   MYLGLMIWPMLALAWMFNIVERGSAAYSRIRAMLAEAPVVKDGEEPVPAGRGELTAAIR
FT                   EFCYPQTTHPALENVNFRLKPGQMLGICGPTGAGKSTILSLIQRHFDVTQGEIRFHDMP
FT                   LTHLQLDSWRSRLAVVSQTPFLFSDSIANNIALGRPEATQEEIEQVARLASVHEDILRL
FT                   PQGYDTQVGERGVMLSGGQKQRISIARALLLNAEILLLDDALSAVDGRTEHQILHNLRQ
FT                   WGEGRTVIISAHRLSALTDANEIIVMQHGHVVQRGDHDQLAQQIGWYRDMYRYQQLEAA
FT                   LDDAPERGEEAVNA"
FT   gene            565654..567435
FT                   /locus_tag="SeHA_C0564"
FT   CDS_pept        565654..567435
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0564"
FT                   /product="ABC-type multidrug transporter, ATP-binding
FT                   protein"
FT                   /note="identified by match to protein family HMM PF00005;
FT                   match to protein family HMM PF00664"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0564"
FT                   /db_xref="EnsemblGenomes-Tr:ACF67575"
FT                   /protein_id="ACF67575.1"
FT                   /translation="MRSFGQLWPTLKRLLAYGSPWRKPLSVAVMMLWIAAAAEVSGPLL
FT                   ISYFIDNMVARHHLPLGKVAGLAAAYVGLQFLAAGLHYAQSLLFNRAAVGVVQSLRTDV
FT                   MDAALRQPLSAFDTQPVGQLISRVTNDTEVIRDLYVTVVATVLRSAALIGAMLVAMFSL
FT                   DWRMALVAILIFPAVLTVMIIYQRYSTPIVRRVRAYLADINDGFNEIINGMSVIQQFRQ
FT                   QARFGERMGEASRSHYMARMQTLRLDGFLLRPLLSLFSALILCGLLMLFSFTSAGTIEV
FT                   GVLYAFISYLSRLNEPLIELTTQQSMLQQAVVAGERVFELMDRPRQRYGSDDRPLQSGA
FT                   IDIDHLSFAYRDDNLVLQDITLSVPSRSFVALVGHTGSGKSTLASLLMGYYPLTQGEIR
FT                   LDGREIASLNHRVLRQGVAMVQQDPVVMADTFLANVTLGRDVSEAQVWQALETVQLADL
FT                   ARGLSDGLHTHLGEQGNTLSVGQKQLLALARVLVDAPQILILDEATASIDSGTEQAIQQ
FT                   ALAAIRERTTLVVIAHRLSTIVEADTILVLHRGQAVERGTHQQLLAAQGRYWQMYQLQL
FT                   VGEELAASVHEEPGPAA"
FT   gene            567648..567986
FT                   /locus_tag="SeHA_C0565"
FT   CDS_pept        567648..567986
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0565"
FT                   /product="nitrogen regulatory protein P-II"
FT                   /note="identified by match to protein family HMM PF00543"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0565"
FT                   /db_xref="EnsemblGenomes-Tr:ACF66755"
FT                   /protein_id="ACF66755.1"
FT                   /translation="MKLVTVIIKPFKLEDVREALSSIGIQGLTVTEVKGFGRQKGHAEL
FT                   YRGAEYSVNFLPKVKIDVAIADDQLEEVIDIISKAAYTGKIGDGKIFVAELMRVIRIRT
FT                   GEADEAAL"
FT   gene            568018..569304
FT                   /gene="amt"
FT                   /locus_tag="SeHA_C0566"
FT   CDS_pept        568018..569304
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="amt"
FT                   /locus_tag="SeHA_C0566"
FT                   /product="ammonium transporter"
FT                   /note="identified by match to protein family HMM PF00909;
FT                   match to protein family HMM TIGR00836"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0566"
FT                   /db_xref="EnsemblGenomes-Tr:ACF66214"
FT                   /protein_id="ACF66214.1"
FT                   /translation="MKIAMIKTTLASLALLPGLTIAAPAVADKADSAFMMICTALVLFM
FT                   TIPGIALFYGGLIRAKNVLSMLTQVTVTFALVCILWVVYGYSLAFGEGNHFFGNADGAM
FT                   LKNIALTAVTGTIYQYIHVAFQGSFACITVGLIVGALAERIRFSAVLIFVVVWFTLSYI
FT                   PIAHMVWGGGLLAAHGALDFAGGTVVHINAAIAGLVGAYLIGKRVGFGKEAFKPHNLPM
FT                   VFTGTAILYIGWFGFNAGSAGSANEIAALAFVNTVVATAAAILGWIIGEWTLRGKPSLL
FT                   GACSGAIAGLVGVTPACGYVGVGGALVIGVIAGLAGLWGVTMLKRLLRVDDPCDVFGVH
FT                   GVCGIVGCILTGVFAASSLGGVGFVDGVTMGHQVMVQLESIAITVVWSGVVAFVGYKLA
FT                   DILVGLRVPEEQEREGLDVNSHGENAYNA"
FT   gene            complement(569404..570264)
FT                   /gene="tesB"
FT                   /locus_tag="SeHA_C0567"
FT   CDS_pept        complement(569404..570264)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tesB"
FT                   /locus_tag="SeHA_C0567"
FT                   /product="acyl-CoA thioesterase II"
FT                   /EC_number="3.1.2.-"
FT                   /note="identified by match to protein family HMM PF02551;
FT                   match to protein family HMM TIGR00189"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0567"
FT                   /db_xref="EnsemblGenomes-Tr:ACF68657"
FT                   /protein_id="ACF68657.1"
FT                   /translation="MSQTLNNLLTLLNLEKIEEGLFRGQSEDLGLRQVFGGQVVGQALY
FT                   AAKETVPEARLVHSFHSYFLRPGDSQKPIIYDVEVLRDGNSFSARRVAAIQNGKPIFYM
FT                   TASFQAPEPGFEHQKTMPTVVGPEGLPSETEIAQSLAHLLPPILKEKFLCDRPLEIRPV
FT                   EFHNPLKGHVAAPVRQVWIRANGTVPDDIRVHQYLLGYASDLNFLPVALQPHGIGFLEK
FT                   GIQIATIDHSMWFHRPFNFNEWLLYSVESTSASSARGFVRGEFYTQDGALVASTVQEGV
FT                   MRNHN"
FT   gene            570479..571048
FT                   /locus_tag="SeHA_C0568"
FT   CDS_pept        570479..571048
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0568"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0568"
FT                   /db_xref="EnsemblGenomes-Tr:ACF70343"
FT                   /protein_id="ACF70343.1"
FT                   /translation="MKLVHIVSGLAVAISLAACADKSADIQTPAPNPNMSITANQSTIQ
FT                   QPNVSGTVWIRQKVALPPDAVLTVTLSDASLADAPSKVLSQKAVRTEGKQAPFSFVLPF
FT                   NPSDIQPNARILLSAAITVDNKLVFITDSVKPVINNGGTKADLTLVPVQQTAVPVQASG
FT                   GATTTVPSTSPTQVNSSSAVPAPTQY"
FT   gene            complement(571081..571470)
FT                   /locus_tag="SeHA_C0569"
FT   CDS_pept        complement(571081..571470)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0569"
FT                   /product="methylated-DNA-[protein]-cysteine
FT                   S-methyltransferase"
FT                   /EC_number="2.1.1.63"
FT                   /note="identified by match to protein family HMM PF01035;
FT                   match to protein family HMM TIGR00589"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0569"
FT                   /db_xref="EnsemblGenomes-Tr:ACF70269"
FT                   /protein_id="ACF70269.1"
FT                   /translation="MLVSCASGLSSPLIPDYPEALTQDSIMDIQDTFPQRVWQIVASIP
FT                   EGFVTTYGDVARLAGSPRAARQVGGVLKRLPEGSTLPWHRVVNRHGAISLTGPDLQRQR
FT                   QALLAEGVVVSGSGQIDLQRYRWVY"
FT   gene            571555..571652
FT                   /gene="srpB"
FT                   /locus_tag="SeHA_C0570"
FT   ncRNA           571555..571652
FT                   /gene="srpB"
FT                   /locus_tag="SeHA_C0570"
FT                   /product="Bacterial signal recognition particle RNA"
FT                   /ncRNA_class="SRP_RNA"
FT   gene            complement(571701..573251)
FT                   /locus_tag="SeHA_C0571"
FT   CDS_pept        complement(571701..573251)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0571"
FT                   /product="cyclic diguanylate phosphodiesterase (EAL) domain
FT                   protein"
FT                   /note="identified by match to protein family HMM PF00563"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0571"
FT                   /db_xref="EnsemblGenomes-Tr:ACF69767"
FT                   /protein_id="ACF69767.1"
FT                   /translation="MTTRHLVSLVTGVLILSVLFPIGLSLWLAHRQVEKRFNEELDIFS
FT                   SRVALRTERVSDQAKAALTHIASFKGEPCSSAHLLAMRRVSYSFRYVQEVLYLKNSIPV
FT                   CSSLEKESHIPAFPPPMKITRDGYRAWFTAQNDLGIKRYMAALGSDSYIVMIDPASFID
FT                   VIPFGAWPIDVAIIGRERNTVVASSGNLDPAILPLIHHETPLRLENRGIQYAIHPFPEM
FT                   GITIVSWAPTAPLERSWYRQAFIWLPAGIVTGLLAAAFILRILRRLQSPRHRLQDAIDN
FT                   REINVHYQPIVSLSSGKIVGAEALARWQQADGTFLSPEIFIALAEQTGLTEPLTRLIID
FT                   TVFEDMGSWLKSHPEQHISINLEASDLASETLPTLLSTLLNRSQISPSQIALELTEREF
FT                   ADPKTSAPIVARYRNAGHSIYIDDFGTGYSSLSYLQNLDVDVLKIDKSFVDALEYKNVT
FT                   PHIIEMAKTLKLKMVAEGIETARQEQWLRQHGVHYGQGWLYSKPLPATAFILWAEQRL"
FT   gene            573476..573736
FT                   /gene="rpmE"
FT                   /locus_tag="SeHA_C0572"
FT   CDS_pept        573476..573736
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmE"
FT                   /locus_tag="SeHA_C0572"
FT                   /product="ribosomal protein L31"
FT                   /note="identified by match to protein family HMM PF01197;
FT                   match to protein family HMM TIGR00105"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0572"
FT                   /db_xref="EnsemblGenomes-Tr:ACF65999"
FT                   /db_xref="GOA:B4T9G3"
FT                   /db_xref="InterPro:IPR002150"
FT                   /db_xref="InterPro:IPR027493"
FT                   /db_xref="InterPro:IPR034704"
FT                   /db_xref="InterPro:IPR042105"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4T9G3"
FT                   /protein_id="ACF65999.1"
FT                   /translation="MKPDIHPVYRTVVFHDTSANEYVKVGSTIKTEREIELDGVTYPYV
FT                   TIDVSSKSHPFYTGRQKTFDSESSAARFQKRFGHFIGAKRG"
FT   gene            573742..573882
FT                   /gene="rpmJ"
FT                   /locus_tag="SeHA_C0573"
FT   CDS_pept        573742..573882
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmJ"
FT                   /locus_tag="SeHA_C0573"
FT                   /product="ribosomal protein L36"
FT                   /note="identified by match to protein family HMM TIGR01022"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0573"
FT                   /db_xref="EnsemblGenomes-Tr:ACF67846"
FT                   /db_xref="GOA:B4T9G4"
FT                   /db_xref="InterPro:IPR000473"
FT                   /db_xref="InterPro:IPR035977"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4T9G4"
FT                   /protein_id="ACF67846.1"
FT                   /translation="MQVLNSLRNAKQRHPDCQIVKRKGRLYVICKTNPRFKAVQGRKKR
FT                   R"
FT   gene            complement(573938..574408)
FT                   /locus_tag="SeHA_C0574"
FT   CDS_pept        complement(573938..574408)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0574"
FT                   /product="inner membrane protein YlaC"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0574"
FT                   /db_xref="EnsemblGenomes-Tr:ACF68793"
FT                   /protein_id="ACF68793.1"
FT                   /translation="MTEIQRLLSETIDDLNIREKRDNRPRFSISFIRKHPGLFIAMYAA
FT                   WFATLAVMLQSETLVGSVWLLVVLFIAFNGFFFFDIAPRYHYNDIDVLDLRVCYNGEWY
FT                   NTRFVPPTLIETILQSPQVDNEHKVQLQKMVARKGELSFYDIFTLARAEASR"
FT   gene            complement(574525..575076)
FT                   /locus_tag="SeHA_C0575"
FT   CDS_pept        complement(574525..575076)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0575"
FT                   /product="maltose O-acetyltransferase"
FT                   /EC_number="2.3.1.79"
FT                   /note="identified by match to protein family HMM PF00132"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0575"
FT                   /db_xref="EnsemblGenomes-Tr:ACF68721"
FT                   /protein_id="ACF68721.1"
FT                   /translation="MSDEKQKMIAGALYCPTDETLCQDRLRARQLIHQYNYTTPDEINK
FT                   RQAILRDLLGRCEDAYIEPSFRCDYGYNIFLGHSFYANFDCVMLDVCPIHIGDNCMLAP
FT                   GVHIYTATHPLDAVERNSGRELGKPVTIGNNVWIGGRAVVNPGVTIGDNVVVASGAVVI
FT                   KNVPPDVVVGGNPARIIKKL"
FT   gene            complement(575255..575473)
FT                   /locus_tag="SeHA_C0576"
FT   CDS_pept        complement(575255..575473)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0576"
FT                   /product="haemolysin expression modulating protein"
FT                   /note="identified by match to protein family HMM PF05321"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0576"
FT                   /db_xref="EnsemblGenomes-Tr:ACF70279"
FT                   /protein_id="ACF70279.1"
FT                   /translation="MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYS
FT                   AADHRLAELTMNKLYDKIPSSVWKFIR"
FT   gene            complement(575501..575875)
FT                   /locus_tag="SeHA_C0577"
FT   CDS_pept        complement(575501..575875)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0577"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0577"
FT                   /db_xref="EnsemblGenomes-Tr:ACF69635"
FT                   /protein_id="ACF69635.1"
FT                   /translation="MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVN
FT                   LQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYLDDTFMLFSSYGINTQDLQKWRKSG
FT                   NRLFRCFVNATRANPVSLSC"
FT   gene            complement(576371..579520)
FT                   /locus_tag="SeHA_C0578"
FT   CDS_pept        complement(576371..579520)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0578"
FT                   /product="acriflavine resistance protein B"
FT                   /note="identified by match to protein family HMM PF00873;
FT                   match to protein family HMM TIGR00915"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0578"
FT                   /db_xref="EnsemblGenomes-Tr:ACF67939"
FT                   /protein_id="ACF67939.1"
FT                   /translation="MPNFFIDRPIFAWVIAIIIMLAGGLAILKLPVAQYPTIAPPAVTI
FT                   SATYPGADAKTVQDTVTQVIEQNMNGIDNLMYMSSNSDSTGTVQITLTFESGTDADIAQ
FT                   VQVQNKLQLAMPLLPQEVQQQGVSVEKSSSSFLMVVGVINTDGTMTQEDISDYVAANMK
FT                   DPISRTSGVGDVQLFGSQYAMRIWMNPTELTKYQLTPVDVINAIKAQNAQVAAGQLGGT
FT                   PPVKGQQLNASIIAQTRLTSTDEFGKILLKVNQDGSQVRLRDVAKIELGGENYDVIAKF
FT                   NGQPASGLGIKLATGANALDTATAIRAELKKMEPFFPPGMKIVYPYDTTPFVKISIHEV
FT                   VKTLVEAIILVFLVMYLFLQNFRATLIPTIAVPVVLLGTFAVLAAFGFSINTLTMFGMV
FT                   LAIGLLVDDAIVVVENVERVMTEEGLPPKEATRKSMGQIQGALVGIAMVLSAVFIPMAF
FT                   FGGSTGAIYRQFSITIVSAMALSVLVALILTPALCATMLKPVAKGDHGEGKKGFFGWFN
FT                   RLFDKSTHHYTDSVGNILRSTGRYLLLYLIIVVGMAYLFVRLPSSFLPDEDQGVFLTMV
FT                   QLPAGATQERTQKVLDEVTDYYLNKEKANVESVFAVNGFGFAGRGQNTGIAFVSLKDWA
FT                   DRPGEKNKVEAITQRATAAFSQIKDAMVFAFNLPAIVELGTATGFDFELIDQAGLGHEK
FT                   LTQARNQLFGEVAKYPDLLVGVRPNGLEDTPQFKIDIDQEKAQALGVSISDINTTLGAA
FT                   WGGSYVNDFIDRGRVKKVYVMSEAKYRMLPDDINDWYVRGSDGQMVPFSAFSSSRWEYG
FT                   SPRLERYNGLPSMEILGQAAPGKSTGEAMAMMEELASKLPSGIGYDWTGMSYQERLSGN
FT                   QAPALYAISLIVVFLCLAALYESWSIPFSVMLVVPLGVIGALLAATFRGLTNDVYFQVG
FT                   LLTTIGLSAKNAILIVEFAKDLMDKEGKGLVEATLEAVRMRLRPILMTSLAFMLGVMPL
FT                   VISSGAGSGAQNAVGTGVLGGMVTATVLAIFFVPVFFVVVRRRFSRKSEDIEHSHSTEH
FT                   R"
FT   gene            complement(579543..580736)
FT                   /gene="acrA"
FT                   /locus_tag="SeHA_C0579"
FT   CDS_pept        complement(579543..580736)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="acrA"
FT                   /locus_tag="SeHA_C0579"
FT                   /product="acriflavine resistance protein A"
FT                   /note="identified by match to protein family HMM PF00529;
FT                   match to protein family HMM TIGR01730"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0579"
FT                   /db_xref="EnsemblGenomes-Tr:ACF66392"
FT                   /protein_id="ACF66392.1"
FT                   /translation="MNKNRGLTPLAVVLMLSGSLALTGCDDKQDQQGGQQMPEVGVVTL
FT                   KTEPLQITTELPGRTVAYRIAEVRPQVSGIILKRNFVEGSDIEAGVSLYQIDPATYQAT
FT                   YDSAKGDLAKAQAAANIAELTVKRYQKLLGTQYISKQEYDQALADAQQATAAVVAAKAA
FT                   VETARINLAYTKVTSPISGRIGKSSVTEGALVQNGQASALATVQQLDPIYVDVTQSSND
FT                   FLRLKQELANGSLKQENGKAKVDLVTSDGIKFPQSGTLEFSDVTVDQTTGSITLRAIFP
FT                   NPDHTLLPGMFVRARLQEGTKPTALLVPQQGVTRTPRGDATVLVVGADNKVETRQIVAS
FT                   QAIGDKWLVTDGLKAGDRVVVSGLQKVRPGAQVKVQEITADNKQQAASGDQPAQPRS"
FT   gene            580878..581531
FT                   /gene="acrR"
FT                   /locus_tag="SeHA_C0580"
FT   CDS_pept        580878..581531
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="acrR"
FT                   /locus_tag="SeHA_C0580"
FT                   /product="transcriptional regulator AcrR"
FT                   /note="identified by match to protein family HMM PF00440;
FT                   match to protein family HMM PF08361"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0580"
FT                   /db_xref="EnsemblGenomes-Tr:ACF69212"
FT                   /protein_id="ACF69212.1"
FT                   /translation="MARKTKQQALETRQHILDVALRLFSQQGVSATSLAEIANAAGVTR
FT                   GAIYWHFKNKSDLFSEIWELSESNIGELEIEYQAKFPDDPLSVLREILVHILEATVTEE
FT                   RRRLLMEIIFHKCEFVGEMVVVQQAQRSLCLESYDRIEQTLKHCINAKMLPENLLTRRA
FT                   AILMRSFISGLMENWLFAPQSFDLKKEARAYVTILLEMYQLCPTLRASTVNGSP"
FT   gene            581656..585012
FT                   /locus_tag="SeHA_C0581"
FT   CDS_pept        581656..585012
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0581"
FT                   /product="potassium efflux system KefA"
FT                   /note="identified by match to protein family HMM PF00924"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0581"
FT                   /db_xref="EnsemblGenomes-Tr:ACF67079"
FT                   /protein_id="ACF67079.1"
FT                   /translation="MLQLYKRSQHFVFITISVLIILLSCQSLAFARGQTNGDLPSKADV
FT                   QNQLDTLNKQKDLSAQDKLVQQDLIDTLATLEKIERVKEETVQLRQKVAQAPEKMRQAT
FT                   AALNALSDVDNDDEMRKTLSALSLRQLELRVAQVLDDLQNSQNDLAAYNSQLVSLQTQP
FT                   ERVQNAMYTASQQIQQIRNRLDGNNVGEAALRPSQQVLLQAQQALLNAQIDQQRKSLEG
FT                   NTVLQDTLQKQRDYVTANSNRLEHQLQLLQEAVNSKRLTLTEKTAQEAISPDETARIQA
FT                   NPLVKQELDINHQLSQRLIVATENGNMLMQQNIKVKNWLDRALQSERNIKEQIAVLKGS
FT                   LLLSRILYQQQQTLPSADELEDMTNRIADLRLEQFEINQQRDALFQSDAFVDKLEEGHT
FT                   SEVNDEVHDALLQVVEMRRELLDQLNKQLGNQLMMAINLQVNQQQLMSVSKNLKAILTQ
FT                   QIFWVNSNRPMDWDWLKAFPQTLKEQFSAMKITVNWQKAWPAVFIAFLAGLPLLLIAGL
FT                   IRWRLKWLKAYQQKLAAAVGSLRNDSQLNTPKAILIDLIRALPVCLIILALGLILLTMQ
FT                   LNISDLLWAFSKKLAMFWLVFGLCWKVLEKEGVAIRHFGMPAQLTSHWRRQIVRISLAL
FT                   LPLHFWSVVAELSPLNLMDDVLGQAVIFLNLLVITLLVWPLCRESWRDKESHGIRLVTV
FT                   TILSIIPVALMVLTATGYFYTTLRLAGRWIETVYLVIIWNLLYQTVLRGLSVAARRIAW
FT                   RRALARRQNLVKEGAEGAEPQEEPTIALEQINQQTLRITMLLMLALFGVMFWAIWSDLI
FT                   TVFSYLDSITLWHYNGSEAGAAVVKSVTMGSLLFAIIAAMVAWALIRNLPGLLEVLVLS
FT                   RLNMRQGASYAITTILNYVIIAVGAMTVFGSLGVSWDKLQWLAAALSVGLGFGLQEIFG
FT                   NFVSGLIILFERPVRIGDTVTIGTYSGTVSKIRIRATTITDFDRKEVIIPNKAFVTERL
FT                   INWSLSDTTTRLVIRLGVAYGSDLEKVKRVLLQAAMEHPKVMHDPEPAVFFTTFGASTL
FT                   DHELRLYVRELRDRSHTVDELNRAIDRLCRENDINIAFNQLEVHLHNAKGDEVTEVKRD
FT                   LNGGDLAPTAS"
FT   gene            complement(585054..585557)
FT                   /pseudo
FT                   /locus_tag="SeHA_C0582"
FT                   /note="conserved hypothetical protein; this region contains
FT                   one or more premature stops and/or frameshifts; identified
FT                   by match to protein family HMM TIGR01784"
FT   gene            complement(585659..586114)
FT                   /pseudo
FT                   /locus_tag="SeHA_C0583"
FT                   /note="conserved hypothetical protein; this region contains
FT                   one or more premature stops and/or frameshifts; identified
FT                   by match to protein family HMM PF04754; match to protein
FT                   family HMM TIGR01784"
FT   gene            complement(586184..586351)
FT                   /locus_tag="SeHA_C0584"
FT   CDS_pept        complement(586184..586351)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0584"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0584"
FT                   /db_xref="EnsemblGenomes-Tr:ACF66212"
FT                   /protein_id="ACF66212.1"
FT                   /translation="MSLENAPDEVKLAVDLIVLLEENRLPARTVLRALEIVMRDYENKL
FT                   KSTEDDSQTE"
FT   gene            complement(586365..586880)
FT                   /locus_tag="SeHA_C0585"
FT   CDS_pept        complement(586365..586880)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0585"
FT                   /product="primosomal replication protein N''"
FT                   /note="identified by match to protein family HMM PF07445"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0585"
FT                   /db_xref="EnsemblGenomes-Tr:ACF70272"
FT                   /protein_id="ACF70272.1"
FT                   /translation="MLLQTLEERLATLRQRCAPLAQHATLSARFDRHLFRTRSTLLQGY
FT                   LEEADANLAALRQAVKHEQLPQVAWLAEHLASQLEAISRETAAWSLRQWDTAAPGLGRW
FT                   QRRRIQHQEFERRLLAMTQERKIRLAQATGLVEQQTLQKEVEIYEGRLARCRHALEKIE
FT                   NVLARLTR"
FT   gene            586961..587338
FT                   /locus_tag="SeHA_C0586"
FT   CDS_pept        586961..587338
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0586"
FT                   /product="inner membrane protein YbaN"
FT                   /note="identified by match to protein family HMM PF04304"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0586"
FT                   /db_xref="EnsemblGenomes-Tr:ACF67556"
FT                   /protein_id="ACF67556.1"
FT                   /translation="MQRTILIIIGWLAVVLGTLGVVLPLLPTTPFILLAAWCFARSSPR
FT                   FHAWLLYRSWFGGYLRHWQRYRAMPPGAKPRAIALILLTFGISLWLVNMMWVRVLLLVI
FT                   LACLLIFMWRIPVIDEKQQKR"
FT   gene            587491..588042
FT                   /gene="apt"
FT                   /locus_tag="SeHA_C0587"
FT   CDS_pept        587491..588042
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="apt"
FT                   /locus_tag="SeHA_C0587"
FT                   /product="adenine phosphoribosyltransferase"
FT                   /EC_number="2.4.2.7"
FT                   /note="identified by match to protein family HMM PF00156;
FT                   match to protein family HMM TIGR01090"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0587"
FT                   /db_xref="EnsemblGenomes-Tr:ACF68071"
FT                   /db_xref="GOA:B4T9H6"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005764"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4T9H6"
FT                   /protein_id="ACF68071.1"
FT                   /translation="MTATAQQLEFLKNSIKSIQDYPKPGILFRDVTSLLEDPKAYALSI
FT                   ELLVERYKNAGITKVVGTEARGFLFGAPVALGLGVGFVPVRKPRKLPRETIAETYALEY
FT                   GTDQLEIHVDAIKPGDNVLVVDDLLATGGTIEATVKLIRRLGGKVTDAAFIINLFDLGG
FT                   EQRLEKQGITCYSLVPFPGH"
FT   gene            588156..590084
FT                   /gene="dnaX"
FT                   /locus_tag="SeHA_C0588"
FT   CDS_pept        588156..590084
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaX"
FT                   /locus_tag="SeHA_C0588"
FT                   /product="DNA polymerase III, tau subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="identified by match to protein family HMM PF00004;
FT                   match to protein family HMM TIGR02397"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0588"
FT                   /db_xref="EnsemblGenomes-Tr:ACF69391"
FT                   /protein_id="ACF69391.1"
FT                   /translation="MSYQVLARKWRPQTFADVVGQEHVLTALANGLSLGRIHHAYLFSG
FT                   TRGVGKTSIARLLAKGLNCETGITATPCGVCDNCREIEQGRFVDLIEIDAASRTKVEDT
FT                   RDLLDNVQYAPARGRFKVYLIDEVHMLSRHSFNALLKTLEEPPAHVKFLLATTDPQKLP
FT                   VTILSRCLQFHLKALDVEQIRHQLEHILNEEHIAHEPRALQLLSRAADGSLRDALSLTD
FT                   QAIASGDGQVSTQAVSAMLGTLDDDQALSLVEAVVDANGERVMSLINEAAARGIEWEAL
FT                   LVEMLSLLHRIAMVQLSPAALGSDMAAIEQRMRELARTVPPGDLQLYYQTLLIGRKELP
FT                   WAPDRRMGVEMTLLRALAFHPRMPLPEPETPRQSFAPVTPTAVMTPPQVQQPSAPAPQT
FT                   SPAPLPASTSQVLAARNQLQRAQGVTKTKKSEPAAASRARPVNNSALERLASVSERVQA
FT                   RPAPSALETAPVKKEAYRWKATTPVVQTKEVVATPKALKKALEHEKTPELAAKLAAEAI
FT                   ERDPWAAQVSQLSLPKLVEQVALNAWKEQNGNAVCLHLRSTQRHLNSSGAQQKLAQALS
FT                   DLTGTTVELTIVEDDNPAVRTPLEWRQAIYEEKLAQARESIIADNNIQTLRRFFDAELD
FT                   EESIRPI"
FT   misc_feature    589417..589481
FT                   /gene="dnaX"
FT                   /locus_tag="SeHA_C0588"
FT                   /note="DnaX ribosomal frameshifting element"
FT   gene            590130..590459
FT                   /locus_tag="SeHA_C0590"
FT   CDS_pept        590130..590459
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0590"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF02575;
FT                   match to protein family HMM TIGR00103"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0590"
FT                   /db_xref="EnsemblGenomes-Tr:ACF66664"
FT                   /db_xref="GOA:B4T9H8"
FT                   /db_xref="InterPro:IPR004401"
FT                   /db_xref="InterPro:IPR036894"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4T9H8"
FT                   /protein_id="ACF66664.1"
FT                   /translation="MFGKGGLGNLMKQAQQMQEKMQKMQEEIAQLEVTGESGAGLVKVT
FT                   INGAHNCRRVEIDPSLLEDDKEMLEDLVAAAFNDAARRIEETQKEKMASVSSGMQLPPG
FT                   FKMPF"
FT   gene            590459..591064
FT                   /gene="recR"
FT                   /locus_tag="SeHA_C0591"
FT   CDS_pept        590459..591064
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recR"
FT                   /locus_tag="SeHA_C0591"
FT                   /product="recombination protein RecR"
FT                   /note="identified by match to protein family HMM PF01751;
FT                   match to protein family HMM PF02132; match to protein
FT                   family HMM TIGR00615"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0591"
FT                   /db_xref="EnsemblGenomes-Tr:ACF67294"
FT                   /db_xref="GOA:B4T9H9"
FT                   /db_xref="InterPro:IPR000093"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR015967"
FT                   /db_xref="InterPro:IPR023627"
FT                   /db_xref="InterPro:IPR023628"
FT                   /db_xref="InterPro:IPR034137"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4T9H9"
FT                   /protein_id="ACF67294.1"
FT                   /translation="MQTSPLLTQLMEALRCLPGVGPKSAQRMAFTLLQRDRSGGMRLAQ
FT                   ALTRAMSEIGHCADCRTFTEQDVCNICSNPRRQENGQICVVESPADIYAIEQTGQFSGR
FT                   YFVLMGHLSPLDGIGPDDIGLDRLEQRLASEKISELILATNPTVEGEATANYIAELCAE
FT                   AGVEASRIAHGVPVGGELEMVDGTTLSHSLAGRHKIIF"
FT   gene            591175..593049
FT                   /gene="htpG"
FT                   /locus_tag="SeHA_C0592"
FT   CDS_pept        591175..593049
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="htpG"
FT                   /locus_tag="SeHA_C0592"
FT                   /product="chaperone protein HtpG"
FT                   /note="identified by match to protein family HMM PF00183;
FT                   match to protein family HMM PF02518"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0592"
FT                   /db_xref="EnsemblGenomes-Tr:ACF68826"
FT                   /protein_id="ACF68826.1"
FT                   /translation="MKGQETRGFQSEVKQLLHLMIHSLYSNKEIFLRELISNASDAADK
FT                   LRFRALSNPDLYEGDGELRVRVSFDKDKRTLTIADNGVGMNRDEVIDHLGTIAKSGTKS
FT                   FLESMGSDQAKDSQLIGQFGVGFYSAFIVADKVTVRTRAAGDKPENGVFWESAGEGEYT
FT                   VADITKNDRGTEITLHLREGEDEFLDDWRVRSIISKYSDHIALPVEIEKREEKDGETVI
FT                   SWEKINKAQALWTRNKSEIKDDEYNEFYKHIAHDFTDPLTWSHNRVEGKQEYTSLLYIP
FT                   SQAPWDLWNRDHKHGLKLYVQRVFIMDDAEQFMPNYLRFVRGLIDSNDLPLNVSREILQ
FT                   DSTVTRNLRSALTKRVLQMLEKLAKDDAEKYQTFWKQFGLVLKEGPAEDHANQEAIAKL
FT                   LRFASTHTDSSAQTVSLEDYVSRMKEGQEKIYYITADSYAAAKNSPHLELLRKKGIEVL
FT                   LLSDRIDEWMMNYLTEFDGKAFQSVAKADESIEKLADEVDENAKEAEKALEPFVERVKT
FT                   LLGDRVKDVRLTHRLTDTPAIVTTDADEMSTQMAKLFAAAGQSVPEVKYIFELNPDHVL
FT                   VKRTADTKDEAQFKEWVELLLDQALFAERGTLEDPNQFIRRMNQLLVS"
FT   gene            593290..593934
FT                   /gene="adk"
FT                   /locus_tag="SeHA_C0593"
FT   CDS_pept        593290..593934
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="adk"
FT                   /locus_tag="SeHA_C0593"
FT                   /product="adenylate kinase"
FT                   /EC_number="2.7.4.3"
FT                   /note="identified by match to protein family HMM PF00406;
FT                   match to protein family HMM PF05191; match to protein
FT                   family HMM TIGR01351"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0593"
FT                   /db_xref="EnsemblGenomes-Tr:ACF65967"
FT                   /db_xref="GOA:B4T9I1"
FT                   /db_xref="InterPro:IPR000850"
FT                   /db_xref="InterPro:IPR006259"
FT                   /db_xref="InterPro:IPR007862"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033690"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4T9I1"
FT                   /protein_id="ACF65967.1"
FT                   /translation="MRIILLGAPGAGKGTQAQFIMEKYGIPQISTGDMLRAAVKSGSEL
FT                   GKQAKDIMDAGKLVTDELVIALVKERIAQEDCRNGFLLDGFPRTIPQADAMKEAGIVVD
FT                   YVLEFDVPDELIVDRIVGRRVHAASGRVYHVKFNPPKVEGKDDVTGEDLTTRKDDQEET
FT                   VRKRLVEYHQMTAPLIGYYQKEAEAGNTKYAKVDGTQAVADVRAALEKILG"
FT   gene            594013..594153
FT                   /locus_tag="SeHA_C0594"
FT   CDS_pept        594013..594153
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0594"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0594"
FT                   /db_xref="EnsemblGenomes-Tr:ACF67527"
FT                   /protein_id="ACF67527.1"
FT                   /translation="MPDGGLNALSGLLASLAPFGKFSSYLSQQLVLLYRFSATIINNLN
FT                   R"
FT   gene            594163..595125
FT                   /gene="hemH"
FT                   /locus_tag="SeHA_C0595"
FT   CDS_pept        594163..595125
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemH"
FT                   /locus_tag="SeHA_C0595"
FT                   /product="ferrochelatase"
FT                   /EC_number="4.99.1.1"
FT                   /note="identified by match to protein family HMM PF00762;
FT                   match to protein family HMM TIGR00109"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0595"
FT                   /db_xref="EnsemblGenomes-Tr:ACF66182"
FT                   /db_xref="GOA:B4T9I3"
FT                   /db_xref="InterPro:IPR001015"
FT                   /db_xref="InterPro:IPR019772"
FT                   /db_xref="InterPro:IPR033644"
FT                   /db_xref="InterPro:IPR033659"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4T9I3"
FT                   /protein_id="ACF66182.1"
FT                   /translation="MRQTKTGILLANLGTPDAPTPEAVKRYLKQFLSDRRVVDTPRLLW
FT                   WPLLRGVILPLRSPRVAKLYQSIWMDGGSPLMVYSREQQQALAARLPDTPVALGMSYGS
FT                   PSLESAVDELLASDVDHIVVLPLYPQYSCSTVGAVWDELGRILARKRRIPGISFIRDYA
FT                   DDGAYIDALAKSARESFARHGEPDVLLLSYHGIPQRYADEGDDYPQRCRDTTRELVSAL
FT                   GLPPEKVMMTFQSRFGREPWLTPYTDETLKMLGEKGTGHIQVMCPGFAADCLETLEEIA
FT                   EQNREIFLEAGGKKYAYIPALNATPEHIDMMLKLTAPYR"
FT   gene            complement(595122..596092)
FT                   /pseudo
FT                   /locus_tag="SeHA_C0596"
FT                   /note="acetyl esterase (EcE); this gene contains a frame
FT                   shift which may be the result of sequencing error;
FT                   identified by match to protein family HMM PF07859"
FT   gene            596245..597549
FT                   /gene="gsk"
FT                   /locus_tag="SeHA_C0598"
FT   CDS_pept        596245..597549
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gsk"
FT                   /locus_tag="SeHA_C0598"
FT                   /product="inosine kinase"
FT                   /EC_number="2.7.1.73"
FT                   /note="identified by match to protein family HMM PF00294"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0598"
FT                   /db_xref="EnsemblGenomes-Tr:ACF69524"
FT                   /protein_id="ACF69524.1"
FT                   /translation="MKFPGKRKSKHYFPVNARDPLLQQIQPEQETNASWVVGIDQTLVD
FT                   IEAKVDDDFITRYGLSAGHSLVIEDEVAEKLYQELTRENLITHQFAGGTIGNTMHNYSV
FT                   LADDRSVLLGVMCSNIEIGSYAYRYLCNTSSRTDLNYLQAVDGPIGRCFTLIGESGERT
FT                   FAISPGHMNQLRAESIPEAVIAGASALVLTSYLVRCKPGEPMPDATMKAIEYAKKHNVP
FT                   VVMTLGTKFVIADNPQWWQAFLKENVSILAMNEEEAEALTGENDPLLAADKALDWVDLV
FT                   LCTAGPIGLYMAGFTEEEAKRKTQHPLLPGAIAEFNQYEFSRAMRHKDCINPLRVYSHI
FT                   APYMGGPEKIMNTNGAGDGALAALLHDITANSYHRSNVPNSSKHKFTWLTYSSLAQVCK
FT                   YANRVSYQVLNQHSPRLTRGLPEREDSLEESYWDR"
FT   gene            complement(597598..599274)
FT                   /locus_tag="SeHA_C0599"
FT   CDS_pept        complement(597598..599274)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0599"
FT                   /product="inner membrane protein YbaL"
FT                   /note="identified by match to protein family HMM PF00999;
FT                   match to protein family HMM PF02254; match to protein
FT                   family HMM TIGR00932"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0599"
FT                   /db_xref="EnsemblGenomes-Tr:ACF65918"
FT                   /protein_id="ACF65918.1"
FT                   /translation="MHHATPLITTIVGGLVLAFILGMIANKLRISPLVGYLLAGVLAGP
FT                   FTPGFVADTKLAPELAELGVILLMFGVGLHFSLKDLMAVKSIAIPGAVAQIAVATLLGM
FT                   ALSAVLGWSLMTGIVFGLCLSTASTVVLLRALEERQLLDSQRGQIAIGWLIVEDLVMVL
FT                   TLVLLPAVAGMVEKGDVGIASLTVDMGITIGKVVAFIAIMMLVGRRLVPWIMARSAATG
FT                   SRELFTLSVLALALGIAFGAVELFDVSFALGAFFAGMVLNESELSHRAAHDTLPLRDAF
FT                   AVLFFVSVGMLFDPLVLIQQPLAVLATLAIIVFGKSIAAFFLVRMFGHSPRTALTIAAS
FT                   LAQIGEFAFILAGLGMALNLLPQAGQNLVLAGAILSIMLNPVLFTLLEKYLAKTETLEE
FT                   QTLEEAIEEEKQIPVDICNHALLVGFGRVGSLLGEKLLAAGIPLVVIETSRTRVDELRE
FT                   RGIRAVLGNAANEEIMNLAHLDCARWLLLTIPNGYEAGEIVASAREKSPDIEIIARAHY
FT                   DDEVKYITERGANQVVMGEREIARAMLELLETPPAGEVVAS"
FT   gene            complement(599489..600709)
FT                   /gene="fsr"
FT                   /locus_tag="SeHA_C0600"
FT   CDS_pept        complement(599489..600709)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fsr"
FT                   /locus_tag="SeHA_C0600"
FT                   /product="fosmidomycin resistance protein"
FT                   /note="identified by match to protein family HMM PF07690"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0600"
FT                   /db_xref="EnsemblGenomes-Tr:ACF66650"
FT                   /protein_id="ACF66650.1"
FT                   /translation="MAMSEPTQPLAGAPAAAAKARTSFGILGAISLSHLLNDMIQSLIL
FT                   AIYPLLQAEFSLTFVQIGLITLTFQLASSLLQPVVGYWTDKYPMPWSLPVGMCFTLSGL
FT                   VLLAMAGSFGGVLLAAALVGTGSSVFHPESSRVARMASGGRHGLAQSIFQVGGNFGSSL
FT                   GPLLAAVIIAPYGKGNVAWFVLAALLAIVVLAQISRWYAAQHRIAKGKPKAIIANPLPR
FT                   NKVVLAVSVLLLLIFSKYFYMASISSYYTFYLMQKFGLSIQNAQLHLFAFLFAVAAGTV
FT                   IGGPVGDKIGRKYVIWGSILGVAPFTLVLPYATLYWTGILTVIIGFILASAFSAILVYA
FT                   QELLPGRIGMVSGLFFGFAFGMGGLGAAVLGLIADHTSIYLVYKICAFLPLLGILTIFL
FT                   PDNRHKA"
FT   gene            600882..602534
FT                   /locus_tag="SeHA_C0601"
FT   CDS_pept        600882..602534
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0601"
FT                   /product="protein UshA"
FT                   /EC_number="3.6.1.45"
FT                   /EC_number="3.1.3.5"
FT                   /note="identified by match to protein family HMM PF00149;
FT                   match to protein family HMM PF02872"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0601"
FT                   /db_xref="EnsemblGenomes-Tr:ACF68168"
FT                   /protein_id="ACF68168.1"
FT                   /translation="MKFLKRGVALALLAAFALTTQPAQAYEKDKTYKITILHTNDHHGH
FT                   FWRSEYGEYGLAAQKTLVDSIRKEVAQEGGSVLLLSGGDINTGVPESDLQDAEPDFRGM
FT                   NLIGYDAMAVGNHEFDNPLTVLRQQEKWAKFPFLSANIYQKSTGERLFKPWAIFTRQDI
FT                   KIAVIGLTTDDTAKIGNPEYFTDIEFRKPAEEAKVVIQELNMNEKPDVIIATTHMGHYD
FT                   NGDHGSNAPGDVEMARSLPAGSLAMIVGGHSQDPVCMASENKKQVNYVPGTPCAPDKQN
FT                   GIWIVQAHEWGKYVGRADFEFRNGEMKMVNYQLIPVNLKKKVTWDNGKSERVLYTPEIA
FT                   ENPQMLSLLTPFQNKGKAQLEVKIGSVNGLLEGDRSKVRFVQTNMGRVILAAQIARTGA
FT                   DFGVMSGGGILDSIEAGDITYKSVLKVQPFGNIVVYADMSGKEVVDYLTAVAQMKPDSG
FT                   AYPQFANVSFVAKEGKLTDLKIKGEPVDPAKTYRMATLSFNATGGDGYPRIDNKPGYVN
FT                   TGFIDAEVLKEFIQQNSPLDAAAFTPNGEVSWL"
FT   gene            complement(602651..603130)
FT                   /gene="ybaK"
FT                   /locus_tag="SeHA_C0602"
FT   CDS_pept        complement(602651..603130)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybaK"
FT                   /locus_tag="SeHA_C0602"
FT                   /product="YbaK/ebsC protein"
FT                   /note="identified by match to protein family HMM PF04073;
FT                   match to protein family HMM TIGR00011"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0602"
FT                   /db_xref="EnsemblGenomes-Tr:ACF67662"
FT                   /protein_id="ACF67662.1"
FT                   /translation="MTPAVKLLEKNKIPFNIHTYDHDPNETNFGDEVVRKLGLNADQVY
FT                   KTLLVAVNGDMKQLAVAVTPVAGQLDLKKVAKALGAKKVDMADPMVAQRTTGYLVGGIS
FT                   PLGQKKRLPTLIDAPARTFATIYVSGGKRGLDIELAADDLAAILGAKFADIARRD"
FT   gene            603254..603333
FT                   /gene="sroB"
FT                   /locus_tag="SeHA_C0603"
FT   ncRNA           603254..603333
FT                   /gene="sroB"
FT                   /locus_tag="SeHA_C0603"
FT                   /product="sroB RNA"
FT                   /ncRNA_class="other"
FT   gene            complement(603332..604126)
FT                   /locus_tag="SeHA_C0604"
FT   CDS_pept        complement(603332..604126)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0604"
FT                   /product="GumN family protein"
FT                   /note="identified by match to protein family HMM PF07446"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0604"
FT                   /db_xref="EnsemblGenomes-Tr:ACF70136"
FT                   /protein_id="ACF70136.1"
FT                   /translation="MELLNQLKRLWRALRGTPNSWPAIDLSLPGGRHLHLVGSIHMGTR
FT                   DMAPLPAKLVKKLRQADALVVEADISGNETPFSNLPKCPPLVERLSAGQLSALEKRVSE
FT                   LGMPLIHFDNQPLWQIAMVLQATQAQRLGLRPDYGIDYQLLQAAREMSLPVQELEGAKH
FT                   QLELLCDLPDGGMALLDDTLTHWHTNARLLQVMIGWWLEQPPTSVGASLPRTFSQPLYD
FT                   VLMVKRNEAWRDALLALPPGRYVVAVGALHLYGEGNLPQILK"
FT   gene            complement(604212..605039)
FT                   /locus_tag="SeHA_C0605"
FT   CDS_pept        complement(604212..605039)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0605"
FT                   /product="putative periplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0605"
FT                   /db_xref="EnsemblGenomes-Tr:ACF69497"
FT                   /protein_id="ACF69497.1"
FT                   /translation="MFRKAVTLLFLLSPAVSYAGLFDSTPELKCGNDNAVTAAKEWIYN
FT                   EALGRLQQDYIKEPSTLFFDIPQTQYEQQLRAIPVQFSDVITQNPQAENANLRTCSATV
FT                   AMGIPQPLFKLMKDLPNTLFYISQGDGQVINNTVTWKQVNYNIQLADNNKDIVVTSVQK
FT                   TDKLARSIYVMARMTVSGDSIIKKKNNSLIEIAAKKFESRDRELNQVWNSLPASARTAL
FT                   KQEQRVWVTQKEQQCGKLSDAKSEAIPAEKRISIYKCQLEMTIARTAYLDSSE"
FT   gene            complement(605193..607694)
FT                   /locus_tag="SeHA_C0606"
FT   CDS_pept        complement(605193..607694)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0606"
FT                   /product="copper-translocating P-type ATPase"
FT                   /EC_number="3.6.3.4"
FT                   /note="identified by match to protein family HMM PF00122;
FT                   match to protein family HMM PF00403; match to protein
FT                   family HMM PF00702; match to protein family HMM TIGR01494;
FT                   match to protein family HMM TIGR01511; match to protein
FT                   family HMM TIGR01525"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0606"
FT                   /db_xref="EnsemblGenomes-Tr:ACF66811"
FT                   /protein_id="ACF66811.1"
FT                   /translation="MSQTIDLTLDGLSCGHCVKRVKESLEQRPDVELADVTVTEAHVTG
FT                   TASADALIETIKQAGYGATLSHPKAKPLTESSIPSEALAAVPHELPVATADEESQQLLL
FT                   SGMSCASCVTRVQHALQSVPGVTQARVNLAERTALVMGSASAADLVQAVEKAGYGAEAI
FT                   EDDIKRRERQQETAIATMKRFRWQAIVALAVGIPVMVWGMIGDNMMVTDDNRSLWLAIG
FT                   LITLAVMVFAGGHFYRNAWKSLLNGTATMDTLVALGTGVAWLYSMSVNLWPQWFPMEAR
FT                   HLYYEASAMIIGLINLGHMLEARARQRSSKALEKLLDLTPPTARVVTEDGEKSVPLADV
FT                   QPGMLLRLTTGDRVPVDGEITQGEAWLDEAMLTGEPIPQQKGEGDSVHAGTVVQDGSVL
FT                   FRASAVGSHTTLSRIIRMVRQAQSSKPEIGQLADKISAVFVPVVVAIALFSAAIWYFFG
FT                   PAPQIVYTLVIATTVLIIACPCALGLATPMSIISGVGRAAEFGVLVRDADALQRASTLD
FT                   TLVFDKTGTLTEGKPQVVAIKTFNGVEEAQALRLAAALEQGSSHPLAHAILEKAGDDKL
FT                   PQVNGFRTLRGLGVSGEAEGHQLLLGNQALLNEQHVATDDMTAEITAQASQGSTPVLLA
FT                   IDGKAAALLAVRDPLRSDSIAALERLHNAGYRLVMLTGDNPTTANAIAKEAGIDEVIAG
FT                   VLPDGKADAIKRLQSQGRQVAMVGDGINDAPALAQADVGIAMGGGSDVAIETAAITLMR
FT                   HSLMGVADALAISRATLRNMKQNLLGAFIYNSIGIPVAAGILWPFTGTLLNPVVAGAAM
FT                   ALSSITVVSNANRLLRFKPKA"
FT   gene            607804..608220
FT                   /gene="cueR"
FT                   /locus_tag="SeHA_C0607"
FT   CDS_pept        607804..608220
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cueR"
FT                   /locus_tag="SeHA_C0607"
FT                   /product="Cu(I)-responsive transcriptional regulator"
FT                   /note="identified by match to protein family HMM PF00376;
FT                   match to protein family HMM PF09278; match to protein
FT                   family HMM TIGR02044"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0607"
FT                   /db_xref="EnsemblGenomes-Tr:ACF66156"
FT                   /protein_id="ACF66156.1"
FT                   /translation="MNISDVAKKTGLTSKAIRFYEEKGLVTPPLRSENGYRTYTQKHLN
FT                   ELTLLRQARQVGFNLEECGELVNLFNDPRRHSADVKKRTLEKVAEIERHISELQSMRDQ
FT                   LLALAESCPGDDSADCPIIDNLSGCCHHKAQKPR"
FT   gene            complement(608221..608673)
FT                   /locus_tag="SeHA_C0608"
FT   CDS_pept        complement(608221..608673)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0608"
FT                   /product="inner membrane protein YbbJ"
FT                   /note="identified by match to protein family HMM PF01957"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0608"
FT                   /db_xref="EnsemblGenomes-Tr:ACF66318"
FT                   /protein_id="ACF66318.1"
FT                   /translation="MIAMILVHPHIFWLSLGGLLLAAEMLGGNGYLLWSGVAAVITGLT
FT                   VWLLPLGWEWQGVLFAALTLLAAWLWWRWLARRVREQKPTDSRLNQRGQQLVGRRFMLD
FT                   AALVNGRGHMRVGDSSWPVCADEDLRAGTHVEVIAVEGITLRIRAV"
FT   gene            complement(608670..609587)
FT                   /locus_tag="SeHA_C0609"
FT   CDS_pept        complement(608670..609587)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0609"
FT                   /product="band 7 protein"
FT                   /note="identified by match to protein family HMM PF01145"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0609"
FT                   /db_xref="EnsemblGenomes-Tr:ACF67978"
FT                   /protein_id="ACF67978.1"
FT                   /translation="MLILIPILIFVALVIVGAGVKIVPQGYQWTVERFGRYTKTLQPGL
FT                   SLVVPFMDRIGRKINMMEQVLDIPSQEVISKDNANVTIDAVCFIQVIDAPRAAYEVSNL
FT                   ELAIINLTMTNIRTVLGSMELDEMLSQRDSINTRLLHIVDEATNPWGIKVTRIEIRDVR
FT                   PPAELISSMNAQMKAERTKRAYILEAEGVRQAEILKAEGEKQSQILKAEGERQSAFLQA
FT                   EARERSAEAEARATQMVSEAIATGDIQAINYFVAQKYTEALQQIGSANNSKVVMMPLDA
FT                   SSLMGAIAGISELVKDSASERKKA"
FT   gene            609734..610411
FT                   /locus_tag="SeHA_C0610"
FT   CDS_pept        609734..610411
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0610"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0610"
FT                   /db_xref="EnsemblGenomes-Tr:ACF68357"
FT                   /protein_id="ACF68357.1"
FT                   /translation="MTERSMLLELKQVGYRTATTKIVNNISFTLQRGEFKLITGPSGCG
FT                   KSTLLKMVASLISPDIGVILFEGQDITTLSPEAYRQQVSYCAQTPALFGDTVYDNLIFP
FT                   WQIRHQRPQPTAFADDLARFELPETILQKPITALSGGEKQRIALIRNLQFLPKILLLDE
FT                   ITSALDEHNKRNVNDIIHRYVRDKQVAVLWVTHDKDEIQHADKVITLTPSAGEMQEARY
FT                   ERA"
FT   gene            610398..611177
FT                   /locus_tag="SeHA_C0611"
FT   CDS_pept        610398..611177
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0611"
FT                   /product="putative membrane protein"
FT                   /note="identified by match to protein family HMM PF03649;
FT                   match to protein family HMM TIGR00245"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0611"
FT                   /db_xref="EnsemblGenomes-Tr:ACF69994"
FT                   /protein_id="ACF69994.1"
FT                   /translation="MNEHNITNTSLALSMLLVVVAMLISHKEKLALEKDILWSVCRAVI
FT                   QLIIVGYVLKYIFGVNHAALTLLMVLFICFNAAWNAQKRSKYIDKAFLSSFIAITVGAG
FT                   LTLTVLVLTGSIEFAPMQVIPIAGMVAGNAMVAVGLCYNQLGLRFHSEQQQIQEKLSLG
FT                   ATPKMASAGLIRDSIRASLIPTIDSAKTVGLVSLPGMMSGLIFAGIDPVKAIKYQIMVT
FT                   FMLLSTASLSTIIACYLTYRKFYNSRHQLVVMPLKKS"
FT   gene            complement(611263..612144)
FT                   /locus_tag="SeHA_C0612"
FT   CDS_pept        complement(611263..612144)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0612"
FT                   /product="thioredoxin domain protein"
FT                   /note="identified by match to protein family HMM PF00085"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0612"
FT                   /db_xref="EnsemblGenomes-Tr:ACF70294"
FT                   /protein_id="ACF70294.1"
FT                   /translation="MTQTKESDAMSVQNIVNINESNLQQTLEQSMTTPVLFYFWSERSQ
FT                   HCLQLTPVLESLAAQYHGQFILAKLDCDAEQMIAAQFGLRAIPTVYLFQNGQPVDGFQG
FT                   PQPEEAIRALLDKVLPREEELKAQQAMQLMQEGNYIDALPLLKDAWQLSSQNSEIGLLL
FT                   AEAQIALNRSEEAEAVLKTIPLQDQDTRYQGLVAQIELLKQAADTPEIQQLQQQVAENP
FT                   QDAALATQLALQLHQVGRNEEALELLFSHLRKDLAAAEGQTRKTFQEILAALGTGDALA
FT                   SKYRRQLYALLY"
FT   gene            complement(612177..612947)
FT                   /locus_tag="SeHA_C0613"
FT   CDS_pept        complement(612177..612947)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0613"
FT                   /product="oxidoreductase, short chain
FT                   dehydrogenase/reductase family"
FT                   /note="identified by match to protein family HMM PF00106;
FT                   match to protein family HMM PF08659"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0613"
FT                   /db_xref="EnsemblGenomes-Tr:ACF69647"
FT                   /protein_id="ACF69647.1"
FT                   /translation="MQKSVLITGCSSGIGLDSALELKRQGFQILAGCRKPDDVARMNSM
FT                   GFTGVLIDLDSPESVDRAADEVIALTDNRLYGIFNNAGYGVYGPLSTISREQMEQQFSS
FT                   NFFGAHQLTMRLLPAMLPHGEGRIVMTSSVMGLISTPGRGAYAASKYALEAWSDALRME
FT                   LRHTGIKVSLIEPGPIRTRFTDNVNQTQRDKPVENPGIAARFTRDPDAVVAKVRHAFAS
FT                   DKPRLRYPVTLVTWAVMALKRLLPGRMLDKILQS"
FT   gene            complement(613102..613716)
FT                   /locus_tag="SeHA_C0615"
FT   CDS_pept        complement(613102..613716)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0615"
FT                   /product="acyl-CoA thioesterase I"
FT                   /EC_number="3.1.2.-"
FT                   /EC_number="3.1.1.5"
FT                   /note="identified by match to protein family HMM PF00657"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0615"
FT                   /db_xref="EnsemblGenomes-Tr:ACF66043"
FT                   /protein_id="ACF66043.1"
FT                   /translation="MNFNTVFRWHLPFLFLILLTFRAAAADTLLILGDSLSAGYRMAAS
FT                   AAWPSLLNDKWQNKTSVVNASISGDTSQQGLARLPALLQQHHPRWVVVELGGNDGLRGF
FT                   APAQTEQTLRKIIQTVKAADAQPLLMQIHLPANYGRRYNESFSAIYPKLAKEFDIPLLP
FT                   FFMEEVYLKPQWMQDDGIHPNRDAQPFIADWMAKQLTPFLS"
FT   gene            613687..614373
FT                   /locus_tag="SeHA_C0614"
FT   CDS_pept        613687..614373
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0614"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0614"
FT                   /db_xref="EnsemblGenomes-Tr:ACF68047"
FT                   /protein_id="ACF68047.1"
FT                   /translation="MPAENSVEVHRLRKSVGQGEHELSILTGVELVVKRGETIALIGES
FT                   GSGKSTLLAILAGLDDGSSGEVRLVGKPLHQMDEEARAQLRAQHVGFVFQSFMLIPTLN
FT                   ALENVELPALLRGENSGQSKAGAKALLEQLGLGKRLDHLPAQLSGGEQQRVALARAFNG
FT                   RPDVLFADEPTGNLDRQTGDKIADLLFSLNREHGTTLILVTHDPALAARCDRRLRLVNG
FT                   QLQEEA"
FT   gene            614370..616784
FT                   /locus_tag="SeHA_C0616"
FT   CDS_pept        614370..616784
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0616"
FT                   /product="efflux ABC transporter, permease protein"
FT                   /note="identified by match to protein family HMM PF02687"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0616"
FT                   /db_xref="EnsemblGenomes-Tr:ACF68764"
FT                   /protein_id="ACF68764.1"
FT                   /translation="MIARWFWREWRSPSLIIVWLALSLAVACVLALGSISDRMEKGLSQ
FT                   QSREFMAGDRTLQSSREVPKAWLEEARKRGLNVGEQLTFATMTFASDTPQLASVKAVDS
FT                   VYPMYGELQTRPGGVKPQPGSVLLAPRLMALLNLKTGDTIDVGDVTLRIAGEVVQEPDS
FT                   GFNPFQMAPRLMMNMADVEKTGAIQPGSRVMWRYKFGGTPQQLAGYESWLLPQLKPEHR
FT                   WYGLEEDDGALGKSLERSQQFLLLSALLTLLLAVAAVAVAMSHYCRSRYDLVAILKTLG
FT                   AGRAQLRKLIIGQWLMVLGLSAVTGGAIGLLFENILLVLLKPVLPADLPPASLWPWLWA
FT                   LGAMTVISLLVGLRPYRLLLATQPLRVLRRDVVARVWPLKIYLPVACAVVVALLAGLMG
FT                   GSMLLWAVLAGAVILALLCGLVGWMLLNVLRGMTLTSLPLRLAVSRLLRQPWSTLSQLS
FT                   AFSLSFMLLALLLVLRGDLLDRWQQQLPPESPNYFLINIASEQVAPLKAFLAEHQVISQ
FT                   TFYPIVRARLTKINGNPTEGQQDESLNRELNLTWQDTRPAHNPLVAGHWPPKPGEVSME
FT                   EGLAKRLNVKLGDSVTFMGDTQAFSAKVTSLRQVDWESLRPNFFFIFPSGALDGQPQSW
FT                   LTSFRWENGNGMLTQLNREFPTVSLLDIGAILKQVGQVLEQVSRALEVMVVLVTLCGML
FT                   LLLAQVQVGMRQRHQELVVWRTLGAGKKLLRTTLWCEFAMLGLVAGLVAAIGAETALAI
FT                   LQINVFDFPWEPDWRLWGALPFCGALLLSVCGGWLGVRLLKGKALFRQFNG"
FT   gene            616970..618103
FT                   /locus_tag="SeHA_C0617"
FT   CDS_pept        616970..618103
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0617"
FT                   /product="outer membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0617"
FT                   /db_xref="EnsemblGenomes-Tr:ACF68313"
FT                   /protein_id="ACF68313.1"
FT                   /translation="MTIKITALAASIGAAMAFMPFATQAEITVLKQDPQAGNPLSRLNF
FT                   TVGGSIRPQFQNMTGNDGANGYKRNGFDGGTRFRFAADYYLFDDISWISYYELGVNIPA
FT                   VFDWDNHYAKGSTDTTRRMLYTGFKSATWGTLTFGQQNSIYYDVVGVKTDIWDYDMIGQ
FT                   APGNGINGDYDGSYRTRKSLKYKKSIGNVDLYASYLFSDDYNANNGLNYKRKGGGSLGA
FT                   DYHLTDDLTWGTAWNYTRAEMRGNGNKTYDQNIVGTALSWTPENWTIAAGGGWYQNFMT
FT                   TKKVSVNDYFAGDAWGLEYFVGYAFPIGQYAVKAIQPYFMGDRIEYVNGRDYLRTDNGV
FT                   GITFQLDYGFRVDYEHVFTSSTDNLGDMNLVRLRYDF"
FT   gene            618360..619190
FT                   /locus_tag="SeHA_C0618"
FT   CDS_pept        618360..619190
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0618"
FT                   /product="lipoprotein"
FT                   /note="identified by match to protein family HMM PF03180"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0618"
FT                   /db_xref="EnsemblGenomes-Tr:ACF70099"
FT                   /protein_id="ACF70099.1"
FT                   /translation="MGLRQSLRIAASTLLLACGLQFAHADSSPQTIVFGVAPGPYGDMV
FT                   KQAIAPTLKEKGYKVVVREFSDYVQPNMALANGSIDANLFQHTLYFDKFTADKGLKLSK
FT                   LIVVPTAGMGFYSRKINSLDALKKGDIITLSNDPTNLARGLRFLQSLGLITIKDNIDPT
FT                   KASERDIASNPKGLVFKPLEAAQLPRTLDGVTGALVNGNFAVAAGLDLSSAIKQEHLDE
FT                   NLKNIIAVRSEDADKPFAKDIVEAVKSPAYRAVIDDPKNIYSAFQKPEWMTATP"
FT   gene            619227..620243
FT                   /locus_tag="SeHA_C0619"
FT   CDS_pept        619227..620243
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0619"
FT                   /product="methionine import ATP-binding protein MetN 2"
FT                   /EC_number="3.6.3.-"
FT                   /note="identified by match to protein family HMM PF00005;
FT                   match to protein family HMM PF09383"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0619"
FT                   /db_xref="EnsemblGenomes-Tr:ACF69600"
FT                   /protein_id="ACF69600.1"
FT                   /translation="MIEIEKVCVDFTAGRGTPTRAVDDVSLHIAAGEIFGIVGTSGAGK
FT                   STLLRTLNALTRPSQGRVNVNGVEISALDGKALRQARQRIGMIFQHFNLMHTRTVAQNV
FT                   AFSLKAAGWERSKIAPRVAEILTLVGLADKANRFPVQLSGGQKQRVGIARAIANHPDVL
FT                   LCDEPTSALDLETSATILALLRQINAQLGITIVLITHEMNVIKSICDRVAVMSGGKVVE
FT                   SGEVFDVFAHPQHAFTQQLVSHTLNLTLPERLREHLPGQLLKILFIGDSAEQPVLSEVA
FT                   IKFGVAVNILHGKIEYIGERALGILVVQLTAPHNPTAVAAAVEHIRQRTAQVVVIRG"
FT   gene            620236..620895
FT                   /locus_tag="SeHA_C0620"
FT   CDS_pept        620236..620895
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0620"
FT                   /product="ABC transporter integral membrane protein"
FT                   /note="identified by match to protein family HMM PF00528"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0620"
FT                   /db_xref="EnsemblGenomes-Tr:ACF66154"
FT                   /protein_id="ACF66154.1"
FT                   /translation="MDDLLPDLTLAFNETFQMLSISTVLAILGGLPLGFLIFVTDRHLF
FT                   WQNRFIYLVASVLVNIIRSVPFVILLVLLLPLTQLLLGNTIGPIAASVPLSVAAIAFYA
FT                   RLVDSALREVDKGIIEAALAFGASPMRIICTVLLPEASAGLLRGLTITLVSLIGYSAMA
FT                   GIVGGGGVGDLAIRYGYYRYETEVMVVTVVALIVLVQVVQMLGDWLAKRADKRDRH"
FT   gene            complement(620934..622028)
FT                   /gene="ybbB"
FT                   /locus_tag="SeHA_C0621"
FT   CDS_pept        complement(620934..622028)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybbB"
FT                   /locus_tag="SeHA_C0621"
FT                   /product="tRNA 2-selenouridine synthase"
FT                   /EC_number="2.9.1.-"
FT                   /note="identified by match to protein family HMM TIGR03167"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0621"
FT                   /db_xref="EnsemblGenomes-Tr:ACF70373"
FT                   /db_xref="GOA:B4T9K6"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR017582"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4T9K6"
FT                   /protein_id="ACF70373.1"
FT                   /translation="MQDRQKAQDYRALLLADTPLIDVRAPIEFEQGAMPGAINLPLMMD
FT                   DERAAVGTCYKRQGADAALALGHRLVCGDIRQQRLEAWKAAYQRFPNGYLCCARGGQRS
FT                   HIVQRWLQETGIDCPLIEGGYKALRQTAIQATWQLAQKPILLIGGCTGSGKTQLVRQQP
FT                   NGVDLEGLARHRGSSFGRTLNPQLSQASFENKLAVELLKINARQTLKRWVLEDEGRTIG
FT                   ANHLPECLRERMAQAPIAVVEDPFALRLERLREEYFICMHHDFTHAYGDEAGWQAYSEY
FT                   LHHGLFAIRRRLGLQRFAELTDTLDRALAEQLSSGSTDGHMAWLVPLLNEYYDPMYRYQ
FT                   LEKKAANIVFRGPWQDVANWLKAQ"
FT   gene            complement(622098..623024)
FT                   /locus_tag="SeHA_C0622"
FT   CDS_pept        complement(622098..623024)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0622"
FT                   /product="HTH-type transcriptional activator AllS"
FT                   /note="identified by match to protein family HMM PF00126;
FT                   match to protein family HMM PF03466"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0622"
FT                   /db_xref="EnsemblGenomes-Tr:ACF66492"
FT                   /protein_id="ACF66492.1"
FT                   /translation="MFDPETLRTFISVAETGSFSKAAERLCKTTATISYRIKLLEENTG
FT                   VGLFFRTTRSVSLTAAGSHLLSQAKDWLAWLDSMPDELRQVNDGVERQVNIVVNNLLYS
FT                   PQAVASLLSWLNARYPFTQFHFSRQIYMGVWDSLLYEGFSLAIGVTGTEPLANTFMLDP
FT                   LGSVQWRFVMSADHPLAHVSGPLTEAQLRRFPAINIEDSARTLTKRVAWRLPGQKEIIV
FT                   PDMETKIAAHLAGVGIGFVPQPLCQTLIDKNELVSCTIPTMRPPSPLSLAWHKFGGGKA
FT                   VEDIVKLFTQRQPEIAGFLSIFNTVRC"
FT   gene            623251..623733
FT                   /gene="allA"
FT                   /locus_tag="SeHA_C0623"
FT   CDS_pept        623251..623733
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="allA"
FT                   /locus_tag="SeHA_C0623"
FT                   /product="ureidoglycolate hydrolase"
FT                   /EC_number="3.5.3.19"
FT                   /note="identified by match to protein family HMM PF04115"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0623"
FT                   /db_xref="EnsemblGenomes-Tr:ACF66432"
FT                   /db_xref="GOA:B4T9K8"
FT                   /db_xref="InterPro:IPR007247"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR023525"
FT                   /db_xref="InterPro:IPR024060"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4T9K8"
FT                   /protein_id="ACF66432.1"
FT                   /translation="MKLEVLPLDQKTFSAYGDVIETQERDFFHINNGLVERYHDLAKVE
FT                   VLEQDRTLISINRAQPAAMPIVVHELERHPLGTQAFVPMNGEAFVVIVALGDDKPDLST
FT                   LRAFISNGRQGVNYHRNVWHHPLFAWQTVTDFLTVDRGGSDNCDVESIPTHELCFA"
FT   gene            623812..624630
FT                   /gene="allR"
FT                   /locus_tag="SeHA_C0624"
FT   CDS_pept        623812..624630
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="allR"
FT                   /locus_tag="SeHA_C0624"
FT                   /product="transcriptional regulator AllR"
FT                   /note="identified by match to protein family HMM PF01614;
FT                   match to protein family HMM PF09339"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0624"
FT                   /db_xref="EnsemblGenomes-Tr:ACF67634"
FT                   /protein_id="ACF67634.1"
FT                   /translation="MTEVRRRGRPGQAEPTAQKGAQALERGIAILQYLERSGGSSSVSD
FT                   ISGSLDLPLSTTFRLLKVLQAADFVYQDSQLGWWHIGLGVFNVGSAYIHNRDVLSVAGP
FT                   FMHRLMLLSGETVNVAIRNGNEAVLIGQKECKSMVRMCAPLGSRLPLHASGAGKALLYP
FT                   LTEEELVGIVVNTGLRRFTPTTLVDLPILLKNLEQAREQGYTVDQEEHVVGLNCIASAI
FT                   YDDAGSVVAAISISGPASRLTEDRFISQGELVRDTAKDISTALGLKPPVA"
FT   gene            624715..626496
FT                   /gene="gcl"
FT                   /locus_tag="SeHA_C0625"
FT   CDS_pept        624715..626496
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gcl"
FT                   /locus_tag="SeHA_C0625"
FT                   /product="glyoxylate carboligase"
FT                   /EC_number="4.1.1.47"
FT                   /note="identified by match to protein family HMM PF00205;
FT                   match to protein family HMM PF02775; match to protein
FT                   family HMM PF02776; match to protein family HMM TIGR01504"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0625"
FT                   /db_xref="EnsemblGenomes-Tr:ACF67101"
FT                   /protein_id="ACF67101.1"
FT                   /translation="MAKMRAVDAAMYVLEKEGITTAFGVPGAAINPFYSAMRKHGGIRH
FT                   ILARHVEGASHMAEGYTRAAAGNIGVCLGTSGPAGTDMITALYSASADSIPILCITGQA
FT                   PRARLHKEDFQAVDIEAIAKPVSKMAVTVREAALVPRVLQQAFHLMRSGRPGPVLVDLP
FT                   FDVQVAEIEFDPDMYEPLPVYKPAASRVQIEKALEMLIQSERPVIVAGGGVINADAAPL
FT                   LQQFAELTNVPVIPTLMGWGCIPDDHPLMAGMVGLQTAHRYGNATLLASDMVFGIGNRF
FT                   ANRHTGSVEKYTQGRKIIHIDIEPTQIGRVLCPDLGIVSDAKAALTLLIDVAQEMQKAG
FT                   RLPCRKTWVDECQQRKRTLLRKTHFDNVPVKPQRVYEEMNKAFGRDVCYVTTIGLSQIA
FT                   AAQMLHVFKDRHWINCGQAGPLGWTIPAALGVCAADPQRNVVAISGDFDFQFLIEELAV
FT                   GAQFNIPYIHVLVNNAYLGLIRQSQRAFDMDYCVQLAFENINSSEVNGYGVDHVKVAEG
FT                   LGCKAIRVFKPEDIAPAFEQAKALMAQYRVPVVVEVILERVTNISMGSELDNVTEFEEV
FT                   ADSAKDAPTETCFMKYE"
FT   gene            626509..627285
FT                   /gene="hyi"
FT                   /locus_tag="SeHA_C0626"
FT   CDS_pept        626509..627285
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hyi"
FT                   /locus_tag="SeHA_C0626"
FT                   /product="hydroxypyruvate isomerase"
FT                   /EC_number="5.3.1.22"
FT                   /note="identified by match to protein family HMM PF01261;
FT                   match to protein family HMM TIGR03234"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0626"
FT                   /db_xref="EnsemblGenomes-Tr:ACF69805"
FT                   /protein_id="ACF69805.1"
FT                   /translation="MLRFSANLSMLFTEYDFLERFDKAALSGFRGVEFMFPYDNDIEVL
FT                   KRKLRDNNLEHTLHNLPAGDWAAGERGIACIPGREEEFRDGVAAAIRYARALGNKKINC
FT                   LVGKTPSGFSATEIHDTLVENLRYAANMLAKEDILLLIEPINHFDMPGFHLTGTQQALA
FT                   LIKDIGSDNIKIQYDIYHMQRMEGELTQTMTAWADKIGHLQIADNPRRGEPGTGEINYD
FT                   FIFNVIKQSDYDGWVGCEYKPLTTTEAGLSWINQYR"
FT   gene            627386..628264
FT                   /locus_tag="SeHA_C0627"
FT   CDS_pept        627386..628264
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0627"
FT                   /product="2-hydroxy-3-oxopropionate reductase"
FT                   /EC_number="1.1.1.60"
FT                   /note="identified by match to protein family HMM PF03446;
FT                   match to protein family HMM PF03807; match to protein
FT                   family HMM TIGR01505"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0627"
FT                   /db_xref="EnsemblGenomes-Tr:ACF69306"
FT                   /protein_id="ACF69306.1"
FT                   /translation="MKLGFIGLGIMGSPMAINLARAGHQLHVTTIGPVADELLSLGAVN
FT                   VETARQVTEFADIIFIMVPDTPQVEDVLFGEHGCAKTSLQGKTIVDMSSISPIETKRFA
FT                   QRVNEMGADYLDAPVSGGEIGAREGTLSIMVGGEQKVFDRVKPLFDILGKNITLVGGNG
FT                   DGQTCKVANQIIVALNIEAVSEALVFASKAGADPVRVRQALMGGFASSRILEVHGERMI
FT                   NRTFEPGFKIALHQKDLNLALQSAKALALNLPNTATCQELFNTCAANGGSQLDHSAMVQ
FT                   ALELMANHKLS"
FT   gene            628330..629577
FT                   /locus_tag="SeHA_C0628"
FT   CDS_pept        628330..629577
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0628"
FT                   /product="major facilitator family transporter"
FT                   /note="identified by match to protein family HMM PF00083;
FT                   match to protein family HMM PF07690"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0628"
FT                   /db_xref="EnsemblGenomes-Tr:ACF66831"
FT                   /protein_id="ACF66831.1"
FT                   /translation="MSETKKSGIDYWKQIVVVMSLGWVAIWIYRTVLTPIYPEIQASLD
FT                   NVSNAEIGAIASFYFFAYCSMQIPCGILVDKFGQKIMLMAGFTLFIIGTLCIAKANGLT
FT                   MIYIGSLMAGGGCASFFSSAYSLSSANVPQARRALANAIINSGSAIGMGIGLIGSSVLV
FT                   KNMSMAWQNVLYIVAAILVIMLCVFTLIIRGKAKSDSAQAEKQTQTVTEDEKRAPLFSG
FT                   LLCSVYFLYFCTCYGYYLIVTWLPSYLQTERGFDGGAIGLASALVAVVGVPGALFFSHL
FT                   SDKFRNSKVKVILGLEIVAAAMLAFTVLSPNTTMLMVSLTLYGLLGKMAVDPILISFVS
FT                   EQASAKSLGRAFSLFNFFGMSSAVVAPTLTGFISDVTGSKEISFVISACLVVTGTLIFA
FT                   VVTLYKKKATQRIASA"
FT   gene            629673..631127
FT                   /gene="ncs1"
FT                   /locus_tag="SeHA_C0629"
FT   CDS_pept        629673..631127
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ncs1"
FT                   /locus_tag="SeHA_C0629"
FT                   /product="NCS1 nucleoside transporter family"
FT                   /note="identified by match to protein family HMM PF02133;
FT                   match to protein family HMM TIGR00800"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0629"
FT                   /db_xref="EnsemblGenomes-Tr:ACF66012"
FT                   /protein_id="ACF66012.1"
FT                   /translation="MEHQRELYQQRGYSEDLLPKTETQRNWKAFNYFTLWMGSVHNVPN
FT                   YVMVGGFFILGLSTFNIMLAIIISALFIAAAMVMNGAAGSKYGVPFAMILRGSYGVRGA
FT                   LFPGLLRGGIAAIMWFGLQCYAGSLAFLILIGKIWPGFLTLGGDFKLLGLSLPGLITFL
FT                   IFWIINVGIGFGGGKVLNKFTAILNPCIYIVFGGMAIWAISLVGIGPILDYLPSGVQKA
FT                   EHSGFLFLVVINAVVAVWAAPAVSASDFTQNAYSFRAQALGQTLGLIVAYILFAVASVC
FT                   IIAGASIHYGMDTWNVLDIVQRWDSLFASFFAVLVILMTTISTNATGNIIPAGYQIAAL
FT                   APTKLNYKNGVMIASIISLLICPWKLMENQDSIYLFLDIIGGMLGPVIGVMLAHYFVVM
FT                   RGKINLDELYTASGDYKYYDNGFNLTAFSVTLVAVILSLGGKFIPFMEPLSRVSWFVGV
FT                   IVAFVAYALLKKRTGFENTGEQKLVG"
FT   gene            631206..632567
FT                   /gene="allB"
FT                   /locus_tag="SeHA_C0630"
FT   CDS_pept        631206..632567
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="allB"
FT                   /locus_tag="SeHA_C0630"
FT                   /product="allantoinase"
FT                   /EC_number="3.5.2.5"
FT                   /note="identified by match to protein family HMM PF01979;
FT                   match to protein family HMM PF07969; match to protein
FT                   family HMM TIGR03178"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0630"
FT                   /db_xref="EnsemblGenomes-Tr:ACF67879"
FT                   /db_xref="GOA:B4T9L5"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR017593"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4T9L5"
FT                   /protein_id="ACF67879.1"
FT                   /translation="MSFDLIIKNGTVILENEARVIDIAVQGGKIAAIGENLGEAKNVLD
FT                   ATGLIVSPGMVDAHTHISEPGRTHWEGYETGTRAAAKGGITTMIEMPLNQLPATVDRET
FT                   IELKFDAAKGKLTIDAAQLGGLVSYNLDRLHELDEVGVVGFKCFVATCGDRGIDNDFRD
FT                   VNDWQFYKGAQKLGEMDQTVLVHCENALICDELGEEAKREGRVTAHDYVASRPVFTEVE
FT                   AIRRVLYLAKAAGCRLHVCHISSPEGVEEVTRARQEGQDVTCESCPHYFVLDTDQFEEI
FT                   GTLAKCSPPIRDQENQKGMWEKLFNGEIDCLVSDHSPCPPEMKAGNIMQAWGGIAGLQN
FT                   CMDVMFDEAVQKRGMSLPMFGKLMATNAADIFGLKHKGRIAPGKDADLVFIQPDSSYVL
FT                   KNEDLEYRHKVSPYVGRTIGARITKTILRGDVIYDIEHGFPVPPKGQFILKHQQ"
FT   gene            632626..633924
FT                   /locus_tag="SeHA_C0631"
FT   CDS_pept        632626..633924
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0631"
FT                   /product="putative purine permease YbbY"
FT                   /note="identified by match to protein family HMM PF00860"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0631"
FT                   /db_xref="EnsemblGenomes-Tr:ACF67220"
FT                   /protein_id="ACF67220.1"
FT                   /translation="MFPVINRESVLSGFQWFFFIFCNTVVVPPTLLSAFHLPADNLLML
FT                   TQYAFLTTALACLVQAFCGHRRAIMEGPTGLWWGAILTITLGEASRGTPLNDIASSLSV
FT                   GIAISAMVTIFIGISGLGHRLARLFTPAVMVFFMLLLGAQLTSIFFKGMLGLPFGIADT
FT                   SARIKLAPFGLAVAVMCFILAMIIFLQQRISRYALLVGTVVGWGLWRLCFPSSHLPPGE
FT                   LSWRWFPLGSHGTLMPGIIVTAVMTGLVNISNTYGAIRGTDIFYPHQGSGSSRYRRSFM
FT                   ISGLMTLVTVPFAVVPFSPFVSSIGLLTQTGDSSRKSFICGSALCLLVAIITPLTRLFC
FT                   SIPLAISSAVMLVSYLPLLYSGLVFSQQITFTARNIYRLALPLFVGIFLMGLPPVYLQD
FT                   LPLMIRPLLSNGLLVGILLAVLMENLIPWERIK"
FT   gene            633947..635095
FT                   /locus_tag="SeHA_C0632"
FT   CDS_pept        633947..635095
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0632"
FT                   /product="glycerate kinase 1"
FT                   /EC_number="2.7.1.31"
FT                   /note="identified by match to protein family HMM PF02595;
FT                   match to protein family HMM TIGR00045"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0632"
FT                   /db_xref="EnsemblGenomes-Tr:ACF67284"
FT                   /protein_id="ACF67284.1"
FT                   /translation="MKIVIAPDSFKESLSADKCCQAIKAGFSTVFPDARYVCLPIADGG
FT                   EGTVDAMVAATGGKRVSVDVSGPMGEKVNGFYGLTGDGKTAIIEMAAASGLMLVAPEAR
FT                   NPLLASSFGTGELIRHALDAGIRHIILGIGGSATVDGGMGVAQALGVRFLDAQGMLLGA
FT                   GGGNLSRLASIDLQGCDPRISECRIEVACDVDNPLVGPRGAAAVFGPQKGATPEMVETL
FT                   ENGLRNYARVLHALTGRDMSQIPGGGAAGGMGIAAIVFLEAEMKPGIEIVMQAVKLEEA
FT                   VKEASLVITGEGRIDSQTAGGKAPIGVASVAKRHHVPVIGIAGVLGDGVEVVHRHGIDA
FT                   VFSILPRLAPLPEVLANGEQNLYHSACNIARVIKLGQDIGTR"
FT   gene            complement(635175..635960)
FT                   /locus_tag="SeHA_C0633"
FT   CDS_pept        complement(635175..635960)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0633"
FT                   /product="putative allantoin catabolism protein"
FT                   /note="identified by match to protein family HMM PF05899;
FT                   match to protein family HMM PF07883; match to protein
FT                   family HMM TIGR03214"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0633"
FT                   /db_xref="EnsemblGenomes-Tr:ACF66453"
FT                   /protein_id="ACF66453.1"
FT                   /translation="MGYLNNVTGYRDDLLANRAIVKHGNYALLTPDGLVKNIIPGFENC
FT                   DVTILSTPKLGASFVDYLVTLHQNGGNQQGFGGEGIETFLYVITGNIEAKAEGKTFSLT
FT                   QGGYLYCPPGEMMTFSNAQTEDSQLFLYKRRYTPVEGHAPWLVSGNASQLERIHYEGME
FT                   DVILLDFLPKELGFDMNMHILSFEPGASHGYIETHVQEHGAYILSGQGVYNLDNNWVPV
FT                   KKGDYIFMGAYSLQAGYGVGRGEAFSYIYSKDCNRDVMI"
FT   gene            complement(635971..637206)
FT                   /gene="allC"
FT                   /locus_tag="SeHA_C0634"
FT   CDS_pept        complement(635971..637206)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="allC"
FT                   /locus_tag="SeHA_C0634"
FT                   /product="allantoate amidohydrolase"
FT                   /EC_number="3.5.3.-"
FT                   /note="identified by match to protein family HMM PF01546;
FT                   match to protein family HMM PF07687; match to protein
FT                   family HMM TIGR01879; match to protein family HMM
FT                   TIGR03176"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0634"
FT                   /db_xref="EnsemblGenomes-Tr:ACF68633"
FT                   /protein_id="ACF68633.1"
FT                   /translation="MIKHFRHAIEETLPWLSSIGADPTGGMTRLLYSPEWLETQQQFKK
FT                   RMAESGLETRFDDVGNLYGRLCGTQFPEQVILSGSHIDTVVNGGNLDGQFGALAAWLAL
FT                   DWLKATYGAPLRTVEVVSMAEEEGSRFPYVFWGSKNIFGLANPEEVRHIQDAKGTGFVD
FT                   AMQACGFTLPAAPLAARTDIRAFVELHIEQGCVLESNGQSIGVVNAIVGQRRYTVTLNG
FT                   ESNHAGTTPMGYRRDTVYAFSRICSQSIEKAKQHGDPLVLTFGKVEPQPNTVNVVPGKT
FT                   TFTIDCRHTDAAVLREFTEQLENDMRAICDEMDISIDIDLWMDEAPVPMNAELVAALTR
FT                   LCETEQLNYRIMHSGAGHDAQIFAPRVPTCMIFVPSINGISHNPAERTNINDLAEGVKT
FT                   LALMLHQLAWQK"
FT   gene            complement(637228..638277)
FT                   /gene="allD"
FT                   /locus_tag="SeHA_C0635"
FT   CDS_pept        complement(637228..638277)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="allD"
FT                   /locus_tag="SeHA_C0635"
FT                   /product="ureidoglycolate dehydrogenase"
FT                   /EC_number="1.1.1.154"
FT                   /note="identified by match to protein family HMM PF02615;
FT                   match to protein family HMM TIGR03175"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0635"
FT                   /db_xref="EnsemblGenomes-Tr:ACF67709"
FT                   /protein_id="ACF67709.1"
FT                   /translation="MKISRETLHQLIENKLYKAGLKREHAAIVADVLVYADARGIHSHG
FT                   AVRVEYYAERISKGGTNREPTFRIENTGPCTAILHADNAAGQVAAKMGMEHAIEIAKKN
FT                   GVAVVGISRMGHSGAISYFVRQAAREGLIGLSICQSDPMVVPFGGADIYYGTNPLAFAA
FT                   PGEGDDIITFDMATTVQAWGKVLDARSRNESIPESWAVDKNGAPTHDPFAVNALLPAAG
FT                   PKGYGLMMMIDILSGILLGLPFGRQVSSMYEDLHAGRNLGQLHLVINPAFFSSCELFRK
FT                   HISQTMQELNAVKPAPGFKQVYYPGQDQDIKQKNADMNGIDIVDDIYQYLISGALYLKS
FT                   YETKNPFAQ"
FT   gene            638465..638596
FT                   /locus_tag="SeHA_C0636"
FT   CDS_pept        638465..638596
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0636"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0636"
FT                   /db_xref="EnsemblGenomes-Tr:ACF69280"
FT                   /protein_id="ACF69280.1"
FT                   /translation="MNSFVNKFDVTLITLFTLPDIYREAHINTARAIAMGAIIKELL"
FT   gene            638593..640257
FT                   /locus_tag="SeHA_C0637"
FT   CDS_pept        638593..640257
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0637"
FT                   /product="protein FdrA"
FT                   /note="identified by match to protein family HMM PF06263"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0637"
FT                   /db_xref="EnsemblGenomes-Tr:ACF68641"
FT                   /protein_id="ACF68641.1"
FT                   /translation="MIHAFIKKGCFQDSVSLMIISRKLSESENVDDVSVMMGTPANKSL
FT                   LETTGFWHDDFHGATPNDICVAIRTEAVDDGITQVIVQQLEEALQQLAQGSSGSQSLIQ
FT                   VRRWESACQKLPEASLALVSVAGEYAAELAEQALDRSLNVMIFSDNVTLDDEIRLKRRA
FT                   RDKGLLVMGPDCGTAMIANTPLAFANVMPEGNIGVIGASGTGIQELCSQIALAGEGITH
FT                   AIGLGGRDLSAEVGGISALTALEILSADEKSQVLAFVSKPPADAVRQHIIAAMKAAGKP
FT                   VVALFLGFSSPVAREENVWFASTLDEAARLACLLSRVTSQRKEMVSTGGVIRGLYTGGT
FT                   LAAEAAGLLAGYLGVAADTEHHHGMMLDADGHQIIDLGDDFYTVGRPHPMIDPALRNQL
FT                   IAGLGAQPQVRVLLVDVVIGFGATADPAASLIQAWQKACAARASDQPLFAIATVTGTER
FT                   DPQCRSQQIAALEDAGITVVDSLPEATLLAAELIRPTLSSTHPSAPRLLEAVAVINAGL
FT                   RSFALDLQAAGMPVVHYQWAPVAGGNKKLARLLERLQ"
FT   gene            640267..641526
FT                   /locus_tag="SeHA_C0638"
FT   CDS_pept        640267..641526
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0638"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF06545"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0638"
FT                   /db_xref="EnsemblGenomes-Tr:ACF70316"
FT                   /protein_id="ACF70316.1"
FT                   /translation="MFTSVAQANAAVIEQIRRARPHWLDVKPASSLISVLNQGKTLLHA
FT                   GPPMRWQEMTGPMKGACIGACLFEGWAKDEMSALALLEQGKVNFIPCHHVNAVGPMGGI
FT                   TSASMPMLVVENITDGNRAYCNLNEGIGKVMRFGAYGEDVQQRLRWMRDVLMPVLSAAL
FT                   GRLERGLDLTAMMAQGITMGDEFHQRNIASSALLMRTLAPHIVRLEHDKQQIAEVMDFL
FT                   SVTDQFFLNLAMAYCKAAMDAGAQIRAGSIVTAMTRNGDMFGIRVSGLGDRWFTAPVNT
FT                   PQGLFFTGFSQDQANPDMGDSAITETFGIGGAAMIAAPGVTRFVGAGGMEAAKSVSEEM
FT                   AEIYLERNMQLQIPGWDFQGACLGLDIRRVVETGITPLINTGIAHKEAGIGQIGAGTVR
FT                   APLACFEQALEALAESMGVS"
FT   gene            641559..642347
FT                   /locus_tag="SeHA_C0639"
FT   CDS_pept        641559..642347
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0639"
FT                   /product="putative cytoplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0639"
FT                   /db_xref="EnsemblGenomes-Tr:ACF69671"
FT                   /protein_id="ACF69671.1"
FT                   /translation="MASRQSADYRQPWQMSGVWRRSINFVAKSGELLTLHRRGSGFSPG
FT                   GWILRGGDFDALRDVLTDGEKPQSTAAGIQIGEFLLCEPERRCSLRVPRYLASPRLNAT
FT                   YMQRSEETGLFGPLTVAAAQPLCPELRQFCHCFQSALAGAATDWRLWLGKGPGLTPSHD
FT                   DTLTGMLLAAWYFGAIDERAGRNFFAQSGSLDRATTLVSVSYLRYAAMGYFASPLLHFI
FT                   HALRRDARTETAIDGLLALGHTSGADTLLGFWLGQQIVKG"
FT   gene            642351..643244
FT                   /gene="arcC"
FT                   /locus_tag="SeHA_C0640"
FT   CDS_pept        642351..643244
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="arcC"
FT                   /locus_tag="SeHA_C0640"
FT                   /product="carbamate kinase"
FT                   /EC_number="2.7.2.2"
FT                   /note="identified by match to protein family HMM PF00696;
FT                   match to protein family HMM TIGR00746"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0640"
FT                   /db_xref="EnsemblGenomes-Tr:ACF66036"
FT                   /protein_id="ACF66036.1"
FT                   /translation="MKTLVVALGGNALLQRGEALTAENQYRNIADAVPALARLARSYRL
FT                   AIVHGNGPQVGLLALQNLAWKAVEPYPLDVLVAESQGMIGYMLAQRLALEPDMPPVTAV
FT                   LTRIKVSADDPAFLEPEKFIGPVYSPEEQMALEATYGWHMKRDGKYLRRVVASPAPRQI
FT                   IESAAIELLLKEGHVVICSGGGGVPVAGEGEGVEAVIDKDLAAALLAEQIAADGLIILT
FT                   DADAVYEHWGTPQQRAIRQASPDELAPFAKADGAMGPKVTAVSGYVKRCGKPAWIGALS
FT                   RIDDTLAGRAGTCICL"
FT   gene            complement(643285..644352)
FT                   /gene="purK"
FT                   /locus_tag="SeHA_C0641"
FT   CDS_pept        complement(643285..644352)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purK"
FT                   /locus_tag="SeHA_C0641"
FT                   /product="phosphoribosylaminoimidazole carboxylase, ATPase
FT                   subunit"
FT                   /EC_number="4.1.1.21"
FT                   /note="identified by match to protein family HMM PF02222;
FT                   match to protein family HMM TIGR01161"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0641"
FT                   /db_xref="EnsemblGenomes-Tr:ACF66643"
FT                   /protein_id="ACF66643.1"
FT                   /translation="MKQVCVLGNGQLGRMLRQAGEPLGIAVWPVGLDAEPTAVPVQQSV
FT                   ITAEIERWPETALTRELARHPAFVNRDVFPIIADRLTQKQLFDKLGLATAPWQLLTSAD
FT                   EWSGIFDRLGELAIIKRRVGGYDGRGQWRLRADETGQLPDDCYGECIVERGIHFSGEVS
FT                   LVGARAHDGSTVFYPLTHNLHQDGILRTSVAFPQANAEQQEQAESMLSAIMQALNYVGV
FT                   MAMECFITPEGLLINELAPRVHNSGHWTQNGASISQFELHLRAITGLPLPAPVINAPSV
FT                   MINLIGSELNYDWLKLPLVHLHWYDKAVRPGRKVGHLNLTDSDTSRLSATLEALSPLLP
FT                   GEYASGIIWAQSKLK"
FT   gene            complement(644349..644858)
FT                   /gene="purE"
FT                   /locus_tag="SeHA_C0642"
FT   CDS_pept        complement(644349..644858)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purE"
FT                   /locus_tag="SeHA_C0642"
FT                   /product="phosphoribosylaminoimidazole carboxylase,
FT                   catalytic subunit"
FT                   /EC_number="4.1.1.21"
FT                   /note="identified by match to protein family HMM PF00731;
FT                   match to protein family HMM TIGR01162"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0642"
FT                   /db_xref="EnsemblGenomes-Tr:ACF67003"
FT                   /protein_id="ACF67003.1"
FT                   /translation="MSSRNNPARVAIVMGSKSDWATMQFAAEIFEILDVPHHVEVVSAH
FT                   RTPDKLFSFAETAEENGYQVIIAGAGGAAHLPGMIAAKTLVPVLGVPVQSAALSGVDSL
FT                   YSIVQMPRGIPVGTLAIGKAGAANAALLAAQILAQHDAELHQRIADWRKAQTDEVLENP
FT                   DPRGTL"
FT   gene            complement(644976..645698)
FT                   /gene="lpxH"
FT                   /locus_tag="SeHA_C0643"
FT   CDS_pept        complement(644976..645698)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lpxH"
FT                   /locus_tag="SeHA_C0643"
FT                   /product="UDP-2,3-diacylglucosamine hydrolase"
FT                   /EC_number="3.6.1.-"
FT                   /note="identified by match to protein family HMM PF00149;
FT                   match to protein family HMM TIGR01854"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0643"
FT                   /db_xref="EnsemblGenomes-Tr:ACF67673"
FT                   /db_xref="GOA:B4T9M8"
FT                   /db_xref="InterPro:IPR010138"
FT                   /db_xref="InterPro:IPR024654"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4T9M8"
FT                   /protein_id="ACF67673.1"
FT                   /translation="MATLFIADLHLQTEEPAIVAGFLRFLAVEARQADALYILGDLFEA
FT                   WIGDDDPNPLHREMAVAIKSLVDSGVPCFFIHGNRDFLIGKRFARESGMILLPQEKVLD
FT                   LYGRNVLIMHGDTLCTDDAGYQAFRAKVHNPWVQRLFLTLPLFIRRRIAARMRAGSKAA
FT                   NSSKSLDIMDVNAQTVVAEMEKHRVQWLIHGHTHRPAVHELSANDQPAFRVVLGAWHHE
FT                   GSMVKVTPDNVELIAFPL"
FT   gene            complement(645701..646195)
FT                   /gene="ppiB"
FT                   /locus_tag="SeHA_C0644"
FT   CDS_pept        complement(645701..646195)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ppiB"
FT                   /locus_tag="SeHA_C0644"
FT                   /product="peptidylprolyl isomerase"
FT                   /EC_number="5.2.1.8"
FT                   /note="identified by match to protein family HMM PF00160"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0644"
FT                   /db_xref="EnsemblGenomes-Tr:ACF69646"
FT                   /protein_id="ACF69646.1"
FT                   /translation="MVTFHTNHGDIVIKTFDDKAPETVKNFLDYCREGFYNNTIFHRVI
FT                   NGFMIQGGGFEPGMKQKATKEAIKNEANNGLKNTRGTLAMARTQAPHSATAQFFINVAD
FT                   NDFLNFSGESLQGWGYCVFAEVVEGMDVVDKIKGVATGRSGMHQDVPKEDVIIENVTVS
FT                   E"
FT   gene            646368..647753
FT                   /gene="cysS"
FT                   /locus_tag="SeHA_C0645"
FT   CDS_pept        646368..647753
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysS"
FT                   /locus_tag="SeHA_C0645"
FT                   /product="cysteinyl tRNA synthetase"
FT                   /EC_number="6.1.1.16"
FT                   /note="identified by match to protein family HMM PF01406;
FT                   match to protein family HMM PF09190; match to protein
FT                   family HMM PF09334; match to protein family HMM TIGR00435"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0645"
FT                   /db_xref="EnsemblGenomes-Tr:ACF70231"
FT                   /db_xref="GOA:B4TA89"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015273"
FT                   /db_xref="InterPro:IPR015803"
FT                   /db_xref="InterPro:IPR024909"
FT                   /db_xref="InterPro:IPR032678"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4TA89"
FT                   /protein_id="ACF70231.1"
FT                   /translation="MLKIFNTLTRQKEEFKPIHAGEVGMYVCGITVYDLCHIGHGRTFV
FT                   AFDVVARYLRFLGYKLKYVRNITDIDDKIIKRANENGESFVALVDRMIAEMHQDFDALN
FT                   ILRPDSEPRATHHIQEIIELTRTLIEKGHAYVADNGDVMFDVPTDPTYGQLSRQDLEQL
FT                   QAGARVDVVDVKRNPMDFVLWKMSKEGEPSWPSPWGEGRPGWHIECSAMNCKQLGNHFD
FT                   IHGGGSDLMFPHHENEIAQSTCAHDGEYVNYWMHSGMVMVDREKMSKSLGNFFTVRDVL
FT                   KYYDAETVRYFLMSGHYRSQLNYSEENLKQARASLERLYTALRGTDKSAAPAGGEAFEA
FT                   RFVEAMNDDFNTPEAYSVLFDMAREVNRLKGEDMTAANAMASHLRKISGVLGLLEQEPD
FT                   VFLQSGAQADDGEVAEIEALIQQRLDARKAKDWAAADAARDRLTEMGIILEDGPQGTTW
FT                   RRK"
FT   gene            complement(647798..648622)
FT                   /locus_tag="SeHA_C0646"
FT   CDS_pept        complement(647798..648622)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0646"
FT                   /product="putative outer membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0646"
FT                   /db_xref="EnsemblGenomes-Tr:ACF66023"
FT                   /protein_id="ACF66023.1"
FT                   /translation="MKRFAFALWLSAISLNAYANSANCHQKANTPESIAATMDQALQLK
FT                   QQLNSQPDPVVILVRQGQDMSSRHLTWSHAGYAMRQPNGDWRVYHNLNTCGTAESALYI
FT                   QGLYEFLADDLVNQSIAVLRPRSDIATALQTLLHSAIKLNLFHSPRYNLIAWPFSGPYQ
FT                   NSNGWLLEVFARANDAQVWSRNDARRWLQLQGYQPSIVSAGAFERLGAKLFTPNVFTDD
FT                   QPAELLRKGNVGLNSGDSVIRFIAHYSRAMPGCEHQNLGESVCVYLSPGAKK"
FT   gene            complement(648619..649056)
FT                   /locus_tag="SeHA_C0647"
FT   CDS_pept        complement(648619..649056)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0647"
FT                   /product="putative inner membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0647"
FT                   /db_xref="EnsemblGenomes-Tr:ACF66564"
FT                   /protein_id="ACF66564.1"
FT                   /translation="MNKMTFAAAVICFSFSHASYSEEMSATGWYAASSAVVSVGSSALV
FT                   SGIILSPVLLPLNLSIGSVVENKKQKTALLTTKSPDNKDIKMQVPLNVVKEGNLKAGDK
FT                   VTLEKTQEGTGAYLKKEGKVLAHMVNQDDAGLSSNQTVPAK"
FT   gene            complement(649049..649594)
FT                   /locus_tag="SeHA_C0648"
FT   CDS_pept        complement(649049..649594)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0648"
FT                   /product="inner membrane protein YbcI"
FT                   /note="identified by match to protein family HMM PF04307"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0648"
FT                   /db_xref="EnsemblGenomes-Tr:ACF67602"
FT                   /protein_id="ACF67602.1"
FT                   /translation="MPTVITHAAVPLCLGAGLGLKVIPPRLLFAGVVLAMLPDADVLAF
FT                   KFGVAYGNVFGHRGFTHSLLFAFVLPLLCVLAGRRWFRAGQVRCWLFLTVSLLSHSLLD
FT                   SITTGGKGVGWLWPWSDERFFAPWQVIKVAPFALSSYITPYGHQVILSELLWVWLPGSI
FT                   LVLFLWVLKTHIKRNQYE"
FT   gene            complement(649721..649933)
FT                   /locus_tag="SeHA_C0649"
FT   CDS_pept        complement(649721..649933)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0649"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0649"
FT                   /db_xref="EnsemblGenomes-Tr:ACF66020"
FT                   /protein_id="ACF66020.1"
FT                   /translation="MATFSLGKHPHVELCDLLKLEGWSESGAQAKIAIADGLVKVDGVV
FT                   ETRKRCKIVAGQTVSFEGQSVNVVA"
FT   gene            complement(649935..650801)
FT                   /gene="folD"
FT                   /locus_tag="SeHA_C0650"
FT   CDS_pept        complement(649935..650801)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folD"
FT                   /locus_tag="SeHA_C0650"
FT                   /product="methylenetetrahydrofolate
FT                   dehydrogenase/methenyltetrahydrofolate cyclohydrolase"
FT                   /EC_number="1.5.1.5"
FT                   /EC_number="3.5.4.9"
FT                   /note="identified by match to protein family HMM PF00763;
FT                   match to protein family HMM PF02882"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0650"
FT                   /db_xref="EnsemblGenomes-Tr:ACF69751"
FT                   /db_xref="GOA:B4TA94"
FT                   /db_xref="InterPro:IPR000672"
FT                   /db_xref="InterPro:IPR020630"
FT                   /db_xref="InterPro:IPR020631"
FT                   /db_xref="InterPro:IPR020867"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4TA94"
FT                   /protein_id="ACF69751.1"
FT                   /translation="MAAKIIDGKTIAQQVRSEVAQKVQARVAAGLRAPGLAVVLVGSNP
FT                   ASQIYVASKRKACDEVGFVSRSYDLPETTSEAELLALIDTLNADNTIDGILVQLPLPAG
FT                   IDNVKVLERIAPDKDVDGFHPYNVGRLCQRAPRLRPCTPRGIVTLLERYNIDTYGLNAV
FT                   VIGASNIVGRPMSMELLLAGCTTTVTHRFTKDLRHHVEHADLLIVAVGKPGFIPGEWIK
FT                   EGAIVIDVGINRLENGKVVGDVVFDEAAARASYITPVPGGVGPMTVATLIENTLQACIE
FT                   YHDPQGK"
FT   gene            650939..651094
FT                   /locus_tag="SeHA_C0651"
FT   CDS_pept        650939..651094
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0651"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0651"
FT                   /db_xref="EnsemblGenomes-Tr:ACF66069"
FT                   /protein_id="ACF66069.1"
FT                   /translation="MTRKRAMINQKETIHHPGYGYRNPSPLIASGGIMRHFIQNKIRPF
FT                   LYPNKN"
FT   gene            complement(651246..652226)
FT                   /locus_tag="SeHA_C0652"
FT   CDS_pept        complement(651246..652226)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0652"
FT                   /product="IS5 transposase"
FT                   /note="identified by match to protein family HMM PF01609"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0652"
FT                   /db_xref="EnsemblGenomes-Tr:ACF68730"
FT                   /protein_id="ACF68730.1"
FT                   /translation="MSHQLTFADSEFSTKRRQTRKEIFLSRMEQILPWQNMTAVIEPFY
FT                   PKAGNGRRPYPLETMLRIHCMQHWYNLSDGAMEDALYEIASMRLFARLSLDSALPDRTT
FT                   IMNFRHLLEQHQLARQLFKTINRWLAEAGVMMTQGTLVDATIIEAPSSTKNKEQQRDPE
FT                   MHQTKKGNQWHFGMKAHIGVDAKSGLTHSLVTTAANEHDLNQLGNLLHGEEQFVSADAG
FT                   YQGAPQREELAEVDVDWLIAERPGKVKTLKQHPRKNKTAINIEYMKASIRAKVEHPFRI
FT                   IKRQFGFVKARYKGLLKNDNQLAMLFTLANLFRVDQMIRQWERSH"
FT   gene            652547..653104
FT                   /locus_tag="SeHA_C0653"
FT   CDS_pept        652547..653104
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0653"
FT                   /product="type-1 fimbrial protein, A chain"
FT                   /note="identified by match to protein family HMM PF00419"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0653"
FT                   /db_xref="EnsemblGenomes-Tr:ACF69251"
FT                   /protein_id="ACF69251.1"
FT                   /translation="MKHKLMTSTIASLMFVAGAAVAADPTPVSVSGGTIHFEGKLVNAA
FT                   CAVSTKSADQTVTLGQYRTASFTAIGNTTAQVPFSIVLNDCDPKVAATAAVAFSGQADN
FT                   TNPNLLAVSSADNSTTATGVGIEILDNTSSPLKPDGATFSAKQALVEGTNTLRFTARYK
FT                   ATAAAATPGQANADATFIMKYE"
FT   gene            653218..653712
FT                   /locus_tag="SeHA_C0654"
FT   CDS_pept        653218..653712
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0654"
FT                   /product="fimbrial protein internal segment"
FT                   /note="identified by match to protein family HMM PF00419"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0654"
FT                   /db_xref="EnsemblGenomes-Tr:ACF67100"
FT                   /protein_id="ACF67100.1"
FT                   /translation="MSPVIAQPVMVESGRVHLRGQLVNGGCAVATESQDLRVLMGQYRT
FT                   NAFTGPGSFAPVSVPFSLRLISCSAEVWRHVGIAFAGVTPAEDPHVFLASGEGIGNAGI
FT                   GLALFDDQQRQIIPNTLPLHYTPILTSEMTLHFTARYRAISENMTPGRIHSEVWFTLVY
FT                   P"
FT   gene            653735..654448
FT                   /locus_tag="SeHA_C0655"
FT   CDS_pept        653735..654448
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0655"
FT                   /product="chaperone protein FimC"
FT                   /note="identified by match to protein family HMM PF00345;
FT                   match to protein family HMM PF02753"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0655"
FT                   /db_xref="EnsemblGenomes-Tr:ACF67614"
FT                   /protein_id="ACF67614.1"
FT                   /translation="MQKVFFTMLNSIKVGFIVLLTLFTSLNVQAAGGIALGATRVIYPS
FT                   AAKQTSLAISNSDTQERYLVNSWIENNAGQKEKTFIVTPPLFVSEPKSENTLRIIYAGQ
FT                   PLPGDRESLFWMNVKAIPSVDKSHIEGKNVLQLAILSRIKLFVRPANLPQTPEDAPTLL
FT                   KFSRVGNHLKITNPSAYYLTLVNISVGAKKIDNVMIAPKSDMQIPLPTGAQGNVTFQSV
FT                   NDYGALTSATTASLG"
FT   gene            654479..657091
FT                   /locus_tag="SeHA_C0656"
FT   CDS_pept        654479..657091
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0656"
FT                   /product="outer membrane usher protein SfmD"
FT                   /note="identified by match to protein family HMM PF00577"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0656"
FT                   /db_xref="EnsemblGenomes-Tr:ACF67133"
FT                   /protein_id="ACF67133.1"
FT                   /translation="MKKTTWFAGRFPGYVSPLSSVALSVLAALCPLTSRGESYFNPAFL
FT                   SADTASVADLSRFEKGNHQPPGIYRVDIWRNDEFVATQDIRFEAGAVGTGDKSGGLMPC
FT                   FTPEWIKRLGVNTAAFPVSDKGVDTTCIHLPEKIPGAEVAFDFASMRLNISLPQASLLN
FT                   SARGYIPPEEWDEGIPAALINYSFTGSRGTDSDSYFLSLLSGLNYGPWRLRNNGAWNYS
FT                   KGDGYHSQRWNNIGTWVQRAIIPLKSELVMGDSNTGNDVFDSVGFRGARLYSSDNMYPD
FT                   SLQGYAPTVRGIARTAAKLTIRQNGYVIYQSYVSPGAFAITDLNPTSSSGDLEVTVDEK
FT                   DGSQQRYTVPYSTVPLLQREGRVKYDLVAGDFRSGNSQQSSPFFFQGTVIAGLPAGLTA
FT                   YGGTQLADRYRAVVVGAGRNLGDWGAVSVDVTHARSQLADDSTHQGQSLRFLYAKSLNN
FT                   YGTNFQLLGYRYSTRGFYTLDDVAYRSMEGYDYEYDSDGRRHKVPVAQSYHNLRYSKKG
FT                   RFQVNISQNLGDYGSLYLSGSQQNYWNTADTNTWYQLGYASGWQGISYSLSWSWNESVG
FT                   ISGADRILAFNMSVPFSVLTGRRYARDTLLDRTYATFNANRNRDGDNSWQTGVGGTLLE
FT                   GRNLSYSVTQGRSSTNGYSGSASASWQATYGTLGVGYNYDRDQHDYNWQLSGGVVGHAD
FT                   GITFSQPLGDTNVLIKAPGAKGVRIENQTGVKTDWRGYAVMPYATVYRYNRVALDTNTM
FT                   DNHTDVENNVSSVVPTEGALVRAAFDTRIGVRAIITARLGGRPLPFGAIVRETASGITS
FT                   MVGDDGQIYLSGLPLKGELFIQWGEGKNARCIAPYALAEDSLKQAITIASATCIRPSS"
FT   gene            657106..658113
FT                   /locus_tag="SeHA_C0657"
FT   CDS_pept        657106..658113
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0657"
FT                   /product="mannose binding protein FimH"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0657"
FT                   /db_xref="EnsemblGenomes-Tr:ACF67645"
FT                   /protein_id="ACF67645.1"
FT                   /translation="MKIYSALLLAGTALFFTHPALATVCRNSNGTATDIFYDLSDVFTS
FT                   GNNQPGQVVTLPEKSGWVGVNATCPAGTTVNYTYRSYVSELPVQSTEGNFKYLKLNDYL
FT                   LGAMSITDSVAGVFYPPRNYILMGVDSNVSQQRPFGVQDSKLVFKLKVIRPFINMVTIP
FT                   RQTMFTVYVTTSTGDALSTPVYTISYSGKVEVPQNCEVNAGQVVEFDFGDIGASLFSQA
FT                   GAGNRPQGVTPQTKTIAIKCTNVAAQAYLSMRLEAEKASGQAMVSDNPDLGFVVANSNG
FT                   TPLTPNNLSSKIPFHLDDNAAARVGIRAWPISVTGNKPVEGPFTARGYLRVDYD"
FT   gene            658123..658641
FT                   /locus_tag="SeHA_C0658"
FT   CDS_pept        658123..658641
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0658"
FT                   /product="major fimbrial subunit"
FT                   /note="identified by match to protein family HMM PF00419"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0658"
FT                   /db_xref="EnsemblGenomes-Tr:ACF66080"
FT                   /protein_id="ACF66080.1"
FT                   /translation="MIFRRVFIAIGCVLFSPLSQANSSLGEVNIELRGNVVDFTCAVVA
FT                   GDSNKSVNLGTWPTKQLHAAGDATQPVAFSLKLEGCPPGSASITFSGTPAPGTALLALA
FT                   DTAMAQKLAIEIRDGDQRRLPLEQASKAVDIDNNGNATLKFYANYIALADGVQPGLANA
FT                   DATFLINYN"
FT   gene            complement(658687..659319)
FT                   /locus_tag="SeHA_C0659"
FT   CDS_pept        complement(658687..659319)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0659"
FT                   /product="fimbriae Z protein"
FT                   /note="identified by match to protein family HMM PF00072;
FT                   match to protein family HMM PF00196"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0659"
FT                   /db_xref="EnsemblGenomes-Tr:ACF66592"
FT                   /protein_id="ACF66592.1"
FT                   /translation="MKPASVIIMDEHPIVRMSIEVLLGKNSNIQVVLKTDDSRTAIEYL
FT                   RTYPVDLVILDIELPGTDGFTLLKRIKSIQEHTRILFLSSKSEAFYAGRAIRAGANGFV
FT                   SKRKDLNDIYNAVKMILSGYSFFPSETLNFISNTRPPKGGHHDMPLSNREVTVLRYLAN
FT                   GMSNKEIAEQLLLSNKTISAHKANIFSKLGLHSIVELIDYAKSHELL"
FT   gene            complement(659923..660645)
FT                   /locus_tag="SeHA_C0660"
FT   CDS_pept        complement(659923..660645)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0660"
FT                   /product="fimbriae Y protein"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0660"
FT                   /db_xref="EnsemblGenomes-Tr:ACF68374"
FT                   /protein_id="ACF68374.1"
FT                   /translation="MRSVPRRERHRRLRNAKDCACRYHSPTPQIFDRLELLNQQLNYAL
FT                   PVGIISQAIITTDNYLGYSLSHYLFSGKRTAAFRSLDDISLWIEKGSLRQLIVDMEALP
FT                   VSCIEALNQLRALSWQQSDIQIYLLVSDKTPAITQFIRMAGHFFVLSRRQNLASVREAL
FT                   LSASKPRLSESFSRTDWLMIETLAQGASLKEIARQQSVPYHRVVYRLKQLITLLNLPHR
FT                   QSFLRLVQQLNVTFHDIF"
FT   gene            complement(660606..660758)
FT                   /locus_tag="SeHA_C0661"
FT   CDS_pept        complement(660606..660758)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0661"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0661"
FT                   /db_xref="EnsemblGenomes-Tr:ACF70018"
FT                   /protein_id="ACF70018.1"
FT                   /translation="MKHQSNEALLFTLVQRWNKVIYGQPYYQIYIRAMEKAGCAAYHAG
FT                   KDTAV"
FT   gene            complement(661137..661733)
FT                   /locus_tag="SeHA_C0663"
FT   CDS_pept        complement(661137..661733)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0663"
FT                   /product="fimbriae W protein"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0663"
FT                   /db_xref="EnsemblGenomes-Tr:ACF69376"
FT                   /protein_id="ACF69376.1"
FT                   /translation="MLSIAIKEQNSHFEHGLKIIMTRLANQWQQKIDFLPPEEIDNADI
FT                   AFLALDDDWFSAGCYQIPMHTQHQLRVIICNKCDKEKLMFRPCLYMLPHIYREDDVEEI
FT                   TRKMILILHKRALRHSVPSGICHYCTTRHFSVTERHLLKLIASGYHLSETAALLSLSEE
FT                   QTKSLRRSIMRKLHVKTEQQFLKYIRVNLHFLLSK"
FT   gene            661689..661925
FT                   /locus_tag="SeHA_C0662"
FT   CDS_pept        661689..661925
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0662"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0662"
FT                   /db_xref="EnsemblGenomes-Tr:ACF66992"
FT                   /protein_id="ACF66992.1"
FT                   /translation="MLKVTVLFLNSDTQHKKYPTRQVNHGEILKKLIDFLNTGGLNSYF
FT                   MRAEMCPGDFLEPGIAPEKTIFVHLVSNQNKSH"
FT   gene            661988..662064
FT                   /locus_tag="SeHA_C0664"
FT   tRNA            661988..662064
FT                   /locus_tag="SeHA_C0664"
FT                   /product="tRNA-Arg"
FT   gene            complement(662629..662847)
FT                   /pseudo
FT                   /locus_tag="SeHA_C0665"
FT                   /note="ISEhe3, transposase OrfA; this region contains one
FT                   or more premature stops and/or frameshifts; identified by
FT                   match to protein family HMM PF01527"
FT   gene            663019..663177
FT                   /locus_tag="SeHA_C0666"
FT   CDS_pept        663019..663177
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0666"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0666"
FT                   /db_xref="EnsemblGenomes-Tr:ACF68014"
FT                   /protein_id="ACF68014.1"
FT                   /translation="MGFGHMRILACIGQLPESGLMHYGSVGFFFGTDGALRLLAKKPDG
FT                   AFVTYDM"
FT   gene            complement(663234..664874)
FT                   /locus_tag="SeHA_C0667"
FT   CDS_pept        complement(663234..664874)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0667"
FT                   /product="putative inner membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0667"
FT                   /db_xref="EnsemblGenomes-Tr:ACF68995"
FT                   /protein_id="ACF68995.1"
FT                   /translation="MVNNRLKMVIAILIVFSLVYSIGFITPMNSDDYTYALRELSLSSV
FT                   KMHYLGWSGRVVSDTISTSLLKFFSPHIYNAINSAALTLMVLCWTMIPATLTKSSPSPY
FT                   VMIFLFFLYFVANPALGQTNFWLVGSANYLWTNMFIAIYILISIYLSNGKKSNLILFVY
FT                   AISSIFAGCSNENTSLVVVLISVAYFFIMNRNKYLLIGVFGSAIGAGVLLLAPGNLSRA
FT                   STIQDWYNQPLAWRVLEHFSERLPSAMGAYWQVYIAFIILLISVVLSRNSSSKLMFGSF
FT                   LFMLGAIAANVAFLASPAMPSRALNGALCFMILSISFVAHSAFTKFNKASIYLSVTTYA
FT                   MAFLYFIPSYILYYSSIKSISKQTEIREEIIDRAKHNKQDQAIIPDYYFPPVLHAGPSL
FT                   DTFNSEAMSRYYGIDLKITAPGFFDYSRAFNFKPLNINAKICNNVYIKSLWIYKQQMGI
FT                   KTFVIFEFNKNPADSLDENTAMFISFKTKDGKIINADVDKKTFQIDGRWLSGRAINGID
FT                   SNELESITSGTWDVRTGARTNENITEIIK"
FT   gene            complement(664867..665793)
FT                   /locus_tag="SeHA_C0668"
FT   CDS_pept        complement(664867..665793)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0668"
FT                   /product="bactoprenol glucosyl transferase"
FT                   /EC_number="2.4.1.-"
FT                   /note="identified by match to protein family HMM PF00535"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0668"
FT                   /db_xref="EnsemblGenomes-Tr:ACF68388"
FT                   /protein_id="ACF68388.1"
FT                   /translation="MKISLVVPVFNEEATIPIFYKTVREFEELKPYEVEIVFINDGSKD
FT                   ATESIINKIAASDPLVIPLSFTRNFGKEPALFAGLDHATGDAVIPIDVDLQDPIEVIPH
FT                   LIEKWQAGADMVLAKRSDRSTDGRMKRKTAEWFYKLHNKISNPKIEENVGDFRLMSREV
FT                   VENIKQMPERNLFMKGVLSWVGGKTDVVEYARAERVAGDSKFNGWKLWNLALEGITSFS
FT                   TFPLRIWTYIGLFIAGMSFLYGAWMIIDKLIFGNNVPGYPSLLVSVLFLGGVQLIGIGI
FT                   LGEYIGRIYIETKKRPKYIIKNEKKNG"
FT   gene            complement(665790..666152)
FT                   /locus_tag="SeHA_C0669"
FT   CDS_pept        complement(665790..666152)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0669"
FT                   /product="bactoprenol-linked glucose translocase"
FT                   /note="identified by match to protein family HMM PF04138"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0669"
FT                   /db_xref="EnsemblGenomes-Tr:ACF70042"
FT                   /protein_id="ACF70042.1"
FT                   /translation="MLKLFAKYTSIGVLNTLIHWGVFAFCVYGMHTHQALANFSGFVIA
FT                   VSFSFYANARFTFNASTTTLRYMMYVGFMGTLSAVVGWMADKCSLPPLLTLVTFSAISL
FT                   ICGFIYSKFIVFRDAK"
FT   gene            666414..666486
FT                   /pseudo
FT                   /locus_tag="SeHA_C0670"
FT   tRNA            666414..666486
FT                   /pseudo
FT                   /locus_tag="SeHA_C0670"
FT                   /product="tRNA-OTHER"
FT   gene            complement(666650..666781)
FT                   /pseudo
FT                   /locus_tag="SeHA_C0671"
FT                   /note="copE1; this gene contains a premature stop which may
FT                   be the result of sequencing error"
FT   gene            complement(667020..667349)
FT                   /pseudo
FT                   /locus_tag="SeHA_C0672"
FT                   /note="sensor kinase CusS; this gene contains a premature
FT                   stop which may be the result of sequencing error;
FT                   identified by match to protein family HMM PF02518"
FT   gene            667449..667637
FT                   /locus_tag="SeHA_C0673"
FT   CDS_pept        667449..667637
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0673"
FT                   /product="cation efflux system protein CusA"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0673"
FT                   /db_xref="EnsemblGenomes-Tr:ACF66759"
FT                   /protein_id="ACF66759.1"
FT                   /translation="MLRVRPKAMTVAVIIAGLLPVLWGTGAGSEVMSRITAPLLSLFII
FT                   PAAYKLMWLRRHRRLAA"
FT   gene            complement(667688..668542)
FT                   /locus_tag="SeHA_C0674"
FT   CDS_pept        complement(667688..668542)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0674"
FT                   /product="transcriptional regulator, AraC family protein"
FT                   /note="identified by match to protein family HMM PF00165"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0674"
FT                   /db_xref="EnsemblGenomes-Tr:ACF66356"
FT                   /protein_id="ACF66356.1"
FT                   /translation="MDALSRLLTLNAPQGSIDKNCPLGGDWQLPHAAGELSVIRWHTVT
FT                   QGEAQLEMPTGDAMTLTPGKVVILPQNSAHRLRQSGESPTHIVCGSLRLHTTSRYFLTA
FT                   LPEVLCLAPPPHSPASIWINATILLLQQESERHLPGADVLYSQQCATLFTLAVRDWLSQ
FT                   AGTAKSVLNLLLHPRLGRVILHMLETPAHPWTVETLAQRVHMSRASFAQLFRDVSATTP
FT                   LAVLTTLRLQIAAQTLSREVLPVMVIAESVGYASESSFHKAFVREFGCTPGEYRKRVSA
FT                   LGR"
FT   gene            668758..670083
FT                   /locus_tag="SeHA_C0675"
FT   CDS_pept        668758..670083
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0675"
FT                   /product="probable pyridine nucleotide-disulfide
FT                   oxidoreductase YkgC"
FT                   /note="identified by match to protein family HMM PF00070;
FT                   match to protein family HMM PF01266; match to protein
FT                   family HMM PF02852; match to protein family HMM PF07992"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0675"
FT                   /db_xref="EnsemblGenomes-Tr:ACF68055"
FT                   /protein_id="ACF68055.1"
FT                   /translation="MTQYQALIIGFGKAGKTLAATLAKTGWRVAIIEQSASMFGGTCIN
FT                   IGCIPTKTLVHDAEREGDFSVAMQRKAAVVNFLRDKNFHNLADLDNVDVIEGRAEFIDN
FT                   HTLRVFQADGERVLRGEKIFINTGAESVIPAITGLTTTAGVFDSTGLLSLSQRPARLGI
FT                   LGGGYIGLEFASMFANFGTKVTIFEAAPQFLPREDRDIAQAITRILQEKGVELILNANV
FT                   QAVSSKEGAVQVETPEGAHLVDALLVASGRKPATAGLQLQNAGVAVNERGGIIVDDYLR
FT                   TTADNIWAMGDVTGGLQFTYISLDDFRIVRDGLLGDGKRSTRDRQNVPYSVFMTPPLSR
FT                   VGLTEEQARASGATVQVVTLPVAAIPRARVMNDTRGVLKAVVDVNTQRIVGVSLLCVDS
FT                   HEMINIVKTVMDADLPYTVLRDQIFTHPTMSESLNDLFSLIK"
FT   gene            670240..670476
FT                   /locus_tag="SeHA_C0676"
FT   CDS_pept        670240..670476
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0676"
FT                   /product="conserved domain protein"
FT                   /note="identified by match to protein family HMM PF07338"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0676"
FT                   /db_xref="EnsemblGenomes-Tr:ACF67734"
FT                   /protein_id="ACF67734.1"
FT                   /translation="MLKVTTLIASLLAAPLAFSASAQPLTDVEYISVSAVSATPSMLED
FT                   AIARLAQSKQASSWKITSMRIDNTGYATAILYK"
FT   gene            670489..671049
FT                   /locus_tag="SeHA_C0677"
FT   CDS_pept        670489..671049
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0677"
FT                   /product="protein of unknown function, superfamily"
FT                   /note="identified by match to protein family HMM PF04224"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0677"
FT                   /db_xref="EnsemblGenomes-Tr:ACF67064"
FT                   /protein_id="ACF67064.1"
FT                   /translation="MDKYLRLLSQGDRLGLTLIRLSIAIVFIWIGLLKFVPYEADSITP
FT                   FVANSPFMSFFYEHPEEYRQHLTHEGELKPEERAWQTANNTYAFSDGLGVVELIIAALV
FT                   LANPVSRWLGLAGGVLAFLTPFVTLSFLITTPEVWVMPLGDAHYGFPYLSGAGRLVLKD
FT                   TLMLAGAVMIMADSARSLLLQRQ"
FT   gene            complement(671128..672303)
FT                   /locus_tag="SeHA_C0678"
FT   CDS_pept        complement(671128..672303)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0678"
FT                   /product="heat shock protein DnaJ domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0678"
FT                   /db_xref="EnsemblGenomes-Tr:ACF68980"
FT                   /protein_id="ACF68980.1"
FT                   /translation="MNKIIKRLEIIKSAIELEDEEIIRQQLIYLKNEPQDAVISAIAQA
FT                   IEARRFSDAMQEIAAWLQAQRALSTWQDPSIAASKLELKALEAQLRDLIDKRNARVQIL
FT                   DDFNDLYHLRLGPLMSRILELRKQLAVSMQRKQEAEIKRREKDYQSCLQFISQAVDQLA
FT                   TLKQQWTGLNAASREAVGIRQRIQQQTELITALLAEIRELEADFSHQDDSAFRQAQENA
FT                   EQDYHQYREQQQEAQFRYARDQRLSADERSELKRLWRQASRLCHPDVVADELKEKAHQM
FT                   MVQLNQARQNADLAAIRALLTQLQSGLEPMMASDRLNNLEHLRHKIRQLRTQIDALLKE
FT                   ITQLETENAWRLASSVADKEAYFSEQERALTEIRNTLEAQVQQVEQELLSG"
FT   gene            672629..674023
FT                   /locus_tag="SeHA_C0679"
FT   CDS_pept        672629..674023
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0679"
FT                   /product="phenylalanine-specific permease"
FT                   /note="identified by match to protein family HMM PF00324"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0679"
FT                   /db_xref="EnsemblGenomes-Tr:ACF68328"
FT                   /protein_id="ACF68328.1"
FT                   /translation="MKNASTASGASVSDAASKNEPTLQRGLQNRHIQLIALGGAIGTGL
FT                   FLGIGPAIQMAGPAVLLGYGVAGIIAFLIMRQLGEMVVEEPVSGSFAHFAWKYWGPFAG
FT                   FLSGWNYWVMFVLVGMAELTAAGIYMQYWLPDVPTWVWAAAFFIIINAVNLVNVRLYGE
FT                   TEFWFALIKVLAIIGMIGFGLWLLFSGHGGEHASIDNLWRYNGFFATGWHGLLLSLAVI
FT                   MFSFGGLELIGITAAEARDPQKSIPKAVNQVVYRILLFYIGSLVVLLALYPWVEVKSNS
FT                   SPFVMIFHNLDSNVVASALNFVILVASLSVYNSGVYSNSRMLFGLSVQGNAPKFLTRVS
FT                   HRGVPVNSLILSGAITSLVVLINYLLPQKAFSLLMALVVATLLLNWIMICLAHLRFRAA
FT                   MRRKGRETQFKALFYPAGNYLCIAFLALILVLMCTMDDMRLSAILLPVWIVFLFIAFTV
FT                   LRRKAH"
FT   gene            complement(674065..675312)
FT                   /locus_tag="SeHA_C0680"
FT   CDS_pept        complement(674065..675312)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0680"
FT                   /product="transporter, small conductance mechanosensitive
FT                   ion channel"
FT                   /note="identified by match to protein family HMM PF00924"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0680"
FT                   /db_xref="EnsemblGenomes-Tr:ACF70367"
FT                   /protein_id="ACF70367.1"
FT                   /translation="MQELISRVEDLAGIEMNHTTSLVVIFGIIFLTAVVVHIILHWIVL
FT                   RAFEKRASASSRLWLQIITQNKLFHRLAFTLQGIIVNIQAALWLQKGSEAADILTTCAQ
FT                   LWIMTYALLSLFSLLDVIFNLSQKWPAASQLPLKGIFQGIKLIGAIIVGILMISLLIGQ
FT                   SPAILISGLGAMAAVLMLVFKDPILGLVAGIQLSANDMLKLGDWLEMPKYGADGAVIDI
FT                   GLTTVKVRNWDNTITTIPTWSLVSDSFKNWSGMSASGGRRIKRSINIDATSIHFLDDDE
FT                   KQRLLTAQLLKPYLTSRHQEIDEWNKQLDAPESALNHRRMTNIGTFRAYLNEYLRHHPR
FT                   IRKDMTLMVRQLAPDDHGLPIEIYAFTNTVVWLEYESIQADIFDHIFAVVEEFGLRIHQ
FT                   TPTGSDIRALSGTLRH"
FT   gene            675342..675524
FT                   /locus_tag="SeHA_C0681"
FT   CDS_pept        675342..675524
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0681"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0681"
FT                   /db_xref="EnsemblGenomes-Tr:ACF69886"
FT                   /protein_id="ACF69886.1"
FT                   /translation="MTAEWHLCKSGRLRFRHNQQQTGKSASGVIHTLYFILRPVNVVIL
FT                   RGSLFLNRRQSVNNE"
FT   gene            675623..677593
FT                   /locus_tag="SeHA_C0682"
FT   CDS_pept        675623..677593
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0682"
FT                   /product="lipase 1"
FT                   /EC_number="3.1.1.3"
FT                   /note="identified by match to protein family HMM PF00657;
FT                   match to protein family HMM PF03797; match to protein
FT                   family HMM TIGR01414"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0682"
FT                   /db_xref="EnsemblGenomes-Tr:ACF69225"
FT                   /protein_id="ACF69225.1"
FT                   /translation="MTQKRTLLKYGILSLALAAPLSACAFDSLTVIGDSLSDTGNNGRW
FT                   TWDSGQNKLYDEQLAERYGLELSPSSNGGSNYAAGGATATPELNPQDNTADQVRQWLAK
FT                   TGGKADHNGLYIHWVGGNDLAAAIAQPTMAQQIAGNSATSAAAQVGLLLDAGAGLVVVP
FT                   NVPDISATPMLLEAVITAGLGAAAPPALKAALDALAEGATPDFASRQQAIRKALLAAAA
FT                   TVSSNPFIQQLLVEQLLAGYEAAAGQASALTDYYNQMEEKGLEQHGGNIARADINGLFK
FT                   EILANPQAFGLTNTVGMACPPGVSASACSSAMPGFNASQDYLFADHLHPGPQVHTIIAQ
FT                   YIQSIIAAPVQATYLNQSVQSMAQGSRTTLDSRYQQLRQGENPVGSLGMFGGYSGGYQR
FT                   YDNNEADGNGNHNNLTVGVDYQLNEQVLLGGLIAGSLDKQHPDDNYRYDARGFQAAVFS
FT                   HLRAGQAWLDSDLHFLSAKFSNIQRSITLGALRRVEEGETNGRLWGARLTSGYDFVMVP
FT                   WLTTGPMLQYAWDYSHVNGYSEKLNTSTSMRFGDQNAHSQVGSAGWRLDLRHSIIHSWA
FT                   QINYRRQFGDDTYVANGGLKSTALTFSRDGKTQDKNWVDIAIGADFPLSATVSAFAGLS
FT                   QTAGLSDGNQTRYNVGFSARF"
FT   gene            677847..680489
FT                   /locus_tag="SeHA_C0683"
FT   CDS_pept        677847..680489
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0683"
FT                   /product="AAA superfamily ATPase with N-receiver domain"
FT                   /note="identified by match to protein family HMM PF00158;
FT                   match to protein family HMM PF00874; match to protein
FT                   family HMM PF07728"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0683"
FT                   /db_xref="EnsemblGenomes-Tr:ACF67355"
FT                   /protein_id="ACF67355.1"
FT                   /translation="MAIADSLRQKRSIISHHLNNLHREQRVVKVNSRPVLFLPVEALRR
FT                   HHRLAVRQGDYASIQALCAERQDSLELLIGAQGSLQESLRQCKAAISYPGAGLPLLLRG
FT                   PTGTGKSFLARQLWQYAIEQGILPPEAPFTVFNCAEYANNPELLTSKLFGHAKGAFTGA
FT                   DRAVSGLIETSNGGVLFIDEVHRLPPEGQEKLFHFMDNGTWRRLGESSDERSATVRLIF
FT                   ASTEDLEKHFLATFIRRIPVIVKILPIAERGQYERLAFIHHFFRREAQRLHHDLSLDSE
FT                   IISQLMQETLEGNVGGLENLIRNICASAWTFGQRDDGVLEVKAGQLPDRLLMEVPFTVP
FT                   QTAERIMIYREGGVFPRVSGQHQEYLRLTENICGLCEELAQENISARTFDKLVYQNLTL
FT                   YLDALMNKESPRARQDKRLRFIEDVGKAIAAHYDLELNAEFAYLTGRYLTSLPLTPVEA
FT                   SPSVRHVMLRWLEEAPGLAQRVAQKLLDVVNNKYDLLIDTLDRLVVAAIVSNAIDATSG
FT                   GKVKALIIAHGYSTASSIAGVANRLIGEKIYHAMDMPMEVAFSDVSRAIVDYLQHTDTR
FT                   AGVMVLIDMGYTKEIADALLSVIHGPLVVVDNVTTRLALNVASEIALQKNIEQIAEEIV
FT                   PLNQSRWDVFWPAQKKARALLVTCITGIGTAFKFKNLMEKSQLTDFDINIIACEYTRLK
FT                   NSRMAASLLNQYEVIAVVGTIDPQLAGVPWVGIEELLGEQGYAHLSQLLSGYLNDKQIA
FT                   LINKNMVREFSLHNVVNSLTILNANKTIGHIETIIAEWQSTLGFSFNNNLIISLYVHLS
FT                   CMIERLVMRNEITHYKNMTEFNERHGEFIAMVNHSFQRLKILYNVALPVAEIGYIHDIF
FT                   ELRIEDFHW"
FT   gene            complement(680617..681603)
FT                   /locus_tag="SeHA_C0684"
FT   CDS_pept        complement(680617..681603)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0684"
FT                   /product="sugar isomerase"
FT                   /note="identified by match to protein family HMM PF01380"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0684"
FT                   /db_xref="EnsemblGenomes-Tr:ACF67027"
FT                   /protein_id="ACF67027.1"
FT                   /translation="MSVAHENARRIISDILGKQNIERVWFVGCGGSLTGFWPGKYFLDC
FT                   EASKLAVGYITSNEFVHATPKALGKNSVVILASQQGNTAETVAAARVAREKGAATIGLV
FT                   YQPDTPLCEYSDYIIEYQWARYPETVDPAQQKAAYSLWLALEILAQTEGYAQYDELVSA
FT                   FGRFSDVVHGAQRQVQEDAQRFAAEWKDEKVVYMMGSGPSFGAAHQESICILLEMQWIN
FT                   SASIHSGEYFHGPFEITEPGTPFILLQSSGRTRPLDDRAIRFIERYQGKLQLIDADKLG
FT                   IQDLSTDVGEYFCGLLHNCVLDVYNLALATARNHPLTTRRYMWKVEY"
FT   gene            complement(681670..682731)
FT                   /locus_tag="SeHA_C0685"
FT   CDS_pept        complement(681670..682731)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0685"
FT                   /product="sugar isomerase"
FT                   /note="identified by match to protein family HMM PF01380"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0685"
FT                   /db_xref="EnsemblGenomes-Tr:ACF66288"
FT                   /protein_id="ACF66288.1"
FT                   /translation="MQVEDYMNETPLRLLEMLTQTREDLWRAAQALTERGVTRIILTGS
FT                   GTSYHGALTARTFMQRWCALPVDVCWPFMLDDETLARSGKALVVGISQGGGSLSTLAAM
FT                   ERARNVGHITASMAGVAPATIDRAADYILTVPCGEETAGAKTKGYHCTVLNLMLLALAV
FT                   AGQQQRLDGEQRRSLLLRMEKTFNHLPALVTASQAWAQTNALALRDSADIRLTGPATLF
FT                   GTVQEGALKMLETLRCPVSGYEFEEFIHGIYNAFNAQSALIMLDPQPDARQDRLAQILG
FT                   EWTPSIYRIGPQVENNGLNLNFPFVNDEDFAVFEYIIPLQMLCAILPPQKGINPAIPKD
FT                   PQFHQKMKSKQEI"
FT   gene            complement(682746..683600)
FT                   /locus_tag="SeHA_C0686"
FT   CDS_pept        complement(682746..683600)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0686"
FT                   /product="PTS system, mannose-specific enzyme II, D
FT                   component"
FT                   /note="identified by match to protein family HMM PF03613"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0686"
FT                   /db_xref="EnsemblGenomes-Tr:ACF66044"
FT                   /protein_id="ACF66044.1"
FT                   /translation="MSEVTQTLIDDAQAHSQSESRITARDLRSVFWRSFTLQGSWNYER
FT                   QQHMGYAFAMSPALKRIYQDPAELGRALQRHLVLFNTTPHLSTFVFGLSIAMEEENQRN
FT                   PDFNEESINAVKTSLMGPLAGIGDSIFWGSLKVIAAGMGIYFAQQGSILGPILALLVYN
FT                   IPHILCRWYALKLGYRAGTTWLMRLWQSGLMDRVTYIASIVGLMVVGAMTASMIDITTP
FT                   LSFTAGQTTMKVQDFIDKILPSLLPLLFTLGMYKLIRKGVNINWILLGTVVFGLLASAL
FT                   GLL"
FT   gene            complement(683603..684346)
FT                   /locus_tag="SeHA_C0687"
FT   CDS_pept        complement(683603..684346)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0687"
FT                   /product="phosphotransferase system PTS, sorbose-specific
FT                   IIC subunit"
FT                   /note="identified by match to protein family HMM PF03609"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0687"
FT                   /db_xref="EnsemblGenomes-Tr:ACF66585"
FT                   /protein_id="ACF66585.1"
FT                   /translation="MLLTATLLGLIAALGILDGRLLGVSMIDRPLVMCALTGLVCGNLH
FT                   EGILIGATLELIFLGNVAIGAAVPPDVVTGSVLATAFSIMSGRGPEAALTIAIPISMLA
FT                   QTLGVLVRVVNARFGHMADRYAAQGNTRMVAVMHLGGPTLLYFLSGFLPVFFAILLGSA
FT                   AVTWFLDAIPAFITNGLVVASKILPALGFALLISMMLSSKLMPYLGLGFLIAAYTKLDI
FT                   IAIALFAVVLAFIISQFLNTSQQEG"
FT   gene            complement(684361..684831)
FT                   /locus_tag="SeHA_C0688"
FT   CDS_pept        complement(684361..684831)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0688"
FT                   /product="PTS system sorbose subfamily IIB component"
FT                   /note="identified by match to protein family HMM PF03830"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0688"
FT                   /db_xref="EnsemblGenomes-Tr:ACF69761"
FT                   /protein_id="ACF69761.1"
FT                   /translation="MIKLVRIDYRLLHGQVVFAWTRALDIDHIIVANANAAGDAFVSMS
FT                   LSLAKPAGVSLDIITVEQAAEKLASGKLDHKKVMVVLGNTAETLAFVEKVPGISVINYG
FT                   GIAQKEGAQQFGKAIYLTEQEIADSQALKAKGIRLEMRQVPAHSAELLNDKL"
FT   gene            complement(684809..685258)
FT                   /locus_tag="SeHA_C0689"
FT   CDS_pept        complement(684809..685258)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0689"
FT                   /product="putative pts system mannose-specific enzyme iiab"
FT                   /note="identified by match to protein family HMM PF03610"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0689"
FT                   /db_xref="EnsemblGenomes-Tr:ACF70249"
FT                   /protein_id="ACF70249.1"
FT                   /translation="MRHVYVASHGPFARGLINSLSLLIGDEHGVTPVCAYDGDIVTTEQ
FT                   LEQTLENLIAQANGEEVVVFTDLLGGSINNSAAKVLMRHRHVFVVAGVNMTLLLEFLLC
FT                   EEESTDAAITYATNAARESIVFINTLITQPSADLQGESHDQISAH"
FT   gene            complement(685458..686111)
FT                   /locus_tag="SeHA_C0690"
FT   CDS_pept        complement(685458..686111)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0690"
FT                   /product="oxygen-insensitive NAD"
FT                   /EC_number="1.-.-.-"
FT                   /EC_number="1.5.1.34"
FT                   /note="identified by match to protein family HMM PF00881"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0690"
FT                   /db_xref="EnsemblGenomes-Tr:ACF67434"
FT                   /protein_id="ACF67434.1"
FT                   /translation="MDIVSVALKRYSTKAFDPSKKLTAEEADKIKTLLQYSPSSTNSQP
FT                   WHFIVASTEEGKARVAKSAAGNYTFNERKMLDASHVVVFCAKTAMDDAWLERVVDQEEA
FT                   DGRFATPEAKAANDKGRRFFADMHRVSLKDDHQWMARQVYLNVGNFLLGVAAMGLDAVP
FT                   IEGFDAEVLDAEFGLKEKGYISLVVVPVGHHSIEDFNAGLPKSRLPLETTLTEV"
FT   gene            complement(686208..686576)
FT                   /locus_tag="SeHA_C0691"
FT   CDS_pept        complement(686208..686576)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0691"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF04237"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0691"
FT                   /db_xref="EnsemblGenomes-Tr:ACF67965"
FT                   /protein_id="ACF67965.1"
FT                   /translation="MDGQTLHACAKRFALELPFTEHCWPFGPQYDVFKVGGKIFMLFTE
FT                   HHCRPVVNLKSDPQKSLVNQQIYPSIAPGYHMNKKHWISVYAGEDITVSLLNDLINDSW
FT                   NLVVDGLPKREQLRLRPR"
FT   gene            complement(686576..687157)
FT                   /locus_tag="SeHA_C0692"
FT   CDS_pept        complement(686576..687157)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0692"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="identified by match to protein family HMM PF00440"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0692"
FT                   /db_xref="EnsemblGenomes-Tr:ACF69463"
FT                   /protein_id="ACF69463.1"
FT                   /translation="MARPKSEDKKQALLEAATQAIAQSGIAASTAVIARNAGVAEGTLF
FT                   RYFATKDELINTLYLHLKQDLCQSMIMELDRSITDAKMMTRFIWNSYISWGLNHPARHR
FT                   AIRQLAVSEKLTKETEQRADDMFPELRDLCHRSVLMVFMSDEYRAFGDGLFLALAETTM
FT                   DFAARDPARAGEYIALGFEAMWRALTREEQ"
FT   gene            687446..687787
FT                   /locus_tag="SeHA_C0693"
FT   CDS_pept        687446..687787
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0693"
FT                   /product="transposon tn10 tetd protein"
FT                   /note="identified by match to protein family HMM PF00165"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0693"
FT                   /db_xref="EnsemblGenomes-Tr:ACF69811"
FT                   /protein_id="ACF69811.1"
FT                   /translation="MTISAQVIDTIVEWIDDNLNQPLRIDDIARHAGYSKWHLQRLFMQ
FT                   YKGESLGRYVRERKLKLAARDLLDTDQKVYDICLKYGFDSQQTFTRIFTRTFNLPPGAY
FT                   RKEKHGRTH"
FT   gene            complement(687793..688017)
FT                   /locus_tag="SeHA_C0694"
FT   CDS_pept        complement(687793..688017)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0694"
FT                   /product="putative inner membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0694"
FT                   /db_xref="EnsemblGenomes-Tr:ACF68391"
FT                   /protein_id="ACF68391.1"
FT                   /translation="MTAAGILLMALLSSLLLPAPSLGLALAQKLVGIFHLMDLNQLYTL
FT                   LFCLWFLLLGALEYYVIRFIWRRWFSLAD"
FT   gene            complement(688108..689226)
FT                   /locus_tag="SeHA_C0695"
FT   CDS_pept        complement(688108..689226)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0695"
FT                   /product="carboxylate-amine ligase YbdK"
FT                   /EC_number="6.3.-.-"
FT                   /note="identified by match to protein family HMM PF04107;
FT                   match to protein family HMM TIGR02050"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0695"
FT                   /db_xref="EnsemblGenomes-Tr:ACF68796"
FT                   /db_xref="GOA:B4TAD4"
FT                   /db_xref="InterPro:IPR006336"
FT                   /db_xref="InterPro:IPR011793"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4TAD4"
FT                   /protein_id="ACF68796.1"
FT                   /translation="MALNDFHVSEPYTLGIELEMQVINPPGYDLSQDSSTLIDAVKPQL
FT                   TAGEIKHDITESMLEMATGVCRDIDQAAAQLSAMQHVILQAASEHHLGICGGGTHPFQK
FT                   WQRQEVCDNERYQRTLENFGYLIQQATVFGQHVHVGCANGDDAIYLLHGLSHFVPHFIA
FT                   LSAASPYMQGSDTRFACARLNIFSAFPDNGPMPWVSNWQEFAGLFRRLSYTTMIDSIKD
FT                   LHWDIRPSPAFGTVEVRVMDTPLTLDHAINMAGLIQATAHWLLTERPFKPQEQDYLLYK
FT                   FNRFQACRYGLEGVLTDAYTGDRRRLADDTLRLLDNVTPSARKLGADSAIDALRLQVKK
FT                   GGNEAQYMREFIADGGSLIGLVQKHCEIWAGQ"
FT   gene            complement(689238..689945)
FT                   /locus_tag="SeHA_C0696"
FT   CDS_pept        complement(689238..689945)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0696"
FT                   /product="4'-phosphopantetheinyl transferase EntD"
FT                   /EC_number="2.7.8.-"
FT                   /note="identified by match to protein family HMM PF01648"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0696"
FT                   /db_xref="EnsemblGenomes-Tr:ACF67491"
FT                   /protein_id="ACF67491.1"
FT                   /translation="MMLTSHFPLPFAGHRLHIVDFDASSFHEHDLLWLPHHDRLRSVGR
FT                   KRKAEHLAGRIAAVHALREVGVRAVPGIGDKRQPLWPDGLFGSISHCASTALAVISRQR
FT                   VGIDIEKIMSQHTATELAPSIIDSDERQILQASSLPFPLALTLAFSAKESVYKAFSDRV
FT                   TLPGFDSAKVTSLTATHISLHLLPAFAATMAERTVRTEWFQRGNSVITLVSAITRFPHD
FT                   RSAPASILSAIPR"
FT   gene            complement(689988..692243)
FT                   /locus_tag="SeHA_C0697"
FT   CDS_pept        complement(689988..692243)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0697"
FT                   /product="ferrienterobactin receptor"
FT                   /note="identified by match to protein family HMM PF00593;
FT                   match to protein family HMM PF07715; match to protein
FT                   family HMM TIGR01783"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0697"
FT                   /db_xref="EnsemblGenomes-Tr:ACF68133"
FT                   /protein_id="ACF68133.1"
FT                   /translation="MNKKIHSLTLLVNLGIYGAALPVMAEDKTDSAALTNEDTIVVTAA
FT                   QQNLQAPGVSTITADEIRKNPPARDVSEIIRTMPGVNLTGNSTSGQRGNNRQIDIRGMG
FT                   PENTLILIDGKPVTSRNSVRLGWRGERDTRGDTAWVPPEMIERIEVLRGPAAARYGNGA
FT                   AGGVVNIITKKGGSEWHGSWNTYFNAPEHKDEGATKRTNFSLNGPLGGDFSFRLYGNLD
FT                   KTQADARNINQGHQSERTGSYADTLPAGREGVINKDINGVVRWDFAPLQSLELEAGYSR
FT                   QGNLYAGDTQNTNTNQLVKDNYGKETNRLYRQNYSLTWNGGWNNGVTTSNWVQYEHTRN
FT                   SRMPEGLAGGTEGIFDPKASQKYADADLNDVTLHSEVSLPFDLLVNQNLTLGTEWAQQR
FT                   MKDELSNSQTFMGGNIPGYSSTNRSPYSKAEIFSLFAENNMELTDSTMLTPGLRFDHHS
FT                   IVGDNWSPSLNLSQGLGDDFTLKMGIARAYKAPSLYQTNPNYILYSKGQGCYATGAGTG
FT                   IGCYMMGNDDLKAETSINKEIGLEFKRDGWLAGITWFRNDYRNKIEAGTVPLQRINNGK
FT                   TDVYQWENVPKAVVEGLEGTLNVPVSDTVNWTNNVTYMLQSKNKETGERLSIIPQYTLN
FT                   STLSWQVRQDVSLQSTFTWYGKQEPKKYDYQGNPVTGTDKQAVSPYSIVGLSATWDVTK
FT                   NVSLTGGVDNLFDKRLWREGNAQTVRDTQTGAYMAGAGAYTYNEPGRTWYMSINTHF"
FT   gene            692432..693646
FT                   /locus_tag="SeHA_C0698"
FT   CDS_pept        692432..693646
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0698"
FT                   /product="enterochelin esterase"
FT                   /note="identified by match to protein family HMM PF00756"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0698"
FT                   /db_xref="EnsemblGenomes-Tr:ACF66687"
FT                   /protein_id="ACF66687.1"
FT                   /translation="MKEALATGSEAWWRTKTGPEWIREKDGNYRVTFWWRDPQGNETHS
FT                   PIRRVWVYITGVTDHHQNAQPQTMARIAGTDVWRWSTALSANWRGSYCFIPTERDDVFA
FT                   DFAPGETPDRNALREGWRQLLPQAIADPLNSQSWRGGRGHAVSALEMPDAPLQPGWDRP
FT                   ETPYSPPLMMQWHSERLGNSRRVWILTTGDEAPEERPLAILLDGQFWAENMPVWPALAS
FT                   LTHQRLLPGAVYLLIDAIDTQHRSQELPCNADFWLAVQQELLPQVRAVTPFSDDAGRTV
FT                   VAGQSFGGLSALYAGLNWPTRFGCVLSQSGSFWWPHRITPPEGEVITRLKTGALCARGL
FT                   RIVLEAGVREPIVFQANQALYAQLNTSQQSIFWRQVDGGHDALCWRGGLTQGLMLLWQP
FT                   LIDTL"
FT   gene            693677..693895
FT                   /locus_tag="SeHA_C0699"
FT   CDS_pept        693677..693895
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0699"
FT                   /product="conserved domain protein"
FT                   /note="identified by match to protein family HMM PF03621"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0699"
FT                   /db_xref="EnsemblGenomes-Tr:ACF66731"
FT                   /protein_id="ACF66731.1"
FT                   /translation="MEFSNPFDNPQGQFYILQNAQRQFSLWPAACALPAGWDVVCEPQS
FT                   QDACQQWLNTRWTTLNPAHYADKQEAK"
FT   gene            693892..697776
FT                   /locus_tag="SeHA_C0700"
FT   CDS_pept        693892..697776
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0700"
FT                   /product="enterobactin synthetase component F"
FT                   /EC_number="2.7.7.-"
FT                   /note="identified by match to protein family HMM PF00501;
FT                   match to protein family HMM PF00550; match to protein
FT                   family HMM PF00668; match to protein family HMM PF00975;
FT                   match to protein family HMM TIGR01733"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0700"
FT                   /db_xref="EnsemblGenomes-Tr:ACF69451"
FT                   /protein_id="ACF69451.1"
FT                   /translation="MTQRLPLVAAQPGIWMAEKLSDLPSAWSVAHYVELNGELDAPLLA
FT                   KAVAVGMQQADTLRMRFTEENGEVWQWIDPEHTFGEPPIADLRDQPDPHHAALALMQAD
FT                   LRQNLRADSGKPLAFHQLIRIDNTRWYWYQRYHHLLVDGFSFPAITRQIAAIYRAWQSD
FT                   APTPESPFTPFADVVEEYQRYHQSEAWQRDGAFWAQQRRELPPPASISAAPLPGRSASA
FT                   GILRMKLSAPAGAFRQLAAHMPEIPRADLALALVTLWLGRLCGRMDYAAGFIFMRRMGS
FT                   AALTATGPVLNVLPLAVNLHATEDLPTLAKRLAAQLKKMRRHQRYDAEQIVRDSGRVAG
FT                   ETPLFGPVLNIKVFDYHLDLPGIQAQTHTLATGPVNDLELALFPDENGGLDIELLANAQ
FT                   RYDDATLSRHALRLMALITQFADNPALRCGDAQMLLAEEQTQLTHLNNTAVTIPAATLS
FT                   DLVAQQAQKTPEAFALADAHYHFTYREMREQVVALAYALRERGVQPGDSVAVALPRSVF
FT                   LTLALHGIVEAGAAWLPLDTGYPDDRLRMMLEDAQPKLLITTQAQLARFHDIPGMEYLC
FT                   YSQPLPVSDATPLGLSLPHHTAYIIFTSGSTGRPKGVMVGQTAIVNRLLWMQDHYPLTA
FT                   DDVVAQKTPCSFDVSVWEFFWPFIAGAKLVMAEPEAHRDPLAMQRFFAQYGVTTTHFVP
FT                   SMLAAFIASLTPASAGKSCASLKRVFCSGEALPTALCREWETLTNAPLHNLYGPTEAAV
FT                   DVSWYPAYGDELAAVDGNSIPIGYPVWNTGLRILDAHMQPVPPGVAGDLYLTGIQLAQG
FT                   YLGRPDLTASRFIADPFAPGERMYRTGDVARWLDSGAVEYLGRSDDQLKIRGQRIELGE
FT                   IDRVMQTLPDVEQAVAHACVFNQAAATGGDARQLVGYLVSHSGLPLDLPALQEKLRQKL
FT                   PAHMVPVVLLQLASLPLSANGKLDRKALPLPDLTPRVKGRAPQSATEIAVAAAFSRLLG
FT                   CEINDVESDFFALGGHSLLAMKLAAQLSQTFNRQVTPGQVMVASDVAQLSKLLDTDDDE
FT                   RSRNLGFGPLLPLRESDGPTLFCFHPASGFAWQFSVLSRYLSPSWSIMGIQSPRPAGPM
FT                   QTATTLDEVCEHHLATLLARQPHGPYYLLGYSLGGTLAQGIAARLRARGETVAFLGLLD
FT                   TWPPETQNWREKEANGLNPDVLAEIERERAAFVAAQQGNASEALFTAIEGNYADAVRLL
FT                   TTAHSVPFDGHATLFVADKTVPEGVSPEQSWSPWIASLAIYRQPCAHVDIISPSAFETI
FT                   GPIISELINK"
FT   gene            698026..699162
FT                   /locus_tag="SeHA_C0701"
FT   CDS_pept        698026..699162
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0701"
FT                   /product="ferric enterobactin transport protein FepE"
FT                   /note="identified by match to protein family HMM PF02706"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0701"
FT                   /db_xref="EnsemblGenomes-Tr:ACF69947"
FT                   /protein_id="ACF69947.1"
FT                   /translation="MPSLNVKQEKNQSFAGYSLPPANSHEIDLFSLIEVLWQAKRRILA
FT                   TVFAFACVGLLLSFLLPQKWTSQAIVTPAESIQWQGLERTLTALRVLDMEVSVDRASVF
FT                   NLFIKKFSSPSLLEEYLRSSPYVMDQLKGAQIDEQDLHRAIVLLSEKMKAVDSNAGKKN
FT                   ETSLFTSWTLSFTAPTREEAQKVLAGYIQYISDIVVKETLENIRNQLEIKTRYEQEKLA
FT                   MDRVRLKNQLDANIQRLHYSLEIANAAGIKRPVYSNGQAVKDDPDFSISLGADGISRKL
FT                   EIEKGVTDVAEIDGDLRNRQYHVEQLAAMNVSDVKFTPFKYQLSPSLPVKKDGPGKAVI
FT                   IILAALIGGMMACGGVLLRHAMVSRKMENALAIDERLV"
FT   gene            complement(699215..700009)
FT                   /locus_tag="SeHA_C0702"
FT   CDS_pept        complement(699215..700009)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0702"
FT                   /product="ferric enterobactin transport ATP-binding protein
FT                   FepC"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0702"
FT                   /db_xref="EnsemblGenomes-Tr:ACF70452"
FT                   /protein_id="ACF70452.1"
FT                   /translation="MTESVARLRGNQLTLGYGSYTVAKNLNVSIPDGHFTAIIGPNGCG
FT                   KSTLLRTLSRLMTPVDGHVWLDGEQIQRYASKEVARRIGLLAQNATTPGDITVQELVAR
FT                   GRYPHQPLFTRWRKEDADAVASAMRATGITSLAAQSVDTLSGGQRQRAWIAMVLAQETS
FT                   IMLLDEPTTWLDISHQIDLLELLSDLNREKGYTLAAVLHDLNQACRYATHLIALREGNI
FT                   VAQGAPKEIVTAELIEKIYGLRCMIIDDPVAGTPLVVPLGRR"
FT   gene            complement(700006..700995)
FT                   /locus_tag="SeHA_C0703"
FT   CDS_pept        complement(700006..700995)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0703"
FT                   /product="ferric enterobactin transport system permease
FT                   protein FepG"
FT                   /note="identified by match to protein family HMM PF01032"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0703"
FT                   /db_xref="EnsemblGenomes-Tr:ACF68626"
FT                   /protein_id="ACF68626.1"
FT                   /translation="MFLSRRLIVSCLILAAGCFAIGLWSLQSGAVPLETGQIIAALLGD
FT                   APRNITLVVTEWRLPRVLMALLIGAALGVSGAIFQSLMRNPLGSPDVMGFNTGAWSGVL
FT                   VAMVLFGQHLTAIALAAMAGGIVTSLIVWLLAWRNGIETFRLIIIGIGIRAMLVAFNTW
FT                   LLLQASLETALTAGLWNAGSLNGLTWAKTWPSAPLIIVMLTGAALLVRRMRLLEMGDDS
FT                   ACALGVSVERSRLMLMLVAVSLTAAATALAGPISFIALVAPHIARRLSGTARWGLTQSA
FT                   LCGALLLLAADACAQQLFMPYQLPVGVVTVSLGGIYLIVLLIQESRKK"
FT   gene            complement(700995..702002)
FT                   /locus_tag="SeHA_C0704"
FT   CDS_pept        complement(700995..702002)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0704"
FT                   /product="ferric enterobactin transport system permease
FT                   protein FepD"
FT                   /note="identified by match to protein family HMM PF01032"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0704"
FT                   /db_xref="EnsemblGenomes-Tr:ACF66776"
FT                   /protein_id="ACF66776.1"
FT                   /translation="MSCSFSVTRAFAVPGLLLLLSLAAVLSLVIGAKPLPAAVVLEAFT
FT                   GVCQSADCTIVLDARLPRTLAGLLAGGALGLAGALMQTLTRNPLADPGILGVNNGASFA
FT                   IVLGAALFGFSTPLEQLFMAFSGALIASLIVAFTGSQGGGQLSPVRLTLAGVALGAVLE
FT                   GLTSGIALLNPEVYDQLRFWQAGSLDIRSLQTLKVALAPVVIAGIVALFLSRALNSLSL
FT                   GSDTATALGSKVARTQLIGLLAITVLCGSATALVGPIAFIGLMMPHMARWLVGADHRWS
FT                   LPVTLLATPTLLLFADIIGRLLVPGELRVSVVSAFIGAPVLIFLVRRKSNGGGL"
FT   gene            702113..703357
FT                   /locus_tag="SeHA_C0705"
FT   CDS_pept        702113..703357
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0705"
FT                   /product="enterobactin exporter EntS"
FT                   /note="identified by match to protein family HMM PF07690"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0705"
FT                   /db_xref="EnsemblGenomes-Tr:ACF69605"
FT                   /protein_id="ACF69605.1"
FT                   /translation="MNRQSWLLNLSLLKTHPAFRAVFLARFISIVSLGLLGVAVPVQIQ
FT                   MMTHSTWQVGLSVTLTGGAMFIGLMVGGVLADRYERKKVILLARGTCGIGFIGLCVNAL
FT                   LPEPSLLAIYLLGLWDGFFASLGVTALLAATPALVGRENLMQAGAITMLTVRLGSVISP
FT                   MLGGILLASGGVAWNYGLAAAGTFITLLPLLTLPRLPVPPQPRENPLIALLAAFRFLLA
FT                   SPLIGGIALLGGLVTMASAVRVLYPALAMSWQMSAAQIGLLYAAIPLGAAIGALTSGQL
FT                   AHSVRPGLIMLVSTVGSFLAVGLFAIMPVWIAGVICLALFGWLSAISSLLQYTLLQTQT
FT                   PENMLGRMNGLWTAQNVTGDAIGAALLGGLGAMMTPVASASVSGFGLVIIGLLLLLVLG
FT                   ELRRFRQTPPVSDAG"
FT   gene            complement(703420..704376)
FT                   /locus_tag="SeHA_C0706"
FT   CDS_pept        complement(703420..704376)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0706"
FT                   /product="ABC superfamily"
FT                   /note="identified by match to protein family HMM PF01497"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0706"
FT                   /db_xref="EnsemblGenomes-Tr:ACF69885"
FT                   /protein_id="ACF69885.1"
FT                   /translation="MRLPAFYRWLLLVVGLSISGISLAQDAGWPRQIQDSRGVHTLDHK
FT                   PARIVSTSVTLTGSLLAIDAPVVASGATTPNNRFADDQGFMRQWSDVAKARHVARLYIG
FT                   EPNAETVAAQMPDLILISATGGDSALALYDQLSAIAPTLVINYDDKSWQSLLTQLGEIT
FT                   GQEKQAAARIAEFEAQLTTVKQRIALPPQPVSALVYTPAAHSANLWTPESAQGKLLTQL
FT                   GFTLATLPRGLQTSKSQGKRHDIIQLGGENLAAGLNGESLFLFAGDNKDVAALYANPLL
FT                   AHLPAVQNKRVYALGTETFRLDYYSATLLLNRLAALF"
FT   gene            704685..705860
FT                   /locus_tag="SeHA_C0707"
FT   CDS_pept        704685..705860
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0707"
FT                   /product="isochorismate synthase EntC"
FT                   /EC_number="5.4.4.2"
FT                   /note="identified by match to protein family HMM PF00425;
FT                   match to protein family HMM TIGR00543"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0707"
FT                   /db_xref="EnsemblGenomes-Tr:ACF69375"
FT                   /protein_id="ACF69375.1"
FT                   /translation="MDMSLAEDAQETMATLAPDRFFFMSPYRSFTTSGCFARYTEPAVA
FT                   GDSPDSPFQQKLRQQFAEAKSQGIANPILVGAIPFDTRQPSSLFIPMAWQSFSRQQKQR
FT                   TARYFTDHQPLTVTARKAIPEQDAFEAMVARAAMLTATPDVDKVVLSRLIDITTDVAVD
FT                   SGALLERLVAQNPVSYNFHVPLADGGVLLGASPELLLRKEGERFSSLPLAGSARRQPDD
FT                   VLDREAGNRLLASQKDRHEHELVTQAMKQILRDRSTELQLPSSPQLITTPTLWHLGTPF
FT                   EGKANAGENALTLACLLHPTPALSGFPHQVAKKLIAELEPFDRELFGGIVGWCDAEGNG
FT                   EWVVTIRCAKLHGNQVRLFAGAGIVPASSPVGEWRETGVKLSTMLNVFGLH"
FT   gene            705870..707480
FT                   /locus_tag="SeHA_C0708"
FT   CDS_pept        705870..707480
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0708"
FT                   /product="2,3-dihydroxybenzoate-AMP ligase"
FT                   /EC_number="2.7.7.58"
FT                   /note="identified by match to protein family HMM PF00501;
FT                   match to protein family HMM TIGR02275"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0708"
FT                   /db_xref="EnsemblGenomes-Tr:ACF68832"
FT                   /protein_id="ACF68832.1"
FT                   /translation="MRIPFTRWPDEFARRYREKGYWQDVPLTDILTRHADSDKTAVIEG
FT                   ERAFSYRQLNQAADNLACYLRRQGIKPGETALVQLGNVPELYITFFALLKLGVAPVLAL
FT                   FSHQRTELNAYAMQIAPTLVIADRQHTLFAGEDFLNTFVAEHRSVRVVLLRNDDGDHSL
FT                   DAAMRQAAEDFTATPSPADEVAYFQLSGGTTGTPKLIPRTHNDYYYSVRRSNEICGFNE
FT                   ETRFLCAIPAAHNYAMSSPGALGVFLAKGTVVLATDPSATLCFPLIEKHQINATALVPP
FT                   AVSLWLQAIQEWGGNAPLASLRLLQVGGARLSATLAARIPAEIGCQLQQVFGMAEGLVN
FT                   YTRLDDSPERIINTQGRPMCPDDEVWVADADGNPLPPGEIGRLMTRGPYTFRGYFNSPQ
FT                   HNASAFDANGFYCSGDLISIDQDGYITVHGREKDQINRGGEKIAAEEIENLLLRHPAVI
FT                   HAALVSMEDELLGEKSCAYLVVKEPLRAVQVRRFLREQGVAEFKLPDRVECVASLPLTP
FT                   VGKVDKKQLRQRLASRSPL"
FT   gene            707494..708351
FT                   /gene="entB"
FT                   /locus_tag="SeHA_C0709"
FT   CDS_pept        707494..708351
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="entB"
FT                   /locus_tag="SeHA_C0709"
FT                   /product="isochorismatase"
FT                   /EC_number="3.3.2.1"
FT                   /note="identified by match to protein family HMM PF00550;
FT                   match to protein family HMM PF00857"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0709"
FT                   /db_xref="EnsemblGenomes-Tr:ACF68258"
FT                   /protein_id="ACF68258.1"
FT                   /translation="MAIPKLQSYALPTALDIPTNKVNWAFEPERAALLIHDMQDYFVSF
FT                   WGRNCPMMDQVIANIAALRQYCKEHHIPVYYTAQPKEQSDEDRALLNDMWGPGLTRSPE
FT                   QQKVVEALTPDEADTVLVKWRYSAFHRSPLEQMLKDTGRNQLIITGVYAHIGCMTTATD
FT                   AFMRDIKPFMVADALADFSREEHLMALNYVAGRSGRVVMTESLLPTPVPASKAALRALI
FT                   LPLLDETDEPLDDENLIDYGLDSVRMMGLAARWRKVHGDIDFVMLAKNPTIDAWWALLS
FT                   RGVE"
FT   gene            708351..709106
FT                   /gene="entA"
FT                   /locus_tag="SeHA_C0710"
FT   CDS_pept        708351..709106
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="entA"
FT                   /locus_tag="SeHA_C0710"
FT                   /product="2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase"
FT                   /EC_number="1.3.1.28"
FT                   /note="identified by match to protein family HMM PF00106;
FT                   match to protein family HMM PF08659"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0710"
FT                   /db_xref="EnsemblGenomes-Tr:ACF68022"
FT                   /protein_id="ACF68022.1"
FT                   /translation="MTGFDFSDKTVWVTGAGKGIGYATALAFVDAGARVIGFDREFTQE
FT                   NYPFATEVMDVADAAQVAQVCQRVLQKTTRLDVLVNAAGILRMGATDALSVDDWQQTFA
FT                   VNVGGAFNLFSQTMAQFRRQQGGAIVTVASDAAHTPRIGMSAYGASKAALKSLALTVGL
FT                   ELAGCGVRCNVVSPGSTDTDMQRTLWVSEDAEQQRIRGFGEQFKLGIPLGKIARPQEIA
FT                   NTILFLASDLASHITLQDIVVDGGSTLGA"
FT   gene            709109..709522
FT                   /locus_tag="SeHA_C0711"
FT   CDS_pept        709109..709522
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0711"
FT                   /product="putative esterase YbdB"
FT                   /note="identified by match to protein family HMM PF03061;
FT                   match to protein family HMM TIGR00369"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0711"
FT                   /db_xref="EnsemblGenomes-Tr:ACF67354"
FT                   /protein_id="ACF67354.1"
FT                   /translation="MIWKRHLTLDELNATSQNTLVAHLGIVYTRLGDDVLEAEMPVDAR
FT                   THQPFGLLHGGASAALAETLGSMAGYLMTRDGQCVVGTELNATHHRAVSQGKVRGVCLP
FT                   LHLGRQNQSWEITLFDEQGRRCCTCRLGTAVMG"
FT   gene            709704..711809
FT                   /gene="cstA"
FT                   /locus_tag="SeHA_C0712"
FT   CDS_pept        709704..711809
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cstA"
FT                   /locus_tag="SeHA_C0712"
FT                   /product="carbon starvation protein A"
FT                   /note="identified by match to protein family HMM PF02554"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0712"
FT                   /db_xref="EnsemblGenomes-Tr:ACF69596"
FT                   /protein_id="ACF69596.1"
FT                   /translation="MNKSGKYLVWTALSVLGAFALGYIALNRGEQINALWIVVASVCVY
FT                   LIAYRFYGLYIAKKVLAVDPTRMTPAVRHNDGLDYVPTDKKVLFGHHFAAIAGAGPLVG
FT                   PVLAAQMGYLPGMIWLLAGVVLAGAVQDFMVLFVSTRRDGRSLGELVKEEMGATAGVIA
FT                   LVACFMIMVIILAVLAMIVVKALTHSPWGTYTVAFTIPLAIFMGIYLRYLRPGRIGEVS
FT                   VIGLVFLIFAIISGGWVAASPTWAPYFDFTGVQLTWMLVGYGFVAAVLPVWLLLAPRDY
FT                   LSTFLKIGTIVGLAVGILIMRPTLTMPALTKFVDGTGPVWTGDLFPFLFITIACGAVSG
FT                   FHALISSGTTPKMLANEGQACFIGYGGMLMESFVAIMALVSACIIDPGVYFAMNSPMAV
FT                   LAPAGTADVVASAAQVVSSWGFAITPDTLHQIANEVGEQSIISRAGGAPTLAVGMAYIL
FT                   HGALGGMMDVAFWYHFAILFEALFILTAVDAGTRAARFMLQDLLGVVSPGLKRTDSLPA
FT                   NLLATALCVLAWGYFLHQGVVDPLGGINTLWPLFGIANQMLAGMALMLCAVVLFKMKRQ
FT                   RYAWVALVPTAWLLICTLTAGWQKAFSPDAKIGFLAIANKFQAMIDSGNIPPQYTESQL
FT                   AQLVFNNRLDAGLTIFFMVVVVVLAVFSIKTALAALKIDKPTANETPYEPMPENVDEIV
FT                   TQAKGAH"
FT   gene            711873..712070
FT                   /locus_tag="SeHA_C0713"
FT   CDS_pept        711873..712070
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0713"
FT                   /product="conserved domain protein"
FT                   /note="identified by match to protein family HMM PF04328"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0713"
FT                   /db_xref="EnsemblGenomes-Tr:ACF69044"
FT                   /protein_id="ACF69044.1"
FT                   /translation="MFDTLSKAGKYLGQAAKMMIGVPDYDNYVEHMRITHPDQTPMTYE
FT                   EFFRERQDARYGGKGGARCC"
FT   gene            complement(712106..713194)
FT                   /locus_tag="SeHA_C0714"
FT   CDS_pept        complement(712106..713194)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0714"
FT                   /product="iron-containing alcohol dehydrogenase"
FT                   /note="identified by match to protein family HMM PF00465;
FT                   match to protein family HMM PF01761"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0714"
FT                   /db_xref="EnsemblGenomes-Tr:ACF65883"
FT                   /protein_id="ACF65883.1"
FT                   /translation="MNHTEIRVVTGPANYFSHAGSLERLTDFFTPEQLSHAVWVYGERA
FT                   IAAARPYLPEAFERAGAKHLPFTGHCSERHVAQLAHACNDDRQVVIGVGGGALLDTAKA
FT                   LARRLALPFVAIPTIAATCAAWTPLSVWYNDAGQALQFEIFDDANFLVLVEPRIILQAP
FT                   DDYLLAGIGDTLAKWYEAVVLAPQPETLPLTVRLGINSACAIRDLLLTSSEQALADKQQ
FT                   RRLTQAFCDVVDAIIAGGGMVGGLGERYTRVAAAHAVHNGLTVLPQTEKFLHGTKVAYG
FT                   ILVQSALLGQDDVLAQLIAAYRRFHLPAKLSELDVDIHNTAEIDRVIAHTLRPVESIHY
FT                   LPVTLTPDTLRAAFEKVEFFRI"
FT   gene            713321..714481
FT                   /locus_tag="SeHA_C0715"
FT   CDS_pept        713321..714481
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0715"
FT                   /product="aminotransferase YbdL"
FT                   /EC_number="2.6.1.-"
FT                   /note="identified by match to protein family HMM PF00155;
FT                   match to protein family HMM PF01053"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0715"
FT                   /db_xref="EnsemblGenomes-Tr:ACF66249"
FT                   /protein_id="ACF66249.1"
FT                   /translation="MRNNPLIPKSKLPNLGTTIFTQMSALAQKHQAINLSQGFPDFDGP
FT                   RYLHERLAYHVAQGANQYAPMTGAQALREAIADKTAEIYGYRPDDVSDITVTAGATEAL
FT                   YAAITALVRAGDEVICFDPSYDSYAPAVALSGGVLKRIALTPPHFRVDWQAFSALLSER
FT                   TRLVILNTPHNPTATVWRQADIEALWQAIGEREIYVLSDEVYEHICFAVEGHASVLAHP
FT                   QLRERAVAVSSFGKTFHMTGWKIGYCVAPAAISAEIRKVHQYLTFCVNTPAQLALADML
FT                   RAAPEHYRALPDFYRKKRDVLVNALAQSRLKVLPCEGTYFLLIDYSAVSTLNDVEFCQW
FT                   LTEEVGVAAIPLSVFCAAPFPHQLIRLCFAKQESTLLAAAERLCKL"
FT   gene            complement(714482..715099)
FT                   /locus_tag="SeHA_C0716"
FT   CDS_pept        complement(714482..715099)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0716"
FT                   /product="IbrB protein"
FT                   /note="identified by match to protein family HMM PF02195"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0716"
FT                   /db_xref="EnsemblGenomes-Tr:ACF67979"
FT                   /protein_id="ACF67979.1"
FT                   /translation="MQHRLTTEITHFLSELPEEERIAAINEFRMAIHSVSPFRDEPVDC
FT                   VLWVKNDHISPNDYNPNNVAPPEKKLLLKSIEQDGFTQPIVVVKANTEEYEIVDGFHRH
FT                   ELGKGKAALKRRLKGYLPITCLDRERHERMAATIRHNRARGRHQIHAMSEIVRELSLLG
FT                   WDESKIGQELGMDADEVLRLKQINGLQELFADRRFSRAWTVK"
FT   gene            complement(715072..716307)
FT                   /locus_tag="SeHA_C0717"
FT   CDS_pept        complement(715072..716307)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0717"
FT                   /product="IbrA protein"
FT                   /note="identified by match to protein family HMM PF01507"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0717"
FT                   /db_xref="EnsemblGenomes-Tr:ACF67437"
FT                   /protein_id="ACF67437.1"
FT                   /translation="MSVYKVPLEQNVLEAAQERIMWTLETLPRVCVSFSGGKDSGLMLH
FT                   LTATLARKMNKKIHVLFIDWEAQFSCTIAYIESLREYYADVIERFYWVALPLTTQNSLS
FT                   QYQPEWQCWQPGTDWVRQPPEDAITDPAFFSFYQHGMTFEQFVRDFADWFSEKRPAAML
FT                   VGIRSDESYNRFAAIANSHKLRFADDKPWTTLAPKGHTWYIYPIYDWKTADIWTWFAKT
FT                   GKPCNPLYNLMYQAGVPPRYMRICEPFGPEQRQGLWLYHVIEPERWAAMCARVSGALSG
FT                   GIYAGQDSHFYGHRKILKPDHLNWEEYALLLLHSMPEVTAEHYRNKIAVYLQWYKKKGM
FT                   HTIPQTQHGDIGSRDIPSWRRICKVLLNNDYWCRALSFSPTKPKNYQRYNERMKAKRQE
FT                   WGILCNTDSQPK"
FT   gene            complement(716473..717375)
FT                   /locus_tag="SeHA_C0718"
FT   CDS_pept        complement(716473..717375)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0718"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="identified by match to protein family HMM PF00126;
FT                   match to protein family HMM PF03466"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0718"
FT                   /db_xref="EnsemblGenomes-Tr:ACF69019"
FT                   /protein_id="ACF69019.1"
FT                   /translation="MANLYDLKKFDLNLLVIFECIYQHLSISKAAETLYITPSAVSQSL
FT                   QRLRTQFNDPLFIRSGKGITPTVTGINLHYHLENNLNSLEQTINIMNQSSLKKKFIIYS
FT                   PQLLITQYVMKLVKYIRKDPQVEIEHHDILTTDELPEDLLAYRKADIVVSMAPLNNRSI
FT                   VCTHFNRLECILVCSENHPRLGDTATIDEILQESFTQLVSRATGMKEYHSLMDDVLGER
FT                   IIGFRSKSLMTIANSISSTELIGFLPQTFFDYYSSSIKLKKVTIPFTIAPIQFYLMYNR
FT                   ASLNNSGFAELIEHITKKH"
FT   gene            complement(717692..718498)
FT                   /locus_tag="SeHA_C0719"
FT   CDS_pept        complement(717692..718498)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0719"
FT                   /product="thiol:disulfide interchange protein DsbG"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0719"
FT                   /db_xref="EnsemblGenomes-Tr:ACF68385"
FT                   /protein_id="ACF68385.1"
FT                   /translation="MSAIGIIINTLFALILKGKNMIKRTLLLAMLPILAHAEELPAPVK
FT                   AIEKQGITILKSFEAPGGMKGYLGKYQDMGVTIYLTPDGKHAISGYMYNEKGENLSNAL
FT                   IEKEIYAPAGREMWQKMEKASWILDGKKDAPVVLYVFADPFCPYCKQFWQQARPWVESG
FT                   KVQLRTLLVGVIKPESPATAAAILAAKDPAKTWHDYEASAGKMKLEVPASIPPAQMKVI
FT                   NQNQQLMDDLGANATPAIYYMNKDKILQQVVGLPEKAQLDAMMGQP"
FT   gene            718879..719442
FT                   /gene="ahpC"
FT                   /locus_tag="SeHA_C0720"
FT   CDS_pept        718879..719442
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ahpC"
FT                   /locus_tag="SeHA_C0720"
FT                   /product="alkyl hydroperoxide reductase subunit C"
FT                   /EC_number="1.11.1.15"
FT                   /note="identified by match to protein family HMM PF00578;
FT                   match to protein family HMM PF08534; match to protein
FT                   family HMM TIGR03137"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0720"
FT                   /db_xref="EnsemblGenomes-Tr:ACF68899"
FT                   /protein_id="ACF68899.1"
FT                   /translation="MSLINTKIKPFKNQAFKNGEFIEVTEKDTEGRWSVFFFYPADFTF
FT                   VCPTELGDVADHYEELQKLGVDVYSVSTDTHFTHKAWHSSSETIAKIKYAMIGDPTGAL
FT                   TRNFDNMREDEGLADRATFVVDPQGIIQAIEVTAEGIGRDASDLLRKIKAAQYVAAHPG
FT                   EVCPAKWKEGEATLAPSLDLVGKI"
FT   gene            719684..721249
FT                   /pseudo
FT                   /gene="ahpF"
FT                   /locus_tag="SeHA_C0721"
FT                   /note="alkyl hydroperoxide reductase subunit F; this gene
FT                   contains a frame shift which may be the result of
FT                   sequencing error; identified by match to protein family HMM
FT                   PF00070; match to protein family HMM PF07992; match to
FT                   protein family HMM TIGR03140"
FT   gene            721582..722142
FT                   /locus_tag="SeHA_C0722"
FT   CDS_pept        721582..722142
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0722"
FT                   /product="putative component of anaerobic dehydrogenase"
FT                   /note="identified by match to protein family HMM PF06192"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0722"
FT                   /db_xref="EnsemblGenomes-Tr:ACF66360"
FT                   /protein_id="ACF66360.1"
FT                   /translation="MDSIYESLTELEKTGLTLRDFFNSHDSRSLKSAYVRLNPTAAVNL
FT                   TDRAWLEAEYDFNALFVGPGKLLAAPFASVYLEEDALVMGKATLEIREFMAALGLSVNQ
FT                   ESNIPDDHISCVLELTTLLLANTRQTSQYRSTLTQYINNYLTKWVPLYIEKIKTHAQTT
FT                   TLYTVADILFYWLDELKREYQYE"
FT   gene            722135..724414
FT                   /locus_tag="SeHA_C0723"
FT   CDS_pept        722135..724414
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0723"
FT                   /product="molybdopterin-containing oxidoreductase catalytic
FT                   subunit"
FT                   /note="identified by match to protein family HMM PF00384;
FT                   match to protein family HMM PF01568; match to protein
FT                   family HMM PF04879; match to protein family HMM TIGR01409"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0723"
FT                   /db_xref="EnsemblGenomes-Tr:ACF70202"
FT                   /protein_id="ACF70202.1"
FT                   /translation="MSNETGHLNRRSFLKGIVALGAVAALPGGLLTSRCALAQPPVPFN
FT                   PKTYKIYRNACPRNCYDTCSLKTWVKDGVITFVEGAPESTFTHGTPCVKGLSYPRRVYS
FT                   PDRIKYPMAQDVRGSGNWRRISWEEAMQRIAAKMLEIKKKDGSMLGLALTKYSGKFGVL
FT                   NYAVEGMMSSLGYTTRFAGTPCWPAGIDAQNYDMGDMWCNDPEDMVKAKYIIIWGANPA
FT                   WCSMHSMKYIYQAREKGAKVVVIDPLLSQTAAKADLYLRVRPGSDGALALGMARHLVDK
FT                   GLVDQDFVNNDAHGYPEFEAYLRNHVTVEWAAEICGLSADVIRQLAEEFTAVKPATVWI
FT                   GYGMQRHVNGGANVRAIDAFVAMSGNIGVEGGGARYGHLHTWGFNYNAMLQKPPVGAIG
FT                   IPGAAGTTSEFGAAAGSDAVQYSDRSLNINQTAQGILEANDPPVRMLWVACKNPFAQDF
FT                   DRSKMKKAFEKLEMVVCADQFFNETVQHADIVLPVTTAFEEWNVDASYWHYWLSINQPA
FT                   IKPMYEAKCDLEIATMLSRTINKMAPGSCSFPQEFDHKRWLDQEFNDGMAKMFGISSWD
FT                   DLLDGPKKAILPSSAAWYDRKFKTPSGKYEFKSELAEKNGHTALPEYKPEAESKLPFHL
FT                   FTPHVQFGLHSQFINLDWMQVFYPEPFVYIHPSSAKKKGISENDLVKVFNGTGEVELRA
FT                   KVTTNVPEDFLVMYEAWFPKRQYNVQNVVADTPADMGLMKTGAPGAAIHSQFADVVLIG
FT                   KGESVA"
FT   gene            724411..724968
FT                   /locus_tag="SeHA_C0724"
FT   CDS_pept        724411..724968
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0724"
FT                   /product="molybdopterin-containing oxidoreductase
FT                   iron-sulfur subunit"
FT                   /note="identified by match to protein family HMM PF00037"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0724"
FT                   /db_xref="EnsemblGenomes-Tr:ACF67525"
FT                   /protein_id="ACF67525.1"
FT                   /translation="MRRAFLVNSDKCIGCRGCAMACKSFNQLEPDRFWRYVYPLDKDIY
FT                   PHEERAFYSLACNHCEHPACVAACPVEAYTKREDGVVVHNPERCIGCKNCIRNCPYGAP
FT                   RFNEETRKAEKCSMCYERLDIGMNPACVNACPVGALSIIDLDADPVPDNAVQYPPGFPH
FT                   MPQLNPGTRFILARQPKQPEDK"
FT   gene            724968..725735
FT                   /locus_tag="SeHA_C0725"
FT   CDS_pept        724968..725735
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0725"
FT                   /product="molybdopterin-containing oxidoreductase membrane
FT                   anchor subunit"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0725"
FT                   /db_xref="EnsemblGenomes-Tr:ACF66505"
FT                   /protein_id="ACF66505.1"
FT                   /translation="MEKYELPLVFFTVLSQMSVGMALVLTWRTLRGEVEGQRFCWLATG
FT                   LVLALASIAAILHLAHPDRAYDALINLRHAWLSREILGATLFGAAVGVTFLAKGHKAMA
FT                   LIASVFGVLLVAVQGMTYAAPAMVAIANGFTMLLFFITVWVMGCAAIPLLKLRPAVPAL
FT                   RQGIVVCIAVLIAAPLVWLSGGTVMQMTARSWLASPFYLASLVCLALAFVASRHGDSRP
FT                   KLLFVLLFVGVFLSRLVFFGDTVSTIVNIGHLY"
FT   gene            complement(725803..726096)
FT                   /locus_tag="SeHA_C0726"
FT   CDS_pept        complement(725803..726096)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0726"
FT                   /product="universal stress protein G"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0726"
FT                   /db_xref="EnsemblGenomes-Tr:ACF68920"
FT                   /protein_id="ACF68920.1"
FT                   /translation="MSLHRFAADVRRFEEHLQHEAETRLQTMVGHFSIDPSRIKTHVRF
FT                   GSVRDVVNEMGEELDADVVVIGSRNPSITTHLLGSNASSVVRHATLPVLVVR"
FT   gene            726118..726369
FT                   /pseudo
FT                   /locus_tag="SeHA_C0727"
FT                   /note="conserved hypothetical protein; this gene contains a
FT                   premature stop which may be the result of sequencing error"
FT   gene            726454..727692
FT                   /locus_tag="SeHA_C0728"
FT   CDS_pept        726454..727692
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0728"
FT                   /product="S-(hydroxymethyl)glutathione dehydrogenase
FT                   (glutathione-dependent formaldehyde dehydrogenase) (fdh)
FT                   (faldh)"
FT                   /EC_number="1.1.1.284"
FT                   /note="identified by match to protein family HMM PF00107;
FT                   match to protein family HMM PF08240"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0728"
FT                   /db_xref="EnsemblGenomes-Tr:ACF69938"
FT                   /protein_id="ACF69938.1"
FT                   /translation="MKALTYHGPHHVKVENVPDPGIEQPDDIILRVTATAICGSDLHLY
FT                   RGKIPQVKHGDIFGHEFMGEVVETGHDVKNIQKGDRVVIPFVIACGDCFFCRLQQYSAC
FT                   ENTNDGHGAAMNKKQIPPPAALFGYSHLYGGVPGGQAEYVRVPKGNVGPFKVPPLLSDD
FT                   KALFLSDILPTAWQAAKNAQIQQGSSVAVFGAGPVGLLTIACARLLGAEQIFVVDHHAW
FT                   RLRFAEERYGAIPINFDDENDPAEKIIEQTAGHRGVDAVIDAVGFEAKGSLTETVLTNL
FT                   KLEGSSGKALRQCIAAVRRGGVVSVPGVYAGFIHGFLFGDAFDKGLTFKMGQTHVHAWL
FT                   GELLPLIEKGLLKPEEIVTHYMPFEEAARGYEIFEKREEECRKVILVPGATSAQAAQKQ
FT                   ATGVINPMPGGVV"
FT   gene            complement(727773..728183)
FT                   /locus_tag="SeHA_C0729"
FT   CDS_pept        complement(727773..728183)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0729"
FT                   /product="nucleoside diphosphate kinase regulator"
FT                   /note="identified by match to protein family HMM PF01272"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0729"
FT                   /db_xref="EnsemblGenomes-Tr:ACF69462"
FT                   /protein_id="ACF69462.1"
FT                   /translation="MSRPTIIINDLDAERIDRLLEQPAYADLPIADALNAELDRAQMCS
FT                   PQEMPNDVVTMNSRVKFRNLSDGETRVRTLVYPANMTDSSTQLSVMAPVGAALLGLRVG
FT                   DTIHWELPGGASTHLEVLELEYQPEAAGDFLR"
FT   gene            complement(728418..729224)
FT                   /locus_tag="SeHA_C0730"
FT   CDS_pept        complement(728418..729224)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0730"
FT                   /product="ribonuclease I"
FT                   /EC_number="3.1.27.6"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0730"
FT                   /db_xref="EnsemblGenomes-Tr:ACF70477"
FT                   /protein_id="ACF70477.1"
FT                   /translation="MNTIWHYSPLLAALLTPIFAANADELQAQQYGDFTDYVLALSWQT
FT                   GFCQSQHERRHREPDECRLQKEPANKADFLTVHGLWPGLPKSIAARGVDQRRWQRFGCA
FT                   TRPIPNLPEVKASRKCSAPTPGLSPDIATALKEVMPGAGGNSCLERYEYAKHGACFGFD
FT                   PNAYFGTMIRLDKAIKDSALGQFLADNYGKTVSRAEFDSVVAQMWGQDNVKAVKVNCHG
FT                   NPAYLTEIQFSLKASMINAPLSFASFLPQPHPGNCGKQFIIDKAGY"
FT   gene            complement(729334..730797)
FT                   /locus_tag="SeHA_C0731"
FT   CDS_pept        complement(729334..730797)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0731"
FT                   /product="sodium:sulfate symporter family protein"
FT                   /note="identified by match to protein family HMM PF00939;
FT                   match to protein family HMM TIGR00785"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0731"
FT                   /db_xref="EnsemblGenomes-Tr:ACF69757"
FT                   /protein_id="ACF69757.1"
FT                   /translation="MSLSKDNIWKLLAPLVVMGVMLLIPVPDGMPPQAWHYFAVFVAMI
FT                   VGMILEPIPATAISFIAVTICVIGSNYLLFDASELADPAFKASKQALKWGLAGFSSTTV
FT                   WLVFGAFIFALGYEVTGLGRRIALFLVKFMGKRTLTLGYAIVIIDILLAPFTPSNTART
FT                   GGTVFPVIKNLPPLFKSFPNDPSARRIGGYLMWMMVISTSLSSSMFVTGAAPNVLGLEF
FT                   VSKIAGVQISWLQWFLSFLPVGIILLIVAPWLSYVLYKPEVTHSAEVAAWAGGELKNMG
FT                   RLSRKEWTLIGLVLLSLGLWVFGGKIINATAVGLLAVSLMLALHVVPWKDITRYNSAWN
FT                   PLVNLATLVVMANGLTRSGFIDWFANTMSTHLEGFSPDATVIVLVLVFYFAHYLFASLS
FT                   AHTATMLPVILAVGKGIPGVPMEQLCILLVLSIGIMGCLTPYATGPGVIIYGCGYVKSR
FT                   DYWRLGAIFGVIYIAMLLLVGWPILAMWN"
FT   gene            complement(730835..731728)
FT                   /gene="citG"
FT                   /locus_tag="SeHA_C0732"
FT   CDS_pept        complement(730835..731728)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="citG"
FT                   /locus_tag="SeHA_C0732"
FT                   /product="triphosphoribosyl-dephospho-CoA synthase CitG"
FT                   /EC_number="2.4.2.52"
FT                   /note="identified by match to protein family HMM PF01874;
FT                   match to protein family HMM TIGR03125"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0732"
FT                   /db_xref="EnsemblGenomes-Tr:ACF67675"
FT                   /protein_id="ACF67675.1"
FT                   /translation="MPIPANPTNASIQPQSLYDAWADLAWRAMLTEVNLSPKPGLVDRL
FT                   NCGAHKDMALADFHRSAEAIRHWLPRFMEYGASCTRLPPESVLAGLRPLGMACEAAMFR
FT                   ATAGVNTHKGSIFSLGLLCAAIGRLYQLRQPIAAETLCATAADFCRGLTTRELRQNNLQ
FT                   LTAGQRLYQQLGLTGARGEAEAGYPLVIRHALPHYRALLAQGRDPELALLDTLLLLMSL
FT                   NGDTNVASRGGADGLRWLQQQAAVLLQQGGIRTPDDLVYLHRFDQQCIERNLSPGGSAD
FT                   LLIVTWFLAQISQVNH"
FT   gene            complement(731703..732254)
FT                   /gene="citX"
FT                   /locus_tag="SeHA_C0733"
FT   CDS_pept        complement(731703..732254)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="citX"
FT                   /locus_tag="SeHA_C0733"
FT                   /product="holo-ACP synthase CitX"
FT                   /EC_number="2.7.7.61"
FT                   /note="identified by match to protein family HMM PF03802;
FT                   match to protein family HMM TIGR03124"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0733"
FT                   /db_xref="EnsemblGenomes-Tr:ACF68744"
FT                   /protein_id="ACF68744.1"
FT                   /translation="MRLFPELATCHDVSIPELLASRDERQARQRAWLTRHATPLVSFTV
FT                   VAPGPMKDSALTRRIFNHGVTALHTLAEEYGWTIREQAALASASGPEGLLAIDAPAQAL
FT                   KQATIALEQRYPLGRLWDIDVLTAEGEILSRRHFALPARRCLLCGQSAAECARGKTHAL
FT                   TDLLIHMEALLHDADSRQPD"
FT   gene            complement(732258..733787)
FT                   /gene="citF"
FT                   /locus_tag="SeHA_C0734"
FT   CDS_pept        complement(732258..733787)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="citF"
FT                   /locus_tag="SeHA_C0734"
FT                   /product="citrate lyase, alpha subunit"
FT                   /EC_number="2.8.3.10"
FT                   /EC_number="4.1.3.6"
FT                   /note="identified by match to protein family HMM PF04223;
FT                   match to protein family HMM TIGR01584"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0734"
FT                   /db_xref="EnsemblGenomes-Tr:ACF66621"
FT                   /protein_id="ACF66621.1"
FT                   /translation="MTQKNESQRQDRVAAWSRHAESELSAYQSAAKLDLQAQKPRDHKL
FT                   CASLEEAIRRSGLRDGMTLSFHHAFRGGDLTINLVMETIAKMGFKNLTLASSSLSDCHA
FT                   PLVEHIRNGVVSRIYTSGLRGPLAEEISRGLLAEPVQIHSHGGRVHLVQSGELNIDVAF
FT                   LGVPSCDEFGNANGYTGKACCGSLGYAMVDADSAKQVVMLTEQLLPYPHNPASIAQDQV
FT                   DLIVQIEEVGDANKIGAGATRMTTNPRELLIARSAAEVIAHSGYFNEGFSLQTGTGGAS
FT                   LAVTRFLEDKMRSRNIVANFALGGITATMVDLHEKGLIRKLLDVQSFDRNAAQSLARNP
FT                   NHIEISANQYANWGSKGASVDRLDVVVLSALEVDTHFNVNVLTGSDGVLRGASGGHCDT
FT                   AVAAALSIIVAPLVRGRIPTLVDNVTTCVTPGSSVDILVTDHGIAVNPARPELAERLKA
FT                   AGMKVVSIEWLRERAQLLTGQPRPIEFTDRVIAVVRYRDGSVIDVVHQVKE"
FT   gene            complement(733797..734705)
FT                   /gene="citE"
FT                   /locus_tag="SeHA_C0735"
FT   CDS_pept        complement(733797..734705)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="citE"
FT                   /locus_tag="SeHA_C0735"
FT                   /product="citrate (pro-3S)-lyase, beta subunit"
FT                   /EC_number="4.1.3.6"
FT                   /note="identified by match to protein family HMM PF03328;
FT                   match to protein family HMM TIGR01588"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0735"
FT                   /db_xref="EnsemblGenomes-Tr:ACF67002"
FT                   /protein_id="ACF67002.1"
FT                   /translation="MISASLQQSKTRTRRSMLFVPGANAAMVSNSFIYPADALMFDLED
FT                   SVALREKDAARRLVYHALQHPLYRDVETIVRVNALDSEWGVNDLEAVVRGGADVVRLPK
FT                   TDTAQDVIDIENEILRIENACGREPGSTGLLAAVESPLGITRAVEIAHASERLIGIALG
FT                   AEDYVRNLRTERSPEGTELLFARCAILQAARSAGIQAFDTVYSDANNEAGFLQEAAHIK
FT                   QLGFDGKSLINPRQIELLHNLYAPTRKEVAHARLVVEAAEAAAREGLGVVSLNGKMVDS
FT                   PVIERARLVLSRAELSGIREE"
FT   gene            complement(734702..734998)
FT                   /gene="citD"
FT                   /locus_tag="SeHA_C0736"
FT   CDS_pept        complement(734702..734998)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="citD"
FT                   /locus_tag="SeHA_C0736"
FT                   /product="citrate lyase acyl carrier protein"
FT                   /EC_number="4.1.3.6"
FT                   /note="identified by match to protein family HMM PF04953;
FT                   match to protein family HMM TIGR01608"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0736"
FT                   /db_xref="EnsemblGenomes-Tr:ACF69090"
FT                   /protein_id="ACF69090.1"
FT                   /translation="MKINQLAVAGTLESGDVMIRIAPLDTQDIDLQINSSVEKQFGEAI
FT                   RATILEVLSRYDVRGVQLNVDDKGALDCILRARLETLLARASGIAALPWEDRQ"
FT   gene            complement(734995..736071)
FT                   /gene="citC"
FT                   /locus_tag="SeHA_C0737"
FT   CDS_pept        complement(734995..736071)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="citC"
FT                   /locus_tag="SeHA_C0737"
FT                   /product="[citrate (pro-3S)-lyase] ligase"
FT                   /EC_number="6.2.1.22"
FT                   /note="identified by match to protein family HMM PF00583;
FT                   match to protein family HMM PF08218; match to protein
FT                   family HMM TIGR00124; match to protein family HMM
FT                   TIGR00125"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0737"
FT                   /db_xref="EnsemblGenomes-Tr:ACF69508"
FT                   /protein_id="ACF69508.1"
FT                   /translation="MFGNNVFTRVKRSENKKMAEIAHFLKENDLSVDTTVEVFITVSRD
FT                   DRLIACGGIAGNIIKCVAISESVRGEGLALTLATELINLAWERHCTHLFIYTKTEYEAL
FT                   FKQCSFSTIASVPGVMVLMENSATRLKRYAESLATLRHEGKKIGCIVMNANPFTNGHRY
FT                   LIQQAAAQCDWLHLFLVKEDTSRFPYEDRLDLVLKGTTDIPRLTVHRGSEYIISRATFP
FT                   CYFIKEQSVINHCYTEIDLKIFRQYLAPALGITHRFVGTEPFCTVTAQYNLDMRFWLET
FT                   PTLPAPPITLVEIERLCFQETPISASWVRKLLVKHDLTAIAPLVPDATLRYLQGMVERH
FT                   PGSAAARQKSPVLATGEK"
FT   gene            736137..736274
FT                   /locus_tag="SeHA_C0738"
FT   CDS_pept        736137..736274
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0738"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0738"
FT                   /db_xref="EnsemblGenomes-Tr:ACF68074"
FT                   /protein_id="ACF68074.1"
FT                   /translation="MITFSFQSEWEYFYDELFIFLSDVYIVRSILVVNFDLFHKALDGF
FT                   "
FT   gene            complement(736331..736444)
FT                   /locus_tag="SeHA_C0739"
FT   CDS_pept        complement(736331..736444)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0739"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0739"
FT                   /db_xref="EnsemblGenomes-Tr:ACF68596"
FT                   /protein_id="ACF68596.1"
FT                   /translation="MGIFLQIYRKCNKNVFSIMKHIKTNRYRFPTLNQLNN"
FT   gene            736456..738117
FT                   /locus_tag="SeHA_C0740"
FT   CDS_pept        736456..738117
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0740"
FT                   /product="sensor kinase DpiB"
FT                   /EC_number="2.7.13.3"
FT                   /note="identified by match to protein family HMM PF02518"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0740"
FT                   /db_xref="EnsemblGenomes-Tr:ACF66376"
FT                   /protein_id="ACF66376.1"
FT                   /translation="MSYQKNKKLFPFFRQLAFPLRIFLLILVVSVFIVAALAQYLSASF
FT                   EDYLASHVRDMAMNQAKIIASNDSIIAAVKKRDYKRLAIIANKLQRGTDFDYVVIGDRH
FT                   SIRLYHPNPEKIGYPMQFTKPGALERGESYFITGKGSIGMAMRAKTPIFDNEGNVIGVV
FT                   SIGYLVSKIDSWRLDFLLPMAGVFVLLLVVLMLLSWFFAAHIRRQMLGMEPKQIARVVR
FT                   QQEALFSSVYEGLIAVDPEGHITAINRNARKMLGLPSPGRQWLGKLIAEVVNPADFFTC
FT                   QIAERRQDVMANFNGLSVIANREAIRSGEELLGAIISFRSKDEIATLNAQLTQIKQYVE
FT                   SLRTLRHEHLNWMSTLNGLLQMKEYDRVREMVQGESQAQQQLIDSLRGAFADRQVAGLL
FT                   FGKVQRARELGLKMVIVPGSQLHQLPEGLDSTEFAAIVGNLLDNAFEASLRTQEGDNTI
FT                   ELFLSDEGDEVVIEVADQGCGVPEALREKIFEQGVSTRTDEPGEHGIGLYLIASYVGRC
FT                   GGVITLEDNDPCGTLFSLFLPKVKKNDDRTINPIDR"
FT   gene            738086..738766
FT                   /locus_tag="SeHA_C0741"
FT   CDS_pept        738086..738766
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0741"
FT                   /product="transcriptional regulatory protein DpiA"
FT                   /note="identified by match to protein family HMM PF00072"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0741"
FT                   /db_xref="EnsemblGenomes-Tr:ACF66928"
FT                   /protein_id="ACF66928.1"
FT                   /translation="MTEPLTLLIVEDETLLAEMHAEYIRHIPGFNQIWLAGNLAQARMM
FT                   IDRFKPGLILLDNYLPDGKGITLLHELMQSRYPGGVVFTTAASDMETVAEAVRSGAFDY
FT                   LVKPIAYERLGQTLTRYQQRRRMLASADSASQKQIDEMFNAYARGEPKGDLPTGIDALT
FT                   LNAVMKLFADPTVRHTAETVAQALTISRTTSRRYLEYCASRHLIVAEIIHGKVGRPQRI
FT                   YHGG"
FT   gene            complement(738820..740250)
FT                   /locus_tag="SeHA_C0742"
FT   CDS_pept        complement(738820..740250)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0742"
FT                   /product="C4-dicarboxylate anaerobic carrier"
FT                   /note="identified by match to protein family HMM PF03606;
FT                   match to protein family HMM PF06808; match to protein
FT                   family HMM TIGR00771"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0742"
FT                   /db_xref="EnsemblGenomes-Tr:ACF70105"
FT                   /protein_id="ACF70105.1"
FT                   /translation="MALIFTLGVDKTGETMLTVIELLIGVVVIVGVARYIIKGYSATGV
FT                   LFVGGLVLLIISALMGHKVLPASETSTGYTATDIVEYIKILLMSRGGDLGMMIMMLCGF
FT                   AAYMTHIGANDMVVKLASKPLQYINSPYLLMIAAYFVACLMSLAVSSATGLGVLLMATL
FT                   FPVMVNVGISRGAAAAICASPAAIILSPTSGDVVLAAKAAEMPLIDFAFKTTLPISIAA
FT                   IIGMAIAHFFWQRYLDKKENISHEMLDVAEITTTAPAFYALLPFTPIIGVLIFDGKWGP
FT                   QLHIITILVICMLLAAVLEFVRGFNTQNVFSGLEVAYRGMADAFAGVVMLLVAAGVFAQ
FT                   GLSTIGFIQSLISIATSFGSASIILMLVLVILTMLAAMTTGSGNAPFYAFVEMIPKLAH
FT                   SSGINPAYLSIPMLQASNLGRTISPVSGVVVAVAGMAKISPFEVVKRTSVPVIVGLLIV
FT                   IIATEIMVPGASSAVTGG"
FT   gene            740596..741156
FT                   /gene="pagP"
FT                   /locus_tag="SeHA_C0743"
FT   CDS_pept        740596..741156
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pagP"
FT                   /locus_tag="SeHA_C0743"
FT                   /product="antimicrobial peptide resistance and lipid A
FT                   acylation protein PagP"
FT                   /note="identified by match to protein family HMM PF07017"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0743"
FT                   /db_xref="EnsemblGenomes-Tr:ACF69619"
FT                   /protein_id="ACF69619.1"
FT                   /translation="MIIRKYFLIIALLVMPWLAIPSVSAADKGWFNTFTDNVAETWRQP
FT                   EHYDLYVPAITWHARFAYDKEKTDRYNERPWGVGFGQSRWDDKGNWHGLYMMAFKDSFN
FT                   KWEPIGGYGWEKTWRPLEDDNFRLGLGFTAGVTARDNWNYIPIPVLLPLASIGYGPATF
FT                   QMTYIPGSYNNGNVYFAWMRFQF"
FT   gene            741344..741553
FT                   /gene="cspE"
FT                   /locus_tag="SeHA_C0744"
FT   CDS_pept        741344..741553
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cspE"
FT                   /locus_tag="SeHA_C0744"
FT                   /product="cold shock protein CspE"
FT                   /note="identified by match to protein family HMM PF00313"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0744"
FT                   /db_xref="EnsemblGenomes-Tr:ACF66734"
FT                   /protein_id="ACF66734.1"
FT                   /translation="MSKIKGNVKWFNESKGFGFITPEDGSKDVFVHFSAIQTNGFKTLA
FT                   EGQRVEFEITNGAKGPSAANVTAL"
FT   gene            complement(741611..741994)
FT                   /gene="crcB"
FT                   /locus_tag="SeHA_C0745"
FT   CDS_pept        complement(741611..741994)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="crcB"
FT                   /locus_tag="SeHA_C0745"
FT                   /product="CrcB protein"
FT                   /note="identified by match to protein family HMM PF02537;
FT                   match to protein family HMM TIGR00494"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0745"
FT                   /db_xref="EnsemblGenomes-Tr:ACF66217"
FT                   /db_xref="GOA:B4TAI2"
FT                   /db_xref="InterPro:IPR003691"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4TAI2"
FT                   /protein_id="ACF66217.1"
FT                   /translation="MLQLLLAVFIGGGTGSVARWMLSMRFNPLHQAIPIGTLTANLLGA
FT                   FIIGMGFAWFNRMTHIDPMWKVLITTGFCGGLTTFSTFSAEVVFLLQEGRFGWALLNVL
FT                   INLLGSFAMTALAFWLFSAAAAR"
FT   gene            742085..742873
FT                   /locus_tag="SeHA_C0746"
FT   CDS_pept        742085..742873
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0746"
FT                   /product="hydrolase YbeM"
FT                   /EC_number="3.5.-.-"
FT                   /note="identified by match to protein family HMM PF00795"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0746"
FT                   /db_xref="EnsemblGenomes-Tr:ACF68775"
FT                   /protein_id="ACF68775.1"
FT                   /translation="MFVAAGQFVVSSVWEENAQVCVSLMAQAAGRGVSLLVLPEGILAR
FT                   NDIDLDLPIRAAQPLDGAFMTRLLEESAHNNMTTIFTILVPSTPGRAVNMLVALRAGHI
FT                   VARYAKLHLYDAFSMQESQSIDAGTVIAPVLDVEGVKVGLMTCYDLRFPDMALALALQG
FT                   ADVLALPTGWVRGPLKEQQWSTLLAARALDTTCYMIAAGECGNRNIGQSRIIDPLGVTI
FT                   AAAADRPALIVAEIFRERIDQVREQLPLLQQRRFAPPQLL"
FT   gene            743002..743205
FT                   /locus_tag="SeHA_C0747"
FT   CDS_pept        743002..743205
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0747"
FT                   /product="twin arginine-targeting protein translocase,
FT                   TatA/E family"
FT                   /note="identified by match to protein family HMM PF02416;
FT                   match to protein family HMM TIGR01411"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0747"
FT                   /db_xref="EnsemblGenomes-Tr:ACF67121"
FT                   /protein_id="ACF67121.1"
FT                   /translation="MGEISITKLLVVAALVVLLFGTKKLRTLGGDLGTAIKGFKKAMND
FT                   EDAGVKKDVDGSVQAEKLSHKE"
FT   gene            complement(743291..744256)
FT                   /gene="lipA"
FT                   /locus_tag="SeHA_C0748"
FT   CDS_pept        complement(743291..744256)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lipA"
FT                   /locus_tag="SeHA_C0748"
FT                   /product="lipoic acid synthetase"
FT                   /EC_number="2.8.1.-"
FT                   /note="identified by match to protein family HMM PF04055;
FT                   match to protein family HMM TIGR00510"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0748"
FT                   /db_xref="EnsemblGenomes-Tr:ACF68622"
FT                   /db_xref="GOA:B4TAI5"
FT                   /db_xref="InterPro:IPR003698"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR031691"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4TAI5"
FT                   /protein_id="ACF68622.1"
FT                   /translation="MSKPIVMERGVKYRDADKMALIPVKNVVTERDALLRKPEWMKIKL
FT                   PADSTRIQGIKAAMRKNGLHSVCEEASCPNLAECFNHGTATFMILGAICTRRCPFCDVA
FT                   HGRPVAPDAEEPQKLAQTIADMALRYVVITSVDRDDLRDGGAQHFADCITAIRAKSPEI
FT                   KIETLVPDFRGRMDRALDILNATPPDVFNHNLENVPRIYRQVRPGADYNWSLKLLERFK
FT                   EAHPEIPTKSGLMVGLGETNAEIIEVMRDLRRHGVTMLTLGQYLQPSRHHLPVQRYVSP
FT                   EEFDEMKAEALAMGFTHAACGPFVRSSYHADLQAKGMEVK"
FT   gene            complement(744297..744431)
FT                   /locus_tag="SeHA_C0749"
FT   CDS_pept        complement(744297..744431)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0749"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0749"
FT                   /db_xref="EnsemblGenomes-Tr:ACF69286"
FT                   /protein_id="ACF69286.1"
FT                   /translation="MGKQHKTTTILHFAGLSGCFMALINDILRVTNSKIVDKYNFPLN"
FT   gene            complement(744462..745415)
FT                   /locus_tag="SeHA_C0750"
FT   CDS_pept        complement(744462..745415)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0750"
FT                   /product="LysR-family transcriptional regulator"
FT                   /note="identified by match to protein family HMM PF00126;
FT                   match to protein family HMM PF03466"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0750"
FT                   /db_xref="EnsemblGenomes-Tr:ACF66030"
FT                   /protein_id="ACF66030.1"
FT                   /translation="MSDNNQAERQPADQHLQDKPQIFRTLRNIDLNLLTIFEAVYVHKG
FT                   IVNAAKILNLTPSAISQSIQKLRTIFPDPLFIRKGQGVTPTTYATHLHEYISQGLESIL
FT                   GALDLTGSYDKQRTITIGTTPSVGALVMPIIYQAIRPRYPQLLLRNIPVDDAESQLSQF
FT                   QTDLIINTHSYNNRSIQHHVLFSDTLEIVCRQHHPCLANAITEERLNSADHTFLMLEGQ
FT                   HLSLLRQRLQETFPDQQISFSSYNIFTIASLIASSDLLGLMPTRFYDLFSRCWPLERLP
FT                   YAPVNSEQVEFSLHYNKLSLRDPVLENVIDIIREAF"
FT   gene            complement(745717..746358)
FT                   /gene="lipB"
FT                   /locus_tag="SeHA_C0751"
FT   CDS_pept        complement(745717..746358)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lipB"
FT                   /locus_tag="SeHA_C0751"
FT                   /product="lipoyltransferase"
FT                   /EC_number="2.3.1.181"
FT                   /note="identified by match to protein family HMM PF03099;
FT                   match to protein family HMM TIGR00214"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0751"
FT                   /db_xref="EnsemblGenomes-Tr:ACF70016"
FT                   /protein_id="ACF70016.1"
FT                   /translation="MYQDKILVRQLGLQPYEAISQAMHNFTDMRDENSHDEIWLVEHYP
FT                   VFTQGQAGKAEHILMPGDIPVVQSDRGGQVTYHGPGQQVMYVLLNLKRRKLGVRDLVTL
FT                   LEQTVVNTLAEIGIEAHPRADAPGVYVGEKKICSLGLRIRRGCSFHGLALNVNMDLSPF
FT                   LRINPCGYAGMEMAKITQWKEDATTDNIAPRLLANILALLNNPPYEYIAA"
FT   gene            complement(746458..746721)
FT                   /locus_tag="SeHA_C0752"
FT   CDS_pept        complement(746458..746721)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0752"
FT                   /product="protein YbeD"
FT                   /note="identified by match to protein family HMM PF04359"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0752"
FT                   /db_xref="EnsemblGenomes-Tr:ACF67758"
FT                   /db_xref="InterPro:IPR007454"
FT                   /db_xref="InterPro:IPR027471"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4TAI9"
FT                   /protein_id="ACF67758.1"
FT                   /translation="MKTKLNELLEFPTPFTYKVMGQALPELVDQVVEVVQRHAPGDYSP
FT                   TVKPSSKGNYHSVSITINATHIEQVETLYEELGNIDIVRMVL"
FT   gene            complement(746829..748040)
FT                   /gene="dacA"
FT                   /locus_tag="SeHA_C0753"
FT   CDS_pept        complement(746829..748040)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dacA"
FT                   /locus_tag="SeHA_C0753"
FT                   /product="serine-type D-Ala-D-Ala carboxypeptidase"
FT                   /EC_number="3.4.16.4"
FT                   /note="identified by match to protein family HMM PF00768;
FT                   match to protein family HMM PF07943"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0753"
FT                   /db_xref="EnsemblGenomes-Tr:ACF67243"
FT                   /protein_id="ACF67243.1"
FT                   /translation="MKTTFSARFMQRMALTTALCAAFISTAHADDLNIKTMIPGVPQID
FT                   AESYILIDYNSGKVLAEQNADERRDPASLTKMMTSYVIGQAMKAGKFKETDLVTVGNDA
FT                   WATGNPVFKGSSLMFLKPGMQVPVSQLIRGINLQSGNDACVAMADFAAGSQDAFVGLMN
FT                   SYVNALGLKNTHFQTVHGLDADGQYSSARDMALIGQALIRDVPNEYAVYKEKEFTFNGI
FT                   RQLNRNGLLWDNSLNVDGIKTGHTSKAGYNLVASATEGQMRLISAVMGGRTYKGRETES
FT                   KKLLTWGFRFFETVNPLKAGKEFASEPAWFGNTDRASLGVDKDVYLTIPRGRMKDLKAS
FT                   YVLNTAELHAPLQKNQVVGTINFQLDGKTIEQRPLVVLQEIPEGNFFGKIIDYIKLMFH
FT                   HWFG"
FT   gene            complement(748180..749313)
FT                   /locus_tag="SeHA_C0754"
FT   CDS_pept        complement(748180..749313)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0754"
FT                   /product="rare lipoprotein A"
FT                   /note="identified by match to protein family HMM PF03330;
FT                   match to protein family HMM PF05036; match to protein
FT                   family HMM TIGR00413"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0754"
FT                   /db_xref="EnsemblGenomes-Tr:ACF69730"
FT                   /protein_id="ACF69730.1"
FT                   /translation="MRKQLPVICVAAGIVLLAACTNDGGQQQTTVAPQPAVCNGPTVEI
FT                   SGAEPRYEPLNPTANQDYQRDGKSYKIVQDPSRFSQAGLAAIYDAEPGSNLTASGEMFD
FT                   PMQLTAAHPTLPIPSYARITNLANGRMIVVRINDRGPYGTDRVISLSRAAADRLNTSNN
FT                   TKVRIDPIIVAPDGSLSGPGMACTTVAKQTYALPPRPDLSGGMGSASSAPAQPQGDVLP
FT                   VSNSTLKSDDTTGAPVSSSGFLGAPTTLAPGVLESNEPTPTPQTAPVSAPVTAPATATP
FT                   VSAPAAAAPVSAPVSAPAAAASARFVVQVGAVSDQTRAQQYQQRLSQQFSVPGRVIQNG
FT                   AVWRIQLGPFASKAEASALQQRLQTEAQLQSFIASAQ"
FT   gene            complement(749324..750436)
FT                   /gene="mrdB"
FT                   /locus_tag="SeHA_C0755"
FT   CDS_pept        complement(749324..750436)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mrdB"
FT                   /locus_tag="SeHA_C0755"
FT                   /product="rod shape-determining protein RodA"
FT                   /note="identified by match to protein family HMM PF01098;
FT                   match to protein family HMM TIGR02210"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0755"
FT                   /db_xref="EnsemblGenomes-Tr:ACF69222"
FT                   /protein_id="ACF69222.1"
FT                   /translation="MTDNPNKKTFWDKIHIDPTMLLILLALLVYSALVIWSASGQDIGM
FT                   MERKIGQIAMGLVVMVVMAQIPPRVYEGWAPYLYIICIILLVAVDAFGAISKGAQRWLD
FT                   LGIVRFQPSEIAKIAVPLMVARFINRDVCPPSLKNTAIALVLIFMPTLLVAAQPDLGTS
FT                   ILVALSGLFVLFLSGLSWRLIGVAIVLIAAFIPILWFFLMHDYQRQRVMMLLDPETDPL
FT                   GAGYHIIQSKIAIGSGGLRGKGWLHGTQSQLEFLPERHTDFIFAVLAEELGLVGILILL
FT                   ALYILLIMRGLWIAARAQTTFGRVMAGGLMLILFVYVFVNIGMVSGILPVVGVPLPLVS
FT                   YGGSALIVLMAGFGIVMSIHTHRKMLSKSV"
FT   gene            complement(750439..752340)
FT                   /gene="mrdA"
FT                   /locus_tag="SeHA_C0756"
FT   CDS_pept        complement(750439..752340)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mrdA"
FT                   /locus_tag="SeHA_C0756"
FT                   /product="penicillin-binding protein 2"
FT                   /note="identified by match to protein family HMM PF00905;
FT                   match to protein family HMM PF03717; match to protein
FT                   family HMM TIGR03423"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0756"
FT                   /db_xref="EnsemblGenomes-Tr:ACF70420"
FT                   /protein_id="ACF70420.1"
FT                   /translation="MKRQNSFRDYTAESALFVRRALVAFLGILLLTGVLIANLYNLQIL
FT                   RFTDYQTRSNENRIKLVPIAPSRGIIYDRNGIPLALNRTIYQIEMMPEKVDNVQQTLDA
FT                   LRSVVDLNDDDIAAFKKERARSHRFTSIPVKTNLTEVQVARFAVNQYRFPGVEVKGYKR
FT                   RYYPYGSALTHVIGYVSKINDKDVERLDRENKLANYAATHDIGKLGIERYYEDILHGQT
FT                   GYEEVEVNNRGRVIRQLKEVPPQAGHDIYLTLDLKLQQYIETLLAGSRAAVIVTDPRTG
FT                   GVLSLVSMPSYDPNLFVDGISSKDYSGLLNDPNTPLVNRATQGVYPPASTVKPYVAVSA
FT                   LSAGVITRNTSLFDPGWWQLPGSEKRYRDWKKWGHGHLNITKSLEESADTFFYQVAYDM
FT                   GIDRLSEWMGKFGYGHYTGIDLAEERSGNMPTREWKQKRFKKPWYQGDTIPVGIGQGYW
FT                   TATPIQMSKALMILINDGVVKVPHLLMSTAENGKQVPWVQPHEPPVGDIHSGYWEIAKD
FT                   GMYGVANRPNGTAHKYFASAPYKIAAKSGTAQVFGLKANETYNAHKIAERLRDHKLMTA
FT                   FAPYNNPQVAVAIILENGGAGPAVGTIMRQILDHIMLGDNNTHLPAENPVVAAAEDQ"
FT   gene            complement(752371..752838)
FT                   /locus_tag="SeHA_C0757"
FT   CDS_pept        complement(752371..752838)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0757"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF02590;
FT                   match to protein family HMM TIGR00246"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0757"
FT                   /db_xref="EnsemblGenomes-Tr:ACF69905"
FT                   /db_xref="GOA:B4TB44"
FT                   /db_xref="InterPro:IPR003742"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4TB44"
FT                   /protein_id="ACF69905.1"
FT                   /translation="MKLQLVAVGTKMPDWVQTGFTEYLRRFPKDMPFELIEIPAGKRGK
FT                   NADIKRILDKEGEQMLAAAGKNRIVTLDIPGKPWDTPQLANELERWKQDGRDVSLLIGG
FT                   PEGLSPACKAAAEQSWSLSALTLPHPLVRVLVAESLYRAWSITTNHPYHRE"
FT   gene            complement(752842..753159)
FT                   /locus_tag="SeHA_C0758"
FT   CDS_pept        complement(752842..753159)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0758"
FT                   /product="iojap family protein"
FT                   /note="identified by match to protein family HMM PF02410;
FT                   match to protein family HMM TIGR00090"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0758"
FT                   /db_xref="EnsemblGenomes-Tr:ACF66422"
FT                   /protein_id="ACF66422.1"
FT                   /translation="MQGKALQDFVIDKIDDLKGQDIIALDVQGKSSITDCMIICTGTSS
FT                   RHVMSIADHVVQSSRAAGMLPLGVEGENAADWIVVDLGDVIVHVMQEESRRLYELEKLW
FT                   S"
FT   gene            complement(753488..754096)
FT                   /gene="cobC"
FT                   /locus_tag="SeHA_C0759"
FT   CDS_pept        complement(753488..754096)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cobC"
FT                   /locus_tag="SeHA_C0759"
FT                   /product="alpha-ribazole phosphatase"
FT                   /EC_number="3.1.3.73"
FT                   /note="identified by match to protein family HMM PF00300;
FT                   match to protein family HMM TIGR03162"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0759"
FT                   /db_xref="EnsemblGenomes-Tr:ACF66006"
FT                   /protein_id="ACF66006.1"
FT                   /translation="MRLWLVRHGETEANVAGLYSGHAPTPLTEKGIGQAKTLHTLLRHA
FT                   PFDRVLCSELERARHTARLVLEGRDTLQHILPELNEMYFGDWEMRHHRDLTHEDAESYA
FT                   AWCTDWQNAVPTNGEGFQAFTRRVERFISRLDAFSDCQNLLIVSHQGVLSLLIARLLAM
FT                   PAASLWHFRVEQGCWSAIDICEGFATLKVLNSRAVWRPE"
FT   gene            754193..755287
FT                   /gene="cobD"
FT                   /locus_tag="SeHA_C0760"
FT   CDS_pept        754193..755287
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cobD"
FT                   /locus_tag="SeHA_C0760"
FT                   /product="threonine-phosphate decarboxylase"
FT                   /EC_number="4.1.1.81"
FT                   /note="identified by match to protein family HMM PF00155;
FT                   match to protein family HMM TIGR01140"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0760"
FT                   /db_xref="EnsemblGenomes-Tr:ACF68544"
FT                   /protein_id="ACF68544.1"
FT                   /translation="MALFNSAHGGNIREAATVLGISPDQLLDFSANINPLGMPVSVKRA
FT                   LIDNLDCIERYPDADYFHLHQALARHHQVPASWILAGNGETESIFTVASGLKPRRAMIV
FT                   TPGFAEYGRALAQSGCEIRRWSLREADGWQLTDAILEALTPDLDCLFLCTPNNPTGLLP
FT                   ERQLLQAIADRCKSLNINLILDEAFIDFIPHEAGFIPALKDNPHIWVLRSLTKFYAIPG
FT                   LRLGYLVNSDDAAVARMRRQQMPWSVNALAALAGEVALQDSAWQQATWHWLREEGARFY
FT                   QALCQLPLLTVYPGRANYLLLRCEREDIDLQRRLLTQRILIRSCANYPGLDSRYYRVAI
FT                   RSAAENERLLSALRNVLTGIAPAD"
FT   gene            complement(755262..755912)
FT                   /gene="nadD"
FT                   /locus_tag="SeHA_C0761"
FT   CDS_pept        complement(755262..755912)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nadD"
FT                   /locus_tag="SeHA_C0761"
FT                   /product="nicotinate (nicotinamide) nucleotide
FT                   adenylyltransferase"
FT                   /EC_number="2.7.7.18"
FT                   /note="identified by match to protein family HMM PF01467;
FT                   match to protein family HMM TIGR00125; match to protein
FT                   family HMM TIGR00482"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0761"
FT                   /db_xref="EnsemblGenomes-Tr:ACF69040"
FT                   /protein_id="ACF69040.1"
FT                   /translation="MGDMKSLQALFGGTFDPVHYGHLKPVETLANLIGLSRVIIMPNNV
FT                   PPHRPQPEASSAQRKYMLELAIADKPLFTLDERELQRNAPSYTAQTLKAWREEQGSEAP
FT                   LAFIIGQDSLLNFPTWHDYDTILDNTHLIVCRRPGYPLEMTQAQHQQWLEQHLTHTPDD
FT                   LHQLPAGKIYLAETPWLNISATLIRERLEKGESCDDLLPENVLNYINQQGLYR"
FT   gene            complement(755905..756936)
FT                   /gene="holA"
FT                   /locus_tag="SeHA_C0762"
FT   CDS_pept        complement(755905..756936)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="holA"
FT                   /locus_tag="SeHA_C0762"
FT                   /product="DNA polymerase III, delta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="identified by match to protein family HMM PF06144;
FT                   match to protein family HMM TIGR01128"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0762"
FT                   /db_xref="EnsemblGenomes-Tr:ACF69177"
FT                   /protein_id="ACF69177.1"
FT                   /translation="MIRLYPEQLRAQLNEGLRAAYLLLGNDPLLLQESQDAIRLAAASQ
FT                   GFEEHHAFTLDPSTDWGSLFSLCQAMSLFASRQTLVLQLPENGPNAAMNEQLATLSELL
FT                   HDDLLLIVRGNKLTKAQENAAWYTALADRSVQVSCQTPEQAQLPRWVAARAKAQNLQLD
FT                   DAANQLLCYCYEGNLLALAQALERLSLLWPDGKLTLPRVEQAVNDAAHFTPFHWVDALL
FT                   MGKSKRALHILQQLRLEGSEPVILLRTLQRELLLLVNLKRQSAHTPLRALFDKHRVWQN
FT                   RRPMIGDALQRLHPAQLRQAVQLLTRTEITLKQDYGQSVWADLEGLSLLLCHKALADVF
FT                   IDG"
FT   gene            complement(756936..757526)
FT                   /locus_tag="SeHA_C0763"
FT   CDS_pept        complement(756936..757526)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0763"
FT                   /product="LPS-assembly lipoprotein RlpB"
FT                   /note="identified by match to protein family HMM PF04390"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0763"
FT                   /db_xref="EnsemblGenomes-Tr:ACF68684"
FT                   /db_xref="GOA:B4TB50"
FT                   /db_xref="InterPro:IPR007485"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4TB50"
FT                   /protein_id="ACF68684.1"
FT                   /translation="MRYLVTLLLSLAVLVTAGCGWHLRSTTQVPASMKTMILDSGDPNG
FT                   PLSRAVRNQLRLNNVNLLDKDTTRKDVPSLRLGTVTISQDTASVFQDGQTAEYQMVMTV
FT                   NASVLIPGHDIYPISTKVYRSFFDNPQMALAKDNEQAMIVQEMYDKAAEQLIRKLTSVR
FT                   AADIQATKEEATADNETAAPASTPARVSTTLSN"
FT   gene            complement(757541..760123)
FT                   /gene="leuS"
FT                   /locus_tag="SeHA_C0764"
FT   CDS_pept        complement(757541..760123)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="leuS"
FT                   /locus_tag="SeHA_C0764"
FT                   /product="leucyl-tRNA synthetase"
FT                   /EC_number="6.1.1.4"
FT                   /note="identified by match to protein family HMM PF00133;
FT                   match to protein family HMM PF08264; match to protein
FT                   family HMM PF09334; match to protein family HMM TIGR00396"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0764"
FT                   /db_xref="EnsemblGenomes-Tr:ACF70251"
FT                   /db_xref="GOA:B4TB51"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002302"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR025709"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4TB51"
FT                   /protein_id="ACF70251.1"
FT                   /translation="MQEQYRPEEIESKVQLHWDEKRTFEVTEDESKEKYYCLSMLPYPS
FT                   GRLHMGHVRNYTIGDVVARYQRMLGKNVLQPIGWDAFGLPAEGAAVKNNTAPAPWTYDN
FT                   IAYMKNQLKTLGFGYDWSREIATCTPEYYRWEQKFFTELYKKGLVYKKTSAVNWCPNDQ
FT                   TVLANEQVIDGCCWRCDTKVERKEIPQWFIKITAYADELLRDLDKLDHWPDTVKTMQRN
FT                   WIGRSEGVEITFDVKGYDNTLTVYTTRPDTFMGATYLAVAAGHPLAQKAAANNAELAAF
FT                   IDECRNTKVAEAEMATMEKKGVDTGYKAIHPLTGEEIPVWAANFVLMEYGTGAVMAVPG
FT                   HDQRDYEFASKYGLTIKPVILAADGSEPDLSEQALTEKGVLFNSGEFDGLAFEAAFNAI
FT                   ADKLAEKGVGERKVNYRLRDWGVSRQRYWGAPIPMVTLEDGTVLPTPEDQLPVILPEDV
FT                   VMDGITSPIKADPEWAKTTVNGMPALRETDTFDTFMESSWYYARYTCPQYQEGMLDSKA
FT                   ANYWLPVDIYIGGIEHAIMHLLYFRFFHKLMRDAGMVTSDEPAKQLLCQGMVLADAFYY
FT                   VGENGERNWVSPVDAIVERDEKGRIVKAKDAAGHELVYTGMSKMSKSKNNGIDPQVMVE
FT                   RYGADTVRLFMMFASPADMTLEWQESGVEGANRFIKRVWKLVYEHTAKGPVAALNVDAL
FT                   SEDQKALRRDVHKTIAKVTDDIGRRQTFNTAIAAIMELMNKLAKAPQEGEQDRALLQEA
FT                   LQAVVRMLNPFTPHVCFTLWQELGGEGDIDNAPWPVADEQAMVENTTLVVVQVNGKVRG
FT                   KITVAVDATEEQVRERAGQEHLVAKYLDGVTVRKVIYVPGKLLNLVVG"
FT   gene            complement(760250..760366)
FT                   /locus_tag="SeHA_C0765"
FT   CDS_pept        complement(760250..760366)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0765"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0765"
FT                   /db_xref="EnsemblGenomes-Tr:ACF69711"
FT                   /protein_id="ACF69711.1"
FT                   /translation="MPFFNCMVYMTLFLQADLAVTGTAVICLSRVAFCVTSS"
FT   gene            760411..760701
FT                   /locus_tag="SeHA_C0766"
FT   CDS_pept        760411..760701
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0766"
FT                   /product="hydrolase, UxaA family"
FT                   /note="identified by match to protein family HMM PF08666"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0766"
FT                   /db_xref="EnsemblGenomes-Tr:ACF66496"
FT                   /protein_id="ACF66496.1"
FT                   /translation="MKKNAVVIHPQDCVATAITALKAGETATMFVGEREISVVLHQDVP
FT                   FGHKFAICDVPFHGEVYKYGESIGRATQEIKSGDYVHVHNVESERGRGDWK"
FT   gene            760724..761890
FT                   /locus_tag="SeHA_C0767"
FT   CDS_pept        760724..761890
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0767"
FT                   /product="hydrolase, UxaA family"
FT                   /note="identified by match to protein family HMM PF04295"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0767"
FT                   /db_xref="EnsemblGenomes-Tr:ACF66000"
FT                   /protein_id="ACF66000.1"
FT                   /translation="MSNETFLGFRRPDGRFGIRNYVLILPTSVCANKVAQDIARQVKGA
FT                   TWVNNDFGCCQVAGDARLTEKTLINVANNPNVGAIVVVGLGCEGAEPLRIAEEITAFGK
FT                   PTSCITIQEEGGTLKCQARGISLARDYAQQLSMQKPQQAPVSELLLAMECGGSDTTSGL
FT                   ASNPSCGVASDKLIRCGGSSILSETTEFIGAEHVMAKRAVTPEVGQQLIDLVVGCEARA
FT                   KALGEDIRGGQPTPGNIKGGLTTIEEKSLGCMHKAGHAPLQGVLEYADSPTHPGLWIMD
FT                   TPGQDIESISGMVAGGAQIVIFTTGRGTPAGNPIAPVIKITGNKATWEMMQDNIDIDVS
FT                   AIMSGEASITQMGEEIYQEILRVANGKTTKSEDLGHNEFSIYKIAPTF"
FT   gene            761940..762893
FT                   /locus_tag="SeHA_C0768"
FT   CDS_pept        761940..762893
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0768"
FT                   /product="2-keto-3-deoxygluconate permease"
FT                   /note="identified by match to protein family HMM PF03812"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0768"
FT                   /db_xref="EnsemblGenomes-Tr:ACF67576"
FT                   /protein_id="ACF67576.1"
FT                   /translation="MKIKKTLERFPGSMMVVPLIIGALFKTFAPEALEIGGFVTSISHG
FT                   AMAILGMFLVCMGADIQFKAAPKALKKGAAITFAKFASGVIIGILVGKFCSPDGLLGLS
FT                   ALAIISAMTNSNSGLYAALVGEYGDETDGGAIAVISLNDGPFFTMLALGSAGMVSIPFM
FT                   NLVAVIIPIIIGMILGNLDEDMRKFLKQGSVVTIPFFAFGLGYGIDFARLITAGSSGIL
FT                   LGLMTVAIGGFFNIFADRVTGGSGVAGAAVSTTSGNAVATPAAIALLDPHFTDLASTAA
FT                   AQVAASTIITALCAPFLTVWIKKRYDRKLNPATAGG"
FT   gene            762961..764889
FT                   /locus_tag="SeHA_C0769"
FT   CDS_pept        762961..764889
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0769"
FT                   /product="putative sigma-54 dependent transcriptional
FT                   regulator"
FT                   /note="identified by match to protein family HMM PF00158;
FT                   match to protein family HMM PF06506"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0769"
FT                   /db_xref="EnsemblGenomes-Tr:ACF67068"
FT                   /protein_id="ACF67068.1"
FT                   /translation="MNKTKDIAASPLCFVSPYPQLAKAAEALVAQLDYAVTIHQTTLNR
FT                   ILDELPLLESRGHQVLISRGGCAEILKKHSKLPVVEIKMSGYDILDALIPFKGQKGTVG
FT                   IVGFSSVIKGCARVAEQLNINYKIFTLQGNDKETISCLKQQLASTPLDCIVGDTVCQDY
FT                   FSPLGSQFRLLDSSPASITEALEEASSLYLAFRSQLLERHHLQLILDQFDKAVITLDDT
FT                   GALLHYNKYASQLFKINASGEIYDASFLKQVLLQERHTLREGKTVSAKVVDTPQGAMVV
FT                   NLYPVFAARQLSRVVLTMQTVSSLQGAEHHVRRQELSRRGLSARYHFDDLLTENPEMLR
FT                   RLAIIKNYAGTDATILINGESGTGKEVLAQSIHNASQRVNGPFVAINCGAMAPQILESE
FT                   LFGYVAGAFTGASPKGKIGLFELAHHGTIFLDEISELDKPLQTRLLRVLQERQIMRLGS
FT                   DQMIPVDIRVIAATNQTLTKLIADGTFREDLYYRLNVLKVTTIPLRKRPEDIKAIGLSL
FT                   LTSFSQHYKRPALTLTPALWQELQRFAWPGNVRQLSNIIERLVLSIDHSPATLDEGRLL
FT                   LDDLEEGSRREPTTCHDCQMLAGDYKTIRLRILRKLLEAERDNKSLVAKRLNVDRTSLT
FT                   RWIRESA"
FT   gene            764982..765455
FT                   /locus_tag="SeHA_C0770"
FT   CDS_pept        764982..765455
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0770"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF07295"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0770"
FT                   /db_xref="EnsemblGenomes-Tr:ACF68589"
FT                   /protein_id="ACF68589.1"
FT                   /translation="MNKVAQYYRELVASLSERLRNGERDIDALVEQARQRVMQTGELTR
FT                   TEVDELTRAVRRDLEEFAMSYEESQEDSVFLRVIKESLWQELADITDKTQLEWREVFQD
FT                   LNHHGVYHSGEVVGLGNLVCEKCHYHLAVYTPDVLPLCPKCGHDQFQRRPFEP"
FT   gene            complement(765494..766489)
FT                   /locus_tag="SeHA_C0771"
FT   CDS_pept        complement(765494..766489)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0771"
FT                   /product="Sel1 repeat family"
FT                   /note="identified by match to protein family HMM PF08238"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0771"
FT                   /db_xref="EnsemblGenomes-Tr:ACF70399"
FT                   /protein_id="ACF70399.1"
FT                   /translation="MNHSITSHSCDNVSLAQLTELAQSGNSEAQYILGRLYNDERIDGS
FT                   EEDKLSFYWLQQAAEQGHCEAQYWLGLRYKDTPTDMKDNTLALFWSEKAAQQGHRHAFN
FT                   TLGWVQEGETGMAPDYAQAVAWYRKGAEQSHNLAQYNLGRMYHSGTGVEQNDTQALYWF
FT                   KQAALQGHCASQERLAYMYGNGKGCRKNLSLAALWYKKSALQESSYSQYQMGYCYYIGK
FT                   GIKQDYQQAIYWFRKAADQGDDDAYNSIGWMYKCGHGVEQNYSLALEWFHKSAECNNPS
FT                   GWYNLGCMYRDGYGTAQDLQQALYWFKKAQPTGKWDVDEEIRQLEAQLNA"
FT   gene            766707..767321
FT                   /locus_tag="SeHA_C0772"
FT   CDS_pept        766707..767321
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0772"
FT                   /product="putative cytoplasmic protein"
FT                   /note="identified by match to protein family HMM PF06889"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0772"
FT                   /db_xref="EnsemblGenomes-Tr:ACF67395"
FT                   /protein_id="ACF67395.1"
FT                   /translation="MYIGIKRFDLESSWGIENRDELLQTISRMTDDGHATQLEWLYRRW
FT                   FRYAPQEWQEYTDALDEGDRIYARFVADTAVCCGEGGIRSWDYVRMGFLCRMGVLNEWL
FT                   TEEESLWLQSRIQLRALSYYSGWLPYFSAYYTGRLYWQLRNGDNLPLLRETFARKEFDD
FT                   AGRRMMNKLIAGKDSFYATLPWRYLPHYPECPDTLQEVSDL"
FT   gene            767318..768751
FT                   /locus_tag="SeHA_C0773"
FT   CDS_pept        767318..768751
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeHA_C0773"
FT                   /product="DnaJ domain protein"
FT                   /note="identified by match to protein family HMM PF00226"
FT                   /db_xref="EnsemblGenomes-Gn:SeHA_C0773"
FT                   /db_xref="EnsemblGenomes-Tr:ACF67887"
FT                   /protein_id="ACF67887.1"
FT                   /translation="MKTCWQVLGIEATTDTDAIRQAYLALLPSFHPETDPQGFKQLREA
FT                   YEYALRFTKSPAITMVEEDPDTPWVNYLREIFGDLLADGERRFQPQAWQEFIQQINKLS
FT                   ISQVEKSRWWLCAIAMKTFPISYSCLKLLSDRLAWEQGSDNRDVDAEEVEDLLFEIRRG
FT                   DLFDYSLLLHLPVAVQNQTIAFYDALDNTFFEHPLYFAQLMAQHGAWIIPDNLRFQRRL
FT                   LRWFSTLHLGIAELLPVALAWQKAEPDNATPGYYYLAQRVFCGEGDSLLPELYAQWWAH
FT                   PSTQLDDLLLRWCRQHRPDFFPLLVMAVEGREQVDINAEQLLYIPGSSARTCLLWAEAL
FT                   HSGALSPLSKSFIARRLNYGAPAVSEAHS