(data stored in ACNUC8465 zone)

EMBL: CP001124

ID   CP001124; SV 1; circular; genomic DNA; STD; PRO; 4615150 BP.
XX
AC   CP001124; AAZA01000000-AAZA01000094;
XX
PR   Project:PRJNA17707;
XX
DT   20-AUG-2008 (Rel. 96, Created)
DT   30-JAN-2014 (Rel. 119, Last updated, Version 5)
XX
DE   Geobacter bemidjiensis Bem, complete genome.
XX
KW   .
XX
OS   Geobacter bemidjiensis Bem
OC   Bacteria; Proteobacteria; Deltaproteobacteria; Desulfuromonadales;
OC   Geobacteraceae; Geobacter.
XX
RN   [1]
RC   Publication Status: Online-Only
RP   1-4615150
RX   DOI; 10.1186/1471-2164-11-490.
RX   PUBMED; 20828392.
RA   Aklujkar M., Young N.D., Holmes D., Chavan M., Risso C., Kiss H.E.,
RA   Han C.S., Land M.L., Lovley D.R.;
RT   "The genome of Geobacter bemidjiensis, exemplar for the subsurface clade of
RT   Geobacter species that predominate in Fe(III)-reducing subsurface
RT   environments";
RL   BMC Genomics 11:490-490(2010).
XX
RN   [2]
RP   1-4615150
RG   US DOE Joint Genome Institute
RA   Lucas S., Copeland A., Lapidus A., Glavina del Rio T., Dalin E., Tice H.,
RA   Bruce D., Goodwin L., Pitluck S., Kiss H., Brettin T., Detter J.C., Han C.,
RA   Kuske C.R., Schmutz J., Larimer F., Land M., Hauser L., Kyrpides N.,
RA   Lykidis A., Lovley D., Richardson P.;
RT   "Complete sequence of Geobacter bemidjiensis BEM";
RL   Unpublished.
XX
RN   [3]
RP   1-4615150
RG   US DOE Joint Genome Institute
RA   Lucas S., Copeland A., Lapidus A., Glavina del Rio T., Dalin E., Tice H.,
RA   Bruce D., Goodwin L., Pitluck S., Kiss H., Brettin T., Detter J.C., Han C.,
RA   Kuske C.R., Schmutz J., Larimer F., Land M., Hauser L., Kyrpides N.,
RA   Lykidis A., Lovley D., Richardson P.;
RT   ;
RL   Submitted (22-JUL-2008) to the INSDC.
RL   US DOE Joint Genome Institute, 2800 Mitchell Drive B100, Walnut Creek, CA
RL   94598-1698, USA
XX
RN   [4]
RC   Protein update by submitter
RP   1-4615150
RA   Aklujkar M., Young N.D., Brown P., Holmes D., Chavan M., Risso C.,
RA   Kiss H.E., Han C.S., Land M.L., Lovley D.R.;
RT   ;
RL   Submitted (01-OCT-2010) to the INSDC.
RL   Microbiology, University of Massachusetts, 639 North Pleasant St., Amherst,
RL   MA 01003, USA
XX
RN   [5]
RC   Protein update by submitter
RP   1-4615150
RA   Aklujkar M., Young N.D., Brown P., Holmes D., Chavan M., Risso C.,
RA   Kiss H.E., Han C.S., Land M.L., Lovley D.R.;
RT   ;
RL   Submitted (18-OCT-2012) to the INSDC.
RL   Microbiology, University of Massachusetts, 639 North Pleasant St., Amherst,
RL   MA 01003, USA
XX
DR   MD5; 9c7e8eb9d25842570cb264f66b90879b.
DR   BioSample; SAMN02598400.
DR   EnsemblGenomes-Gn; EBG00001157800.
DR   EnsemblGenomes-Gn; EBG00001157801.
DR   EnsemblGenomes-Gn; EBG00001157802.
DR   EnsemblGenomes-Gn; EBG00001157803.
DR   EnsemblGenomes-Gn; EBG00001157804.
DR   EnsemblGenomes-Gn; EBG00001157805.
DR   EnsemblGenomes-Gn; EBG00001157806.
DR   EnsemblGenomes-Gn; EBG00001157807.
DR   EnsemblGenomes-Gn; EBG00001157808.
DR   EnsemblGenomes-Gn; EBG00001157809.
DR   EnsemblGenomes-Gn; EBG00001157810.
DR   EnsemblGenomes-Gn; EBG00001157811.
DR   EnsemblGenomes-Gn; EBG00001157812.
DR   EnsemblGenomes-Gn; EBG00001157813.
DR   EnsemblGenomes-Gn; EBG00001157814.
DR   EnsemblGenomes-Gn; EBG00001157815.
DR   EnsemblGenomes-Gn; EBG00001157816.
DR   EnsemblGenomes-Gn; EBG00001157817.
DR   EnsemblGenomes-Gn; EBG00001157818.
DR   EnsemblGenomes-Gn; EBG00001157819.
DR   EnsemblGenomes-Gn; EBG00001157820.
DR   EnsemblGenomes-Gn; EBG00001157821.
DR   EnsemblGenomes-Gn; EBG00001157822.
DR   EnsemblGenomes-Gn; EBG00001157823.
DR   EnsemblGenomes-Gn; EBG00001157824.
DR   EnsemblGenomes-Gn; EBG00001157825.
DR   EnsemblGenomes-Gn; EBG00001157826.
DR   EnsemblGenomes-Gn; EBG00001157827.
DR   EnsemblGenomes-Gn; EBG00001157828.
DR   EnsemblGenomes-Gn; EBG00001157829.
DR   EnsemblGenomes-Gn; EBG00001157830.
DR   EnsemblGenomes-Gn; EBG00001157831.
DR   EnsemblGenomes-Gn; EBG00001157832.
DR   EnsemblGenomes-Gn; EBG00001157833.
DR   EnsemblGenomes-Gn; EBG00001157834.
DR   EnsemblGenomes-Gn; EBG00001157835.
DR   EnsemblGenomes-Gn; EBG00001157836.
DR   EnsemblGenomes-Gn; EBG00001157837.
DR   EnsemblGenomes-Gn; EBG00001157838.
DR   EnsemblGenomes-Gn; EBG00001157839.
DR   EnsemblGenomes-Gn; EBG00001157840.
DR   EnsemblGenomes-Gn; EBG00001157841.
DR   EnsemblGenomes-Gn; EBG00001157842.
DR   EnsemblGenomes-Gn; EBG00001157843.
DR   EnsemblGenomes-Gn; EBG00001157844.
DR   EnsemblGenomes-Gn; EBG00001157845.
DR   EnsemblGenomes-Gn; EBG00001157846.
DR   EnsemblGenomes-Gn; EBG00001157847.
DR   EnsemblGenomes-Gn; EBG00001157848.
DR   EnsemblGenomes-Gn; EBG00001157849.
DR   EnsemblGenomes-Gn; EBG00001157850.
DR   EnsemblGenomes-Gn; EBG00001157851.
DR   EnsemblGenomes-Gn; EBG00001157852.
DR   EnsemblGenomes-Gn; EBG00001157853.
DR   EnsemblGenomes-Gn; EBG00001157854.
DR   EnsemblGenomes-Gn; EBG00001157855.
DR   EnsemblGenomes-Gn; EBG00001157856.
DR   EnsemblGenomes-Gn; EBG00001157857.
DR   EnsemblGenomes-Gn; EBG00001157858.
DR   EnsemblGenomes-Gn; EBG00001157859.
DR   EnsemblGenomes-Gn; EBG00001157860.
DR   EnsemblGenomes-Gn; EBG00001157861.
DR   EnsemblGenomes-Gn; EBG00001157862.
DR   EnsemblGenomes-Gn; EBG00001157863.
DR   EnsemblGenomes-Gn; EBG00001157864.
DR   EnsemblGenomes-Gn; EBG00001157865.
DR   EnsemblGenomes-Gn; EBG00001157866.
DR   EnsemblGenomes-Gn; EBG00001157867.
DR   EnsemblGenomes-Gn; EBG00001157868.
DR   EnsemblGenomes-Gn; EBG00001157869.
DR   EnsemblGenomes-Gn; EBG00001157870.
DR   EnsemblGenomes-Gn; EBG00001157871.
DR   EnsemblGenomes-Gn; EBG00001157872.
DR   EnsemblGenomes-Gn; EBG00001157873.
DR   EnsemblGenomes-Gn; EBG00001157874.
DR   EnsemblGenomes-Gn; EBG00001157875.
DR   EnsemblGenomes-Gn; EBG00001157876.
DR   EnsemblGenomes-Gn; EBG00001157877.
DR   EnsemblGenomes-Gn; EBG00001157878.
DR   EnsemblGenomes-Gn; EBG00001157879.
DR   EnsemblGenomes-Gn; EBG00001157880.
DR   EnsemblGenomes-Gn; EBG00001157881.
DR   EnsemblGenomes-Gn; EBG00001157882.
DR   EnsemblGenomes-Gn; EBG00001157883.
DR   EnsemblGenomes-Gn; EBG00001157884.
DR   EnsemblGenomes-Gn; EBG00001157885.
DR   EnsemblGenomes-Gn; EBG00001157886.
DR   EnsemblGenomes-Gn; Gbem_R0001.
DR   EnsemblGenomes-Gn; Gbem_R0002.
DR   EnsemblGenomes-Gn; Gbem_R0003.
DR   EnsemblGenomes-Gn; Gbem_R0004.
DR   EnsemblGenomes-Gn; Gbem_R0005.
DR   EnsemblGenomes-Gn; Gbem_R0006.
DR   EnsemblGenomes-Gn; Gbem_R0007.
DR   EnsemblGenomes-Gn; Gbem_R0008.
DR   EnsemblGenomes-Gn; Gbem_R0009.
DR   EnsemblGenomes-Gn; Gbem_R0010.
DR   EnsemblGenomes-Gn; Gbem_R0011.
DR   EnsemblGenomes-Gn; Gbem_R0012.
DR   EnsemblGenomes-Gn; Gbem_R0013.
DR   EnsemblGenomes-Gn; Gbem_R0014.
DR   EnsemblGenomes-Gn; Gbem_R0015.
DR   EnsemblGenomes-Gn; Gbem_R0016.
DR   EnsemblGenomes-Gn; Gbem_R0017.
DR   EnsemblGenomes-Gn; Gbem_R0018.
DR   EnsemblGenomes-Gn; Gbem_R0019.
DR   EnsemblGenomes-Gn; Gbem_R0020.
DR   EnsemblGenomes-Gn; Gbem_R0021.
DR   EnsemblGenomes-Gn; Gbem_R0022.
DR   EnsemblGenomes-Gn; Gbem_R0023.
DR   EnsemblGenomes-Gn; Gbem_R0024.
DR   EnsemblGenomes-Gn; Gbem_R0025.
DR   EnsemblGenomes-Gn; Gbem_R0026.
DR   EnsemblGenomes-Gn; Gbem_R0027.
DR   EnsemblGenomes-Gn; Gbem_R0028.
DR   EnsemblGenomes-Gn; Gbem_R0029.
DR   EnsemblGenomes-Gn; Gbem_R0030.
DR   EnsemblGenomes-Gn; Gbem_R0031.
DR   EnsemblGenomes-Gn; Gbem_R0032.
DR   EnsemblGenomes-Gn; Gbem_R0033.
DR   EnsemblGenomes-Gn; Gbem_R0034.
DR   EnsemblGenomes-Gn; Gbem_R0035.
DR   EnsemblGenomes-Gn; Gbem_R0036.
DR   EnsemblGenomes-Gn; Gbem_R0037.
DR   EnsemblGenomes-Gn; Gbem_R0038.
DR   EnsemblGenomes-Gn; Gbem_R0039.
DR   EnsemblGenomes-Gn; Gbem_R0040.
DR   EnsemblGenomes-Gn; Gbem_R0041.
DR   EnsemblGenomes-Gn; Gbem_R0042.
DR   EnsemblGenomes-Gn; Gbem_R0043.
DR   EnsemblGenomes-Gn; Gbem_R0044.
DR   EnsemblGenomes-Gn; Gbem_R0045.
DR   EnsemblGenomes-Gn; Gbem_R0046.
DR   EnsemblGenomes-Gn; Gbem_R0047.
DR   EnsemblGenomes-Gn; Gbem_R0048.
DR   EnsemblGenomes-Gn; Gbem_R0049.
DR   EnsemblGenomes-Gn; Gbem_R0050.
DR   EnsemblGenomes-Gn; Gbem_R0051.
DR   EnsemblGenomes-Gn; Gbem_R0052.
DR   EnsemblGenomes-Gn; Gbem_R0053.
DR   EnsemblGenomes-Gn; Gbem_R0054.
DR   EnsemblGenomes-Gn; Gbem_R0055.
DR   EnsemblGenomes-Gn; Gbem_R0056.
DR   EnsemblGenomes-Gn; Gbem_R0057.
DR   EnsemblGenomes-Gn; Gbem_R0058.
DR   EnsemblGenomes-Gn; Gbem_R0059.
DR   EnsemblGenomes-Gn; Gbem_R0060.
DR   EnsemblGenomes-Gn; Gbem_R0061.
DR   EnsemblGenomes-Gn; Gbem_R0062.
DR   EnsemblGenomes-Gn; Gbem_R0063.
DR   EnsemblGenomes-Gn; Gbem_R0064.
DR   EnsemblGenomes-Gn; Gbem_R0065.
DR   EnsemblGenomes-Gn; Gbem_R0066.
DR   EnsemblGenomes-Gn; Gbem_R0067.
DR   EnsemblGenomes-Gn; Gbem_R0068.
DR   EnsemblGenomes-Gn; Gbem_R0069.
DR   EnsemblGenomes-Gn; Gbem_R0070.
DR   EnsemblGenomes-Gn; Gbem_R0071.
DR   EnsemblGenomes-Gn; Gbem_R0072.
DR   EnsemblGenomes-Gn; Gbem_R0073.
DR   EnsemblGenomes-Gn; Gbem_R0074.
DR   EnsemblGenomes-Gn; Gbem_R0075.
DR   EnsemblGenomes-Gn; Gbem_R0076.
DR   EnsemblGenomes-Tr; EBT00001746880.
DR   EnsemblGenomes-Tr; EBT00001746881.
DR   EnsemblGenomes-Tr; EBT00001746882.
DR   EnsemblGenomes-Tr; EBT00001746883.
DR   EnsemblGenomes-Tr; EBT00001746884.
DR   EnsemblGenomes-Tr; EBT00001746885.
DR   EnsemblGenomes-Tr; EBT00001746886.
DR   EnsemblGenomes-Tr; EBT00001746887.
DR   EnsemblGenomes-Tr; EBT00001746888.
DR   EnsemblGenomes-Tr; EBT00001746889.
DR   EnsemblGenomes-Tr; EBT00001746890.
DR   EnsemblGenomes-Tr; EBT00001746891.
DR   EnsemblGenomes-Tr; EBT00001746892.
DR   EnsemblGenomes-Tr; EBT00001746893.
DR   EnsemblGenomes-Tr; EBT00001746894.
DR   EnsemblGenomes-Tr; EBT00001746895.
DR   EnsemblGenomes-Tr; EBT00001746896.
DR   EnsemblGenomes-Tr; EBT00001746897.
DR   EnsemblGenomes-Tr; EBT00001746898.
DR   EnsemblGenomes-Tr; EBT00001746899.
DR   EnsemblGenomes-Tr; EBT00001746900.
DR   EnsemblGenomes-Tr; EBT00001746901.
DR   EnsemblGenomes-Tr; EBT00001746902.
DR   EnsemblGenomes-Tr; EBT00001746903.
DR   EnsemblGenomes-Tr; EBT00001746904.
DR   EnsemblGenomes-Tr; EBT00001746905.
DR   EnsemblGenomes-Tr; EBT00001746906.
DR   EnsemblGenomes-Tr; EBT00001746907.
DR   EnsemblGenomes-Tr; EBT00001746908.
DR   EnsemblGenomes-Tr; EBT00001746909.
DR   EnsemblGenomes-Tr; EBT00001746910.
DR   EnsemblGenomes-Tr; EBT00001746911.
DR   EnsemblGenomes-Tr; EBT00001746912.
DR   EnsemblGenomes-Tr; EBT00001746913.
DR   EnsemblGenomes-Tr; EBT00001746914.
DR   EnsemblGenomes-Tr; EBT00001746915.
DR   EnsemblGenomes-Tr; EBT00001746916.
DR   EnsemblGenomes-Tr; EBT00001746917.
DR   EnsemblGenomes-Tr; EBT00001746918.
DR   EnsemblGenomes-Tr; EBT00001746919.
DR   EnsemblGenomes-Tr; EBT00001746920.
DR   EnsemblGenomes-Tr; EBT00001746921.
DR   EnsemblGenomes-Tr; EBT00001746922.
DR   EnsemblGenomes-Tr; EBT00001746923.
DR   EnsemblGenomes-Tr; EBT00001746924.
DR   EnsemblGenomes-Tr; EBT00001746925.
DR   EnsemblGenomes-Tr; EBT00001746926.
DR   EnsemblGenomes-Tr; EBT00001746927.
DR   EnsemblGenomes-Tr; EBT00001746928.
DR   EnsemblGenomes-Tr; EBT00001746929.
DR   EnsemblGenomes-Tr; EBT00001746930.
DR   EnsemblGenomes-Tr; EBT00001746931.
DR   EnsemblGenomes-Tr; EBT00001746932.
DR   EnsemblGenomes-Tr; EBT00001746933.
DR   EnsemblGenomes-Tr; EBT00001746934.
DR   EnsemblGenomes-Tr; EBT00001746935.
DR   EnsemblGenomes-Tr; EBT00001746936.
DR   EnsemblGenomes-Tr; EBT00001746937.
DR   EnsemblGenomes-Tr; EBT00001746938.
DR   EnsemblGenomes-Tr; EBT00001746939.
DR   EnsemblGenomes-Tr; EBT00001746940.
DR   EnsemblGenomes-Tr; EBT00001746941.
DR   EnsemblGenomes-Tr; EBT00001746942.
DR   EnsemblGenomes-Tr; EBT00001746948.
DR   EnsemblGenomes-Tr; EBT00001746949.
DR   EnsemblGenomes-Tr; EBT00001746952.
DR   EnsemblGenomes-Tr; EBT00001746954.
DR   EnsemblGenomes-Tr; EBT00001746956.
DR   EnsemblGenomes-Tr; EBT00001746958.
DR   EnsemblGenomes-Tr; EBT00001746960.
DR   EnsemblGenomes-Tr; EBT00001746961.
DR   EnsemblGenomes-Tr; EBT00001746962.
DR   EnsemblGenomes-Tr; EBT00001746963.
DR   EnsemblGenomes-Tr; EBT00001746965.
DR   EnsemblGenomes-Tr; EBT00001746966.
DR   EnsemblGenomes-Tr; EBT00001746969.
DR   EnsemblGenomes-Tr; EBT00001746972.
DR   EnsemblGenomes-Tr; EBT00001746973.
DR   EnsemblGenomes-Tr; EBT00001746975.
DR   EnsemblGenomes-Tr; EBT00001746977.
DR   EnsemblGenomes-Tr; EBT00001746979.
DR   EnsemblGenomes-Tr; EBT00001746981.
DR   EnsemblGenomes-Tr; EBT00001746983.
DR   EnsemblGenomes-Tr; EBT00001746985.
DR   EnsemblGenomes-Tr; EBT00001746987.
DR   EnsemblGenomes-Tr; EBT00001746989.
DR   EnsemblGenomes-Tr; EBT00001746990.
DR   EnsemblGenomes-Tr; Gbem_R0001-1.
DR   EnsemblGenomes-Tr; Gbem_R0002-1.
DR   EnsemblGenomes-Tr; Gbem_R0003-1.
DR   EnsemblGenomes-Tr; Gbem_R0004-1.
DR   EnsemblGenomes-Tr; Gbem_R0005-1.
DR   EnsemblGenomes-Tr; Gbem_R0006-1.
DR   EnsemblGenomes-Tr; Gbem_R0007-1.
DR   EnsemblGenomes-Tr; Gbem_R0008-1.
DR   EnsemblGenomes-Tr; Gbem_R0009-1.
DR   EnsemblGenomes-Tr; Gbem_R0010-1.
DR   EnsemblGenomes-Tr; Gbem_R0011-1.
DR   EnsemblGenomes-Tr; Gbem_R0012-1.
DR   EnsemblGenomes-Tr; Gbem_R0013-1.
DR   EnsemblGenomes-Tr; Gbem_R0014-1.
DR   EnsemblGenomes-Tr; Gbem_R0015-1.
DR   EnsemblGenomes-Tr; Gbem_R0016-1.
DR   EnsemblGenomes-Tr; Gbem_R0017-1.
DR   EnsemblGenomes-Tr; Gbem_R0018-1.
DR   EnsemblGenomes-Tr; Gbem_R0019-1.
DR   EnsemblGenomes-Tr; Gbem_R0020-1.
DR   EnsemblGenomes-Tr; Gbem_R0021-1.
DR   EnsemblGenomes-Tr; Gbem_R0022-1.
DR   EnsemblGenomes-Tr; Gbem_R0023-1.
DR   EnsemblGenomes-Tr; Gbem_R0024-1.
DR   EnsemblGenomes-Tr; Gbem_R0025-1.
DR   EnsemblGenomes-Tr; Gbem_R0026-1.
DR   EnsemblGenomes-Tr; Gbem_R0027-1.
DR   EnsemblGenomes-Tr; Gbem_R0028-1.
DR   EnsemblGenomes-Tr; Gbem_R0029-1.
DR   EnsemblGenomes-Tr; Gbem_R0030-1.
DR   EnsemblGenomes-Tr; Gbem_R0031-1.
DR   EnsemblGenomes-Tr; Gbem_R0032-1.
DR   EnsemblGenomes-Tr; Gbem_R0033-1.
DR   EnsemblGenomes-Tr; Gbem_R0034-1.
DR   EnsemblGenomes-Tr; Gbem_R0035-1.
DR   EnsemblGenomes-Tr; Gbem_R0036-1.
DR   EnsemblGenomes-Tr; Gbem_R0037-1.
DR   EnsemblGenomes-Tr; Gbem_R0038-1.
DR   EnsemblGenomes-Tr; Gbem_R0039-1.
DR   EnsemblGenomes-Tr; Gbem_R0040-1.
DR   EnsemblGenomes-Tr; Gbem_R0041-1.
DR   EnsemblGenomes-Tr; Gbem_R0042-1.
DR   EnsemblGenomes-Tr; Gbem_R0043-1.
DR   EnsemblGenomes-Tr; Gbem_R0044-1.
DR   EnsemblGenomes-Tr; Gbem_R0045-1.
DR   EnsemblGenomes-Tr; Gbem_R0046-1.
DR   EnsemblGenomes-Tr; Gbem_R0047-1.
DR   EnsemblGenomes-Tr; Gbem_R0048-1.
DR   EnsemblGenomes-Tr; Gbem_R0049-1.
DR   EnsemblGenomes-Tr; Gbem_R0050-1.
DR   EnsemblGenomes-Tr; Gbem_R0051-1.
DR   EnsemblGenomes-Tr; Gbem_R0052-1.
DR   EnsemblGenomes-Tr; Gbem_R0053-1.
DR   EnsemblGenomes-Tr; Gbem_R0054-1.
DR   EnsemblGenomes-Tr; Gbem_R0055-1.
DR   EnsemblGenomes-Tr; Gbem_R0056-1.
DR   EnsemblGenomes-Tr; Gbem_R0057-1.
DR   EnsemblGenomes-Tr; Gbem_R0058-1.
DR   EnsemblGenomes-Tr; Gbem_R0059-1.
DR   EnsemblGenomes-Tr; Gbem_R0060-1.
DR   EnsemblGenomes-Tr; Gbem_R0061-1.
DR   EnsemblGenomes-Tr; Gbem_R0062-1.
DR   EnsemblGenomes-Tr; Gbem_R0063-1.
DR   EnsemblGenomes-Tr; Gbem_R0064-1.
DR   EnsemblGenomes-Tr; Gbem_R0065-1.
DR   EnsemblGenomes-Tr; Gbem_R0066-1.
DR   EnsemblGenomes-Tr; Gbem_R0067-1.
DR   EnsemblGenomes-Tr; Gbem_R0068-1.
DR   EnsemblGenomes-Tr; Gbem_R0069-1.
DR   EnsemblGenomes-Tr; Gbem_R0070-1.
DR   EnsemblGenomes-Tr; Gbem_R0071-1.
DR   EnsemblGenomes-Tr; Gbem_R0072-1.
DR   EnsemblGenomes-Tr; Gbem_R0073-1.
DR   EnsemblGenomes-Tr; Gbem_R0074-1.
DR   EnsemblGenomes-Tr; Gbem_R0075-1.
DR   EnsemblGenomes-Tr; Gbem_R0076-1.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00162; SAM.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00230; T-box.
DR   RFAM; RF00379; ydaO-yuaA.
DR   RFAM; RF00380; ykoK.
DR   RFAM; RF01051; c-di-GMP-I.
DR   RFAM; RF01055; MOCO_RNA_motif.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01733; atoC.
DR   RFAM; RF01749; pan.
DR   RFAM; RF01766; cspA.
DR   RFAM; RF01852; tRNA-Sec.
DR   RFAM; RF01854; Bacteria_large_SRP.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   SILVA-LSU; CP001124.
DR   SILVA-SSU; CP001124.
DR   StrainInfo; 620864; 1.
XX
CC   URL -- http://www.jgi.doe.gov; JGI Project ID: 4002943; Source DNA
CC   and bacteria available from Derek Lovley
CC   (dlovley@microbio.umass.edu); Contacts: Derek Lovley
CC   (dlovley@microbio.umass.edu); David Bruce
CC   (microbe@cuba.jgi-psf.org); Quality assurance done by JGI-Stanford;
CC   Annotation done by JGI-ORNL and JGI-PGF; Finishing done by
CC   JGI-LANL; The exact number of bases in the following homopolymer
CC   regions is not known:; 9853-9860; 117347-117353; 309446-309452;
CC   364592-364598; 471636-471645; 548091-548097; 555847-555854;
CC   632073-632081; 838327-838334; 868396-868403; 1029608-1029613;
CC   1128961-1128966; 1376004-1376012; 1479358-1479365; 1717134-1717140;
CC   2879837-2879844; 2950043-2950050; 3313185-3313194; 3818905-3818909;
CC   4055976-4055987; 4136297-4136306; 4175475-4175479; 4254266-4254273;
CC   4598423-4598432; Finished microbial genomes have been curated to
CC   close all gaps with greater than 98% coverage of at least two
CC   independent clones. Each base pair has a minimum q (quality) value
CC   of 30 and the total error rate is less than one per 50000.; The JGI
CC   and collaborators endorse the principles for the distribution and
CC   use of large scale sequencing data adopted by the larger genome
CC   sequencing community and urge users of this data to follow them. it
CC   is our intention to publish the work of this project in a timely
CC   fashion and we welcome collaborative interaction on the project and
CC   analysis.; (http://www.genome.gov/page.cfm?pageID=10506376).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..4615150
FT                   /organism="Geobacter bemidjiensis Bem"
FT                   /strain="Bem"
FT                   /mol_type="genomic DNA"
FT                   /note="type strain of Geobacter bemidjiensis"
FT                   /db_xref="taxon:404380"
FT                   /culture_collection="ATCC:BAA-1014"
FT                   /culture_collection="DSM:16622"
FT   gene            166..1542
FT                   /gene="dnaA"
FT                   /locus_tag="Gbem_0001"
FT   CDS_pept        166..1542
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaA"
FT                   /locus_tag="Gbem_0001"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37034"
FT                   /db_xref="GOA:B5E7P6"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5E7P6"
FT                   /protein_id="ACH37034.1"
FT                   /translation="MENIWLEAQTNLKQVLTEQTYSTWIDPLKFLGATVDTIVLEVPSS
FT                   FFQKWVTDKYLAMIKEAISAVNGKSYQIEFHVAEEKPEAAHEAKPEKEAKPAREKERDK
FT                   DKEKEKDREKEKKELVPNLNPKYTFESFVSGPSNQFAYAASQAVANKPATNYNPLFIYG
FT                   GVGLGKTHLVNAIGNHILAKNPKAKICYYSSEKFMNEMINSLRYKKMDEFRNKFRKMDL
FT                   LLIDDIQFMAGKEATQEEFFHTFNALYESHKQIVVTSDKFPKDIPGLEERLRSRFEWGL
FT                   IADIQPPGVETKVAILKKKSDMHAVNLPDDVALFLAEGANSNIRELEGMLIRLEAFASL
FT                   TGQEITLSMAREVMKDIIVEKTRDITVEMIQKTVAEHFRIKVSELKSDKRIKTLVVPRQ
FT                   IAIYICRELTKASYPEIGEKFGGKDHSTIIHSVKKIEKQIAGDDEFKATVEDIRKKLFT
FT                   "
FT   gene            1757..2875
FT                   /gene="dnaN"
FT                   /locus_tag="Gbem_0002"
FT   CDS_pept        1757..2875
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaN"
FT                   /locus_tag="Gbem_0002"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37035"
FT                   /db_xref="GOA:B5E7P7"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:B5E7P7"
FT                   /protein_id="ACH37035.1"
FT                   /translation="MEFRISKEIFMKALQRIQGIVEKRNTMPILSNALLEVQNDQLFIT
FT                   ATDLEVGMKSSYPTAVIREGKITVSAKKLYEIVKEMPDEEIHFTTKDNDWVEITCGKAR
FT                   FNIVGLSSEEFPYFPKVKEESFLVFKNEILADMIEKTSYAICYDETKYNLNGVFIKAFD
FT                   ENGENVLKMVATDGHRLSVSQKAITGNITSELSKGVIFPKKGIFELKKMVEEEDGEIML
FT                   GFMDNSAVIKKGNTVVVMRLIDGEFPDYTKVIPASNDRIVQINRDKFLHSLKRMAILSS
FT                   EKFKGVKIEVNPELVIISSSNPELGEAREEIEVQYEGNNISARFNAKYLIDVLSVMEQR
FT                   EVELKLKDELSPVIMKAAAEEEFLAVIMPMRL"
FT   misc_feature    2964..2996
FT                   /note="hexanucleotide repeats; Gbem_R6001"
FT   gene            3017..4111
FT                   /gene="recF"
FT                   /locus_tag="Gbem_0003"
FT   CDS_pept        3017..4111
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recF"
FT                   /locus_tag="Gbem_0003"
FT                   /product="DNA replication and repair protein RecF"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37036"
FT                   /db_xref="GOA:B5E7P8"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5E7P8"
FT                   /protein_id="ACH37036.1"
FT                   /translation="MKLIKLKLASFRNLQNIELAPGKKFNVFYGNNGQGKTNLLESIYL
FT                   LATMKSFKQARNAELIAFAGEFALVKGTVERDQVRREIAVLIEKQGKKAKVDAKLMTRL
FT                   DDFFGNLNVVLFTPEEISMVRGGPDLRRRYLDRAVFTCDLGYLTAYHDYAKILKNRNAL
FT                   LKVNETTGIEVWTEQLVQAALLVIERRKAYLDRIGKLLQGFYSEISGNDETVQIEYRLH
FT                   GVDERLLAEDPAGALNQALRAHAAEERRRGTTAIGPHRDDLYFGLNGRSARQFASQGQQ
FT                   RSFVLALKMAEIEHITRCFEAPPVLLLDDMTSELDRERNRNLMEFLKKREMQVFITTTS
FT                   LHNVDIDELQDNRTFRIKEGKILD"
FT   gene            4120..6510
FT                   /gene="gyrB"
FT                   /locus_tag="Gbem_0004"
FT   CDS_pept        4120..6510
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gyrB"
FT                   /locus_tag="Gbem_0004"
FT                   /product="DNA gyrase, B subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37037"
FT                   /db_xref="GOA:B5E7Q1"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR034160"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B5E7Q1"
FT                   /protein_id="ACH37037.1"
FT                   /translation="MNSEEQGDYGADKIQILEGLEAVRKRPAMYIGSTAAQGLHHLVYE
FT                   LVDNAIDEALAGYCDAVQVIIHLDGSVTVEDNGRGIPTDMHPTEGRSAAEVVLTVLHAG
FT                   GKFDNTSYKVSGGLHGVGSSVVNALSTRLDLEIRRNGHVHTQTYRKGVPQAPLEITGET
FT                   KRRGTKITFFPDGEIFETTEFSFDVLSKRLRELAFLNAGVRIKIHDERTEKDHDFFYEG
FT                   GIRSFVEYLNKNKNLVNPEPIYIRGEKSGVDIEIAMQYNDSYDEKVFSFANNINTHEGG
FT                   THLVGFKASLTRTMNTYATANNLLKNVKVAISGDDLREGLTAVISVKISQPQFEGQTKT
FT                   KLGNSEVKGYVETLMNEKLATYLEENPAMARKILEKSIDAARAREAARKARELTRRKGA
FT                   LEVGTLPGKLADCQEKDPALCELFLVEGDSAGGSAKQGRDRKYQAILPLKGKILNVEKA
FT                   RFDKMLASQEIRTLISALGTSIGKEDFDMAKLRYHRIIVMTDADVDGSHILTLLLTFFF
FT                   RQMLELIERGYLYIAQPPLYKIKRGRKEQYLKNEAALQAYLLEEGTEEMTLKLGVGNDE
FT                   RVYRGKQIIPILTQLIDYNELFDKVVKKGINDELLRVFLKTGIKPGLEEMADLIALLPK
FT                   MKEAFPEVTTEEFGDSIIFAFGNLRVKIDHQIFSVLESYEYGMLLENHKRMRSVMGAGT
FT                   GVVLGAEDKLVLETENQEDILSFFMESAKKGLYIQRYKGLGEMNPEQLWETTMHQENRV
FT                   LLQVKIEDAVAAEEIFTVLMGDQVEPRRDFIEQNALNVSNLDI"
FT   gene            6866..9376
FT                   /gene="gyrA"
FT                   /locus_tag="Gbem_0005"
FT   CDS_pept        6866..9376
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gyrA"
FT                   /locus_tag="Gbem_0005"
FT                   /product="DNA gyrase, A subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37038"
FT                   /db_xref="GOA:B5E7Q2"
FT                   /db_xref="InterPro:IPR002205"
FT                   /db_xref="InterPro:IPR005743"
FT                   /db_xref="InterPro:IPR006691"
FT                   /db_xref="InterPro:IPR013757"
FT                   /db_xref="InterPro:IPR013758"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR035516"
FT                   /db_xref="UniProtKB/TrEMBL:B5E7Q2"
FT                   /protein_id="ACH37038.1"
FT                   /translation="MLNQLNKVSVNIEDEMKRSYMDYAMSVIVGRALPDVRDGLKPVHR
FT                   RCLFAMYDMSNDWNKPYKKSARVVGDVIGKYHPHGDTAVYDTLVRMAQDFSLRYPLVDG
FT                   QGNFGSIDGDSPAAMRYTEIRMEQLAHELLADIDKETVPYGPNYDDSLKEPLVLPSKFP
FT                   NLLVNGSAGIAVGMATNIPPHNLSEVIDGIVAIIDNPQLTFEELVELIPGPDFPTGGFI
FT                   YGREGIMKAYSTGRGIIQMRAKVQIETQKKTERQSIVVTEIPYQVNKARLVEKIAELVK
FT                   EKKIEGISDLRDESDREGMRVVIELKKDENPTIILNHLYKQTQMQSSFGIIMLAIVNSR
FT                   PRVLTLRETIDFFIEHRKEIVTRRTIFDLKKAEARAHILEGLKIALDNLDEVIALIKAS
FT                   ASPAEAKAGLMERFGLSDLQAQAILDMRLHRLTGLEREKIMEELREILKYIARLKEILA
FT                   SEAEILKIIVGELVELKDKFGDKRRSEIVMQTADISLEDTIVEEDMVVTISHTGYIKRN
FT                   AVTLYRAQRRGGKGKTGMKTKEEDFVEQLFIASTKDYLMFFTDAGKVYWLKVYEIPEAG
FT                   RAARGKAIVNLLNLAANEKITTILPVKEFVDDKFIMMATRNGVVKKTNMMEYSHPRVGG
FT                   IIAVNLDEGDKLITVALTDGKQDVLLASANGKAIRFKEEDVRTVGRVSRGVRGMTLEGE
FT                   DVVIGMEILNENFTDSTIFTVTENGYGKRTEISEYRSQSRGGKGVITIKTTERNGNVVD
FT                   IKQVNDDNDLMLITDQGKILRVPVAGFSIIGRNTQGVRLMVKEENERVVAVARLAEKEE
FT                   QDESEDGELDEMVELESGEEQGEE"
FT   gene            9496..11012
FT                   /locus_tag="Gbem_0007"
FT   CDS_pept        join(9496..9840,9840..11012)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0007"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ADO00760"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:E1P665"
FT                   /protein_id="ADO00760.1"
FT                   /translation="MQTNRIDNSLKERRDILDLLGKLRGDGISIHEMEKIGQKFQQAGR
FT                   RALRPLVRELWRENSGELITKYAYILDFFETEDWLDQLIQIALKRNDLGADGKAALMVA
FT                   LEGYGVDVHSPPLQAAPPAPRSSLGETVQGAIRLGEEGMVTFLDDFLSYQQEVQQIVIR
FT                   ELSQSDDPSSSRLLAAMLWHEDRTVVLSALQALGRLRDPLAAGVLQDFIADCAEEYSDT
FT                   AQKCLRRLGFLGVNAPAPRQLLPFHAAYATAPDGDGYRSLLLSRRTAEGRLCVLYLQVH
FT                   ERRGVLAAWGSAELTLEEFRSEVEGFRMQDDLHEVPPPYLLALVRDALYWSRELCYLPA
FT                   DFYMRRGIFAGEDMTPAPFAPTLTALPQHRVLSFEEGENAARALFKNPLFTGWFMASQR
FT                   VYDYAEECRAGADIEQVLQRFCEELLAPELELIRERLLVSADLMRVVGNPPFEVANVVS
FT                   LAESLADNPLPFHLHPFLRCFALESMEIAKESLERGDDAPLRAAEEF"
FT                   /artificial_location="low-quality sequence region"
FT   gene            11070..12077
FT                   /gene="gpsA"
FT                   /locus_tag="Gbem_0008"
FT   CDS_pept        11070..12077
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gpsA"
FT                   /locus_tag="Gbem_0008"
FT                   /product="glycerol-3-phosphate dehydrogenase,
FT                   NAD(P)-dependent"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37039"
FT                   /db_xref="GOA:B5E7Q3"
FT                   /db_xref="InterPro:IPR006109"
FT                   /db_xref="InterPro:IPR006168"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR011128"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5E7Q3"
FT                   /protein_id="ACH37039.1"
FT                   /translation="MAEKIAVIGAGSWGTTLADLLAKKGHEVTLWAYEPELVLEMRDNR
FT                   ENSLFLPGIKLNERLAFTNDLAEAYRGCSMVLCVVPSQLVRRVMTNSLPFLPKEAIIVS
FT                   ASKGIEVDTLATVSEIYQEILPPEQFQVLAALSGPSFAREVALEMPTAVTAAASSEAVA
FT                   RRVQEAFTTDYFRVYRNSDVVGVELGGAIKNVIAIAAGISDGLGFGSNTRAALITRGLA
FT                   EMTRLGVAMGAQPSTFAGLAGMGDLVLTCTGDLSRNRSVGIQIGQGRTLSEILGEMRMV
FT                   AEGVKTTESAYNLAKKLGVEMPIIEQMYQMLYQNKSAREAVLELMTRNLKAEGV"
FT   misc_feature    12226..12252
FT                   /note="hexanucleotide repeats; Gbem_R6002"
FT   gene            12272..14536
FT                   /locus_tag="Gbem_0009"
FT   CDS_pept        12272..14536
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0009"
FT                   /product="sensor histidine kinase, HAMP and PAS
FT                   domain-containing"
FT                   /note="domains: HAMP, PAS, HisKA, HATPase_c"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37040"
FT                   /db_xref="GOA:B5E7Q4"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR029150"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B5E7Q4"
FT                   /protein_id="ACH37040.1"
FT                   /translation="MQLRFGIRTKLLLSILAILFVSYSTLLYSSMKTLNASLQTELDRN
FT                   LATNLKYARSQYLDQAEIAKFSMMQAVVSQTVQQRLRERDSAWFSTRIKRWHDVLPFVD
FT                   LVVVVDPQEKVLATLQGPEKNGPMELPAMVKQALASKRAILSTELLSGEFMCRAGVPGY
FT                   CERPGSEALVATVAVPVIGTDGSVLGCVVTGDILNHHPNLPGKLQEVTGNNVEVTLTQR
FT                   GLRVASSLPARVRESYILSPKVLDVLERGEVYRGRTDMGAKSYETIIDPLLNSRGEFVG
FT                   SLSVAISTETVTNSRRENLQYILASAFLGIICSFAMAYFASRHLTGPLRQLAMSARRIE
FT                   EGDLDQRVVGHQRDEVGMLASSFNNMAESLKERDGIINKKTGDLQELNEQLEKMVEQRT
FT                   SALSMEMGRLEAVLTSLAEGVVVTDRDNLVVLFNPAAQQLFELVPHRVVGQSVERLCEM
FT                   TGFCNVLEQVSDKAQREPRCGKKEVTVKGKRLHVNTATLQDEAGEFAGMVMSLRDVTKE
FT                   EQVDRMKTEFISTVSHELKTPLTSIKGSLQLLLTRSKWLTDTERQLLTVCFRNTQRLIR
FT                   LISEILDISGIESGGMIFNFKPLCIGELAVYAVEEIKSLAMGREITIVNTVGEHLPMVF
FT                   GDSDRLIQVMTNLLSNAVKFSPEGKVVMVTAEQEGNYVVVSVADRGRVIQWSDRDKLFK
FT                   KFQQIESTERNKIGGTGLGLAICKEIVERHHGRIFYTAAKEYGNTFSFTVPIIGETDAK
FT                   G"
FT   gene            14523..16058
FT                   /locus_tag="Gbem_0010"
FT   CDS_pept        14523..16058
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0010"
FT                   /product="response receiver sensor histidine kinase, PAS
FT                   domain-containing"
FT                   /note="domains: REC, PAS, HisKA, HATPase_c"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37041"
FT                   /db_xref="GOA:B5E7Q5"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B5E7Q5"
FT                   /protein_id="ACH37041.1"
FT                   /translation="MQKDKILIVDDEADIALILKLQLEDAGYETVRARDGVEALEAVAQ
FT                   EPFDLIMLDIKMPRMDGLEVLSRLKGDETPVVMMTAHGSEDIAVDAMKKGALDYISKPF
FT                   STDDMLQKVERAIGIDRTRKENARLSQQLDEERRKMEAVLQGMADLLVAVDLQGRIITW
FT                   SRQAARLLAAEGESLLGKTLEEVLKAEVPGGELPARTVLRTGEPRLDVGYLLKIGSLTV
FT                   PVLSSAAPLWNANGELAGSVEIIRDISKLKELEQEKEDFVSMLSHDLKSPITAVVGSID
FT                   LVREAKLGPVTPDQSEYLNAAIESCEEMVEMIDTLLGIHKFEAGKMKLNFREEDPSLLI
FT                   NRSVTKFQTPAQRGAISLFATLPPSLPAISADRSSFSRILGNLLSNAVKFTPEGGEIEV
FT                   SADLVQDPAPVLAHVPEECYPGQELPREGEFVRIRVRDSGVGIPQESLGSIFDRFVQAR
FT                   NRRQGKTRGTGLGLAFCRKAVDAHGGYIWAESEPGAGSVFTLMFPALPEEEDE"
FT   gene            16266..17357
FT                   /gene="fgrK"
FT                   /locus_tag="Gbem_0011"
FT   CDS_pept        16266..17357
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fgrK"
FT                   /locus_tag="Gbem_0011"
FT                   /product="sensor histidine kinase of FgrL"
FT                   /note="domains: HisKA, HATPase_c"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37042"
FT                   /db_xref="GOA:B5E7Q6"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B5E7Q6"
FT                   /protein_id="ACH37042.2"
FT                   /translation="MALRESDAGYRELFEENPQPMWVCHRESRRLLAVNEAALRLYGYR
FT                   REQFLELALEQLSGGEPMGDPGASQDQQLRCRQLKKDGSSFEAQLVCHPCRFQGERVQL
FT                   ALVRDEGGAQQEAQLRYRVLQQGSLLEAAQRELETFSYSVSHDLRAPLRHIDGFSRALM
FT                   DDYGTLLDGQGKEYLTRICQAAEKMSQLIDAMQQLSRVGRTELSLEKVDLSVKAQVISL
FT                   ELKRREPERRVDFAIEEGVKGEADAKLVRQLLEILMGNAWKFSSKTPSAVISFGSVELQ
FT                   GETAYFVRDNGAGFDMAYAEKLFSVFHRLHRADEFEGSGVGLAIAQRIVARHGGRIWAE
FT                   SAPGAGATFYFTLKGEKQLTIDN"
FT   misc_feature    complement(17505..17535)
FT                   /note="heptanucleotide repeats; Gbem_R7001"
FT   gene            17567..19714
FT                   /gene="fgrL"
FT                   /locus_tag="Gbem_0012"
FT   CDS_pept        17567..19714
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fgrL"
FT                   /locus_tag="Gbem_0012"
FT                   /product="flagellar biogenesis master response receiver
FT                   sensor histidine kinase, PAS and GAF domain-containing"
FT                   /note="domains: REC, PAS, GAF, HisKA, HATPase_c"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37043"
FT                   /db_xref="GOA:B5E7Q7"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B5E7Q7"
FT                   /protein_id="ACH37043.1"
FT                   /translation="MSKELRVLLVEDSEEDSLLLIRELRRGGYKLIHMRVETAESMRRA
FT                   LHDGEWDVVISDYRMPSFDALGALQVLHETGRDIPFIIVSGKIGEDLAVEAMKSGASDY
FT                   LMKGNLARLVPVMVRELREAEERRTHRLTQDAVRRGKAEWESVFDAVSDLIIITDADGV
FT                   VLRCNGRVSAYFPGGYGAIIGRRIDEIFFGSQQPEGKLFRFLHSVQSEADEDIRFPNLS
FT                   GWYNVASYPMRTEGSNRPNLVFIIKDITKRREVEEEKRTSDRELLTLYAVAFRLQYTKG
FT                   VDKVMGDLLFQLHNMLQMDFSCIHLFEDDKLKMRASLGVSPAFEKAMKTLPRETQWATL
FT                   AQAGRPFLGEEPDARFPARAKSAAIEMGLHSWCTVPLKIGQEVMGVMTVGTVSGRSYSD
FT                   RDVFLLCAIAGQLAVLIDNYGLYDKMKEKAEELYRSKEELKENLHKVKRANIELGRLNT
FT                   AKNNFIGIASHELKTPITSIMGGVEFLLKYSGIQMSPEQHNIFVSVYEGTIQLRKLVED
FT                   LLSISRIEAQGPLAQKKPASLMRVCREVHDLFALPLSERHIKVEITGDDVLVPVDEAFA
FT                   MLAVRNLLENAIKFTRDGGCVRLTGRVLKQAQLKEMTQTLHTFYPSFPGNVAATEKYYL
FT                   LQVRDNGIGIPPDERVRVFEKFYGVGDIDHHSSGATAFMSKGSGLGLSIVRGIMDAHEG
FT                   AVWVEEAEGGGSTFSLLFPIE"
FT   gene            19747..20673
FT                   /locus_tag="Gbem_0013"
FT   CDS_pept        19747..20673
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0013"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37044"
FT                   /db_xref="GOA:B5E7Q8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005894"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR025302"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B5E7Q8"
FT                   /protein_id="ACH37044.1"
FT                   /translation="MPHAIRLHEITKSYGGFKAVDRFSLEVERGTVFGLLGPNGAGKTT
FT                   LIKILTTLMRPTHGDAFVEEFSILTAGKSVRRVIGVVPQENNLDRYLTARENLALHGRL
FT                   HGLRPAAYNRRIDELLEMTGLTSRQNDFPDTFSGGMQRRLVVARALVHEPRVLFLDEPT
FT                   TGLDPQSRRALWEYVRGLRRNMTVFLTTHYMDEADALCDRIMIMDHGVCLADGTAAELK
FT                   DAFSRAHVYQVEFRRDSDRYEGMLAGLSFVRSVERSGSTFQITLSDEESIKPLMDCLGG
FT                   ADIRRICLKEPSLEEVFISLTGEKLRE"
FT   gene            20695..21450
FT                   /locus_tag="Gbem_0014"
FT   CDS_pept        20695..21450
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0014"
FT                   /product="ABC transporter, membrane protein, ABC-2 family"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37045"
FT                   /db_xref="GOA:B5E7Q9"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/TrEMBL:B5E7Q9"
FT                   /protein_id="ACH37045.1"
FT                   /translation="MFKGAFSIWSRDMMVLRRSIFSELVAVIAYPLTLYLAFGFGLKGY
FT                   ITDVSGVPYPLFIAPGLISMTAINAAFDESSWSMWFHRRVQRTIEEYRVTPITVYDIVI
FT                   GKILSGFSQGAVKGTVVFLVILLLTPFRIDYGHLPVYLMCIAISSMTFSCLGTICGTVI
FT                   DKPENIGRVQSVVIVPLIFMAGIFFPLSSYPASIRPFIELLPTTAVFEGARDALLQGSV
FT                   PAPYLINLVATAAVSFLVAVYTFDRKMAE"
FT   gene            21667..22743
FT                   /locus_tag="Gbem_0015"
FT   CDS_pept        21667..22743
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0015"
FT                   /product="radical SAM domain iron-sulfur cluster-binding
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37046"
FT                   /db_xref="GOA:B5E7R0"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017200"
FT                   /db_xref="InterPro:IPR023885"
FT                   /db_xref="UniProtKB/TrEMBL:B5E7R0"
FT                   /protein_id="ACH37046.1"
FT                   /translation="MAEEFVPKWIAWETTQRCNLKCVHCRCSSELTSSEGDFSTEEGKK
FT                   LLKEISDFSKPVVVLSGGEPLMRPDIFELAEYGTSLGLRMCMASNGSLVTDEVCEKMKK
FT                   ADIKMVSLSLDGSTAEVHDNFRQCPGSFEGVLRAAELFRKHGQKFLINSSFTKRNQHDI
FT                   ASTFKVAKSLGATAWYMFMIVPTGRGEDIMSELISKEDYEEILDWHYHQEKNEDDILMR
FT                   PTCAPHYYRIVPQKAKAEGEKFERRSLTFSTGGGKGCIAAQTICLIDCYGNLKPCSYFH
FT                   RTAGNVKETPFRELWENSEIFKDLRDFKSYKGKCGECEYLNVCGGCRARADAVHGDYME
FT                   EEPFCNYVPIKLQKKQKD"
FT   misc_feature    complement(22802..22836)
FT                   /note="conserved nucleotide sequence; Gbem_R4001"
FT   gene            22877..23896
FT                   /gene="hemE"
FT                   /locus_tag="Gbem_0016"
FT   CDS_pept        22877..23896
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemE"
FT                   /locus_tag="Gbem_0016"
FT                   /product="uroporphyrinogen decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37047"
FT                   /db_xref="GOA:B5E7R1"
FT                   /db_xref="InterPro:IPR000257"
FT                   /db_xref="InterPro:IPR006361"
FT                   /db_xref="InterPro:IPR038071"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5E7R1"
FT                   /protein_id="ACH37047.1"
FT                   /translation="MNTRFLDACWGKPVDTVPVWLMRQAGRYLPDYMRVRSKCTFLELC
FT                   KTPELATEVTVQPVDILGVDAAILFSDILTPIEPMGMELDFTPGPVFAKPIRTMADVEA
FT                   LKIPKMETDVPYVLDAVKLLRKELATKVPLIGFGGAPFTLACYMVEGKGSKDFAALKKM
FT                   MYADPEVYAALMDKITTMDMEYLNAQIKAGAQAIQIFDTWGGMLSPADYERYVLPYTQR
FT                   LINGLDRTNIPVIHFVKGAGTMLEIVKQAGGDVMGLDWHVNLGKARDILGDMAVQGNLD
FT                   PTVLFAPNEIIEREVKRVLDENAGRPGLIFNLGHGILPTVPPEKAIFMVDCVHRLSRK"
FT   gene            24012..24965
FT                   /gene="corA-3"
FT                   /locus_tag="Gbem_0017"
FT   CDS_pept        24012..24965
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="corA-3"
FT                   /locus_tag="Gbem_0017"
FT                   /product="magnesium transport protein CorA"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37048"
FT                   /db_xref="GOA:B5E7R2"
FT                   /db_xref="InterPro:IPR002523"
FT                   /db_xref="InterPro:IPR004488"
FT                   /db_xref="UniProtKB/TrEMBL:B5E7R2"
FT                   /protein_id="ACH37048.1"
FT                   /translation="MLRLFSIDNGLIKEMDFEKSDLPNQILHADWIDAHEPDDEERDLL
FT                   ELLLHTDIPESDEVDEIEISARCFVDQAGIHVHPLFLSQSEGRHVTLTVACILQSKHLI
FT                   TIREGDLADFRLLRMRARRGQVECRTPSELLVLLLDQKVENHADTLEDIHRQLEGVSHL
FT                   VLEDDDSELEDAISKLAKLEDSNGKIRLCLMDTQRDISFLLRHLRDRADQSETLREIAR
FT                   DVETLMSHTTFLFDKINFLMDSTQGFINIEQNQIIKIFSIAAVVFLPPTLVASIYGMNF
FT                   DVMPELKLSFGYPWALALMILSGIAPYWYFKRKGWL"
FT   gene            25221..26090
FT                   /locus_tag="Gbem_0018"
FT   CDS_pept        25221..26090
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0018"
FT                   /product="sensor histidine kinase"
FT                   /note="domains: HisKA, HATPase_c"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37049"
FT                   /db_xref="GOA:B5E7R3"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B5E7R3"
FT                   /protein_id="ACH37049.1"
FT                   /translation="MMSLRDWCRDILASHTEGSCPAGAGKDPPSPAAEAKPNEALLAPD
FT                   ELEKQLLQVQKLAAVGVLAGSIAHDLNNLMMGISGNLELLRQAKEPDAASQKYMDNALD
FT                   ASRRAANLSRQMLAFSRKGSQEVKSVDLNRLVAENLELMKGSMRKGISLSVRLEPELPP
FT                   IEAEPGKMQQLIVNLVTNAAEALGETGAIGVSTGVGELPAAEFTWSRVEPKPASGRFVF
FT                   IEVSDSGCGMDGETSDRMFDPLFSTKAAGRGLGLTAVHAIVKASGGAILADTAPGEGTT
FT                   IRAFLPAP"
FT   misc_feature    26098..26150
FT                   /note="conserved palindrome; Gbem_R1001"
FT   gene            26173..26454
FT                   /locus_tag="Gbem_0019"
FT   CDS_pept        26173..26454
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0019"
FT                   /product="GIY-YIG domain nuclease, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37050"
FT                   /db_xref="InterPro:IPR000305"
FT                   /db_xref="InterPro:IPR035901"
FT                   /db_xref="UniProtKB/TrEMBL:B5E7P9"
FT                   /protein_id="ACH37050.1"
FT                   /translation="MNWQVYIILCSDGTFYTGITTDIARRLRQHATGSGAKYFRGRRPE
FT                   EVLFLEGGHDRSSASRRELYIKGLSRAGKQALLQTAAKPVPHLLHLSS"
FT   gene            complement(26479..27516)
FT                   /gene="macA"
FT                   /locus_tag="Gbem_0020"
FT   CDS_pept        complement(26479..27516)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="macA"
FT                   /locus_tag="Gbem_0020"
FT                   /product="cytochrome c peroxidase"
FT                   /note="2 heme-binding sites"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37051"
FT                   /db_xref="GOA:B5E7Q0"
FT                   /db_xref="InterPro:IPR004852"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR026259"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:B5E7Q0"
FT                   /protein_id="ACH37051.1"
FT                   /translation="MKGKWIILLLPLLPGCVDATAKETMSKAQATFKPIPAQAPAIKGN
FT                   EATKAKVDLGRMLFFDPRLSTSQLISCNTCHNVGLGGADLQETSVGHGWQKGPRNAPTV
FT                   FNAVYNVAQFWDGRAKDLQTQAKGPVQASVEMNSNPELVVRTLKNIPGYPALFEAAFPG
FT                   YRDPVTFDNMAKAIEVFEATLVTPDAPFDHFLNGEPSALNAREQTGLGVFMEKGCAACH
FT                   GGINIGGAAYYPFGVREIPTAEIRPESDTGRFKVTNTASDKYVFRAPSLRNVALTQPYF
FT                   HSGKVWSLKDAVVVMGSAQLGMKLNETEVNDTVAFLKSLTGKQPKIDYPLLPPSSDQTP
FT                   HPQLK"
FT   gene            complement(27683..29092)
FT                   /gene="nfnA"
FT                   /locus_tag="Gbem_0021"
FT   CDS_pept        complement(27683..29092)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nfnA"
FT                   /locus_tag="Gbem_0021"
FT                   /product="NADH-dependent ferredoxin:NADP+ oxidoreductase,
FT                   alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37052"
FT                   /db_xref="GOA:B5EJ26"
FT                   /db_xref="InterPro:IPR006004"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR028261"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B5EJ26"
FT                   /protein_id="ACH37052.1"
FT                   /translation="MSNDLSPKERMAIERVHMPELPADERSKNFEEVNQGLSPDQAVAE
FT                   AQRCLQCKSRNCVAGCPVGVSIPEFIDALASDDMPRAAQVLRGDNALPAVCGRVCPQET
FT                   QCEALCVRGKKGDAVAIGYLERYVADWAMQHPDELITEDAPKPTGKSVAVVGCGPAGLT
FT                   AAGELARQGHKVTIFEALHDTGGVLRYGIPEFRLPKEIIDREVAVLSRMGVAIECNVII
FT                   GKTLTIPQLRSEFDAVFIANGAGLPTMLNIMGENLKGVYAANEFLTRVNLMEAGRRADS
FT                   STPILQRDEVAVIGGGNTAMDCVRTARRLGAKRAMIVYRRSETEMPARVEEIKHAKEEG
FT                   VEFIMLTAPVAIVATEDGWVSALRCQKMELGPADDSGRRRPQAIEGSEFDLPAGIVINA
FT                   VGTSANPLLTATAPDLTLNKWGNIVTNDEGETSIPGVFAGGDIVRGGATVILAMGDGKR
FT                   AAAAIDKYLKG"
FT   gene            complement(29089..29937)
FT                   /gene="nfnB"
FT                   /locus_tag="Gbem_0022"
FT   CDS_pept        complement(29089..29937)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nfnB"
FT                   /locus_tag="Gbem_0022"
FT                   /product="NADH-dependent ferredoxin:NADP+ oxidoreductase,
FT                   beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37053"
FT                   /db_xref="GOA:B5EJ27"
FT                   /db_xref="InterPro:IPR012165"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR019480"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:B5EJ27"
FT                   /protein_id="ACH37053.1"
FT                   /translation="MFEVVSNEILAENLHKMVLVAPRIARARKAGQFVMVRLAQGEERI
FT                   PLTIGDADPEAGTITLFIQAIGASTRKIVDTPVGGSIRDVAGPLGKETHITNWGRVACV
FT                   GGGVGTAVLFPLVKALAEAGNEITTIIGGRSSRYVILAEELGALSKNLLITTEDGSLGS
FT                   KGFVTGPLGEMIADPARAPKAVFAVGPVPMMKAVANMTREPGIETIVSLNPIMIDGTGM
FT                   CGGCRVQVGSETKFACVDGPEFDAHLVDFDGLSDRLTSYRKEEALRHAATDCKIAKEVA
FT                   K"
FT   misc_feature    30086..30116
FT                   /note="heptanucleotide repeats; Gbem_R7002"
FT   gene            complement(30217..31092)
FT                   /locus_tag="Gbem_0023"
FT   CDS_pept        complement(30217..31092)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0023"
FT                   /product="membrane protein, EamA domain pair-containing"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37054"
FT                   /db_xref="GOA:B5EJ28"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:B5EJ28"
FT                   /protein_id="ACH37054.1"
FT                   /translation="MPYLLLTLSALIWSGNFVISRAMNNVIPPAGFVFWRWVVALVVLL
FT                   PVVLPRLRREWPIVRANLGLIAVCGLFGVTLFNFLIYTAMHYTTAINAALVNSAIPIFI
FT                   LMFARIFYGQRVVLRQHVGIALSLIGVAAIILRGDPSRILTLSFNHGDLLVLLAAIAWG
FT                   LYSVAIKRYPQGLNPFVFLFSITVAGLLLLIPFYAWEIAQGQLMTLNQPTVLSIAYVGI
FT                   LASVVAFTAWNHGLRQIGPHIGGQFVHLMPAFSTILAVIFLGERLQSFHVAGIVLISAG
FT                   ILCATYKIRA"
FT   gene            complement(31125..31448)
FT                   /locus_tag="Gbem_0024"
FT   CDS_pept        complement(31125..31448)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0024"
FT                   /product="toxin, MazF family"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37055"
FT                   /db_xref="GOA:B5EJ29"
FT                   /db_xref="InterPro:IPR003477"
FT                   /db_xref="InterPro:IPR011067"
FT                   /db_xref="UniProtKB/TrEMBL:B5EJ29"
FT                   /protein_id="ACH37055.1"
FT                   /translation="MVVKRFDIFMVNLDPTVGSEIRKFRPCLIISPDEMNENIATVIVA
FT                   PMTTKGRGYPTRVPCTFKGKDGQVILDQIRTVDKSRLIHKQGKLAKDVQEKVLSILAKM
FT                   FAL"
FT   gene            complement(31442..31696)
FT                   /locus_tag="Gbem_0025"
FT   CDS_pept        complement(31442..31696)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0025"
FT                   /product="antitoxin, AbrB family"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37056"
FT                   /db_xref="GOA:B5EJ30"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="UniProtKB/TrEMBL:B5EJ30"
FT                   /protein_id="ACH37056.1"
FT                   /translation="MKTNIIRIGNSQGVRIPKILLEQSRLGTEVELEVQNEMIVIRSAT
FT                   QPRDGWAEQFRLMSECGDDKMIDEDPGEQTDWDKEEWEW"
FT   gene            complement(31964..32806)
FT                   /gene="hdrF"
FT                   /locus_tag="Gbem_0026"
FT   CDS_pept        complement(31964..32806)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hdrF"
FT                   /locus_tag="Gbem_0026"
FT                   /product="heterodisulfide oxidoreductase, NAD(P)H
FT                   oxidoreductase subunit F"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37057"
FT                   /db_xref="GOA:B5EJ31"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR001709"
FT                   /db_xref="InterPro:IPR001834"
FT                   /db_xref="InterPro:IPR008333"
FT                   /db_xref="InterPro:IPR012165"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR019480"
FT                   /db_xref="InterPro:IPR037117"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:B5EJ31"
FT                   /protein_id="ACH37057.1"
FT                   /translation="MCQSNNIYLPNLATIEAIVDETPDVRTLRLVFQDEQVRENFSFRA
FT                   GQFAEYSAFGAGESTFCIASAPTRKGYIECCFRSVGRVTESLRRLEVGDTIGVRGPYGN
FT                   SFPIEQFFGKSLVFIAGGIALPPLRTVIWNCLDLRDKFKDITIVYGARSEADLVYKREL
FT                   AEWQERDDVRLVKCVDPGGNGPDFHGKVGFVPNVLEEAAPSSENTVALVCGPPIMIKFT
FT                   LPVLERLGFADDQIYTTLENRMKCGVGKCGRCNVGNVYVCKDGPVFTAGQVKAMSQEF"
FT   gene            complement(32984..33994)
FT                   /gene="hdrE"
FT                   /locus_tag="Gbem_0027"
FT   CDS_pept        complement(32984..33994)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hdrE"
FT                   /locus_tag="Gbem_0027"
FT                   /product="heterodisulfide oxidoreductase, iron-sulfur
FT                   cluster-binding subunit E"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37058"
FT                   /db_xref="GOA:B5EJ32"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:B5EJ32"
FT                   /protein_id="ACH37058.1"
FT                   /translation="MPQIITEQNLRNLIDLLVKESKVVVGPKQADSVVLYQPLAAGSEL
FT                   TLDSLPRRSAKELFFPICEKILSYQRQDGKMQVTDVDRSRFPETVLIGAPPCDAASPAI
FT                   LDAVFSWDYNDEFYLERRRKSTIVGIACTKGDDACFCTAVGLAPNAEAGSDLFLTPLKD
FT                   GSYACKAVTEKGKALVDAHAGLFGEAASVDAAPFAEQGTEKLDLVKIKKWLEGHFEDPL
FT                   WEKISDICVGCGSCAFICPACHCFDINDEGSTEQGSRRKHWDACGFSKFTNHASGHNPR
FT                   DVQNKRYRNRIMHKFKYYDDKFGKTLCTGCGRCVRACPVGIDIAEILSTINAKQD"
FT   misc_feature    34013..34043
FT                   /note="heptanucleotide repeats; Gbem_R7003"
FT   misc_feature    complement(34095..34130)
FT                   /note="conserved nucleotide sequence; Gbem_R4002"
FT   gene            complement(34153..35097)
FT                   /gene="hdrD"
FT                   /locus_tag="Gbem_0028"
FT   CDS_pept        complement(34153..35097)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hdrD"
FT                   /locus_tag="Gbem_0028"
FT                   /product="heterodisulfide oxidoreductase, iron-sulfur
FT                   cluster-binding subunit D"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37059"
FT                   /db_xref="GOA:B5EJ33"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:B5EJ33"
FT                   /protein_id="ACH37059.1"
FT                   /translation="MNAKANKNQSSCIEPSYYQAVTQAIRTQAVQVLKDGTVAGVVGYL
FT                   PGRRKGTARPALITTPEEAEKLIFSPACVNNLSVYLTKSKKGVLKQGRIGIVAKGCDMR
FT                   ALAGLMGESQIKREDLFIIAVDCAGVYGSGAERSESVTEANIARKCVECTVHHPEGADF
FT                   VAGAATELSGLTPLEAEEMARIEALPQAERWAFWKEHFSRCIRCMACRQVCPFCYCEQC
FT                   LCDKNRPQAVENSPRPAGNTAWHIVRAMHLAGRCGGCAECERVCPMDIPLNLLNRRMAK
FT                   ELKELYDYEAGLAPAEKGPLTQYREDDDQSFIK"
FT   gene            complement(35094..35621)
FT                   /gene="hdrG"
FT                   /locus_tag="Gbem_0029"
FT   CDS_pept        complement(35094..35621)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hdrG"
FT                   /locus_tag="Gbem_0029"
FT                   /product="heterodisulfide oxidoreductase, iron-sulfur
FT                   cluster-binding subunit G"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37060"
FT                   /db_xref="GOA:B5EJ34"
FT                   /db_xref="InterPro:IPR003813"
FT                   /db_xref="UniProtKB/TrEMBL:B5EJ34"
FT                   /protein_id="ACH37060.1"
FT                   /translation="MHAEAKQHDFEPKIVAFVCTWCTYAGADLAGTSRMQYPANVRVLK
FT                   FPCTGRIDPVFILRAFQKGADGVLVSGCHPGDCHYMAGNFHARRRFAAFRALLDFVGVD
FT                   LHRLQFSWVSAAEGGKWVEVVTELTERVRAMGPMLEFKSLEHEEQWSAFQAMADVPGVV
FT                   NTPELKEAYDKI"
FT   misc_feature    complement(35641..35664)
FT                   /note="heptanucleotide repeats; Gbem_R7058"
FT   misc_feature    35745..35768
FT                   /note="heptanucleotide repeats; Gbem_R7059"
FT   gene            complement(35773..37770)
FT                   /gene="hdrA"
FT                   /locus_tag="Gbem_0030"
FT   CDS_pept        complement(35773..37770)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hdrA"
FT                   /locus_tag="Gbem_0030"
FT                   /product="heterodisulfide oxidoreductase, FAD-binding and
FT                   iron-sulfur cluster-binding subunit A"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37061"
FT                   /db_xref="GOA:B5EJ35"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR039650"
FT                   /db_xref="UniProtKB/TrEMBL:B5EJ35"
FT                   /protein_id="ACH37061.1"
FT                   /translation="MSRIGVFVCHCGENISRTVDVEQVARAAGKISGVAYACDYKYMCS
FT                   DPGQNLLKKAVSEHKLDGVVVAACSPRMHEKTFRKAASAAGLNPYLCDMANIREHCSWV
FT                   HEDKKLATSKASDIVKLMVERVKKGKSLAPITVPVTKRALVIGGGIAGIQAALDIADAG
FT                   HQVVLVEREPSIGGHMAQLSETFPTLDCSQCIMTPKMVDVANHPNITLHTFSEVEKVEG
FT                   YIGNFQVTLKHKARSVNESKCTGCGICMTKCPKKKIPNEFDQGHGLRTAIYVPFPQAVP
FT                   NTPVIDRENCTMFQSGKCGVCAKVCGPGAVDYQQEDRFSVEAVGAVVVATGFKLYSIDR
FT                   KPEDSPIQGYGEFGYGAIPDVIDGMTFERLASASGPTGGKILRPSDGKEPKQVVFIQCV
FT                   GSRAREKGISYCSKVCCMYTAKHTMLYHHKVHDGQAYVFFMDARTPGKGYDEFWRRAVE
FT                   EEEAVYIRGMVSRLYQKGEKIVVMGSDIQVGVQVEIEADLVVLATAVQAQDGADQLAQK
FT                   LGISYDKYNFYSEAHAKLKPVECATAGIYLAGACQGPKDIPDTVSQASAAAAKVMTLFS
FT                   KDQLERDPVVAKVNEKYCVGCLACKKVCPYGAVEEKEIRDRQGNLVKVVAYVNPGVCGG
FT                   CGTCQATCPSKSVELDGYTDEQIMAMIESL"
FT   gene            complement(37804..38757)
FT                   /gene="hdrB"
FT                   /locus_tag="Gbem_0031"
FT   CDS_pept        complement(37804..38757)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hdrB"
FT                   /locus_tag="Gbem_0031"
FT                   /product="heterodisulfide oxidoreductase, CCG domain
FT                   pair-containing subunit B"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37062"
FT                   /db_xref="InterPro:IPR004017"
FT                   /db_xref="UniProtKB/TrEMBL:B5EJ36"
FT                   /protein_id="ACH37062.1"
FT                   /translation="MTPGKKRLNYSYYPGCSLHASGREYDISTRALFKALNVGLKEVPD
FT                   WFCCGATPAHNVDELLSLSLCAKNLSLAEQVEGDLAVACAACFSRLKTTQHHLKEDEEK
FT                   RKQVETAIAGPAALDKPVKHILEILAREFGLSKLEESVKKPLLGLKVASYYGCLLTRPP
FT                   EVPELDDCEDPSIMEDILRALGAEPVKWSHRMECCGANFTLSRPGVVLKLSNAILESAR
FT                   LAGADCIMVACPLCHGNLDIRQKEIKDAYGAPDSTLFGNIFGSELQQGAPKDQRDLPVF
FT                   YITQLAALAMGVPSGNLGFESVITDPKPLLREKQLL"
FT   gene            complement(38754..39338)
FT                   /gene="hdrC"
FT                   /locus_tag="Gbem_0032"
FT   CDS_pept        complement(38754..39338)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hdrC"
FT                   /locus_tag="Gbem_0032"
FT                   /product="heterodisulfide oxidoreductase, iron-sulfur
FT                   cluster-binding subunit C"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37063"
FT                   /db_xref="GOA:B5EJ37"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:B5EJ37"
FT                   /protein_id="ACH37063.1"
FT                   /translation="MKNKLMHLSNETMNVGFVKKVEALSGSSVRRCFQCGKCSAGCPMS
FT                   AFMEHPPNRIVRLLQLGQGQRVLAGRSIWYCASCETCTTRCPNKVDLAGIMDALRKLSW
FT                   DADGPSKESYVQLANRLFIENIRTYGRQYELRLGAAFNMKSGQFLKDLMLGPKLISKGK
FT                   LKMFHSKNKNIGEIEAIFKRIEEMRKKGEAL"
FT   gene            39897..41606
FT                   /locus_tag="Gbem_0033"
FT   CDS_pept        39897..41606
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0033"
FT                   /product="ABC transporter, ATP-binding/membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37064"
FT                   /db_xref="GOA:B5EJ38"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:B5EJ38"
FT                   /protein_id="ACH37064.1"
FT                   /translation="MRTCRGAYLGGALLLVGTNLCGLAIPWLLKLAIEELQHPASGRFT
FT                   PGQYGAMIAAAAVGQGIIRVFSRTTLLNAGRRIEYLLREDLYGKLLTLDRTYFSNWRTG
FT                   DILSRLANDLTNVRMLLGFGVLSVLNTFVVYTAALILLTRISPFLTICAIAPFPLMIFI
FT                   VKKLSASMFKTSKRMQEALSRLTTRVEENVSAAAVVKAYCREEGEIETFRQVCDGYSDA
FT                   SMAVAKIRGFMLPVMASTGAFGTLIILFVGGAQVVRGELTLGGFVAFNGYLAMLVWPTI
FT                   MLGWILNLVQRGAASMARLGEILNASAEVVEPSDPVDPGEIRGEIEFRNLTFSYGATEM
FT                   LRGITLKVPAGSRIGIVGVVGSGKSTLVRMIPRLFPVPDGTVFIDGVDLNRISLEKIRA
FT                   AVGFVPQEGFLFSRSIAENVAYGKPGAGREEIERAVRIAGLAGDVARFPQGLETMVGER
FT                   GVTLSGGQRQRVSIARALLKEPSILVLDDPLSAVDADTEEEILSALSGYYGERTVLIVS
FT                   HRLSPLRGCDQIIVLEQGAIVEQGSHEELLELGGRYAAIHKEEQLKAEIERL"
FT   gene            41608..43419
FT                   /locus_tag="Gbem_0034"
FT   CDS_pept        41608..43419
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0034"
FT                   /product="ABC transporter, ATP-binding/membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37065"
FT                   /db_xref="GOA:B5EJ39"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:B5EJ39"
FT                   /protein_id="ACH37065.1"
FT                   /translation="MHFGGIYEDEIVGKMYDRRLMGRFFPYLLPYRRLITAALVLLPFV
FT                   AAAKLVQPWILKLAIDDHITKGVMAGLPSLAALFLGVILAESLLMFAQVYLLQYVGQKV
FT                   MYDIRVQLFSHIQRLSARFFDRTPVGSLVSRLTSDIEVLGEMFAAGIVTVVGDVLVLAG
FT                   IVGIMLFMNVKLSLVTFSVLPFLIWTAFAFRRWMRAAFRQVRARQSNLSAFLTESIGGM
FT                   AVVQLFNRERDEAREFRRLNTAYMESNLPVITWDAALYAVVETLSSVAVALIIWYGGGE
FT                   IVRGTLSFGALVAFIQYIERFFSPIRDLSAKYSVMQGAMASLERIFTLLDNQALEPALL
FT                   NGGSAGAGKEKGTPCQTAPDEAGSSICFNDIWFAYSDDAYVLKGFSLQMRRGEKVALVG
FT                   ETGGGKTTVTRLLSRLYDVNRGSITVDGADIRDIPLKTLRKRIGVVLQDPYLFSGTIAY
FT                   NISLGDPEAQKRVEKAAAVVGADRFIRELPKGFEEEVRERGVNFSAGERQLISFARAVA
FT                   FDPDILVLDEATASVDTASERLIQRGLEGLMHGRTTLVVAHRLSTIRDADRIVVIHHGE
FT                   KMEEGTHAELMDAKGVYYRLYQLQFKD"
FT   gene            43462..45372
FT                   /gene="selB"
FT                   /locus_tag="Gbem_0035"
FT   CDS_pept        43462..45372
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="selB"
FT                   /locus_tag="Gbem_0035"
FT                   /product="selenocysteine-specific translation elongation
FT                   factor"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37066"
FT                   /db_xref="GOA:B5EJ40"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004535"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR015190"
FT                   /db_xref="InterPro:IPR015191"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B5EJ40"
FT                   /protein_id="ACH37066.1"
FT                   /translation="MKHLILGTAGHIDHGKTSLVKALTGVDTDRLKEEKARGITIELGF
FT                   AHLELPGDLRFGIVDVPGHERFVRTMVAGVGGMDLVLLVIAADEGIMPQTREHLEICQL
FT                   LGVKRGIVVLSKKDTVEPDWLDLVTEEVREYLAESFLAGAPIVAVSSRTGDGIEALKAE
FT                   LTRMAGEIEQKRVDSPFRLPVDRVFTVTGFGTVVTGTLLSGAVSVGDEVEILPSGIACR
FT                   VRGVQSFGSKVEKGGAGERLAVNLQGVDHTDVERGDVVVPKGLYQPTSAVDVRLNYLAS
FT                   AGKELKHRATVRLHSATYEVPAKIILFDRGALQPGESAYVQLRLSRPVLLLPGDPFVLR
FT                   TYSPQATLGGGTVLDPAPPRRRRRSVEALELLAAAESGADQERIRLLVESSLLSGISVQ
FT                   EMVNRSGMSAKRIEAALAPLLSSGAAIQVVKEPRIFLGKDAFAQLKQKLSGELHDYLEE
FT                   NPMQEGIGKEELKSRIPKRSDPRFFGPLLASMEKDGQALSDRDLVKLPGRKAGVTQDQA
FT                   SVQAALEEALKKGWCEPPTLKELCDMLGCSEKQVLDHANLLTREGRVAKIKGDIFYAPG
FT                   AVAELREKLVARLKEKGEITPPEFREVTGLSRKFMIPLLEYFDSEKLTIRMGDKRILRK
FT                   G"
FT   gene            complement(45505..47454)
FT                   /locus_tag="Gbem_0036"
FT   CDS_pept        complement(45505..47454)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0036"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37067"
FT                   /db_xref="UniProtKB/TrEMBL:B5EJ41"
FT                   /protein_id="ACH37067.1"
FT                   /translation="MPERLHLENFGNVHALPILHYRMEFAHLVREAYEVLKPDCIAIEL
FT                   PRTLEPQFLRAVARLPEISVLAYHVAGQSAFLLVEPADPLIEGARLALKHRIPLHLVDI
FT                   DLDSYPSHDEQLPDSYAVQRIGLEPFYREVEKLYRDLEPCEEDLRRELGMAHRLQQLSA
FT                   QHQRVLFICGMSHLVRIRENFGRPLAQPLTRTHREGIAIFNLHPECCHEVLAEYPFLSS
FT                   LYETRRSPLPPEPAQAASLRKSFNAFELILGGKQSIPEEQALLESIQRSAHRIGDEGEM
FT                   PDRQKIMLRLFLEAARHYRQETGDKVHYWQKRAFFRFARNYALLSQMLLPDLYQMLAAA
FT                   RGCLDDNFAYAFFRLAAHYPWQREQSDIPTLRLSAAELSAGTRRIRFRPREQVRGKGRS
FT                   GIKMTNRRKEKRPGDWLEGFDDPYICSYPPEDLSIEEYGRNLKRIGARQLSEEASRTEP
FT                   FSASLLDGIDMRETIRNLHEGKIYVKENKRLKSGVGCVVVVFDEDREDAGYPYCMTWLG
FT                   EHEQESDMAFYATPPTDNIVGPGISRCEYGGFLLSYPPRRMHDVWQDPDYRGALGKGEV
FT                   LLMAALDYSLEKDVVYAAAKPPRSYLKQQAARLGKRIIYLPLGSLSPVALKRLRAFHIL
FT                   YGKDKRDIAKDYIW"
FT   gene            complement(47484..48302)
FT                   /locus_tag="Gbem_0037"
FT   CDS_pept        complement(47484..48302)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0037"
FT                   /product="ATPase, AAA_5 family"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37068"
FT                   /db_xref="GOA:B5EJ42"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011704"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B5EJ42"
FT                   /protein_id="ACH37068.1"
FT                   /translation="MERITLDGINLTLANPIELPLRWVGDEELLKQLLAAWMVIDERDI
FT                   PFNPRLIGKPGVGKTTLAYAAAKRLERKVYLFQATMDTRPEDLIVTPVIGPEGSIQYAA
FT                   SSLVSAMISGGVLILDEGNRMSEKAWASLAPLLDDRRYVESIITGLRITAHPDFRIVVT
FT                   MNEDSSTFEVPEYIHSRLQPQLFIDFPEADEELAILKENLPFAGSSILNYVVQFLQRGH
FT                   ASDEPYSVRDGINIARYALKMMAATEKDPRELLPLAVERILGEEALRYLK"
FT   gene            complement(48450..48629)
FT                   /locus_tag="Gbem_0038"
FT   CDS_pept        complement(48450..48629)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0038"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37069"
FT                   /db_xref="UniProtKB/TrEMBL:B5EJ43"
FT                   /protein_id="ACH37069.1"
FT                   /translation="MKTCSICKKEYDENEPDTLYGEAGEWLAEELFKDAGELCRSCREN
FT                   RARLVMMYGHDVNT"
FT   gene            complement(48629..49582)
FT                   /gene="hemH"
FT                   /locus_tag="Gbem_0039"
FT   CDS_pept        complement(48629..49582)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemH"
FT                   /locus_tag="Gbem_0039"
FT                   /product="ferrochelatase"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37070"
FT                   /db_xref="GOA:B5EJ44"
FT                   /db_xref="InterPro:IPR001015"
FT                   /db_xref="InterPro:IPR019772"
FT                   /db_xref="InterPro:IPR033644"
FT                   /db_xref="InterPro:IPR033659"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5EJ44"
FT                   /protein_id="ACH37070.1"
FT                   /translation="MSSKTALLLLQMGGPDSLDAVHPFLMNLFTDRDIIKIGPAFLQPF
FT                   IARRIVNKRAPKVEEYYRQIGGKSPIRELTEAQGEGLQQLLGEDFRSFVAMRYSRPSTI
FT                   DALAAIKRAGIERVIALSLYPHYSKATTGSSLNELKRVLKESGAKFEISYIDRFYNHPL
FT                   YIKALSEKVVQGLASFPDRKDVEIVFSAHSLPQSFIEEGDPYLDHIQETVRLVMEQVGE
FT                   GSHTLCFQSKASRVKWLEPSTEATIEQMAKAGKKNLLMVPLSFVSDHIETLYEIDIQYG
FT                   EEAKALGIERFVRSESLNSSPLFLECLADLVKTAAK"
FT   misc_feature    complement(49601..49653)
FT                   /note="conserved palindrome; Gbem_R1002"
FT   misc_feature    complement(49727..49779)
FT                   /note="conserved palindrome; Gbem_R1003"
FT   gene            complement(49794..51341)
FT                   /gene="mcp40H-15"
FT                   /locus_tag="Gbem_0040"
FT   CDS_pept        complement(49794..51341)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mcp40H-15"
FT                   /locus_tag="Gbem_0040"
FT                   /product="methyl-accepting chemotaxis sensory transducer,
FT                   class 40H, hemerythrin-like domain-containing"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37071"
FT                   /db_xref="GOA:B5EJ45"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR012312"
FT                   /db_xref="InterPro:IPR012827"
FT                   /db_xref="InterPro:IPR016131"
FT                   /db_xref="InterPro:IPR035938"
FT                   /db_xref="UniProtKB/TrEMBL:B5EJ45"
FT                   /protein_id="ACH37071.1"
FT                   /translation="MSLFSRVLTINFIAVAATIGAAVAFGSGVGLFAVGAVIILLCAVA
FT                   CGLSSRGETKALEEMAIALESAAAGNLSYRVTAAGNGEIGRIGSAFNTMMGDWNKTMHQ
FT                   FFTVTDLVRDSVALVSATNDAMAAAAEDVALQASTIATASEEMSATSGDIARNCLYAAE
FT                   NAHRATEETTSGAEIVSNSARLMENIAQRVMATSSSVAGLGERSDQIGAIAGTIEDIAD
FT                   QTNLLALNAAIEAARAGETGRGFAVVADEVRALAERTTRATKEIDAMIKSIQTETRAAV
FT                   GSMGEGVEQVNQGTAETCRSGEALNGILKMINDLTMQLSQIATAAEEQTATTHEITSNI
FT                   QMITSVVNSNVESARDTRAATGKLVQQVDELHQLVSHFQLSDAMVWDQSFATNIGTFDD
FT                   QHKKLFAMVNELNQAMQHKRSKEAIGSVLNRLIEYTGSHFAAEEEAFRKSGYPEEEAHV
FT                   RAHRDLVQQVVALQQKFNAGETLLTHDVIEFLQNWLVKHIKGTDVRYTSHLTKAGVR"
FT   gene            complement(51529..51717)
FT                   /locus_tag="Gbem_0041"
FT   CDS_pept        complement(51529..51717)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0041"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37072"
FT                   /db_xref="UniProtKB/TrEMBL:B5EJ46"
FT                   /protein_id="ACH37072.1"
FT                   /translation="MKNYRGKLVMAAIILSCGLVMQAEHSEQVQLKQDTNEIRTSPQDS
FT                   QAGTNRSTVAHNVDSSR"
FT   gene            51985..52815
FT                   /gene="sco"
FT                   /locus_tag="Gbem_0042"
FT   CDS_pept        51985..52815
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sco"
FT                   /locus_tag="Gbem_0042"
FT                   /product="cytochrome c oxidase, coo3-type, synthesis
FT                   factor"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37073"
FT                   /db_xref="GOA:B5EJ47"
FT                   /db_xref="InterPro:IPR003782"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B5EJ47"
FT                   /protein_id="ACH37073.1"
FT                   /translation="MGFIRRWGAWVPVLVLLFWGTAAAHVEGPQPLSSFSSAGANAQPL
FT                   GLTERLGGRIPLDLTFRDETGRERRLSELITGPTIILPVYYSCTNVCNYMQEGLARVLP
FT                   EIKLVPGKDYRVLSLSFDERETPERAARSKRMYETVMRGKFPAGNWTFLTGDAASIHKL
FT                   TDAAGFQFRRQGNDFVHPVASFVVAGDGMIVRYLYGTQFLAKDVTLALIEARQGRVGAT
FT                   ISKMVSYCFSFDPKSKSYEFNLLRVSATVIIACVLAFAVFLVFGGKKPPAGKGQ"
FT   gene            52879..54498
FT                   /gene="coxA"
FT                   /locus_tag="Gbem_0043"
FT   CDS_pept        52879..54498
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="coxA"
FT                   /locus_tag="Gbem_0043"
FT                   /product="cytochrome c oxidase, coo3-type, cytochrome o
FT                   subunit I"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37074"
FT                   /db_xref="GOA:B5EJ48"
FT                   /db_xref="InterPro:IPR000883"
FT                   /db_xref="InterPro:IPR014241"
FT                   /db_xref="InterPro:IPR023615"
FT                   /db_xref="InterPro:IPR023616"
FT                   /db_xref="InterPro:IPR036927"
FT                   /db_xref="UniProtKB/TrEMBL:B5EJ48"
FT                   /protein_id="ACH37074.1"
FT                   /translation="MSQDTAMAQGGFWRDTRRSGIGSWIFSTDHKRIGMMYLYCVLSFF
FT                   LVGVVLGFLIRLELIAPGPTIVTAQTYNALFTVHGVVMIFLFIIPGIPASFGNLVLPIQ
FT                   LGARDVAFPRVNLLSWWLYAIGAVIVLVSLFTGGGAPDTGWTFYVPFSARTSTNVSLAV
FT                   FGVFVLGFSSILTGINFITTIHRMRAPGMTWTRIPLFTWSLYATAWVQVLATPIIAITL
FT                   LLVVTERILGLGLFDPNRGGDPVMYQHMFWIYSHPAVYIMILPGMGVISDIIPVFSRKP
FT                   IFGYKMIAFSSLAIAAAGSAVWGHHMYTSGMSDLGVLVFSFLTFIVAIPSAIKVFNWVS
FT                   TMYKGSISLEAPMLFALSFILLFSIGGLSGLILGAAATDIHVHDTHFVVGHFRYVMFGG
FT                   TGFAFFAAAHYWLPKYYGRRYKEKPAIVGWILMFVGFNVMYFTMQVLGMEGMPRRYYDY
FT                   LPEFTRLNVVATVGSWILVAGIVIVVWNLWRGLFRGEPFTGNPWGGATLEWSIATPPPT
FT                   ENFDEDPVVTHGPYEFKGAGIP"
FT   gene            54495..55094
FT                   /gene="coxC"
FT                   /locus_tag="Gbem_0044"
FT   CDS_pept        54495..55094
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="coxC"
FT                   /locus_tag="Gbem_0044"
FT                   /product="cytochrome c oxidase, coo3-type, subunit III"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37075"
FT                   /db_xref="GOA:B5EJ49"
FT                   /db_xref="InterPro:IPR000298"
FT                   /db_xref="InterPro:IPR013833"
FT                   /db_xref="InterPro:IPR024791"
FT                   /db_xref="InterPro:IPR035973"
FT                   /db_xref="UniProtKB/TrEMBL:B5EJ49"
FT                   /protein_id="ACH37075.1"
FT                   /translation="MSHAEKDSFGAKLGMWLFLFTEMLLFGGVFILYSVYLTRYPKEFG
FT                   LGGHQLDLVFGATNTVVLLTSSLFAAMSVTAIKRGAKQLTLGLLSGTIGCALIFLFIKY
FT                   LEWSAKFHHGIYPNSPKLIAGPPGESIFFSLYYLTTGLHGIHVIIGGILMTWTAVMVQK
FT                   GMLNSADNVTLENVTLYWHLVDLVWIFIFPLYYLIL"
FT   gene            55211..55492
FT                   /gene="coxD"
FT                   /locus_tag="Gbem_0045"
FT   CDS_pept        55211..55492
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="coxD"
FT                   /locus_tag="Gbem_0045"
FT                   /product="cytochrome c oxidase, coo3-type, subunit IV"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37076"
FT                   /db_xref="GOA:B5EJ50"
FT                   /db_xref="InterPro:IPR005171"
FT                   /db_xref="InterPro:IPR011743"
FT                   /db_xref="UniProtKB/TrEMBL:B5EJ50"
FT                   /protein_id="ACH37076.1"
FT                   /translation="MEHTEHILSYGKLTAVWVALLVLTAATIMVTRFELGVWKVWAALA
FT                   IASVKSGLVIAFFMHMKYEPRLFRIILFVALFTLAGFIGGTFFDVLYR"
FT   gene            55502..56407
FT                   /gene="coxB"
FT                   /locus_tag="Gbem_0046"
FT   CDS_pept        55502..56407
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="coxB"
FT                   /locus_tag="Gbem_0046"
FT                   /product="cytochrome c oxidase, coo3-type, cytochrome c
FT                   subunit II, one heme-binding site"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37077"
FT                   /db_xref="GOA:B5EJ51"
FT                   /db_xref="InterPro:IPR001505"
FT                   /db_xref="InterPro:IPR002429"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR011759"
FT                   /db_xref="InterPro:IPR014222"
FT                   /db_xref="InterPro:IPR036257"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:B5EJ51"
FT                   /protein_id="ACH37077.1"
FT                   /translation="MENQLITSTQQAVDPVFTFLFGACLVLLLGITATMVYFVVRYRRS
FT                   KNPEPTSQVSGSPLLEVVWTVLPTILVMGMFYYGWTSYLSLRTVPKNAMQVKAEARMWS
FT                   WNFVYDNGKQSGKLYVPVGRAVQVNLESKDVVHGFYVPAFKIKRDVVPGMKNHVWFVAT
FT                   SPGTYDLFCSQYCGTGHSAMITTVEALPPAQFAAWLQQTAAGGAAQGQALLEKYGCLGC
FT                   HSLDGTRKVGPTFKGLYGSQVKVEREKKEETVTADDVYLRESILNPAAAIVDDYPAVMP
FT                   PSTMPEADLKAVIEYLKGLK"
FT   gene            56404..57222
FT                   /gene="ctaB"
FT                   /locus_tag="Gbem_0047"
FT   CDS_pept        56404..57222
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ctaB"
FT                   /locus_tag="Gbem_0047"
FT                   /product="protoheme IX farnesyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37078"
FT                   /db_xref="GOA:B5EJ52"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR006369"
FT                   /db_xref="InterPro:IPR030470"
FT                   /db_xref="UniProtKB/TrEMBL:B5EJ52"
FT                   /protein_id="ACH37078.2"
FT                   /translation="MRILARLFRLPLALMNGAAAAAGYLLFPSPAQRPTLLAVFLGVAL
FT                   LAAAGSALNQVMERDLDALMRRTCDRPLPTGKLTPAAALLAGLAALSAGAALLSLVAGT
FT                   VPAAVSLFTLLWYLALYTPLKRVSSLALLVGGLCGCGAPLVGWSAAGGGIGEFPVILLA
FT                   GVIYLWQVPHFWQLQRKHADDYRRAGFPVFTPPAGADGCAPLCRLWMAAMVAGTLMLPL
FT                   FGVVRATPLICTILLPVPLLFWSRKRWEPFAGLVLHCYPLLVTLAIFGAK"
FT   gene            57239..57433
FT                   /locus_tag="Gbem_0048"
FT   CDS_pept        57239..57433
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0048"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37079"
FT                   /db_xref="UniProtKB/TrEMBL:B5EJ53"
FT                   /protein_id="ACH37079.1"
FT                   /translation="MADKIKCETPLKHKDHMCKLKKDGRTEELEKFQENPIVFCNKCKM
FT                   QANDPCRLCNPRTIKGAHN"
FT   gene            complement(57638..58828)
FT                   /locus_tag="Gbem_0049"
FT   CDS_pept        complement(57638..58828)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0049"
FT                   /product="2-amino-3-ketobutyrate--coenzyme A ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37080"
FT                   /db_xref="GOA:B5EJ54"
FT                   /db_xref="InterPro:IPR001917"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR010962"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:B5EJ54"
FT                   /protein_id="ACH37080.1"
FT                   /translation="MSEKFEWINEEMEALKQQGLKTHIRTIGSACGPWMVVDGKKVLNF
FT                   CTNNYLGLANHPRLKEAARAAVQIWGVGPAAVRSIAGTLELHRLLEERLAAFKGVEDAL
FT                   YVQSGFCANQAAIPSMVGKGDVIFTDRLNHASIIDGCRLSSARVVVYEHCDVEDCERAI
FT                   KENLGEYRRALLITDGVFSMDGDIAPLDRLFELCERHGIITMVDDAHGEGVLGRGGRGI
FT                   VDHFQLNGKFDLEIGTLSKAFGVMGGVIAGSSTVIEWIRQKARPFLFSSAVTAADTAAC
FT                   LAAVDLLEEGTELVERLWENTRYFKEGMRGAGFDIGASVTPITPVMIGDATLAQNFSRM
FT                   LFDSDPGIFAMPIGYPTVPQGKARIRVMISASHSREDLDLGLDIFTRIGKSVGVIG"
FT   gene            complement(58851..59894)
FT                   /locus_tag="Gbem_0050"
FT   CDS_pept        complement(58851..59894)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0050"
FT                   /product="L-threonine 3-dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37081"
FT                   /db_xref="GOA:B5EJ55"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR004627"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B5EJ55"
FT                   /protein_id="ACH37081.1"
FT                   /translation="MQKTMQALVKKYPKPGLWLDEVPVPEVGINDVLIKVHKTAVCGTD
FT                   LHIWDWNDWARKTIPVPMVVGHEFVGRVAAMGSNVADLNIGDIVSGEGHIVCGRCRNCL
FT                   AGRRHLCKDTNGVGVNRAGAFAEYICIPVTNVWHADPTIPMEILGIFDPFGNATHTTLA
FT                   FPILGEDVLITGAGPIGIMATAIARHAGARYIVVTDLNQYRLDLAKKMGATVALNVREG
FT                   TLAQVRQQLGMKEGFDVGLEMSGNGDAFKEMLANMCHGGKIAMLGLPSGDLAVDWNQVI
FT                   FNMLTIKGIYGREMYETWYLMQSLIKIGLDLTPVITHRMHYTEFEEAFRVMSTGNAGKV
FT                   MLNWVEE"
FT   gene            60050..60229
FT                   /locus_tag="Gbem_0051"
FT   CDS_pept        60050..60229
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0051"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37082"
FT                   /db_xref="UniProtKB/TrEMBL:B5EJ56"
FT                   /protein_id="ACH37082.3"
FT                   /translation="MSEHKECPKPAEHKAHMCQLKREGRIEEIDLHSSKPKFICNRCQA
FT                   KADEEGYLCTPRPL"
FT   misc_feature    60248..60300
FT                   /note="conserved palindrome; Gbem_R1004"
FT   gene            60472..63636
FT                   /locus_tag="Gbem_0052"
FT   CDS_pept        60472..63636
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0052"
FT                   /product="sensor histidine kinase response receiver, PAS
FT                   and GAF domain-containing"
FT                   /note="domains: PAS, GAF, HisKA, HATPase_c, REC"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37083"
FT                   /db_xref="GOA:B5EJ57"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B5EJ57"
FT                   /protein_id="ACH37083.1"
FT                   /translation="MLAVPRKISAALIFLLVLFGLLFIGDSQLQAASRPHVLVLNSYND
FT                   GYEWSDDEMRGLRETLTRRLPQMEFLIEHLDTKKFPAKKHFPQLADLLAAKYSASRFQV
FT                   VIAMDNAAFEFALRYRDRLFPGTPLVFCGINDYNPRMIAGRKNLTGVAEHHDMVGTLET
FT                   ALSLHPGTRQVMVVHDYTDTGLAMAHELSQHHVQFPGVRLRFLPNLPLEIAVQQLKALR
FT                   PDTLVLLLSYSVEKGGRSFTQGQVAQMVSSASPVPVYAVHAAQLGKGVVGGRMMEGETQ
FT                   GRKAAELALRIIAGEKAQSIAVVDQNLSEAMFDDAVMRRFGIDRGKIPAGSRAINKPVA
FT                   VYAVNKTVFWLALAVAVLMLTGLLTLYLNNERRKRLEKVLQMSEARFRQLFDNTVDAIY
FT                   IHDFGFKILEANQSACDKMGYSHEELLHVSLYEINHPSQREKLPKRLAAAQRDGRALYE
FT                   SMHQTRAGEPVPIEVSSRVIEFGEQPAILSVVRDISRRKRIERRENARLKILEQMATGS
FT                   NLEELLGDIVRFVEQESPGALCSVLLVDDSGTHLVHGAAPGLPDFYNQAVNGLRIEQGM
FT                   GSCGTAAFTKQRVVVEDIETHPYWTNFRLALDAGLRACWSEPVLSREAEVLGTFAVYYR
FT                   SCRSPREEELALIESAAHMASIAIGKMRSEESRQKLEEQMRQMQKIEAIGQLAGGLAHD
FT                   FNNLLTPIFVYADIAKRSFAHDDPNWKKLDGILVSAHKAADLTKKLLSFGRKQMLTMEV
FT                   LELNEVIASLLDLMQRTIRANIEIRTNLTDCGARIFADRGQIEQILINFAVNAQDAING
FT                   NGSIVIETGNVTIDDEFSRMNPGIKPGPHVLLSFTDNGCGMGEEVLSHIFEPFYTTKPV
FT                   GQGTGLGLATVYGIVKQHNGWIKVESQVGNGTSFLLYFPRQAAKAKMKQAEPESAAKIE
FT                   QSDSRATILVVDDNESIREMALELLQASGHHVLTAETPALALELVGERAVSLDLLVTDV
FT                   VMPEMSGPELYERLALLQPGLPVLYISGYTFDVKVHNPRQHQQVSFLPKPFTSEKFLSV
FT                   IDKAIS"
FT   gene            63912..64913
FT                   /locus_tag="Gbem_0053"
FT   CDS_pept        63912..64913
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0053"
FT                   /product="peptidoglycan-binding lipoprotein, OmpA family"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37084"
FT                   /db_xref="GOA:B5EJ58"
FT                   /db_xref="InterPro:IPR006664"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="UniProtKB/TrEMBL:B5EJ58"
FT                   /protein_id="ACH37084.1"
FT                   /translation="MKREKLVGKALLLLALGSVGTLSGCAHYEVNNGRGNIPGYWIRYE
FT                   MQEADRAIEAARADGKAALCPDQFREAEAAKNNAYDVFRACHTEEGAALAKEATAKAKA
FT                   LCPPRPAEPAPKPVVAPPPPPPPAPKAPTDTLLVEPASVTKGETATLSWTSANANTCAI
FT                   EPGIGPVQTAGTLTITPKDDILYTLVCTGPGGAARSDAKVAVTAPPVPVPVPPVKLCKP
FT                   AVLNVHFDTNKSDIKPQYHDELKALADFLKEFPNATGTIEGHTDSVGDKAANMKLSQRR
FT                   ADSVRKYLVDKFGIAPERVKAVGYGPTKPAADNKTAAGKQKNRRIESNFHCD"
FT   gene            complement(65087..66094)
FT                   /locus_tag="Gbem_0054"
FT   CDS_pept        complement(65087..66094)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0054"
FT                   /product="peptidase, M28 family"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37085"
FT                   /db_xref="InterPro:IPR007484"
FT                   /db_xref="UniProtKB/TrEMBL:B5EJ59"
FT                   /protein_id="ACH37085.1"
FT                   /translation="MAYKKFPALCAGGCALFLALIAIAGGSMVILPGESYRGALPPLER
FT                   EELQLRDRLRQHVVQLSGTIGERNVAHYDSLVKSAEYVKAELRKAGLSVSEQPFAADGK
FT                   VVANLEVEMKGTTEAQEIVVIGAHYDSAPGTPGADDNASGVAALLELARQCTNLRPART
FT                   VRFVAFVNEEAPYFQGEEMGSVVYAQRAKERREKIVGMVSLETIGYYADQPGSQRYPAP
FT                   LSHFYPDTGNFIGFVSNWNSQSLLRQAIGAFRRGGVKFPSEGVAAPAGIPGIGWSDQWS
FT                   FWQQGYPALMVTDTAPFRYPHYHEPSDTPDRIDYGRMTRVVQGLGKVVEELAGK"
FT   gene            66327..68432
FT                   /locus_tag="Gbem_0055"
FT   CDS_pept        66327..68432
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0055"
FT                   /product="protein 3-oxoalanine-generating enzyme family
FT                   protein and SAM-dependent methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37086"
FT                   /db_xref="GOA:B5EJ60"
FT                   /db_xref="InterPro:IPR005532"
FT                   /db_xref="InterPro:IPR013217"
FT                   /db_xref="InterPro:IPR016187"
FT                   /db_xref="InterPro:IPR024775"
FT                   /db_xref="InterPro:IPR027577"
FT                   /db_xref="InterPro:IPR027625"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR042095"
FT                   /db_xref="UniProtKB/TrEMBL:B5EJ60"
FT                   /protein_id="ACH37086.1"
FT                   /translation="MDLRKTHSVILTEGDPEQKRSEILDYFHATFTIDERLYETLKDES
FT                   TFYLKGDHLRHPLIFYYGHTATFFINKLIIARVIDRRVNPRFESLFAVGVDEMSWDDLN
FT                   ESHYDWPTPGEVKRYRDQVRDLVDGLIKTLPLTLPITWEHPFWAIMMGIEHERIHLETS
FT                   SVLIRQLPLDQVRRHDFWEICRESGEPAANELLPVAAGRVRLGKDEGHPLYGWDNEYGS
FT                   REAKVEAFSASKFLVSNREYLAFVKAGGYRERGWWTEEGWNWRSFKQAEHPLFWVEREW
FT                   GWGLRTMLEIIDLPWNWPVEVNYLEAKAFCNWLSAKSGKSIRLPTEDEWYHLRDLAGVP
FT                   DQPGWSRAPGNINLEYWASSCPVGRFAFGDFFDLIGNVWQWTETPIYPFHGFRVHPWYD
FT                   DFSTPTFDTRHNLIKGGSWISTGNEATRDSRYAFRRHFFQHAGFRYVESAHPVEIHEDP
FT                   YETDALAAQYCDAHYGPEHFGVPNFPRACAEICLELTRGRSRGHALDLGCAVGRASFEL
FT                   ARGFDQVTGLDFSSRFFRLAARMQDEGFLRYALPEEGEVVSFNELELADLGLKEVRERV
FT                   EFFQADACNLPDKFTGYDLVLAANLIDRLYSPRRFLAAIRERLNPGGLLVIASPYTWLE
FT                   EYTKKDEWLGGYREAGEPVWTIDGLSRELLPYFTPLGAPREIPFVIRETRRKFQYSIAQ
FT                   LTVWELK"
FT   gene            68429..69586
FT                   /locus_tag="Gbem_0056"
FT   CDS_pept        68429..69586
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0056"
FT                   /product="pyridoxal-5'-phosphate-dependent enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37087"
FT                   /db_xref="GOA:B5EJ61"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR027619"
FT                   /db_xref="UniProtKB/TrEMBL:B5EJ61"
FT                   /protein_id="ACH37087.1"
FT                   /translation="MTKKFDFDEIIDRRGTSSEKWDKYRDRDIIPLWVADMDFRSPPAV
FT                   IDALHERVSHGVFGYTAPSESLVEAVLQSLRDEFGWQVAKEWIVWLPGLVTGLNVSCRA
FT                   VGAAGDDVITLTPVYPPFMSAPPLSGRNAIKVPLRCEEGRWGFSLEDLERAVTPATKLL
FT                   LLCSPHNPVGRVWSREELTQLAQFAQRHDLVICSDEIHAGLVLEEGVRHIPLATLSPEI
FT                   SARTITLLAPSKTFNVPGLGCSFAVISDDTLRRAFKKAMGRIVPHVNLLGYTAAEAAYR
FT                   HGEEWRQELIAYLRGNRDLVAREVARMPGLTVAPVEATYLSWIDLRQTGIEDPVTFFEE
FT                   AGVGLSGGADFGLPCYVRLNFGCRRDLLVEALRRMRVALEARTGN"
FT   gene            69610..70254
FT                   /locus_tag="Gbem_0057"
FT   CDS_pept        69610..70254
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0057"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37088"
FT                   /db_xref="UniProtKB/TrEMBL:B5EJ62"
FT                   /protein_id="ACH37088.1"
FT                   /translation="MKRTDIFKITLAGIAAIVAVTFGAPRNAAAHCDTLDGPVIQDAHK
FT                   ALEAKDITPVLKWVKAKDEKAVKAAFNKALAAKGANAETAHHKFFATLVKIHRAGEGAP
FT                   FTGLKPAGEVEPAVAEADKALAGGSADALVKLVTDDVTAGINKRYERAAAAYKHKDESV
FT                   AQGREFVEAYVEFTHYVEKLHMDATGKGAHGEHKEPAKEHGGHADHGADKH"
FT   gene            complement(70364..71047)
FT                   /locus_tag="Gbem_0058"
FT   CDS_pept        complement(70364..71047)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0058"
FT                   /product="RES domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37089"
FT                   /db_xref="InterPro:IPR014914"
FT                   /db_xref="UniProtKB/TrEMBL:B5EJ63"
FT                   /protein_id="ACH37089.1"
FT                   /translation="MKVLFDKVRDFDDDVFRNIVSLRESQDLFDDLTVDEGATQYAIDA
FT                   EAQVKSSLPSGVIERGFDYTTAIDYPFTNEPYLLSRYGNGSFGVWYGALDLETTLYETL
FT                   YHTVREESKIEGISGILKRERAVYLVRTRAILIDLVGKENRYPELISDSYALTQQIAER
FT                   VHKEHPGLLAPSARYSGTNLIAFTPKILSNPRVNCYLTYTYDYQKKSVVVERRPGEVIL
FT                   ERSFA"
FT   gene            complement(71047..71454)
FT                   /locus_tag="Gbem_0059"
FT   CDS_pept        complement(71047..71454)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0059"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37090"
FT                   /db_xref="InterPro:IPR024467"
FT                   /db_xref="UniProtKB/TrEMBL:B5E8A7"
FT                   /protein_id="ACH37090.1"
FT                   /translation="MPVSAIQQRNNDFRSPEGRSALAKMVIKLFGLWELTTADQLELLG
FT                   LSAKSRSLLSRYAKGDALPEGRDTLDRVGWLLAIHKALRLLYPQNPEIRYSWVNRRNEA
FT                   FGNLRPLDVMKEQGIIGLARVSRYLDYYRGL"
FT   gene            complement(72062..72829)
FT                   /locus_tag="Gbem_0060"
FT   CDS_pept        complement(72062..72829)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0060"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37091"
FT                   /db_xref="GOA:B5E8A8"
FT                   /db_xref="UniProtKB/TrEMBL:B5E8A8"
FT                   /protein_id="ACH37091.1"
FT                   /translation="MGNMNYIISGLNLVVLAAIFVVLLLLRHYLPSYTKKKGENLATKE
FT                   DVGDITDRIERVKALYSSQLEEIKATISSIRNEREEFNKSRRECLLNFYDQIVEFYYEK
FT                   IAVNFGDFPMDDGASMAGFQDEFNKLITAMLKSYQRIVVYFDQPEPVRIESENIVNEVL
FT                   AARTAFKKHFGNVKLTHINECQAWQSGDRGRIDIAVPAANEANIKYWDAMGPVVEKLKL
FT                   SLQRYLLETNKSLKPAETSNIPEAIFATDDRKS"
FT   gene            complement(73065..73868)
FT                   /locus_tag="Gbem_0061"
FT   CDS_pept        complement(73065..73868)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0061"
FT                   /product="FRG domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37092"
FT                   /db_xref="InterPro:IPR014966"
FT                   /db_xref="UniProtKB/TrEMBL:B5E8A9"
FT                   /protein_id="ACH37092.1"
FT                   /translation="MHVVNLATWEEFEGNVFALYQLLHPKVPENKSYVSPLLFRGHSNA
FT                   SWLLETTLERVAGKCFRADEYYNIMLSVQPAIQSFTEKTWEFAHSYPNDDGTPKPPPGY
FT                   EFMAYLRHHGFPSPLLDWSRSPYIAAFFAFQSPELHSHDDNVAIYVFVEYLAAGKSGML
FT                   SEATIIGCGPHVTTHKRHFNQQSEYTICRKIKEDRVFYCCHEEAFARDEGSQDLLFKYI
FT                   LPRSERGKVLERLHMMNITAYSLYGSEDSLISTLAYQEINRKRRI"
FT   gene            complement(73976..74794)
FT                   /locus_tag="Gbem_0062"
FT   CDS_pept        complement(73976..74794)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0062"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37093"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:B5E8B0"
FT                   /protein_id="ACH37093.1"
FT                   /translation="MKKMFALVVCLAVIFPNIVMAASIEKAEMYRQNGLTAEAKRELID
FT                   IIYTKEDRAKPEAYYLLGTIAFGERNISSALDLWKKLIEKYPKSSQAALVKDRVKQLAE
FT                   ITGEVTKVTIENAVAQSYLRHADFWSERKKEIFVIDSSWIPQVEAAIKWYDKVILEFPK
FT                   SEAAKIAYEGKLKTIIGWEETGRYGEQHGLKGNFYKYMPMMLSTFAAFESDHPDASTLQ
FT                   SFRYQIAQAYWSNRDWEKTREWLKLMMEKSGPNDSFYKDLASRRLEKVEY"
FT   gene            complement(74971..78072)
FT                   /locus_tag="Gbem_0063"
FT   CDS_pept        complement(74971..78072)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0063"
FT                   /product="efflux pump, RND family, inner membrane protein,
FT                   AcrB/AcrD/AcrF family"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37094"
FT                   /db_xref="GOA:B5E8B1"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:B5E8B1"
FT                   /protein_id="ACH37094.1"
FT                   /translation="MNIAELFIRRPIMTSLVMIAILIFGIAAYRLLPVNDLPNVDFPTI
FT                   QVSANLPGANPDTMASAVATPLENQLSTIAGVDSMTSTNGIGTTRITIQFTLDRDIDAA
FT                   AQDVQAALSLATRDLPKNMPTPPSFRKVNPADQPVLYLALSSPTLPLSAIDEYAQTIIA
FT                   RRLSTISGVAQVNVWGSQKYAVRAQLDPRIMASRRIGIDEVATAIGAANVNMPTGVLDG
FT                   AKQAHTIDTNGQLYKAEAYRPIAVAYRDGAPIRLEEIGKVIDSVENARTASWYNNTRAI
FT                   ILTVQRQPGTNTIEVVDSVKKLLPAFRGQMPASVELNVLYDRSTMIRESMTDVKYTLCL
FT                   TICLVIMVVFLFLRNFSATVIPSLAVPMSIVGTFSVMYLLGFSVNNISMMAITLAVGFV
FT                   VDDAIVMLENIVRHMEKGEGAMQAALKGSREIGFTIVSMTISLVAVFIPVLFMRGILGR
FT                   LLHEFAVTISAAILVSGFVSLTLTPMLCSRFLKPQSAIHHGRFYLVMERFFDGLRDLYG
FT                   RTLSQVLSHRRVTMMVTLIITILTVWLFVRIPTGFLPSEDTGRLNADTEAAQGTSFAEM
FT                   KQLQESVAQIIAKDPNIEGFMSSIGSGGGASNTGRLFMRLKPRSERKLSADEIIQELRP
FT                   KLAKLRGIKVYLRNVPSIQIGGTSSKSLYQFTLQGQDTDELYKAAAEFETRLRSVPELL
FT                   DVASDLQISNPQVRVEINRDKAAALGLSVLQVEDALSYAYSTRQVSSILAPSNQYQVIL
FT                   ELDPLYQGDPAALGMLYIHSSSGDLVPLDTIATISKTIGPLTVNHLQQLPAVNISFNLR
FT                   PDVSLGDAIAIVDKLAPSILPPGVSKQFQGTAQAFQSSFSGLLILLALAVFVIYLVLGV
FT                   LYESYIHPVTILSGLPSAGFGALVTLMLFGSELNIYGFVGIIMLIGIVKKNAIMMIDFA
FT                   LEAERVEGKSPVDAIYEGALVRFRPIMMTTMAALMGTLPIALGLGAGGEARQPLGLAVV
FT                   GGLLTSQLLTLYITPVVYYYMDRLLRMVRSRKSVPVAGVGDVAD"
FT   gene            complement(78069..79202)
FT                   /locus_tag="Gbem_0064"
FT   CDS_pept        complement(78069..79202)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0064"
FT                   /product="efflux pump, RND family, membrane fusion
FT                   lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37095"
FT                   /db_xref="GOA:B5E8B2"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:B5E8B2"
FT                   /protein_id="ACH37095.1"
FT                   /translation="MFPATSRRFVQAVSLVTVLLSLSACSTQKEKPKAKPPVPVAVATA
FT                   ARKDVPVQLKAIGNIEPFNSVAIKSQVNGQIAKVHFQDGCDVQKGALLVTLQPESFQAA
FT                   LNQSEAALTRDLAQAKFAKEQAERYRQLVAEGIVTKDQYDQLRTNAESAAAAVAADRAA
FT                   IANAKIQRNYCYIRSPISGRTGNLALQLGNLVKANDLTLVTINQISPIYATFSIPEKSL
FT                   PEVKKAMAGRALKIEAVVPNDPNGKETGTISFLDNAVNSATGTIRLKGVFANADRKLWP
FT                   GQFVDVVMTLGVRRDAVVVPTQAVQVGQQGQYVYVVKPDKTAEMRSVTVAAEQAGESVI
FT                   EKGVAPGETVVVSGQLRLTPGAKVELPSSQPTAVKRP"
FT   misc_feature    79368..79403
FT                   /note="conserved nucleotide sequence; Gbem_R4003"
FT   gene            complement(79674..81410)
FT                   /locus_tag="Gbem_0065"
FT   CDS_pept        complement(79674..81410)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0065"
FT                   /product="response receiver histidine kinase response
FT                   regulator"
FT                   /note="domains: REC, HisKA, HATPase_c, REC"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37096"
FT                   /db_xref="GOA:B5E8B3"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B5E8B3"
FT                   /protein_id="ACH37096.1"
FT                   /translation="MGKERDILIVDDNQVVCDVLTELFRNEGFDSWGVATGEACLDEVT
FT                   RASCKLVMLDVRLPGISGIEVLEAIRRDHPRTEVIIMTSHVSLETAVQALRLGAQDYLF
FT                   KPFDDLEMVIATVNKALERRRLVEERDKLVRTLTDLAIENGRILAECRRVNSSLEEKVA
FT                   QRTAELSKSNLQQKAIIAELHEAKEAAEAANRAKSQFLANMSHEIRTPMNGVLGMAELL
FT                   LHSELDEKQKSYVKILHQSGESLLGIINDILNISKIEAGRLEIERIPFDLHETARGAVE
FT                   LYREVGRRKGVAVELQIEEDVPRCVVGDPSRLRQVLINVVNNGLKFTDKGSVQVRVTLV
FT                   EQYQNGQYVAFEVKDTGIGIPADCIGDIFGLFAQVDGSTTRKYGGTGLGLAIAKQLVEL
FT                   MGGAIGVESEPGQGSTFTFIVFLHRHADQTTCDEDTPAELDNPMAAAREVRKFNARVLL
FT                   AEDNPVNCEVAFAMIAALGCQVDVAQDGREAVEAFTRQPYDLIFMDCQMPEMDGYQATR
FT                   AIRQRELGSGRHTTVIALTAHAMAGAREHCLSAGMDDYLSKPFNLEQLQELIVKWTTPH
FT                   LA"
FT   gene            81597..82259
FT                   /locus_tag="Gbem_0066"
FT   CDS_pept        81597..82259
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0066"
FT                   /product="cyclic nucleotide-binding helix-turn-helix
FT                   transcriptional activator, Crp family"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37097"
FT                   /db_xref="GOA:B5E8B4"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR012318"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B5E8B4"
FT                   /protein_id="ACH37097.1"
FT                   /translation="MPNKMKLTAADLLSLFNPADSDQFLAHFTTRHYPPKALVYSPFEE
FT                   KNLVFVVKSGRLRVYLAYEDKEFTLALLEPGDVFSTHTPAFVQALEGSEILVCSTATFR
FT                   EAVARRPELSLTMVKVLGELLKNSIETIEGLAFKDVRLRLVDFLLGAAAERGRASTEGT
FT                   VVQLGLGTEDIALLIGTTRQTISQIVNDFIKADLLRKIDRKTLLITDMDALKALREL"
FT   misc_feature    82324..82434
FT                   /note="conserved palindrome; Gbem_R2001"
FT   gene            82695..83693
FT                   /gene="cooL/cooX"
FT                   /locus_tag="Gbem_0067"
FT   CDS_pept        82695..83693
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cooL/cooX"
FT                   /locus_tag="Gbem_0067"
FT                   /product="hydrogenase subunit, iron-sulfur cluster-binding
FT                   domain-containing"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37098"
FT                   /db_xref="GOA:B5E8B5"
FT                   /db_xref="InterPro:IPR006137"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:B5E8B5"
FT                   /protein_id="ACH37098.1"
FT                   /translation="MQDQVKETPAEPVRLFRINTGSCNGCDVELAVTAAVDEFDVEQLG
FT                   CRYTEEPHEADILLITGPLTVRARNEALRLYAEAPETKVTVAVGVCPVSGGVFRDSYAV
FT                   DGPVQRYLPVDLNVPGCPPRPQALLAGIAQARDLWRARSKGVDAVFAAPPLAKPADEPA
FT                   QQFPIRGRMSFDPKACVDCRMCRHVCAAGAIHFDIKGDKGDRHLRSQSPSGNKEDRHLR
FT                   SLSPGSPEGVRLTLWHNSCVFCGLCSHYCPTGALSVTGDWHLAHRGGQTFRFSEQGEVP
FT                   YTPCSGCGSPLIAVAPELLHAAFRRPTPEIEHLKTLCPACRQQLSIGAVRR"
FT   misc_feature    complement(83298..83330)
FT                   /note="conserved palindrome; Gbem_R1101"
FT   gene            83690..84217
FT                   /gene="cooU"
FT                   /locus_tag="Gbem_0068"
FT   CDS_pept        83690..84217
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cooU"
FT                   /locus_tag="Gbem_0068"
FT                   /product="carbon monoxide-induced hydrogenase, CooU
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37099"
FT                   /db_xref="GOA:B5E8B6"
FT                   /db_xref="InterPro:IPR001268"
FT                   /db_xref="InterPro:IPR037232"
FT                   /db_xref="UniProtKB/TrEMBL:B5E8B6"
FT                   /protein_id="ACH37099.1"
FT                   /translation="MTTLIDEVAALLAAAAGEETVATWRRDRKGGLTGWCRLPSADSLL
FT                   AVGRAIASIQGRLSMVTAYLTEKAREKGGREIAYHFDLDGATLTLTVPLPLEGAQVPSL
FT                   TPIFRNCDWHERELMELYEIQVVGHPDPRRLFLADSVPDAPFERLIPYSTFTNGAGGKA
FT                   LWEKVLAAKEKP"
FT   gene            84214..85293
FT                   /gene="cooH"
FT                   /locus_tag="Gbem_0069"
FT   CDS_pept        84214..85293
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cooH"
FT                   /locus_tag="Gbem_0069"
FT                   /product="carbon monoxide-induced hydrogenase, large
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37100"
FT                   /db_xref="GOA:B5E8B7"
FT                   /db_xref="InterPro:IPR001135"
FT                   /db_xref="InterPro:IPR001501"
FT                   /db_xref="InterPro:IPR029014"
FT                   /db_xref="InterPro:IPR038290"
FT                   /db_xref="UniProtKB/TrEMBL:B5E8B7"
FT                   /protein_id="ACH37100.1"
FT                   /translation="MSSVIELGPHQLALEEPMYFRVKLEGDRVAGLDVQPGQVHRGMEH
FT                   LVMRRNLYQNITLLERLCSLCSNSHPSTFCSAIEEVAGVAIPERAEYLRAVADEIKRIA
FT                   SHLFCCAVQANLIGQTALFRRAMEVREIMQRSKEAIYGNRMDLAANCIGGVRYDLTPDA
FT                   AMYLARQMEAMKAPLDELYLQFQNNPAIMARTAGVGVLPRLEAIECAVVGPVARACGID
FT                   YDVRKKSPYGAYDRLEFSTSLQQAGDVRARNLVRLAEARQSVSLIEQCLAGLVPGPLCA
FT                   DLLPEIPAGEAVAKSEAPRGELVYYLRTDGTDFPLRLKWRVPSYMNWDALKVMLHGEPV
FT                   ANIPLIVNSIDPCIACTDR"
FT   gene            85302..85676
FT                   /gene="hypA-2"
FT                   /locus_tag="Gbem_0070"
FT   CDS_pept        85302..85676
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hypA-2"
FT                   /locus_tag="Gbem_0070"
FT                   /product="hydrogenase nickel insertion protein HypA"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37101"
FT                   /db_xref="GOA:B5E8B8"
FT                   /db_xref="InterPro:IPR000688"
FT                   /db_xref="InterPro:IPR020538"
FT                   /db_xref="UniProtKB/TrEMBL:B5E8B8"
FT                   /protein_id="ACH37101.1"
FT                   /translation="MHEITLVTGLFEIINREVAARGIESISKVRLMVGELAAVEPMTLA
FT                   ACFEVVAEGTVASGAQLEIETVHLTGRCRGCASGFRIVGFRFQCPDCGGGDVELSGGRE
FT                   LYLESLEAICKGDHNEATAA"
FT   gene            85657..86226
FT                   /gene="cooF"
FT                   /locus_tag="Gbem_0071"
FT   CDS_pept        85657..86226
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cooF"
FT                   /locus_tag="Gbem_0071"
FT                   /product="carbon monoxide dehydrogenase-associated
FT                   iron-sulfur cluster-binding oxidoreductase CooF"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37102"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:B5E8B9"
FT                   /protein_id="ACH37102.1"
FT                   /translation="MKQQQRENAIVFADPERCLGCHGCELACALAHSGTGLHQAALQGL
FT                   TLRPRNRVVAAGDVMMPVQCRQCEDAPCACACPTGAMLQEKGAVGVREKNCVGCKVCVM
FT                   VCPFGAISVKHEGSEEATGRTNGGVARKCDLCAGTGREIPACVEGCPTKALTLVDLEEY
FT                   RQSLIEARAAELAQSLQFLKKRKAKL"
FT   gene            86223..88130
FT                   /gene="cooS-2"
FT                   /locus_tag="Gbem_0072"
FT   CDS_pept        86223..88130
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cooS-2"
FT                   /locus_tag="Gbem_0072"
FT                   /product="carbon monoxide dehydrogenase, catalytic subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37103"
FT                   /db_xref="GOA:B5E8C0"
FT                   /db_xref="InterPro:IPR004137"
FT                   /db_xref="InterPro:IPR010047"
FT                   /db_xref="InterPro:IPR011254"
FT                   /db_xref="InterPro:IPR016099"
FT                   /db_xref="InterPro:IPR016101"
FT                   /db_xref="UniProtKB/TrEMBL:B5E8C0"
FT                   /protein_id="ACH37103.1"
FT                   /translation="MTLNLTTDPSAATLLPIAKKEGISTVWDRHRAMQPQCGFGQLGVC
FT                   CRICWKGPCRIDPFGDGPQRGICGADADTIVARNLIRMIAAGAAGHSEHGRHVALALQG
FT                   VSQGKLPAYQIRDEAKLLRVAAKLKICTEGQEIQAVAAAVAKATLEDFQSQDHDAPCNW
FT                   IEATLTKERLERLQALHVVPHNIDAVITQIMGRTLVGCDADPVNLILGGIKGALADFNG
FT                   MCLATEISDALFGAPAPVVTAANLGVIKPDAVNIAVHGHNPLLSEVVCEVAQQMDEEAR
FT                   KAGAKEGINIVGICCTGNEVMVRHGIPLAANYLSQELALVTGAVDAMVVDVQCIMPSVA
FT                   EIGACFHTAVITTMEENKIKGASHVSFKEETALENARQIVETAIEAYKRRDPRRVNIPD
FT                   FKQTAIVGFGLESVVAALATLNAEDPLQPLIDNIANGNIRGIALFAGCNSTQVAQDSSF
FT                   VTMAKKLAKNNVLLLATGCGAGSFAKHGLMTQEATVEYAGDSLKAVLTAIGTSAGLNGP
FT                   LPLVLHMGSCVDNSRAVEVAVAVANRLGVDLDKLPLVASAPEAMSEKAVAIGTWSVALG
FT                   IPTHLGTMPQVTGSAQVTELLTQTAKDLLGGYFLVELDPELAAEKLLEVIDERRKGLGI
FT                   "
FT   gene            88292..89068
FT                   /gene="cooC"
FT                   /locus_tag="Gbem_0074"
FT   CDS_pept        88292..89068
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cooC"
FT                   /locus_tag="Gbem_0074"
FT                   /product="carbon monoxide dehydrogenase accessory protein
FT                   CooC"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37105"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR014433"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B5E8C2"
FT                   /protein_id="ACH37105.1"
FT                   /translation="MRIAVTGKGGVGKTTFASLLARAFADDGARVLAVDADPDANLAQA
FT                   LGISSEAARALQPVARMKELAEERTGASGGYGSFFKLNPKVSDLPERFCLTHDGVRFLW
FT                   MGTFEQGGSGCACPESTLVKRLMGHLLLERDEVVIMDMEAGLEHLGRRTAESVDALVVV
FT                   VEPGQRSIQTAEQIMKLAADLGIEEVYVVGSKVRDEEDRLLISGAIPARQLLGTVSFCD
FT                   GIRRADRENQAPARLSAGALEEVGAIKERLLALHAA"
FT   gene            89459..90142
FT                   /locus_tag="Gbem_0075"
FT   CDS_pept        89459..90142
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0075"
FT                   /product="response regulator, PilZ domain-containing"
FT                   /note="domains: REC, PilZ"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37106"
FT                   /db_xref="GOA:B5E8C3"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR009875"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:B5E8C3"
FT                   /protein_id="ACH37106.1"
FT                   /translation="MNPTILLVDDLQMFLEIEKDFFKYAQVNLLTARDGIEALEVVKNR
FT                   KPDLIFMDLQMPRMDGAQCCRAIRSDPELASTPVVLISSSSDAKDKEMSLAAGCNYFLS
FT                   KPAGRDRFLEIAREFIPGINRRDHRIPCDVGAVLNVGGQAIACSLHDLGSEGAFVVTDF
FT                   PGQPGNIVSLTFTLPDGSVIDSPCKIVWTSESMVFRPKGLGVKFALMPKEVKSALARYL
FT                   EGKSR"
FT   misc_feature    90240..90266
FT                   /note="nonanucleotide repeats; Gbem_R9001"
FT   misc_feature    90297..90341
FT                   /note="nonanucleotide repeats; Gbem_R9002"
FT   gene            90435..92633
FT                   /gene="pcrA"
FT                   /locus_tag="Gbem_0076"
FT   CDS_pept        90435..92633
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pcrA"
FT                   /locus_tag="Gbem_0076"
FT                   /product="ATP-dependent DNA helicase PcrA"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37107"
FT                   /db_xref="GOA:B5E8C4"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR013986"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="UniProtKB/TrEMBL:B5E8C4"
FT                   /protein_id="ACH37107.1"
FT                   /translation="MKLLHNLNPPQKEAVLHGEGPLLVLAGAGSGKTRVIVHRIAYLIH
FT                   ERGVPAWQILGVTFTNKAAGEMRERLAHMLGDGELPLISTFHSTCARILRSEIRHLGYD
FT                   SNFAIYDDRDCEKLLKDCAAELNLDEKRYPAKALAGALDEFKNQGLAPDDVPTDSPYQA
FT                   TLARVYRCYQERLKRCNAVDFGDLLLLAVQLLEQVKEVRDKYLQRYRWIMVDEYQDTNP
FT                   VQYRLVQLLAGERKNLCVVGDDDQSIYGWRGADIRNILEFEKDFPGVKVVKLEQNYRST
FT                   KTILDGAWNVVQKNRGRKPKRLWTDNPDGERIVYRTLPNEWEEARTVCRETERFLDEGG
FT                   DLSEVAVFYRTNAQSRAVEDAMVSAGVAYHMVGGVRFYARLEVKDILAYLKVLDNPSDD
FT                   VALKRIINTPPRGIGNTTVQRLSEFAAEKGIPLYDAMLEGAFGPLLSVAAKGKVAAFAQ
FT                   EIDGYKEKAEQMPLSELTSTIIYESGYFARLKALGSDEAQERIENLQELVTAMQAYESG
FT                   PGEKGLADFLEQVALVSDLEQEGDGKKSSATLMTLHSAKGLEFPLVFIIGMEERLFPHV
FT                   RALEDPAQMEEERRLCYVGMTRAKKRLFLLNVRRRHIFGQEQMNPPARFIADIPRELLD
FT                   SGENWQEPARHREFPSHNLASLFEEEMEPEEDDNEVRMVPEHDEGIYLGMKVRHAQFGP
FT                   GTIRKIEGEGDNQKVIVWFNSLGGPKKLLVRFAGLERA"
FT   gene            92690..93427
FT                   /locus_tag="Gbem_0077"
FT   CDS_pept        92690..93427
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0077"
FT                   /product="lipoprotein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37108"
FT                   /db_xref="UniProtKB/TrEMBL:B5E8C5"
FT                   /protein_id="ACH37108.1"
FT                   /translation="MKKLCVLMISMLLFSACTSYKSQYVSFRPPEAYTNYREVNGVSMG
FT                   GEAYPDADSAEKAFGFDIKGAGLLPVMLVFDNKSANNLELISGQTFLVDDGGNYWPVVP
FT                   NNTAFDRLESSTQFASFFGKGAGKGAILGAAAGGILATAIGIASGKSVGEAVGKGVALG
FT                   AAGGALIGGTQEGTSGEREHRISDDLRSKGLEGKPIPAGALANGFLFFPGEANSAKELR
FT                   LQVRERESGQVHKVSLPLNTAKK"
FT   misc_feature    93508..93542
FT                   /note="conserved nucleotide sequence; Gbem_R4004"
FT   gene            93585..94586
FT                   /gene="pdxA"
FT                   /locus_tag="Gbem_0078"
FT   CDS_pept        93585..94586
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pdxA"
FT                   /locus_tag="Gbem_0078"
FT                   /product="4-hydroxythreonine-4-phosphate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37109"
FT                   /db_xref="GOA:B5E8C6"
FT                   /db_xref="InterPro:IPR005255"
FT                   /db_xref="InterPro:IPR037510"
FT                   /db_xref="UniProtKB/TrEMBL:B5E8C6"
FT                   /protein_id="ACH37109.1"
FT                   /translation="MDKPVIAVTMGDPCGIGPEIIAAALADPAITALCRPLVLGDRGAM
FT                   ERGIAVAGVKLAIASAPDLLPPLDASPHTLYLRELSRLKLDEIPYGAPTKAGGDACYRY
FT                   ICEAAKLCLDGTVQAMATAPINKESMNSAGHDYPGHTELLAELTGTPEVVMMLAGERLR
FT                   VTLVTIHEPLARVPELVTFDRVLSTIRITHDALSRWFCCAPRLAVLALNPHCGEGGMFG
FT                   DEESRIIAPAVAAAREAGIDAAGPVSADTLFHFAAKGGYDAVVCMYHDQGLIPLKLLHF
FT                   DDGVNVTLGLPIIRTSVDHGTAYNLAGTGKASAESMKAALVMAARMAQQGCQ"
FT   gene            94612..95571
FT                   /locus_tag="Gbem_0079"
FT   CDS_pept        94612..95571
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0079"
FT                   /product="biosynthetic peptidoglycan transglycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37110"
FT                   /db_xref="GOA:B5E8C7"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR011812"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/TrEMBL:B5E8C7"
FT                   /protein_id="ACH37110.1"
FT                   /translation="MKKYLTWGGIVLAVYLIYVVISLAMTPPVTELKDKKFNMTIQVKD
FT                   WQGNYHPLVVGPKNRYWTPLSQIPSEMKWAVILAEDASFYKHEGIDVKAIKEAIKYDLE
FT                   KQSFARGASTITQQVAKNLFLSREKTLTRKAKELYLAKRMEQELTKGRIIELYLNVIEL
FT                   GPLVHGIGHGARYYFGKSPANLTPRECAFLAAMLPGPRVAYNPYKNLGKVLKRSNMILG
FT                   LLAKKGVLSEAEYRTALAQSPNVGRMQRKVDMSIKQVEVMANHTSATLPEQPLSQEEMN
FT                   AQEPKAGAPEGAAPQPAPEPAQEPASPASPPAAQEEKQ"
FT   misc_feature    95602..95712
FT                   /note="conserved palindrome; Gbem_R2002"
FT   misc_feature    95740..95770
FT                   /note="conserved palindrome; Gbem_R0088"
FT   gene            95859..96932
FT                   /locus_tag="Gbem_0080"
FT   CDS_pept        95859..96932
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0080"
FT                   /product="response receiver-modulated cyclic diguanylate
FT                   phosphodiesterase"
FT                   /note="domains: REC, HD-GYP"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37111"
FT                   /db_xref="GOA:B5E8C8"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR037522"
FT                   /db_xref="UniProtKB/TrEMBL:B5E8C8"
FT                   /protein_id="ACH37111.1"
FT                   /translation="MENLKSGRVVLVDDDPYVLESVALLLSVSGFEVTSFSNGHEALQL
FT                   LRRSPPDVVLTDVNMPQMSGIELLEQIHDFDRDIPVILMTAYAELEMAVSAIKKGAFDF
FT                   IIKPFKTPYLIYAVEKGINYQRLVLMEKNYKAELEQKVQDRTRELGAALVQMRNMSRET
FT                   IERLTAAAELRDEDTGRHISRIGLYAKRLAEQLQMPADFAEGIGMAAPMHDVGKIGIPD
FT                   AILLKAGPLNGEEFGVMKSHTEIGGRILAGSTHMVLQMAASIALTHHERWDGSGYPHGL
FT                   AGEKIPVEGRIVMLVDQYDALRSKRVYKPTFEHGKTVRIITEGDGRTMPEHFDPEILRA
FT                   FVTAAHDFEAIYENHSD"
FT   gene            96951..99365
FT                   /locus_tag="Gbem_0081"
FT   CDS_pept        96951..99365
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0081"
FT                   /product="sensor diguanylate cyclase, Cache_1, HAMP, PAS
FT                   and PAS domain-containing"
FT                   /note="domains: Cache_1, HAMP, PAS, PAS, GGDEF"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37112"
FT                   /db_xref="GOA:B5E8C9"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR033479"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:B5E8C9"
FT                   /protein_id="ACH37112.1"
FT                   /translation="MSRCSLKIKMSLVVFLLIGTVSSCVAGLGLLFFMREFKETVAARQ
FT                   FAVVSAMAGELDEKILAAQRELVAVAMSIPPATGRDAAAMQSFLDQRLDLHQVFSDGTA
FT                   FFSADGRLVAFSPGQTPDIGDNFSKLDFLAATLRSGKALISEPFPSQRRRGHQVVMFTV
FT                   PVLGGGGRMIGVLGGRVDLMEENFLSRVAHLNLQDGGEFFLFNRQRQIVAHRNHDKIGK
FT                   PMPAKGMRELLDRAIDGYQGSGEMDNPAGSPSIYSFKRLPARGWILAAERPLSEAYAPI
FT                   YRAQKLAIFSLALLLPLALITVWLFVGRLTAPLQLFAGRVREIGGDAGKYLPVLVNNND
FT                   EIGDLAQAFNAMMQELVINKRSLESEKGFAVQLLQHSAVPCFVIDAEHRVIIWNSAMEE
FT                   LTGVAAGAQLGQIEPWRAFYDEPRRVLADIVVAGTLYEMADLYCCYADSPLIPEGLRAE
FT                   GWYRLKGKQRYLAFEAAPIRDAEGRLIAAIQTMQDMTLRANNEEQLRGMVAAIGESEER
FT                   FRRLVELSLDGIAILVGRRFVFVNPAGCEMLGYRSSDELLGKEMREFIQRDSEQQFLEQ
FT                   ATCAEETGTTAPWIEERLLRHDRTAVEVELGVGPFVFRGENALQVIFRDITERKLAKAR
FT                   LETLAHYDSLTSLPNRVLFFDRLRHAVFEAKRYQHPMALMFLDLDSFKQVNDRLGHAAG
FT                   DAVLVEAGYRLRECVRACDMVARMGGDEFTIILTKMADRRDASLVAERVLEAFALPFLV
FT                   EGESAQVGVSIGICVYPDCDADLDGMVRYADYAMYQAKQDGKNVYRFHLGG"
FT   gene            complement(99397..100401)
FT                   /locus_tag="Gbem_0082"
FT   CDS_pept        complement(99397..100401)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0082"
FT                   /product="thiamin biosynthesis protein ThiI-related adenine
FT                   nucleotide alpha hydrolase superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37113"
FT                   /db_xref="GOA:B5E8D0"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020536"
FT                   /db_xref="UniProtKB/TrEMBL:B5E8D0"
FT                   /protein_id="ACH37113.1"
FT                   /translation="MQRKAIALLSGGLDSTLAVKVLLDQGIAVEALNFTSPFCTCTGKN
FT                   AGCKSEAVRVAEEFKIPIKVMHKGADYLEVVRNPKHGHGKGMNPCIDCRIFLLKKAKEY
FT                   MLESGADFVFTGEVLGQRPMSQRRDTLRIIEKESGLEGLLLRPLSAKHFQPTIPEQEGW
FT                   VDREKLLSIQGRSRKEQFELAAELDVKNYPCPAGGCLLTEPSFVGKIRDVFDHSDELNM
FT                   RDFRLLKLGRHFRIGPRTKVVLGRNEGENELLERAVQPGEATLRWVEGMSPLAAVMGET
FT                   TDHLLEKAGQILLRYTKAEPGCAATLSILRDGSETELKTVNALDEAAVEALRR"
FT   misc_feature    100418..100448
FT                   /note="heptanucleotide repeats; Gbem_R7004"
FT   misc_feature    100497..100527
FT                   /note="heptanucleotide repeats; Gbem_R7005"
FT   misc_feature    100574..100604
FT                   /note="heptanucleotide repeats; Gbem_R7006"
FT   misc_feature    complement(100720..100750)
FT                   /note="heptanucleotide repeats; Gbem_R7007"
FT   misc_feature    complement(100898..100921)
FT                   /note="heptanucleotide repeats; Gbem_R7008"
FT   misc_feature    complement(100938..100954)
FT                   /note="heptanucleotide repeats; Gbem_R7009"
FT   gene            101019..102677
FT                   /locus_tag="Gbem_0083"
FT   CDS_pept        101019..102677
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0083"
FT                   /product="PilB/PulE/GspE family ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37114"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR007831"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037257"
FT                   /db_xref="InterPro:IPR042181"
FT                   /db_xref="UniProtKB/TrEMBL:B5E8D1"
FT                   /protein_id="ACH37114.1"
FT                   /translation="MNGLVKEGSIGEILFKSQIITEQELSAALEEQKVSGCRVGEALVR
FT                   LGVVAQEDIDWALANQLNIPYVRLKKENIDPAAVAKVPGQLARRYSLCPIFLSGSELSI
FT                   AMADPLNKEAVEEITRVTGCQISISVGLIREIREMHDAMYGPDQNLPELGFSSGHFPAK
FT                   VLSAINADLSGAMLLNHLLLRVVQKKFASVALQPLGDQVRVLARGEGRTSELGKLSATH
FT                   YGRLTERIRRLSGIGGAEENPSSGILTFIWQGKRIPFQTLVMPGNGGDYLTLKLHVGAP
FT                   KISELDDLGVSAGKRADLKALCSEKEGLVLFTGRDPEERSRLIDLFLDACDHADRTVIL
FT                   VGERLGRGRDRWPRLPAGRCGADDTAKVVSAALEHDPDTLVIEDVTELASFIAASKAVM
FT                   RGKLVVAGMSQGNKGAVLKQLLYLSQKNFLIPTHLKGVVSLKCVLLLCPECKKQYTPAA
FT                   DELAALRLKATAPEYFRPTGCPSCDQTGYSGKKYLLDVIRFDQGLLEAFEVIRDSDEII
FT                   RHLKDNGYRGIGEEGAELLERGEISPGEYVASILL"
FT   gene            102690..103763
FT                   /gene="pilT-3"
FT                   /locus_tag="Gbem_0084"
FT   CDS_pept        102690..103763
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pilT-3"
FT                   /locus_tag="Gbem_0084"
FT                   /product="twitching motility pilus retraction ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37115"
FT                   /db_xref="GOA:B5E8D2"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR006321"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B5E8D2"
FT                   /protein_id="ACH37115.1"
FT                   /translation="MARIDALFKLLHEAGASDLHLSAGSPPIFRLRGEMERQNFKSLGH
FT                   EELKALLYEILTPKQRETFEEKHDLDFAYSVPGLARFRGNFMMQHRGIAAVFRIIPTKI
FT                   LSADELGLPEGIRNLTKLRKGLVLVTGPTGSGKSTTLAAMIDLINITRREHILTLEDPL
FT                   EFIHENKMSLFNQRQIGEHSESFASALRAALREDPDVILVGEMRDLETIALAMSAAETG
FT                   HLVFGTLHTSSAAKTVDRIIDVFPKDGQEQVRAILSESLRGVVCQQLLKTADGKGRAAA
FT                   QEIMVWNAAIGNLIREGKTFQIPSIMQTGRKDGMQLMDQHILDLLKTKKIAPEEAYRCC
FT                   TDKRQFEQYLPNKPAEQ"
FT   gene            103767..104936
FT                   /locus_tag="Gbem_0085"
FT   CDS_pept        103767..104936
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0085"
FT                   /product="amino acid aminotransferase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37116"
FT                   /db_xref="GOA:B5E8D3"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:B5E8D3"
FT                   /protein_id="ACH37116.1"
FT                   /translation="MRFPVSPLIAGVHPPPISEVKSWIAGAPAGLPLIDLCQAIPDYPP
FT                   PRELTDHLAEVMLDPHTSRYSIDEGLPEVREAICGGYRELYGACIDPSQLILTIGASQA
FT                   FWLAMVTLCRAGDEVIVQLPAYFDHPMALEVLGIRCVYAPFEEARGGLPSVAAIASLIT
FT                   EKTRAILLVTPSNPTGAVISPETVRELHRLAVSRDIALVLDETYNSFITGGVRPHDLFQ
FT                   EPNWGDHFVHIASFGKTFALTGYRAGMLAASEEFIRHALKAQDTMAVCQPRVAQHAVKY
FT                   GFERLSGWVAENRVMMERRHEVFRAEFEKPGNAFKLVASGPFFGWVRHPLPKATGREVA
FT                   RRLVEEAGILLLPGEVFGPGLEGYLRLAFGNIREETIPEAVARFREFNP"
FT   misc_feature    104983..105035
FT                   /note="conserved palindrome; Gbem_R1005"
FT   misc_feature    complement(105162..105214)
FT                   /note="conserved palindrome; Gbem_R1006"
FT   gene            complement(105215..106054)
FT                   /locus_tag="Gbem_0086"
FT   CDS_pept        complement(105215..106054)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0086"
FT                   /product="chloroperoxidase/bromoperoxidase, non-heme-type"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37117"
FT                   /db_xref="GOA:B5E8D4"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR000639"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B5E8D4"
FT                   /protein_id="ACH37117.1"
FT                   /translation="MNYITVGKENSCNIDLYYEDMGEGQPVVLIHGWPLSSRSWERQVP
FT                   ALLKAGFRVIAYDRRGFGQSSRPGSGYDYDTLADDLHALMTRLDLRKAVLVGFSMGGGE
FT                   VAHYLGRYGTERVQKAVFMAAVTPFLRKAADNAAGLDAGIFEEIKQAIRADRPSFLTSF
FT                   LSNFYNVHAFGGKKVSEELLRLSWSIAAAASPIGTLACVDSWLTDFRDDLVRIRIPTLV
FT                   MHGDDDRILPFAATGSRTHEAVEGSRLIVVAGAPHGLNWTHAEEVNDGLIDFMQEAI"
FT   gene            106490..106708
FT                   /locus_tag="Gbem_0087"
FT   CDS_pept        106490..106708
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0087"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37118"
FT                   /db_xref="UniProtKB/TrEMBL:B5E8D5"
FT                   /protein_id="ACH37118.1"
FT                   /translation="MKRIITMAAGFLVALSLAATAYAAPKGANARKSSPGIENSKKVMQ
FT                   YRMQREKKMEDVRKKAQLKKQQAKAGK"
FT   gene            106762..110661
FT                   /gene="ompB-1"
FT                   /locus_tag="Gbem_0088"
FT   CDS_pept        106762..110661
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ompB-1"
FT                   /locus_tag="Gbem_0088"
FT                   /product="laccase family multicopper oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37119"
FT                   /db_xref="GOA:B5E8D6"
FT                   /db_xref="InterPro:IPR003961"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR011706"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR036116"
FT                   /db_xref="UniProtKB/TrEMBL:B5E8D6"
FT                   /protein_id="ACH37119.1"
FT                   /translation="MNRLTKTLMAGLAMLVMTLGIYPQTAQAIDETKVPHYYGPYPNWA
FT                   LSPLPFKNLSTGVVTGGIKKFVNRLPGLGEANANDLGNFLPVAVPDTTTYADADYYEIG
FT                   LVQYRQQMHSDLPPTLLRGYVQLSTAVVPGGQVPLTNATVDGSPDVPIIGYTGVTKPSY
FT                   LGPVIVAKKDRPVRIVFRNLLPNGAGGDLFLPVDSTMMGSGMGPMGMTAPVDGKSVTDM
FT                   VRNPLCTDNPKSDMCFKDNRATLHLHGGVTPWISDGTPHQWITPKDEMTAWPKGVSVKN
FT                   VPDMPDPGPGAMTFFYTNQQSARLMFYHDHAWGITRLNVYAGQAAGYIIEDSTEQALLD
FT                   KGVIPGATDTIPLIIQDRTFVPPGDKTTRTGQLYESDPTWDANRWGGFGNLWYHHVYMP
FT                   AQNPSDPSGMSAFGRWMYGPWFWPPATPKYPPIPNPRYNMDPATAFTTPLAKPCLLSDP
FT                   TSWQYQTDPFCEPELIPGTPNISVGMEQFNDTPVVNGTVYPYTTVDPKAYRLRILNAAN
FT                   DRFLNLQLYVADTTGTEVALKAAELAAAQLDPNVFPTPDTALSPKGPDWIQIGSEGGFL
FT                   PAPAVIPPQPITWIIDPTRFDFGNVDQHSLALAPAERADVIVDFSKYAGQTLILYNDAP
FT                   AAYPARVASYDYYTGAPDLSPNGAPGVLPGYGPNTRTVMQIKVNPLVDPTVPAPTFNLA
FT                   ALQQAFTHQLDGTPSAFETGQHPIIVGQAAYNSAYGTKFAASSWCNAPGSTNQLCDGFA
FT                   RISDQGGDLFGFNTLLNQGGKLQIPLQPKALHDEMNAVAFDEFGRMTANIGVEAVPAAP
FT                   GAQNVVLYPYVNPPTELIDGTNLPKGDLNITPITTADGTQIWKITHNGVDTHPIHFHLY
FT                   DVQVLNRVTWDNIIIPPDANELGWKDTVRVSPLEDTIVALRPIVPSLPFEIPNSVRLLN
FT                   PMMPAGDTSMFEPTDVSGNPTNAIINQLVNFGWEYVYHCHILSHEEMDMMRPVSLALPP
FT                   KAADGLTFAINGNGNKAKLTLNWNDNSITETAFVVQKTTDGTTWTNVGTIATPLDAVNS
FT                   TGPKSLVDPAAYNPNVVAKYQVVAQNTVGYGGQMPSLTVTSVSAPLLTGTVPAAPTALT
FT                   ATLQAGPQVTLSFTDNALTEIGFVVERSDNGGAFVQIAKLAARANTGAVTYVDKTVAAA
FT                   ATDTTYVYRVAAINAAGLSGYAVTAPLLLPALPAAPAGLTAVNGPNGTGNNRTVILNWQ
FT                   DLSSNETGFSVQRATNATFTTGVSNTTVGAGVTTLTQAGLARNTNYYYRVRANNGSIVS
FT                   SAWVAATPSPILTNP"
FT   gene            complement(110803..111777)
FT                   /locus_tag="Gbem_0089"
FT   CDS_pept        complement(110803..111777)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0089"
FT                   /product="rhodanese homology domain pair protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37120"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:B5E8D7"
FT                   /protein_id="ACH37120.1"
FT                   /translation="MAGKHLVRLLSVLALIISLAGTSWAKQQQGYKGYARGSALITAKE
FT                   LKQLIDAKDKKLVIIAAENDVEYRLGHIPGSFQVDRPAYEAPAATQNGVTGNLIDAAGF
FT                   TKLAQELGINKDSKVVVYDTKYDATRLWWAFLYYGKGDVRVLDGGIKAWKDAGYDTAIL
FT                   APDAARAGAFVAKVALPRSRVETPEILALKDPAKGQLWDNRDRKEYCGEELKKGAYRKG
FT                   RIPWGKHSDWAIFKKKENAGEWLTAAEAQAILKKLGVDGKKDQYFFCQSGVRSTQAMFT
FT                   FYLLGYPLNKLHNYDSSWIGWSKDASLPIETGCDLNPAVATAR"
FT   gene            complement(112025..113854)
FT                   /gene="glmS"
FT                   /locus_tag="Gbem_0090"
FT   CDS_pept        complement(112025..113854)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glmS"
FT                   /locus_tag="Gbem_0090"
FT                   /product="glutamine--fructose-6-phosphate aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37121"
FT                   /db_xref="GOA:B5E8D8"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR005855"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR035466"
FT                   /db_xref="InterPro:IPR035490"
FT                   /db_xref="UniProtKB/TrEMBL:B5E8D8"
FT                   /protein_id="ACH37121.1"
FT                   /translation="MCGIVGFTGRQEATSIIIEGLRRLEYRGYDSAGICTISDGKASIR
FT                   RSEGKLSNLEKLLAASPVTGTVGIGHTRWATHGRPSEINAHPHQAGPIVVVHNGIIENY
FT                   LQLREELKGQGHVFKSETDTEVISHLIDQRLKSCDSFEQAVREALAVLKGAYAICIVSE
FT                   NDPDEMIAAKLGSPMVVGIGDGEFYVASDIPAILSHTRSMIFMEDGEMVVFKGGSATFS
FT                   NVAGGVLNKVPRHIDWSAHMAEKGGYKHFMLKEIFEQPRAVRDTIAGRLREEQGDVYLE
FT                   DLSLNDAALKGINRICIIACGTSWHAALVGKFLIEEHCRVPVEVDIASEFRYRNPVVDE
FT                   NTLVMLISQSGETADTLAAMRESKRRGGKCVAICNVVDSSIAREADGVIYTHAGPEIGV
FT                   ASTKAFVTQLIALYLFTIRLGRSREVMSLEEGRDLIAAVVRVPALMEEALKLNEQVEKV
FT                   ARNYLQARDFLYLGRGMNYPIALEGALKLKEISYIHAEGYAAGEMKHGPIALIDEHMPV
FT                   VVLVPKGPNYDKVFSNMEEVIARGGRVIAVCSEGDQEVKDKVEVALEIPEDGCNVSPLI
FT                   LSIPMQLLAYHVAVLKGTDVDQPRNLAKSVTVE"
FT   gene            complement(113940..115316)
FT                   /gene="glmU"
FT                   /locus_tag="Gbem_0091"
FT   CDS_pept        complement(113940..115316)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glmU"
FT                   /locus_tag="Gbem_0091"
FT                   /product="glucosamine-1-phosphate N-acetyltransferase and
FT                   N-acetylglucosamine-1-phosphate uridylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37122"
FT                   /db_xref="GOA:B5E8D9"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005882"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR025877"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR038009"
FT                   /db_xref="UniProtKB/TrEMBL:B5E8D9"
FT                   /protein_id="ACH37122.1"
FT                   /translation="MGNKISAIVLAAGMGTRMKSDLVKVMHLVAGVPMIQWPVAAAFAS
FT                   GVERCVLVVGHQQEKVRELFAGRGEVSFALQSEQLGTGHAVRCAMTELDPGADTVLILC
FT                   GDTPLLEAQSLAGMLKAHRETKACITVMTATLGNPFGYGRIVKDATGKVSAITEEKDAT
FT                   EKERLIDEVNAGVYCIDRAFLEKAIATIKNDNAQGEYYLTDVVRQAAQHGLSCLSYKVA
FT                   DPREISGVNDRAQMAEAARVLRGRINRELMLSGVTMIDPETVYIDRGVRIGRDSVVYPG
FT                   ATIEGNTVIGERCVIGQGSLIQNCSIADDVVVKAGSVLEDSKVGPEAAIGPMAHLRAGT
FT                   ELSAHVKIGNFVETKKTFMGEGSKASHLTYLGDATIGRDVNIGCGTITCNYDGVKKHKT
FT                   VIEDGVFVGSDVQLVAPVTVGRNSLIAAGTTVTKDIPADSLAIARSPQVNKEGYMLRKK
FT                   "
FT   gene            115466..116026
FT                   /locus_tag="Gbem_0092"
FT   CDS_pept        115466..116026
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0092"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37123"
FT                   /db_xref="UniProtKB/TrEMBL:B5E8E0"
FT                   /protein_id="ACH37123.1"
FT                   /translation="MGIQDDIARLEVDLRELIIKYEQYFFGIEKREPLRLLDTVERAVR
FT                   RYQNVSIPNTSQRFKYESLVSTLSVHKQKWTRTNRLIEEGKFQRDRFRMSLHQKDTPKE
FT                   PTVAAPTTKSTNDSQLENVYQQYIDARRACNLPVENVTREKVAEAISRQKPALMEKYRC
FT                   KDVDFVVVIEGGKPSLKARPKNS"
FT   gene            116023..117874
FT                   /locus_tag="Gbem_0093"
FT   CDS_pept        join(116023..117349,117351..117874)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0093"
FT                   /product="radical SAM domain iron-sulfur cluster-binding
FT                   oxidoreductase with cobalamin-binding-like domain"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37124"
FT                   /db_xref="GOA:B5E8E1"
FT                   /db_xref="InterPro:IPR006158"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR034466"
FT                   /db_xref="UniProtKB/TrEMBL:B5E8E1"
FT                   /protein_id="ACH37124.2"
FT                   /translation="MNITLIAIHPERSPQAVPLACAFLKEALLADASLRGKVEAEVLEF
FT                   FQGDDPARCAESIAQAKPQLVAFSVYVWSRESAIETARELRSRVPGVVICAGGAEPTAN
FT                   PAGLLETGLFDFLVRGEGEGSFLQAVKLLAQGAMPQGVPGVVLPGEAPGALPAPLDLEQ
FT                   IPSPYLSGQLDPTVPGGALWQLSRGCDFACAFCYDHKGNGGVRRFALKRIEAELRLFAR
FT                   LQVPQVFVLDSTFNKVPQRAKEILRLIRKLAPGVHFHFEVRSEFIDAEMAELFASITCS
FT                   LQIGLQSADPAVLRGVGRGFDRDDFVMRASLLNRTGAIFGFDLIYGLPGDSLKLFRSSL
FT                   DFALSLYPNHLDIFPLAVLPGTRLNGKADALGLEHLKVPPYTVLSTPTFSAKELKEASA
FT                   LAAACDVFYSRGKAVAWFNAVACSLKLSPSAFLAGFAHLLGERGEKGEKEIAEGEIWGL
FT                   QRQFLTALFQQKKKARLLPLALDLADYHHYYAEALLAAPVTPARKPRNSELLQTPLVLS
FT                   AAATLASFNYEILDILEAGEFDLGEFAGCFEAAGSCAIIYPAQGEVATESISPEYFELL
FT                   RSLDGKRGAGDICKKLGLPLPDALPFLEFLVTEGVASFSR"
FT                   /artificial_location="low-quality sequence region"
FT   gene            118311..120161
FT                   /gene="cbcY"
FT                   /locus_tag="Gbem_0095"
FT   CDS_pept        118311..120161
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cbcY"
FT                   /locus_tag="Gbem_0095"
FT                   /product="cytochrome c, and cytochrome b"
FT                   /note="9 heme-binding sites"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37126"
FT                   /db_xref="GOA:B5E8E3"
FT                   /db_xref="InterPro:IPR011031"
FT                   /db_xref="InterPro:IPR012286"
FT                   /db_xref="InterPro:IPR036280"
FT                   /db_xref="UniProtKB/TrEMBL:B5E8E3"
FT                   /protein_id="ACH37126.1"
FT                   /translation="MVHVFTRLIPLLLLLLLSQPAFAAQGLAIDPATCLGCHGDKISAE
FT                   KMAVSVHGKNGCTSCHVEIVELAKHMKGEIKVGKVKCVRCHKKEAAEHALSVHAEKGVQ
FT                   CAGCHTDMHSHTSWNKDKRRVLAKCVQCHSDEKGFLTSVHGKGVIAGNQDSAACNDCHN
FT                   LHEIKALGNPNSHTNREFHTKVCLRCHADAKLVERNHISEVAVKSYMESYHGKNYRLGY
FT                   PEKVAGCADCHTAHGILPSKDPNSSVNPNNLVKTCSKCHDKAKTPFTKFYAHGEHNDRE
FT                   KYPILFYTFIAMTGLLVGTFAVFWVHTLLWMIRGFVENREKAAALEEGVILHHVPEGHK
FT                   QYRRFKRVHVFMHLLVIISFLGLSLTGLPLKFSDQVWAKFLMDLYGGAPNAAAFHRVCA
FT                   GITFVYFSMALAMSIHFLFIRKDIKGNPLQRLFGPDSLCPNLRDISDVVGMVRWFFFKG
FT                   PKPAFERWTYWEKFDFIAVFWGMFAIGGSGLMLWFPEFFGMFLPGWAFNVATIIHSDEA
FT                   LLATGFIFSVHFFNTHGRPEKFPMDFVIFNGQMSKHEFVEERGDQWARYEKEGITEKFA
FT                   AKKSSGIFYDFCLKAFGFTALFIGITLLMLMVYAFMHPHH"
FT   gene            complement(120264..121301)
FT                   /gene="guaC"
FT                   /locus_tag="Gbem_0096"
FT   CDS_pept        complement(120264..121301)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="guaC"
FT                   /locus_tag="Gbem_0096"
FT                   /product="guanosine-5'-monophosphate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37127"
FT                   /db_xref="GOA:B5E8E4"
FT                   /db_xref="InterPro:IPR001093"
FT                   /db_xref="InterPro:IPR005993"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR015875"
FT                   /db_xref="UniProtKB/TrEMBL:B5E8E4"
FT                   /protein_id="ACH37127.1"
FT                   /translation="MFLESDIKLGFSDVLIRPKRSNLKSRSQVDLQRHFKFLHSRHEWT
FT                   GVPVIAANMDTTGTFEVADRLASHEMLTAIHKHYSIAEWDAYLASRNDDIYPRIMVSTG
FT                   TSEADFEKVSAILGKHPKLEFICIDVANGYAESFVEFVAKMREAYAEKTIVAGNVVTGE
FT                   MVEELLLSGADIVKVGIGPGSVCTTRVKAGVGYPQLSAVIECADAAHGLGGRIISDGGC
FT                   TCPGDVAKAFGGGADFVMLGGMFAGHDECGGQLLERGGRQFKLFYGMSSTTAMDKHAGG
FT                   VASYRASEGKTVEVPYRGPIDETVRDVLGGVRSACTYVGASALKELTKRTTFIRVQEQE
FT                   NRIFG"
FT   gene            121535..122782
FT                   /locus_tag="Gbem_0097"
FT   CDS_pept        121535..122782
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0097"
FT                   /product="membrane protein, major facilitator superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37128"
FT                   /db_xref="GOA:B5E8E5"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B5E8E5"
FT                   /protein_id="ACH37128.1"
FT                   /translation="MHEQERLRRQRWFIFFILALVYIMVYFYRVSLAVVAKDVSHDLDL
FT                   TPAQLGSLSSILFYVYAAAQIPLGPMIDRLGSRVVISCSGVLTALGGILFSQAANMGQA
FT                   MAGRVLIGIGTASVLMATFTIFSHWFTKQEFGKVSGMMVATGNLGNLAGTAPLALAVAA
FT                   VGWRNSFLSAGVLQAVVTVLVFGLVRDRPPVTERHEEEAPARLGMLEAWKKIVSNGDFW
FT                   LLAAVAFAWYGNYLAVQGLWGGPYLMEVARLSREETGRMLMYTSLGFITGSLMIDHVAR
FT                   RIFHSYKKTLLVGQLLLLLLMTNFLGLADKMPTVALSALFFGLGLCVSSGVMIYPIVRS
FT                   MFPVAIVGTALTSLNFFVLLGAASVQQGMGIVIGAVAKTTPEATAQAYHSAFQLPIGAL
FT                   AFAAAMFFFAKDYWEK"
FT   gene            complement(122824..123849)
FT                   /locus_tag="Gbem_0098"
FT   CDS_pept        complement(122824..123849)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0098"
FT                   /product="tRNA dihydrouridine synthase-like flavin
FT                   mononucleotide-binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37129"
FT                   /db_xref="GOA:B5E8E6"
FT                   /db_xref="InterPro:IPR001269"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR035587"
FT                   /db_xref="UniProtKB/TrEMBL:B5E8E6"
FT                   /protein_id="ACH37129.1"
FT                   /translation="MTMENPRHQALQPNSATPAPAPSKLPWLPGVKPLMLAPMQGLTNR
FT                   ALRSLFTKWVRPDVVWTEFMRVNPVSAKKRLMPGDLREISASEDGIPLVVQLIGHGREA
FT                   LVSAAQAAQDAGAVHLNLNMGCPYGRMTSGLTGGGMLKKPELLEEIIPALREAIHGSFS
FT                   IKLRAGYEDPQQVFSLLPLFERSGVDFLVLHPRTVRQAYNGWADHEVTAEVVRQTSIPV
FT                   IANGDIRSAAGGQRLLEQTGAAGLMLGRGGIGEPMLFERLRGRAAAEPDLAERKAMLHR
FT                   YLIDLLPLYCALFCGDAQVLGKIKGVVSNVEDAELERELKKLTRSKTLQAFRSALEELA
FT                   P"
FT   gene            complement(123930..124421)
FT                   /locus_tag="Gbem_0099"
FT   CDS_pept        complement(123930..124421)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0099"
FT                   /product="peptidylprolyl cis-trans isomerase, FKBP-type,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37130"
FT                   /db_xref="GOA:B5E8E7"
FT                   /db_xref="InterPro:IPR001179"
FT                   /db_xref="UniProtKB/TrEMBL:B5E8E7"
FT                   /protein_id="ACH37130.1"
FT                   /translation="MATAKQGDKVLINYTGKLEDGSVFDTTIQETGCCEDDNCGCDDDG
FT                   CGCGETGPLEITIGNEDFFPQIEEALVGMAPGEKKTVVIPAEDAFGEYDEDEVFTISRE
FT                   QLTGEIIPEVGMELELTGDDDEPVEVVVVEVSEETITVDANHPLAGEDITYEIELLEIK
FT                   "
FT   gene            124578..124793
FT                   /locus_tag="Gbem_0100"
FT   CDS_pept        124578..124793
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0100"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37131"
FT                   /db_xref="UniProtKB/TrEMBL:B5E8E8"
FT                   /protein_id="ACH37131.1"
FT                   /translation="MDEKHEKKQKVTVEEWTSRFRAIGLDDEQMGHWHTLFERENPSGH
FT                   QSFLEWLGLPEERIALVRSKSAESKK"
FT   gene            complement(124808..125287)
FT                   /locus_tag="Gbem_0101"
FT   CDS_pept        complement(124808..125287)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0101"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37132"
FT                   /db_xref="GOA:B5E8E9"
FT                   /db_xref="UniProtKB/TrEMBL:B5E8E9"
FT                   /protein_id="ACH37132.1"
FT                   /translation="MPPIMDLPKIKKTIRIFAVAQCALIALLIFMAVLFQQRLQLLGRG
FT                   DQFMSGVVAAFVIQLLLFYPIFRFAGKEAERDFSLIGKTLNQEELKAFTKQKRWSDVIK
FT                   MAVFGFFFIFILALKPATPTLVLSVIYYSFVLTIVTYLQCYNFAARKRSKGVANP"
FT   gene            125570..126217
FT                   /locus_tag="Gbem_0102"
FT   CDS_pept        125570..126217
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0102"
FT                   /product="protein of unknown function DUF480"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37133"
FT                   /db_xref="InterPro:IPR007432"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5E8F0"
FT                   /protein_id="ACH37133.1"
FT                   /translation="MEATLDGTELRVLGSLVEKDLTTPEYYPLSLNALVNACNQKSNRD
FT                   PVLSLDESQVTRALDTLRFKQYALVSGSGGRVAKYRHALVEKFRFSPAELAILCELMLR
FT                   GPQTVGELRGRGERMHKFSDLSEVESVLADLAERTPSLVAKLPLQPGRKEPRYCQLFSG
FT                   EPDLSELAAQMEARGAGADGEKIARLEQELSELREEVASLRETIAEFRKSFE"
FT   gene            126229..126531
FT                   /locus_tag="Gbem_0103"
FT   CDS_pept        126229..126531
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0103"
FT                   /product="protein of unknown function DUF2288"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37134"
FT                   /db_xref="InterPro:IPR018741"
FT                   /db_xref="UniProtKB/TrEMBL:B5E8F1"
FT                   /protein_id="ACH37134.1"
FT                   /translation="MSAIKEELATKIDSTDWLSLRAHLERGGVIIVDPMLDLAEVGAAV
FT                   ANDEVKTVERWLLSGLLSKPSAEQIQAWDAESGKSFLCLIVSPYVLAQEERPVKG"
FT   gene            126545..127270
FT                   /locus_tag="Gbem_0104"
FT   CDS_pept        126545..127270
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0104"
FT                   /product="protein of unknown function DUF1847"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37135"
FT                   /db_xref="InterPro:IPR014997"
FT                   /db_xref="UniProtKB/TrEMBL:B5E8F2"
FT                   /protein_id="ACH37135.1"
FT                   /translation="MEKEQVAEVSCSRCSAVWQKSGTTNCWSGDPGTAPPRPGNCPAGS
FT                   FPGVVAQSAEMMQGTGDDAKMAFVAARVEGLCYQPIPGNDAVNARWTRVEDTIAFAKLM
FT                   GYQRIGIATCIGLLEESDRLAAILKAQGFTPLSVCCKAGSLDKKEFGLAESDKVRPGTF
FT                   EPACNPIAQARICNDLKTDMNIIVGLCVGHDMLFNKHSEAPVTTLVVKDRVTGHNPAAV
FT                   LYGQNFYYKRLQKGPMVVE"
FT   gene            127379..127813
FT                   /locus_tag="Gbem_0105"
FT   CDS_pept        127379..127813
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0105"
FT                   /product="peptidylprolyl cis-trans isomerase, FKBP-type"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37136"
FT                   /db_xref="GOA:B5E8F3"
FT                   /db_xref="InterPro:IPR001179"
FT                   /db_xref="UniProtKB/TrEMBL:B5E8F3"
FT                   /protein_id="ACH37136.1"
FT                   /translation="MKRFGLIVVMMAIAAPAFAAAANDVIANAARENGAIQTASGMVYK
FT                   SIKDGSGPSPKASSVVGVDYRGTLPNGREFDSSYNSKMVTKFPLSSVIPCWTEGLQMMK
FT                   VGGKAKLVCPPELAYGSRGAGQAIPPNATLIFEVELLSIE"
FT   gene            128318..129136
FT                   /gene="fliC-1"
FT                   /locus_tag="Gbem_0106"
FT   CDS_pept        128318..129136
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliC-1"
FT                   /locus_tag="Gbem_0106"
FT                   /product="flagellin"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37137"
FT                   /db_xref="GOA:B5E8F4"
FT                   /db_xref="InterPro:IPR001029"
FT                   /db_xref="UniProtKB/TrEMBL:B5E8F4"
FT                   /protein_id="ACH37137.1"
FT                   /translation="MATSDISLTAGMRTNLLNLQNTSQLLNRTQQRLSSGKQVNSALDN
FT                   PTNYFAAQNANQRASDLADRKDGMSEGVQTVSAANAGITAITGLINAAKGIAQSALSTS
FT                   DTLTRSKLATQYDTIRSQIDNISSDSGYRGLNLLSANNTLTVNFNENASSSLNVVGFLA
FT                   TSTGLSMGANSGAWATASDITTDTAKMDTAISTLRSNTQTLAANLNIITTRQNFTDSMI
FT                   NTLQTGADNLTLADMNQEGANMLMLQTRQSLGTTSLSMSSQAAQSVLKLF"
FT   gene            complement(129392..129946)
FT                   /locus_tag="Gbem_0107"
FT   CDS_pept        complement(129392..129946)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0107"
FT                   /product="2',5' RNA ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37138"
FT                   /db_xref="GOA:B5E8F5"
FT                   /db_xref="InterPro:IPR004175"
FT                   /db_xref="InterPro:IPR009097"
FT                   /db_xref="InterPro:IPR014051"
FT                   /db_xref="UniProtKB/TrEMBL:B5E8F5"
FT                   /protein_id="ACH37138.1"
FT                   /translation="MPRLFVAIDLPEEIKASLSQLSCAVTGARWVAPSEIHLTLRFIGD
FT                   VDPQTVSKIEKALSAVQFPSFPLRVAGVGHFPARGYPRVLWVGLEPHPELIALQQRIES
FT                   ALQPAGVSPEDRPFSPHITLARLKETPPAAVAAFESLHRGLAYPPFPATEYVLYSSVLT
FT                   PKGAIHRKEEVFRSSEEAASR"
FT   gene            130066..131334
FT                   /gene="serS"
FT                   /locus_tag="Gbem_0108"
FT   CDS_pept        130066..131334
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="serS"
FT                   /locus_tag="Gbem_0108"
FT                   /product="seryl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37139"
FT                   /db_xref="GOA:B5E8F6"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002317"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR015866"
FT                   /db_xref="InterPro:IPR033729"
FT                   /db_xref="InterPro:IPR042103"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5E8F6"
FT                   /protein_id="ACH37139.1"
FT                   /translation="MLDARYIRENLETVEARLKTRGEGVDIALFKELDGRRRELLQQSE
FT                   TLKALRNKVTEEIARLQDKSQAAERKTEMREVSQQIKGIDESLRSVEEELQNFLLTVPN
FT                   VPNETTPIGKSEEDNVVVRTWGEVPTLSFEPKPHWEIGEGLGILDFERGAKLAGARFTL
FT                   YRGAGARLERALINYMLDLHTDEHKYIEMLPPFMVNRECMTGTGQLPKFEEDLFHMEGV
FT                   DFFLIPTAEVPVTNIHRGEILKGSDLPISYVAYTPCFRKEAGSYGKDTRGLIRQHQFNK
FT                   VELVKFTSPEDSYQQLQKLLGHAEEVLRRLQIPYRVVELCTGDIGFSAAKTFDIEVWLP
FT                   GQNCYREISSCSCFEDFQARRAGIRFRPEEKAKPEFVHTLNGSGLAVGRTLVAVLENYQ
FT                   QADGSVLIPEVLRPYMGGAERIS"
FT   gene            131340..131425
FT                   /locus_tag="Gbem_R0001"
FT   tRNA            131340..131425
FT                   /locus_tag="Gbem_R0001"
FT                   /product="tRNA-Ser"
FT   gene            131494..131586
FT                   /locus_tag="Gbem_R0002"
FT   tRNA            131494..131586
FT                   /locus_tag="Gbem_R0002"
FT                   /product="tRNA-Ser"
FT   gene            131639..132118
FT                   /locus_tag="Gbem_0109"
FT   CDS_pept        131639..132118
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0109"
FT                   /product="lipoprotein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37140"
FT                   /db_xref="InterPro:IPR019225"
FT                   /db_xref="UniProtKB/TrEMBL:B5E8F7"
FT                   /protein_id="ACH37140.1"
FT                   /translation="MKRLMKLLVLSSLVAIGFTTGCNEKQKQEQAAVKPQPAKPPTEVV
FT                   VPDDVKRKWKAVEIAVSDKQHNQQKVYTIKLGSELKIPGSNLTLRVENFLPHFVMEGTT
FT                   LTSQSNQLVNPAAQIVIREDAKEIYKGWLFSLYPTTHAFQHPLYGFTLVDYLPAS"
FT   gene            132127..132203
FT                   /locus_tag="Gbem_R0003"
FT   tRNA            132127..132203
FT                   /locus_tag="Gbem_R0003"
FT                   /product="tRNA-Arg"
FT   gene            132250..132326
FT                   /locus_tag="Gbem_R0004"
FT   tRNA            132250..132326
FT                   /locus_tag="Gbem_R0004"
FT                   /product="tRNA-Arg"
FT   gene            132425..132775
FT                   /locus_tag="Gbem_0110"
FT   CDS_pept        132425..132775
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0110"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37141"
FT                   /db_xref="UniProtKB/TrEMBL:B5E8F8"
FT                   /protein_id="ACH37141.1"
FT                   /translation="MNVSVIYKANVTDEVLDALAGKLPAIISELLEVRGAKIAILKPEQ
FT                   ISLQFSLANVRDVGADLRIIVLARSVGPRTSAENKLATAILDKVLPLAGDKFSIAIRLY
FT                   LTEIGAAEYAPA"
FT   gene            133141..135186
FT                   /locus_tag="Gbem_0111"
FT   CDS_pept        133141..135186
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0111"
FT                   /product="ligand-gated TonB-dependent outer membrane
FT                   channel"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37142"
FT                   /db_xref="GOA:B5E8F9"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010917"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039426"
FT                   /db_xref="UniProtKB/TrEMBL:B5E8F9"
FT                   /protein_id="ACH37142.1"
FT                   /translation="MGTCISRLVTGIFLLTTLGAPLAFAQQEGEGAAAPALGEMDLEQL
FT                   TNLKVEQVYGVSKFEQAVTEAPASVSVITADEIKHYGWRTLADVIRSSRGFFTSYDRNY
FT                   SYIGTRGFSRPGDYNTRVLLLIDGHRINDAIYETAAIGTEFILDLALIDRIEIIRGPSS
FT                   SLYGAGAFFGVINVITRSAKQIEGGEAAASGGSQRTGAGRLTYGKSFDGGEFVASGSAY
FT                   KSRGNDSLFYPEFNDPATNNGIASNMDRDRNYSLFASGRLHDFTLTGALISRDKRIPTA
FT                   SFNTIFNDPRTHSVDRRSYLDLKYDKALEGGTGVTARLFYDEYRYQGNFAYEKGLDDPG
FT                   FYPPTYLNRDDHLARWWGGEAQASRQVLPRLQLTAGASFRDSFLKLPNYDAVPQGRRVE
FT                   NDHSDLFLALFGQGELRLFEHLIVNVGVRHDHYQTFGGATSPRLAVIYTPVEGTVFKYI
FT                   EGKAFRAPNAYELYYNDVFDTNVANPRLAPETVRTRELIYEQYLGEVLRTSLSLFQNKI
FT                   ENLISYQNLPSGEVSFGNAGRVKAVGGEFEVEGQWASGFAARTSYSFVSARDEGQDQRL
FT                   DYSPRQLAKLNLTAPLYRKKLFAGVELQGTARRDFSHNGVQTAAPGYLIANATLFSTGI
FT                   LPSLDLSLSVYNFLDRRYQDPATTDHRQSLIAQDGRTFRVQATYGF"
FT   gene            135200..135772
FT                   /locus_tag="Gbem_0112"
FT   CDS_pept        135200..135772
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0112"
FT                   /product="protein of unknown function DUF4154"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37143"
FT                   /db_xref="InterPro:IPR025293"
FT                   /db_xref="UniProtKB/TrEMBL:B5E8G0"
FT                   /protein_id="ACH37143.2"
FT                   /translation="MIRRHCPIPAAAGLRCLPILLALLFLHAFEPRAEGAQEYQVKAAM
FT                   VVNLSKYIEWPAEAFPRTGAPLQICSVGRGPFSAALEQYQGKTVLGHPLSLRRLATGDE
FT                   PSECNVLVVSGIEKRYLAGVLDLARRRGVLTVGDIPDFARFGGVIGLVENDGRVRFEIN
FT                   LKAAQQSRVKISSQLLKLAKLIREGDQ"
FT   gene            135769..137934
FT                   /locus_tag="Gbem_0113"
FT   CDS_pept        135769..137934
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0113"
FT                   /product="diguanylate cyclase/phosphodiesterase, HAMP
FT                   domain-containing"
FT                   /note="domains: HAMP, GGDEF, EAL"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37144"
FT                   /db_xref="GOA:B5E8G1"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR033417"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:B5E8G1"
FT                   /protein_id="ACH37144.1"
FT                   /translation="MSPLRLSFVRNLPLKRKLMLIIMLCCCASLLAASIFFLTRDAKGL
FT                   YQVQREDLVSLAEIIGANSASALVFDDPESAQRTIAPLASKRSILAVYVLTSEGQIMAR
FT                   HVAPEAGNAELPLERLGSSPSPAAVLAAVETIRKTAEKNSAVSGFDCLVQPVYFDYERV
FT                   GTVVIHADTELFRKNLRWTATVTLLFMLVTVIAAYFFSAKLQQMISRPLLDLLSSMKDV
FT                   SASKNYAIRVAKPSDDEIGLLYDGFNEMLSEIEERNQILRQRQAHLQQLAHYDPLTRLP
FT                   NRTLFYDRLAQALYQAERSRQALSVIFIDLDHFKDINDTLGHRTGDLLLIEVASRLSTV
FT                   VRSCDTVARLGGDEFTIFTQNVVNAENAAIVAAKLNGLFAKPFHLGESEIYVTASIGVT
FT                   LFPHDGKTVDELLMNADIAMYHAKACGKNVYKMFDRKMNEHATERVTLLSDLRLALERD
FT                   EFVLHYQPKVDLLTGNVTSVEALVRWMHPRLGMLAPDKFIRLSEESGFIVELTDWVLRT
FT                   ACSQAKKWQEQNLGSVRVAVNLSPYHFQRQDVKEAILSVLEATGLEPALLEIEITESAL
FT                   MQNDEYTCALFRELRELGMTISVDDFGTGYSSLSYLHRFPINTLKIDRTFILNMMKSTE
FT                   DQAIVTAIIAMAKSLNMQIVAEGVETVDQLEKLKDQGCHEIQGFLVSRPVAADAVTEFF
FT                   TPENHLHQHTDPAQPEPPQGASPATRP"
FT   gene            complement(137849..140056)
FT                   /locus_tag="Gbem_0114"
FT   CDS_pept        complement(137849..140056)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0114"
FT                   /product="heavy metal-translocating P-type ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37145"
FT                   /db_xref="GOA:B5E8G2"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:B5E8G2"
FT                   /protein_id="ACH37145.1"
FT                   /translation="MPTTAAASTMEHYSCAHCGLPVATPSLGKAPSTLDRQEIFCCHAC
FT                   RLVSAIVGNRQGEQGWHLFRLGIGALLAMNVMMISLLLYAGSVETQLIPLFRRILLVLS
FT                   IPAMLILIPPFLSGALREISSRRFCLDFLIALGSLSAFSLSAVNAVVGSGEVYFDTATM
FT                   LPVLVTLGKFIEASVKRKASELLETLETLLPRTALRVTGEGTDEVALDALQPGDLVRVR
FT                   PGERVAVDGTVVEGTSSIEEAPFTGEFLPRLCRKGDAVTAGTVNGQGTLLLRADRTGSQ
FT                   LLLHSIADMVQQAWRAPSQSERLAQKAAMLFLPAVLLVSVGALICWSFKGLPDQALLSA
FT                   LSVLVVACPCTMGIATPLATSLAVARAARAGIVVRGGSVMEGIAGTGTVFFDKTGTVTS
FT                   GTPVLSEMELLDPLTTRAELLGRLAALESASEHPLAAAVKAAAAACGAAPGTATQVELS
FT                   AGCGISGTVTWKGVATRMWAGNASCADGDVGCEDLPGEGAVVFAGWDGRLRARLHFADP
FT                   LKDDAASSLDALHRLGLTSVLLSGDRFSSAQVAAKRLGIRRVEAPSPPDRKLELIAGYI
FT                   AKGRKVAMVGDGVNDAPALAAAQTGIALGTGMELAQVAGNVVILSGRLSQIPWLIALSR
FT                   RAGNIIRGNLALSFAYNAVALAAAAAGLLHPLLAAVAMVVSSLTVLGNSLRIGAFPAPS
FT                   ALPARSRETASPQPKGVLPAMPLEEAPAAQGRCAGAGGFPA"
FT   gene            complement(140034..140813)
FT                   /locus_tag="Gbem_0115"
FT   CDS_pept        complement(140034..140813)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0115"
FT                   /product="membrane protein, DsbD superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37146"
FT                   /db_xref="GOA:B5E909"
FT                   /db_xref="InterPro:IPR039447"
FT                   /db_xref="UniProtKB/TrEMBL:B5E909"
FT                   /protein_id="ACH37146.1"
FT                   /translation="MEIEGLTHHLWIGFAGGLVACAHCVGMCGGFVLHLSREKERQDML
FT                   TGQFLWQAGRLSSYLFLGAVAGFTGGYFQLLLLRHGLWQNLLSYAAAAVMFLMGASLLG
FT                   LLPLRGEANRGMFSSTLSALAARLCTDSSPGSALTMGIVTGFLPCPIVVAFLAYSLQTG
FT                   SVLSGLATMAALAAGTSLPLLVLGSAARLTRWHLRAWGARAGGAVLLLFALGTALRGSA
FT                   FYHRLLGCPPTPGPQIISASAHSATGAWRGDAYDSGR"
FT   misc_feature    complement(140843..140886)
FT                   /note="conserved nucleotide sequence; Gbem_R4005"
FT   gene            complement(140901..141401)
FT                   /gene="actE"
FT                   /locus_tag="Gbem_0116"
FT   CDS_pept        complement(140901..141401)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="actE"
FT                   /locus_tag="Gbem_0116"
FT                   /product="menaquinol oxidoreductase complex ACIII,
FT                   cytochrome c subunit ActE, 1 heme-binding site"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37147"
FT                   /db_xref="GOA:B5E910"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:B5E910"
FT                   /protein_id="ACH37147.1"
FT                   /translation="MKKLIALIIVVPPLIFTVVFGYLLVKGPRMTVQHHFREFQTVLPP
FT                   PPPGTVSAQPDASRIPAGAALALVKNPLPANPQNLERGGIYYGYYCLFCHGEGGAGDGP
FT                   VGHSYIPAPADLRRAKVVGYSDGELLRAMLTGAGHEPVLERVVPPEQRFHLALFVRSLA
FT                   RAR"
FT   gene            complement(141398..141682)
FT                   /locus_tag="Gbem_0117"
FT   CDS_pept        complement(141398..141682)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0117"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37148"
FT                   /db_xref="GOA:B5E911"
FT                   /db_xref="UniProtKB/TrEMBL:B5E911"
FT                   /protein_id="ACH37148.1"
FT                   /translation="METPRYDEKQELPSPWEWIILTVFSATIMVFGWIVYLLVADAPRF
FT                   WDFGQLPDAPAESIYSSTTPEKQRLPRRQIAPLPEAMPLPVVVPKGARK"
FT   gene            complement(141691..141969)
FT                   /locus_tag="Gbem_0118"
FT   CDS_pept        complement(141691..141969)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0118"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37149"
FT                   /db_xref="GOA:B5E912"
FT                   /db_xref="UniProtKB/TrEMBL:B5E912"
FT                   /protein_id="ACH37149.1"
FT                   /translation="MMLYLYVLQNQWIVLSLLGGAILTLLMCLTYQALWVPRGTETESE
FT                   RIKVKDLRSFIAWIKSFVPWTVILLILASLAFTILEITRNHAIPPNW"
FT   gene            complement(141987..142214)
FT                   /locus_tag="Gbem_0119"
FT   CDS_pept        complement(141987..142214)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0119"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37150"
FT                   /db_xref="GOA:B5E913"
FT                   /db_xref="UniProtKB/TrEMBL:B5E913"
FT                   /protein_id="ACH37150.1"
FT                   /translation="MNPMEGNAFLFLWIGFLLLMSTALGTLFLWAIRAGQFSNQERARY
FT                   LALDAAIPDLEPPTETAPQAKGKQTRPEEG"
FT   misc_feature    complement(142236..142261)
FT                   /note="conserved nucleotide sequence; Gbem_R2101"
FT   gene            complement(142329..143348)
FT                   /gene="ccoP"
FT                   /locus_tag="Gbem_0120"
FT   CDS_pept        complement(142329..143348)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ccoP"
FT                   /locus_tag="Gbem_0120"
FT                   /product="cytochrome c oxidase, cbb3-type, diheme subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37151"
FT                   /db_xref="GOA:B5E914"
FT                   /db_xref="InterPro:IPR003468"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:B5E914"
FT                   /protein_id="ACH37151.1"
FT                   /translation="MKMTPAVLIVGALMVFWASAFIIVGIPSLTMKETPSEIWRPLTPL
FT                   EKAGHRLYVKNGCSYCHSLFIRVNDWDIGAERIAKAGDYVGVEPAILGSERTGPDLSQE
FT                   GGEHSDDWNIAHFTNPRFTSPISLMPSWDFLTEGEITALTAYVQSQGGKHADLRQARQR
FT                   EWKKQAVEAYSGGFDRNIEWLHAQVPEVWRRMPNPYPATEAALQRGKRIYQQLCVNCHS
FT                   PVGDGNGPAMPFLSPPPLNFTTLRRHVVENRYIGGIFYYQIMNGITGTAMPYFKKHLES
FT                   EKIWDLANYLGVSFVGYTDANTEPRGIDASFEGAWENSYPPPGRERPELPVAPPAPVP"
FT   gene            complement(143345..144736)
FT                   /gene="ccoN"
FT                   /locus_tag="Gbem_0121"
FT   CDS_pept        complement(143345..144736)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ccoN"
FT                   /locus_tag="Gbem_0121"
FT                   /product="cytochrome c oxidase, cbb3-type, subunit I"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37152"
FT                   /db_xref="GOA:B5E915"
FT                   /db_xref="InterPro:IPR000883"
FT                   /db_xref="InterPro:IPR004677"
FT                   /db_xref="InterPro:IPR023616"
FT                   /db_xref="InterPro:IPR036927"
FT                   /db_xref="UniProtKB/TrEMBL:B5E915"
FT                   /protein_id="ACH37152.1"
FT                   /translation="MFKFASKPQSAALAFMVAGSVWFVVGAVYGFMSAIHLVAPEFLPH
FT                   VGALVFGRERPVHVNTMLYGFVGPMLVGSGLYYLPALLRTRLWSEPLAWAAFFFWNLTV
FT                   LSGPVGFAFGITQGREYNEYVWLADVSLVIAVVCLIVNSALTIANRQEDQIYVSIWYFM
FT                   ATFLWTASNYPLGNVMWHPATGAMPGLIDSIFLWFWGHNLPGLLITPLATGAAYFVIPR
FT                   VARTPLNSHTLSLLGFWLLIALYSHIGGHHVLQSPIPNWLKTVSVVDSIAMVLPVSIVV
FT                   INLWMTARNFGRRIWGDPAARLVMGGVVWYIVTCIQGPLQSLPFLQRVTHFNNWTVGHA
FT                   HIAMLGFGGYIALGAMWHIVPLITGRELYSKKLVSLQFGLVTFGLTGFFLVLTAAGLVQ
FT                   GTAWHNGETVLRVLPQLVPFMASRAALGVFIFTASLVGLYNLLMSLRRGEEQEGAQLQR
FT                   AEDAA"
FT   gene            complement(144770..145321)
FT                   /gene="actA"
FT                   /locus_tag="Gbem_0122"
FT   CDS_pept        complement(144770..145321)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="actA"
FT                   /locus_tag="Gbem_0122"
FT                   /product="menaquinol oxidoreductase complex ACIII,
FT                   cytochrome c subunit ActA"
FT                   /note="5 heme-binding sites"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37153"
FT                   /db_xref="InterPro:IPR011031"
FT                   /db_xref="InterPro:IPR029467"
FT                   /db_xref="InterPro:IPR036280"
FT                   /db_xref="InterPro:IPR039118"
FT                   /db_xref="UniProtKB/TrEMBL:B5E916"
FT                   /protein_id="ACH37153.1"
FT                   /translation="MSPASEDKNMKKWKTPLWAAVAAACVVLLSFLATLVYLDQLYPVG
FT                   LGPRQPIPFSHRVHAGVKKISCFMCHSEAHRSSRAGIPPLQTCLLCHSRIIRTYPYIAK
FT                   LRALAASNQPVIWARVNWLPEFVYFDHSMHIQRGIDCGHCHGDVSRMDRVSKARKFQMG
FT                   FCIQCHRYNRATHDCFTCHR"
FT   gene            complement(145318..146394)
FT                   /gene="actF"
FT                   /locus_tag="Gbem_0123"
FT   CDS_pept        complement(145318..146394)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="actF"
FT                   /locus_tag="Gbem_0123"
FT                   /product="menaquinol oxidoreductase complex ACIII,
FT                   menaquinol-binding membrane protein subunit ActF"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37154"
FT                   /db_xref="GOA:B5E917"
FT                   /db_xref="UniProtKB/TrEMBL:B5E917"
FT                   /protein_id="ACH37154.1"
FT                   /translation="MSTSDRGHSSKSWGVAWGVAAVAGIALWAVLLRGEDPARAWRSLL
FT                   VNFLFFSSLSAGLVVWPALVRTCNGKWQQGVERYASAAIAFALPSLLALALLWGGSGAW
FT                   APWYRVNFHQGMWLNNSFLFGRDLAALLLFWGWAAFHLARRRRGSGRRSGSILLVVYSL
FT                   VFSLLGFDLVMALDPHFRSNLAGGYFFMSGLYIGISAWALIACLKGGAKPKQLHDLGNL
FT                   VLAFSLMTTYLMYAHLLPFWYENLPPEIRFLVPRMHNENWSPVSVALLCTVYFGPLVLL
FT                   LPARFKENRWTLGAVALLVVAGMWLERWWLVAPTFDPLARLGLSELSLALGCTGLLGLG
FT                   MLISPRHLPPDAADGDKP"
FT   gene            complement(146381..148255)
FT                   /gene="actCD"
FT                   /locus_tag="Gbem_0124"
FT   CDS_pept        complement(146381..148255)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="actCD"
FT                   /locus_tag="Gbem_0124"
FT                   /product="menaquinol oxidoreductase complex ACIII,
FT                   menaquinol-binding membrane protein subunit ActC and
FT                   DUF3341 subunit ActD"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37155"
FT                   /db_xref="GOA:B5E918"
FT                   /db_xref="InterPro:IPR005614"
FT                   /db_xref="InterPro:IPR021776"
FT                   /db_xref="UniProtKB/TrEMBL:B5E918"
FT                   /protein_id="ACH37155.1"
FT                   /translation="MADLGYGEINDDVLRALKKPTLPYFLTAAALAGVVGLAALTFMYQ
FT                   TQAGMGVTGLNRPVGWAVYITNFVFWVGIAHSGTLISAILYLMRADWRDAVSRSAEAMT
FT                   IFAVLTAGLFPLIHLGRLWAAYYIVPYPSQRQIWPNFVSPLVWDVLAVTTYLTVSSIFW
FT                   FVGMIPDLAAARDLHQEQLGPRHWRTRLYRALSLGWSGTGSQWHHYGRSYLFFAAFATP
FT                   LVVSVHSVVSWDFAMGLLPGWHSAIFPPYFVAGAIHSGLAMVITLLIPMRRYLRLERLI
FT                   EMRHFEMLAKTIILTATIVGYAYAVEAFIAWYGEDPIEWQNHLWRAFGPPAWMYWLCVV
FT                   CNVFVPWLFLFKKMRTSLVPLFVISLLINLGMWFERLMIIYTSQAHDFLPHNFGGYAPS
FT                   WVELMITASSFGFFLLFFLGFTKTLPTVPLSELKEKVADEEIKPVGSCDSRVRERIATQ
FT                   RPSVLALFSNAGRLVEAAKLSCDGGFQVMESFSPVKIEALDHVLKKRHSPVRLFTLGGA
FT                   VSGLVGGFWLAGGTALVNRLIVGGKPPLSWVPFCVVAFEGTILLGCLANLLGLALFSRL
FT                   FRFETAPYYDPRFSRDRFGLLVSCKAGEVDRLKELLAPSLPEEIHVHK"
FT   gene            complement(148248..151148)
FT                   /gene="actB"
FT                   /locus_tag="Gbem_0125"
FT   CDS_pept        complement(148248..151148)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="actB"
FT                   /locus_tag="Gbem_0125"
FT                   /product="menaquinol oxidoreductase complex ACIII,
FT                   molybdopterin-binding-like and iron-sulfur cluster-binding
FT                   subunit ActB"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37156"
FT                   /db_xref="GOA:B5E919"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR006963"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="UniProtKB/TrEMBL:B5E919"
FT                   /protein_id="ACH37156.1"
FT                   /translation="MSDMSRRTFLWVTGGSSIALVTEPPRKLVNKLIPKVIPPENIRPG
FT                   SWTVFATTCRECPAGCGMHLSHRDGRVTKAEGNPAHPVNRGALCPRGQSAPQGLYDPDR
FT                   LRQVLYRSGGASRPSNWQDALSAISTRLISGGRAVILSSLQTGALAEVMTGFASAFRGK
FT                   LLFHEAFNYEPMRAAHQELFGLPVVPHHDLENSDYILSFAADFLETWVSPVSYARQFAD
FT                   MHGFRQDEAQNRMVYVGPRLSMTASNADSFIQVPPGQERLVAATLLKLVIERGWQKNDL
FT                   TPFRGALDGMLKGAGQVPAIPEATLLQVAQAFANARAPLALAGPSAAKGAVASDTALCV
FT                   ALLNYAVGAVGKTVDFSRPHALSRTAREAELAALLGSLGANDVLFVHDTNPAYSRNGAA
FT                   AQLRRAGTVVYLGTMPDETAQMADWVLPIDSPLESWGEYEPEPGVRGLMQPGMGRIHDT
FT                   RSAGDLFLKMAGLARRPLSRKGSAEPPADFASWLKAGWSAPGGEAAWAGALRTGGDWST
FT                   RPKSPAAQPALQAKGGLRFAAAGVTPLPKPDQAELWAWPSIMLYDGRLANRGWLQEAPD
FT                   PVSFVVWGNWVDMNPRQAEALGIEEGEMVQISTATGSLRAPARITEEVGLQTVAVGLGQ
FT                   GHTALGKNAKGIGANAFLLLGGVNSGSTFAPCRIAKVPGGAGDRMTATAPTRNQLHREL
FT                   LQAVPVSELRVMKPGEGDRLDLPLSKGHRPEEDMYPAHEHKKHRWGMAIDLQRCIGCGA
FT                   CAVACYAENNIPVIGKELVRGGREMAWLRVPPYRMPGDRLRYAWLPLHCQHCDAAPCEP
FT                   VCPVFAAVHNEEGLNAQIYNRCIGTRYCSNNCPYKVRRFNWLNVEWRKPLDLQLNPEVT
FT                   VRTRGVMEKCTFCVQRIRQAEYRASRERRQLQDGEVVPACAQTCPTGVFTFGDLLDPNS
FT                   RVSRLAATEPRRYQLLHELHTKPAVTFLRRVEVELG"
FT   gene            151341..152213
FT                   /locus_tag="Gbem_0126"
FT   CDS_pept        151341..152213
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0126"
FT                   /product="polyphosphate-dependent ADP kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37157"
FT                   /db_xref="GOA:B5E920"
FT                   /db_xref="InterPro:IPR016898"
FT                   /db_xref="InterPro:IPR022300"
FT                   /db_xref="InterPro:IPR022488"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B5E920"
FT                   /protein_id="ACH37157.1"
FT                   /translation="MKIDVEQFQVKAKEKVSLKRRPTDVAPFYHSKEQYQECLTEQIER
FT                   LSALQGLLYANNNYAVLLIFQAMDAAGKDGVIKHVLSGINPQGCEVYSFKHPSAEELDH
FT                   DFLWRSGRRLPERGRIGIFNRSYYEEVLIVRVHPEILAGEGLPGQLVNGHVWRDRFESI
FT                   VNLEEHLHRNGTRIAKFFLHISKEEQRKRFIERIDNPEKNWKFDKADVEERKLWKQYME
FT                   AYQDCLEATSRKNAPWYIVPADDKKNARLIVAQVLLNLLEELKMEYPDTSEERRKELQE
FT                   IRKELAKPE"
FT   gene            complement(152278..152454)
FT                   /locus_tag="Gbem_0127"
FT   CDS_pept        complement(152278..152454)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0127"
FT                   /product="protein of unknown function DUF1328"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37158"
FT                   /db_xref="GOA:B5E921"
FT                   /db_xref="InterPro:IPR009760"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5E921"
FT                   /protein_id="ACH37158.1"
FT                   /translation="MLRWALIFFIIAIIAAVFGFGGIATAAAGIAKILFYLFLVVAVVM
FT                   LVSALLAGRNITR"
FT   gene            complement(152612..155227)
FT                   /gene="ligD"
FT                   /locus_tag="Gbem_0128"
FT   CDS_pept        complement(152612..155227)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ligD"
FT                   /locus_tag="Gbem_0128"
FT                   /product="DNA ligase D, ATP-dependent"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37159"
FT                   /db_xref="GOA:B5E922"
FT                   /db_xref="InterPro:IPR012309"
FT                   /db_xref="InterPro:IPR012310"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014143"
FT                   /db_xref="InterPro:IPR014144"
FT                   /db_xref="InterPro:IPR014145"
FT                   /db_xref="InterPro:IPR014146"
FT                   /db_xref="UniProtKB/TrEMBL:B5E922"
FT                   /protein_id="ACH37159.1"
FT                   /translation="MGLEEYQRKRNPGRTPEPPASEGKSERSLRFVVHKHAASHLHYDF
FT                   RLELDGVLKSWAIPKGPSLDPSVKRLAMMVEDHPYDYGDFEGVIPKGNYGAGEVIVWDT
FT                   GSYEAPGAADPEQGVRLLREGLKKGDLKFILVGRKLNGEYALVRIKGDKENTWLLIKKN
FT                   DRFASTEDVTLQDRSVVSDVTIEELKTGRKPQALPLAAAEAAEPVGPVRPAAPMPHRLT
FT                   PMLANSAAEPFDDPDWLFEIKLDGYRAIAEIEGGEVQLYSRNNLSFNKRFPAIVQSLAS
FT                   LPVTAVLDGEVVALDAKGRSSFQLLQNSLRTGEKNIYYYAFDLLYLDGEDLRAEPLQAR
FT                   KERLRNLLPELPWVRFSDHIREYGRQFFELARENNLEGILAKRADSRYFAGRRSGDWLK
FT                   IKIRLQQEAVICGFTQPRGSRKGLGSLVLGVYENGELVYIGLTGGGFDDVGLKEMYAAL
FT                   QPLIQPESPFRQQVKTSMPVTWTKPVLVCEVEFAEWTDENVMRLPIFLGLREDKDPRSV
FT                   QREIFPAEVQPPVHHAQTDQEEDVGEPAAGEKVPAEETVATAKPFVKKGGAKKGEVNLV
FT                   IDGQRLTLTNLDKVFWPEEGYTKGDVIDYYRKMARVILPYLMDRPESMYRTPHGIAEGG
FT                   FYQKETADLIPPWITAREIYSKHVDKNIKFLVCQDEATLIYMANLGCIEINPWLSRLQQ
FT                   LDYPDYLVIDLDPEDISFEKVIETALAVHEVLESAGAASFPKTSGATGIHIYVPLGARY
FT                   DYDTAGVFAKLVATLAHHKVPGFTSLLRSPRQRQKKVYLDFLQNKPGQTLAAPYSIRPR
FT                   PGATVSAPLRWEEVKPGLDPRQFTINTIGKRLEQVGDLFQGVLGPGIDMERCLERLQNG
FT                   "
FT   gene            155463..155642
FT                   /locus_tag="Gbem_0129"
FT   CDS_pept        155463..155642
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0129"
FT                   /product="SAP domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37160"
FT                   /db_xref="UniProtKB/TrEMBL:B5E923"
FT                   /protein_id="ACH37160.1"
FT                   /translation="MRVQDIREIAQRMAIPTSKLKKGELIRVIQRTEGNRQCFDSGQSG
FT                   QCGQRECLWADDCN"
FT   gene            155709..155891
FT                   /locus_tag="Gbem_0130"
FT   CDS_pept        155709..155891
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0130"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37161"
FT                   /db_xref="UniProtKB/TrEMBL:B5E924"
FT                   /protein_id="ACH37161.1"
FT                   /translation="MDFDYTEYEYLPECKDGCGAITDWLNSREMAREVGENHGRQTGHE
FT                   WIVLEKMREEQPLRK"
FT   gene            155954..156391
FT                   /locus_tag="Gbem_0131"
FT   CDS_pept        155954..156391
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0131"
FT                   /product="ferritin-like protein of unknown function
FT                   DUF2383"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37162"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="InterPro:IPR019052"
FT                   /db_xref="UniProtKB/TrEMBL:B5E925"
FT                   /protein_id="ACH37162.1"
FT                   /translation="MNRDDILNHLGKLIQLDVDATHAYDQAIRNVNEVVIKDKLIQFQA
FT                   DHRKHIDLLSAKMLELGGTPPELTSDFKGFLISGFTALRSLTGSKGALEAMETNERLTT
FT                   SRYEEASKLDFPVDISAIVRSNYADEQRHLSFIREAIPTLK"
FT   gene            156622..158511
FT                   /gene="treZ-1"
FT                   /locus_tag="Gbem_0132"
FT   CDS_pept        156622..158511
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="treZ-1"
FT                   /locus_tag="Gbem_0132"
FT                   /product="maltooligosyltrehalose trehalohydrolase,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37163"
FT                   /db_xref="GOA:B5E926"
FT                   /db_xref="InterPro:IPR004193"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR012768"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR022567"
FT                   /db_xref="UniProtKB/TrEMBL:B5E926"
FT                   /protein_id="ACH37163.1"
FT                   /translation="MVAAAWKFDLGATVLKEGGTRFRVWAPKSQTVNLLILSGKAAGAV
FT                   LMQQEEMGYYSATVAGVADGDRYLYQLDNGKTFPDPVSRYQPDGVHEPSQVVDPDLFEW
FT                   SDEGWTGIPLEQYRIYEIHTGTFTKEGTFEAAISFLDYLVDLGITAVEIMPVSQCPGKR
FT                   NWGYDGVFHFAPQSSFGGPDGLKRLVNACHKKGLAVLLDVVYNHFGPEGNYLWDFGHYF
FT                   TDKYRTPWGRAMNLDGAYSDSVLEFFLLNAGYWINEFRFDGLRLDAVDWIFDQTPKPLL
FT                   QRLAEEVHLHRGRLGREIFLFAENDTNDARLIKPPELCGFGLDAQWCDNFHHALRTLLT
FT                   RETTGYYEDFGQFSQMVKTYEEAFVFTGEYSQYRKRRQGGPAKDLPTSQFVVFSQNHDQ
FT                   VGNRKCGDRLSGSLPVGQLLLVAGVVILSPYIPMLFMGEEYGEKAPFHYFIDHGNPELV
FT                   ELVRKGKHEEHASGICEGEIPDPAAEETFLESKIDLVSEKVGEQAVILEFYKKLFSLRS
FT                   TLPALQVFQREQMEVSGMPQQKVLCFRRWSGQNSVLCLFSFNNMQQEISLPLAEGTWEK
FT                   LLDSSAQHWLGPGEEAPVKVEVTGEPGEIPVSINPYSVVVYAADLTGGAHGAS"
FT   gene            158498..160942
FT                   /locus_tag="Gbem_0133"
FT   CDS_pept        158498..160942
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0133"
FT                   /product="glycoside hydrolase, family 57, DUF3536
FT                   domain-containing"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37164"
FT                   /db_xref="GOA:B5E927"
FT                   /db_xref="InterPro:IPR004300"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="InterPro:IPR021923"
FT                   /db_xref="UniProtKB/TrEMBL:B5E927"
FT                   /protein_id="ACH37164.1"
FT                   /translation="MEQANERFVCIHGHFYQPPRENPWLEAVEIQDSAFPYHDWNERIT
FT                   AECYASNSASRILDGEQRVMDITSNYAKINFNFGPTVLSWMQFAAPKIYQAILEADKLS
FT                   MEWRSGHGSAIAQVFNHMIMPLANSRDKRTQIIWGIKDFEQRFQRFPEGMWLAETAVDL
FT                   ESLDLLAEYGIKYTILAPHQAAGYRELGDEEWTETEIDPTRAYLCKLPSGREISLFFYD
FT                   GPISRAVAFENLLDSGEALANRLVGGFTEDRDWSQLMHIATDGETYGHHQKFGDMALAA
FT                   ALNHIELNNLARLTNYGEYLELCPPTMEAKIHERTSWSCAHGVERWNSDCGCSGGVPGW
FT                   NQQWRGPLRASLDWLRDRLAQGFSRKGAELFKDPWQARDAYIEVILNREMERAESFLAQ
FT                   HAKKDLDASEKITALKLLEMQRHAMLMYTSCGWFFDELSGLETVQVIDYASRALQLSEG
FT                   IAEHGVEKAFLDRLKEAKSNIPAHQDGLWIYQNFVLPIRLDLVKVGAHYAFSSLYEEYE
FT                   DHSQIYCYAIAKEEYSKVSTPDAVIAMGRIHVASEITEENACLTFCVMRLGSHDFKGGV
FT                   IESCDPQAYAAMREEMSASFDKGLYTELVTLMDKHFGTHSFSLLNLFSDEQRKIINIII
FT                   NQNMEESISSYQEMFERSRPLMEFVKETRVPVPHIFLAAAEPALNQSLKKAMSEEEIDD
FT                   DAVHRIIGQIKKWQVGIDGGDTEYFMRRHMESMSSQLMEHPDDVKLMGRMLKYMNLLNE
FT                   IPINLVLWQMQNDYYILAKSVYSDFAAKAAKGEEGTAAWIEAFRKLGETFRFNLGAVLP
FT                   QG"
FT   gene            160955..163939
FT                   /locus_tag="Gbem_0134"
FT   CDS_pept        160955..163939
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0134"
FT                   /product="maltooligosyltrehalose synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37165"
FT                   /db_xref="GOA:B5E928"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR012767"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:B5E928"
FT                   /protein_id="ACH37165.1"
FT                   /translation="MAENYKPAARIPTATYRLQFNAGFTFADATRIIGYLNDLGISDVY
FT                   ASSYLAAKEGSVHGYDVVNQTVLNKEVGDEQSHLAMVEELKRHGMGHILDFVPNHMCIE
FT                   SGENLWWMDVLENGMSSPYAHFFDIDWEPVKKELTGKVLLPLLGDQYGKVLESGGLQLI
FT                   FKEGAFFVQVYALQIPLEPRSYLQILQYRLDALKEKFPAEAAPVEELLSIETALQHLPL
FT                   ATEQDPEKMGERHREKEIIKKRLWQLCHESPEVAAFIADNVKSFNGSKGDPRSFDLMDK
FT                   LLRDQAYRLSYWRVATEEINYRRFFDINGLAAIRMEDQAVYDLTHTLLFRLIREGKVTG
FT                   VRIDHVDGLYDPVSYLQNLQKSSYFQLRQAGSTFPADNGEEKKEALEKEYNALLETDPC
FT                   YKPFYAVVEKILMKGELLPDQWPVFGTTGYDFLNSLNGIFVATEKAKQMDRLYDRFVKW
FT                   GGDFPDLVYEKKKLVMQVSLSGERNMLAHQLNNIAEQDRLTRDFTLNSLARAISEVIAC
FT                   FPVYRTYANSASVRDKDVQYIEAAVYKAKRRNPAISGSVFDFVRDVLLLKSPERATEND
FT                   RRAWLYFAMRFQQITGPVMAKGLEDTAFYVYNRLVSLNDVGGMPGKFGTTLEAFHGQNL
FT                   DRNKTFPHAMIATATHDSKRGEDVRTRIDALSEIPELWQKSVVRWSRFNKGKSTSIENQ
FT                   PVPDRNEEYLLYQILLGVWPAGEMDQEEYKSLKGRVRDYMVKALREAKVNTSWVSPNTA
FT                   YEEGVTSFVDRILEPGPENVFLREFLPLQRRLARCGIFSSLSQTFLKMVSPGVPDFYQG
FT                   TELFEFTLVDPDNRRQVDYGKRVELLADLKAREAETGPEALCRELMGKAKDGRIKLYLI
FT                   YRVLNYRRSNRGPFEGGEYLPLEAKGTRERHICAFARKGKEKTVIAAAARLVATLMPAE
FT                   GSLPLGEEAWQDTVLVLPEGCGGRFRNIVNGEELEAQEQGGEQVIPLARLFGQVSVALL
FT                   ESASA"
FT   gene            163980..165962
FT                   /locus_tag="Gbem_0135"
FT   CDS_pept        163980..165962
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0135"
FT                   /product="alpha-amylase-related protein,
FT                   DUF3416-containing"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37166"
FT                   /db_xref="GOA:B5E929"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR021828"
FT                   /db_xref="InterPro:IPR026585"
FT                   /db_xref="UniProtKB/TrEMBL:B5E929"
FT                   /protein_id="ACH37166.1"
FT                   /translation="MEGRARIAIEGVHPQIDCGRFAVQRVTGDEMAVQADIFSDGHEEV
FT                   VAMLLYRRQGDEVWQETQMQRLENDRWQGSFKLGEPGFYEYSLLGWVDHFRTWQRDLQK
FT                   RFEAGQDVSVDLKIGSSILSQAAKEAKEPDDAKLRQAVEALNQEPELEGAVALGLDSRL
FT                   ADLVSTCCARGLATRYHKDLVVRVDRKKALFSSWYELFPRSLGGAEGRHGTLKDCIAIL
FT                   PDIAELGFDVLYLPPIHPIGTSKRKGKANQVEAEPGDPGSPWAIGSPEGGHKSIHPELG
FT                   TLEDFQALVLEADRHGIEIALDIAFQCSPDHPYLKEHPEWFLWRPDGTVQYAENPPKKY
FT                   QDIVPFNFETPQWQELWEELKSIFFFWMDRGVRIFRVDNPHTKPFPMWEWIIAKAREKD
FT                   PNVIFLAEAFTRQKIMYRLAKLGFSQSYSYFAWRNSKRELTEYLTELTRSDAKEFMRPN
FT                   FWPNTPDILTEYLQYGGRAAFMIRVTLAATLSSNFGIYGPAFELCIPTAEAAGSEEYKD
FT                   AEKYEIRPWDRKGPGNIRELISKLNRIRREYSALQETCNVQFLESDSDSVLFFVKTSGK
FT                   PGASLLVAVNLDPFRVRSAKLRLPLGLLGVLSGQSYLLHDLLNGERSIWQGEWASVTLD
FT                   PQLAPAGIFRLSTWLRKESDFDYYL"
FT   gene            166156..169506
FT                   /gene="treS"
FT                   /locus_tag="Gbem_0136"
FT   CDS_pept        166156..169506
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="treS"
FT                   /locus_tag="Gbem_0136"
FT                   /product="trehalose/maltose transglucosylase and
FT                   maltokinase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37167"
FT                   /db_xref="GOA:B5E930"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR012810"
FT                   /db_xref="InterPro:IPR012811"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR032091"
FT                   /db_xref="InterPro:IPR040999"
FT                   /db_xref="UniProtKB/TrEMBL:B5E930"
FT                   /protein_id="ACH37167.1"
FT                   /translation="MPQRSDKNPLWFKDAIVYEVHIRSFCDSNGDGIGDFRGLLQKLPY
FT                   LRDLGITAIWVLPFYPSPLKDDGYDIADYRSVHPDYGTLRDFQDFLKGAHALGMRVITE
FT                   LVLNHTSDQHPWFQKSRTSKPGSPWRDFYVWSDTPDKYLDARIIFKDFEVSNWTRDPVA
FT                   KSYFWHRFYSHQPDLNYDNPRVHEAMFRVIDFWLGMGVDGLRLDAVPYLYEREGTNCEN
FT                   LPETYEFLKKLRAYIDAKYPDRMLLAEANQWPEDAASYFGGGAACQMCFHFPLMPRMFM
FT                   ALQMEDSFPIINILQQTPVIPQQCQWALFLRNHDELTLEMVTDEERDYMYRIYARDPRA
FT                   RINLGIRRRLAPLMGDDRRKIELMNVLLFCLPGTPIIYYGDEIGMGDNYYLGDRNGVRT
FT                   PMQWSPDRNAGFSPVNPQKLYLPAIIDPEYHYEARNVENQAKNPSSLLWWMKRMIDLRK
FT                   RFKAFGWGSVEFMPIENSKVLAMVRKYEDQSIVVLINLSRSTQFVQVNQPRFAGFYPEE
FT                   MFSRNRFPVIKDSPYGVILGAYDYHLLLMKDGSEEVKPREEGVLEEVPVTGSWENVLRS
FT                   AGLRQLEQSVLPEYLKRSRWFQGKSRIMVRFSVMEKVPVPVNSSSVILTLLEVSYSEGA
FT                   PETYLLPLHFVPMDGGGEGILTETPAAVVCKLRIGDKVGVLYDGTYNSHFRWSLFEMIW
FT                   RRKAIRTDGGRLSGRPAGGMGALMEGKEPPFVSQVGKSEQSNTSMLFDKHFFLKLYRRL
FT                   EEGAHPEVEIGRFLSDRIHFQHVAPLAGTIEYRRPGLEPVAIGMLQAFVPNQGDAWAFT
FT                   LGEAGQFIDRVLAHREEAKESGTPAVAQPDTAATGFSTVLHDLIQGLYPEMVALIGKRT
FT                   AELHLALSSRSDDPSFAPEPFALLYQRSVYQSMRSRTRKVFDLLRRNLGRLPQELVPEA
FT                   EALLGMEPEVQGALQKFTASKFSAMKTRVHGDYHLGQLLYTGDDFLIMDFEGEPVKSLG
FT                   ERRIKQSPLRDVAGMMRSFEYAAHAVLMQRPQVREEDVAFLLPWIQAWCRYNSALFLAS
FT                   YQKGVEGCNFMPDHPQDVETMLRCFMLDKAIYELGYELNNRPHWVSIPLRGIVNLLASE
FT                   KSGPKLGGQ"
FT   misc_feature    complement(169543..169594)
FT                   /note="conserved palindrome; Gbem_R1007"
FT   gene            complement(169630..170580)
FT                   /locus_tag="Gbem_0137"
FT   CDS_pept        complement(169630..170580)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0137"
FT                   /product="ribonuclease BN family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37168"
FT                   /db_xref="GOA:B5E931"
FT                   /db_xref="InterPro:IPR017039"
FT                   /db_xref="UniProtKB/TrEMBL:B5E931"
FT                   /protein_id="ACH37168.1"
FT                   /translation="MFSLRRYFKLGDTSYKELAKRAFKKFSEEDCPEHAAAMAYYFLFA
FT                   SFPFLLFLTTLIAYLPIPHLLDYVLDNASRVLPGETFTLIEDNIQALFTNKKQGLLSMG
FT                   IVLALWASSNAIVSVMDAMNNLYDVKEGRPFWKVRLIAIGLVIGLSVLFLVAMAALMFG
FT                   NQIGDYVAGLINFGGAFKVAWFAALVPVTLFVLVLAVAVIYYFTPDVEHQWVWISPGAV
FT                   IAIPSWILMSLAFSYYINNFGSYDKTYGSIGAVIVLLLWLYLTGLIILAGAVVNSVIEH
FT                   SSAEGKKPGEKVAGEVSDPREDVNEEMKEEKDQKR"
FT   gene            complement(170631..171491)
FT                   /locus_tag="Gbem_0138"
FT   CDS_pept        complement(170631..171491)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0138"
FT                   /product="oxidoreductase, short-chain
FT                   dehydrogenase/reductase family"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37169"
FT                   /db_xref="GOA:B5E932"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B5E932"
FT                   /protein_id="ACH37169.1"
FT                   /translation="MPTEEGKQFPPQRQAQPGKEAEMTPRPQSGEFEYRGAGKLQGKTA
FT                   LITGGDSGIGRAVAIAFAREGANIAFGYLEEDQDAKETRDIVEREGVRCLAFRGDVGQE
FT                   QFCLDIVKKTLEAFGRLDIVVNNAAEQHYRESIEEISSEQLERTFRTNIFSYFYLVKAA
FT                   LKHLQEGSRIINTTSVTAYKGNPNLLDYSSTKGAIVAFTRSLALSLAGKGILVNAVAPG
FT                   PIWTPLIPGTFPEEKTEQFGGNVLLKRAGQPVEVAHSYVFLASEGGSYMTGQVLHPNGG
FT                   TIVGG"
FT   gene            complement(171528..172733)
FT                   /gene="fdh"
FT                   /locus_tag="Gbem_0139"
FT   CDS_pept        complement(171528..172733)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fdh"
FT                   /locus_tag="Gbem_0139"
FT                   /product="formaldehyde dehydrogenase,
FT                   glutathione-dependent"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37170"
FT                   /db_xref="GOA:B5E933"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR027399"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B5E933"
FT                   /protein_id="ACH37170.1"
FT                   /translation="MRAVCWHGKQDVRVDTVPDPEIVQKGDVIVKVALTCICGSDLHLY
FT                   NGYVPTMKKGDILGHEFVGEIVAACPGVTHFRVGDRVIVPFPISCGACWYCKHELWSLC
FT                   DNTNPNSWMMEHIYGDTGGGIFGYSHLYGGYAGGQAEYVRVPFADVGLEKIPDGIPYEQ
FT                   VVLLTDIMPTGYQAAVYCNINPGDTVAVWGCGPVGLLAMKSAKLLGAERVIGIDRFPDR
FT                   LQMAHSQCQAEVLNYEEVDVAEQLQNMTGGRGPDSCIDAVGLEARGTGIEDVYDLVKQT
FT                   LRLETDRASALRQLVRACRKGGTLSISGVYSGFIDKFPMGAIFAKGLTVRGGQAHVHKY
FT                   LPHLVKLVAEQQIDPSSIITHRMSLEDAPAGYRTFLKKQDSCIKIALTPEHAAPKTEPA
FT                   SP"
FT   gene            complement(172781..173509)
FT                   /locus_tag="Gbem_0140"
FT   CDS_pept        complement(172781..173509)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0140"
FT                   /product="DUF2892 and SRPBCC_8 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37171"
FT                   /db_xref="InterPro:IPR005031"
FT                   /db_xref="InterPro:IPR021309"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:B5E934"
FT                   /protein_id="ACH37171.1"
FT                   /translation="METSATEQSRAYRGQSRQKRVNVGPGERKASMAGGAALALSGLWS
FT                   IGRRNYLSGLAMIASGGMLLYRGQTGHCGMYEAMGVDTVHTQGSGLRIEKVVTIGLPPH
FT                   QVYEFWRHLDNLPRFMKHLESVQVTGERTSHWKAVGPGGLSTEWDAEMMEDTPGQQISW
FT                   HSVGSADIPNKGTVEFKEAPGNRGTEVRVSIDYYPPGGTAGRAAMKIAHGLNAQQLEED
FT                   LKRLKQILEVGEETTARRTA"
FT   gene            complement(173716..174495)
FT                   /locus_tag="Gbem_0141"
FT   CDS_pept        complement(173716..174495)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0141"
FT                   /product="DNA-binding Ku protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37172"
FT                   /db_xref="GOA:B5E935"
FT                   /db_xref="InterPro:IPR006164"
FT                   /db_xref="InterPro:IPR009187"
FT                   /db_xref="InterPro:IPR016194"
FT                   /db_xref="UniProtKB/TrEMBL:B5E935"
FT                   /protein_id="ACH37172.1"
FT                   /translation="MRAMWSGSISFGLVNIPVKLYSGSQSNTLDLDMLRKSDLCPIKYL
FT                   RVCKNDNQEVPYEEIVKGYEYSDGEYIVLTDQDFENASLEKTHLIDIVDFIDEREIDTR
FT                   FFEKPYYLEPEKTGPKAYALLREALKRSGKVGVAHYVLRNRGSIGILRPLDQVLVLNQI
FT                   RYAEEVRDASDLKLPGDENLREQEVTLALSLIDQLTVKFDPEKYKDQYVDDLKRIIEEK
FT                   AQGRMPAPQAKQPPPPRVADMMALLKESIKQKRKEAA"
FT   gene            174812..176437
FT                   /locus_tag="Gbem_0142"
FT   CDS_pept        174812..176437
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0142"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37173"
FT                   /db_xref="GOA:B5E936"
FT                   /db_xref="InterPro:IPR008023"
FT                   /db_xref="UniProtKB/TrEMBL:B5E936"
FT                   /protein_id="ACH37173.1"
FT                   /translation="MVEESGQHAHGAGKKLLSTKLLLWIVGIVVALVLIVFIASFFIDE
FT                   PLRRATEKKMNQSLKGYSVRLPKLHFSLIGLSITLKGLTVSQQAHPEPPVAEFPYLRAS
FT                   VHWREILSGKLVGEMRLDDPKIHINLTQLKSEAKSKVPMKEKGWQQAVEAIYPLKINHL
FT                   KINDASITYIDEDAKRPLVLSNLDLEANNIRNIHLPDKVYPSSFHLETDIFKTGHGTVD
FT                   GKANFLAEPTPAVKADLKLEKVPIDYFQPVLARYNMSVQGGALSGNGDIEYGRKVQTAR
FT                   LKKLVISGVTMTYFHSEKTAAVEKRRAEKVKAAAKEVSNKPNLVLSIEQFDLVRSNLGM
FT                   MYNAGGKKFRIFVADTDFSLSNFSNQFSRGAAKAKLSGKFMGSGMTSASGDFRPEKNGP
FT                   DFDLYLKITNTQLTSLNDLLRSYGDFDVTAGTFSLVTELHVKNERVDGYIKPFFRDMKV
FT                   YDRRQDKNKGFFKQVKEILIGGIAKILENKQRDQVATKADISGPLKNPQTSTWQIVVQL
FT                   VRNAFFKAIVPTFERDVTALGKKR"
FT   gene            176472..176624
FT                   /locus_tag="Gbem_0143"
FT   CDS_pept        176472..176624
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0143"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37174"
FT                   /db_xref="GOA:B5E937"
FT                   /db_xref="InterPro:IPR021738"
FT                   /db_xref="UniProtKB/TrEMBL:B5E937"
FT                   /protein_id="ACH37174.1"
FT                   /translation="MRNVVLLILILLVIAVLPTWPYSAGWGYFPSGGLGVVLVVLLLLV
FT                   IMERI"
FT   gene            176670..176852
FT                   /locus_tag="Gbem_0144"
FT   CDS_pept        176670..176852
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0144"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37175"
FT                   /db_xref="UniProtKB/TrEMBL:B5E938"
FT                   /protein_id="ACH37175.1"
FT                   /translation="MPKYGKKAQETVHEVMDKFKKGDLKSGSGKKVTDRKQAVAIGLSE
FT                   AREKGAKVPEPPKKK"
FT   gene            176895..177458
FT                   /locus_tag="Gbem_0145"
FT   CDS_pept        176895..177458
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0145"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37176"
FT                   /db_xref="GOA:B5E939"
FT                   /db_xref="InterPro:IPR021776"
FT                   /db_xref="UniProtKB/TrEMBL:B5E939"
FT                   /protein_id="ACH37176.1"
FT                   /translation="MAKNIAVFGIYHSRESVENAVDALRAADFRNTDISVLFSENVGTK
FT                   DFAHEKHTKVPEGSSAGAGTGAVIGGALGWLTGIGALAIPGVGPFIAAGPIVAALAGVG
FT                   AGGVIGGIAGALVGMGIPEYEAKRYEGRVKEGGILLSVHCDNADWKKRGMDVLRQTGAA
FT                   DIGSEGESKADFASSDKPKPRGSA"
FT   gene            177572..178087
FT                   /locus_tag="Gbem_0146"
FT   CDS_pept        177572..178087
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0146"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37177"
FT                   /db_xref="InterPro:IPR012312"
FT                   /db_xref="UniProtKB/TrEMBL:B5E940"
FT                   /protein_id="ACH37177.1"
FT                   /translation="MPTTKSSSESHAKSSELTIFDVLKQDHEKARYLFDKAQKAGRKEI
FT                   STLQKLFAQLEEELEIHMEGEERFFYSVLEQNEEMRDKVLQSFEEHQVARTMLGTFQAL
FT                   AVDDERWMAKMQVLNEIVEHHMQEEEREVFKLARKALGKEQQHEIALQFQRNKREGRKS
FT                   SRGAPVEG"
FT   gene            178470..178880
FT                   /locus_tag="Gbem_0147"
FT   CDS_pept        178470..178880
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0147"
FT                   /product="response regulator, putative"
FT                   /note="domains: REC"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37178"
FT                   /db_xref="GOA:B5E941"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:B5E941"
FT                   /protein_id="ACH37178.1"
FT                   /translation="MQDAEILLVEDNSNCEELALRALRKAGYSNVAVARDGAEALGMLL
FT                   GEAAEGRGHNEPDFVLLDMKLPKIDGVGVLQKIRSDERTKRLKVFALSSSEDPKDLEEC
FT                   RNLGVLAVLSKPLNPEVLRFWLSEEPVGTPRQ"
FT   gene            complement(179254..179445)
FT                   /gene="tatA"
FT                   /locus_tag="Gbem_0148"
FT   CDS_pept        complement(179254..179445)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tatA"
FT                   /locus_tag="Gbem_0148"
FT                   /product="twin-arginine translocation pathway protein,
FT                   TatA/TatE family"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37179"
FT                   /db_xref="GOA:B5E942"
FT                   /db_xref="InterPro:IPR003369"
FT                   /db_xref="InterPro:IPR006312"
FT                   /db_xref="UniProtKB/TrEMBL:B5E942"
FT                   /protein_id="ACH37179.1"
FT                   /translation="MFGFGMPELIIIMVIVLVVFGAGRLPEIGGALGKSIRNFKKASSG
FT                   KEEIEIKPGRPEDDKKSN"
FT   gene            179632..180081
FT                   /locus_tag="Gbem_0149"
FT   CDS_pept        179632..180081
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0149"
FT                   /product="response regulator, putative"
FT                   /note="domains: REC"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37180"
FT                   /db_xref="GOA:B5E943"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:B5E943"
FT                   /protein_id="ACH37180.1"
FT                   /translation="MNKTILLVEDNPDDEALTLRAVRKHMPYGIVVARDGAEALDYLFG
FT                   TGNHSERDSLANPLLVLLDLKLPKVNGLEVLRRMRENCKTRSIPVIVFTSSTEEQDILD
FT                   SYRLGANSYIRKPVDYGQFCDNMKQVMTYWLSVNQLPPQRNCAAA"
FT   gene            180127..182115
FT                   /gene="uvrB"
FT                   /locus_tag="Gbem_0150"
FT   CDS_pept        180127..182115
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="uvrB"
FT                   /locus_tag="Gbem_0150"
FT                   /product="excinuclease ABC, B subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37181"
FT                   /db_xref="GOA:B5E944"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="InterPro:IPR004807"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR024759"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036876"
FT                   /db_xref="InterPro:IPR041471"
FT                   /db_xref="UniProtKB/TrEMBL:B5E944"
FT                   /protein_id="ACH37181.1"
FT                   /translation="MDKFELVTSFEPRGDQPRAIAELADGVLRGDPHQVLLGVTGSGKT
FT                   FTMAQVIARCNCPTLVLAPNKTLAAQLYGEFKELFPNNAVEYFVSYYDYYQPEAYIPSS
FT                   DTFIEKDSSINDEIDKFRHSATRSLLTRRDVIIVASVSCIYGIGSPESYQEMQIRFREG
FT                   DEVGRDEMLQRLVAIQYQRNDVDFHRGSFRVRGDTVEVFPAHDDERALRIEFFGDTVDA
FT                   ISEIDPLRGVQLQKLSRCAIYPASHYVASRQTLERAVEQIRLELEERLRYFNSQNMLLE
FT                   AQRIEQRTFFDIEMMEEMGFCQGIENYSRHFDGRAAGEPPYTLIDYFPKDFLLVIDESH
FT                   ITVSQVGGMYRGDRSRKETLVNYGFRLPSALDNRPLTFQEFQKKLHQTIYVSATPADYE
FT                   LKLAEGVVVEQLIRPTGLIDPAIEVRPAAGQVDDLLHEARETAARGERVLVTTLTKRMA
FT                   EELTDYYRELGIRVRYLHSDIDTFQRMEILRDLRLGEFDLLVGINLLREGLDLPEVSLV
FT                   AILDADKEGFLRSTRSLIQTCGRAARNVSGRVLMYADKVTGSMQAAIDETLRRRALQTA
FT                   YNEEHGITPESVRRMIGNVLQAPEEKDWVTVPASAEEFLSVKELEKTLKRLRKEMLAAA
FT                   KAQEFERAAELRDKIKRLEVAEITRGS"
FT   misc_feature    182120..182150
FT                   /note="heptanucleotide repeats; Gbem_R7010"
FT   gene            complement(182199..183644)
FT                   /gene="pcnB"
FT                   /locus_tag="Gbem_0151"
FT   CDS_pept        complement(182199..183644)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pcnB"
FT                   /locus_tag="Gbem_0151"
FT                   /product="nucleic acid-independent polyadenylating
FT                   polymerase"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37182"
FT                   /db_xref="GOA:B5E945"
FT                   /db_xref="InterPro:IPR002646"
FT                   /db_xref="InterPro:IPR010206"
FT                   /db_xref="InterPro:IPR025866"
FT                   /db_xref="InterPro:IPR032828"
FT                   /db_xref="UniProtKB/TrEMBL:B5E945"
FT                   /protein_id="ACH37182.1"
FT                   /translation="MNTNMEKVIIPRAEHSVSRSELSPNAVKTLYKLKEQGFTAYLVGG
FT                   GVRDLLLGREPKDFDVVTDATPAQLKKMFRNCRLIGRRFRLAHLHFHDEIIEVATFRST
FT                   VDPSAEAPAEETAEAPSEAAQELPQETVVEAKLLEEEREGRRRRGHHGPSMLKSEDGMV
FT                   LRDNVFGTPEEDAVRRDFTVNALFYNIADFSIIDHVGGMEDLKQGLIRTIGDPLVRFTE
FT                   DPVRMIRAIRFASMLGFNIEERTEAAIEELCGTINKATPPRLYEEVLKLLLLGAGERTY
FT                   QMMRHSGLFAPLFPHFDAWLERESEGYPHARVSKGLEWVDELIGQDEPVSPPLLIALVF
FT                   GEYLEEKIAEFRDGGLPPQQAADAAVAAFAAELTPTVAVPNRVLVAVRDILSLQLRFQK
FT                   TPGRNGRGVIGRPSFLDALQYLRFMGKLTPPKKSLADWWERYAVQQAAGQPTAAAEVPG
FT                   EAEKAPAKKRRRRRRRKPAPMPS"
FT   gene            183750..184052
FT                   /locus_tag="Gbem_0152"
FT   CDS_pept        183750..184052
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0152"
FT                   /product="protein of unknown function YgbA"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37183"
FT                   /db_xref="InterPro:IPR020483"
FT                   /db_xref="UniProtKB/TrEMBL:B5E946"
FT                   /protein_id="ACH37183.2"
FT                   /translation="MENKHKQEKDIRILETFISCYCRSKHNGEKGKLCPECDELLSYAK
FT                   QKREKCPLDPKPTCKHCHVHCYGKVQRAKIKEIMAYSGKHLMLRGRLDLLWHYFF"
FT   gene            184092..184910
FT                   /locus_tag="Gbem_0153"
FT   CDS_pept        184092..184910
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0153"
FT                   /product="iron-sulfur cluster-binding oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37184"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="UniProtKB/TrEMBL:B5E947"
FT                   /protein_id="ACH37184.1"
FT                   /translation="MIRKIVNIDQDKCDGCGLCVPSCAEGAIKIVDGKAQISADNLCDG
FT                   LGACLGDCPRNAITIIERDADEFDEEAVEKHLQAQGVTPKPQAHGHGHGHGHGNGNGLG
FT                   HGHGAHGHGTGHGHGAGHGGGCPGSRVQSFAPAPAQAGSPAAGAVQSQLAQWPVQLHLV
FT                   PVTAPYFKDAELLITADCVPFAYGNYHQDFLAGKAVVVGCPKLDDNNAYLNKLTELFKV
FT                   SGIKGITVLRMEVPCCGGIVMAARQALAASEMEIPFREVTISIRGEIVER"
FT   gene            185027..185629
FT                   /gene="prx-2"
FT                   /locus_tag="Gbem_0154"
FT   CDS_pept        185027..185629
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prx-2"
FT                   /locus_tag="Gbem_0154"
FT                   /product="peroxiredoxin, typical 2-Cys subfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37185"
FT                   /db_xref="GOA:B5E948"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR019479"
FT                   /db_xref="InterPro:IPR024706"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B5E948"
FT                   /protein_id="ACH37185.1"
FT                   /translation="MSLTTLVTKEAPDFTAQAVLPDNSFAELTLSKYRGKYVVLFFYPL
FT                   DFTFVCPSEILAFDKRVEDFKAKNCEVIGVSVDSRFTHLAWKNTSVENGGIGNVQYPLV
FT                   EDLDKSIARSYGILLNESVALRGLFLIDTKGVIRHSVINDLPLGRSVGEALRMLDALQF
FT                   VETHGGEVCPANWQEGEESMKASTEGVAEYLKKKHGK"
FT   gene            185855..186283
FT                   /locus_tag="Gbem_0155"
FT   CDS_pept        185855..186283
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0155"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37186"
FT                   /db_xref="InterPro:IPR023824"
FT                   /db_xref="UniProtKB/TrEMBL:B5E949"
FT                   /protein_id="ACH37186.1"
FT                   /translation="MRTKATMLSLLLVMLFATSSFAIEGQQPEAIAEKMAFKLVRGVTN
FT                   VATSIVEIPKQSYLTVRDRGAVGYVVGPLKGFGMGVYRLFTGLTETVFFAVPQPGYYDP
FT                   MIQPEFVWEGWDAKRVEPRAQTVAVPAEPAEPAEKKGD"
FT   gene            186289..186657
FT                   /locus_tag="Gbem_0156"
FT   CDS_pept        186289..186657
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0156"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37187"
FT                   /db_xref="InterPro:IPR023824"
FT                   /db_xref="UniProtKB/TrEMBL:B5E950"
FT                   /protein_id="ACH37187.1"
FT                   /translation="MRKYVVVMALLVLALAGAVDMAQADDRNVDSAAPQDVVDGMANKL
FT                   VRGVANIGTGWMEFPKQIYLTCRDDGFAKGLTVGPLKGIGMTVVRTVAGAGETATFFLA
FT                   YPGFYDPYFDPAYVWQKE"
FT   misc_feature    186796..186837
FT                   /note="conserved nucleotide sequence; Gbem_R5007"
FT   misc_feature    186842..186897
FT                   /note="conserved nucleotide sequence; Gbem_R5008"
FT   gene            complement(187036..187269)
FT                   /locus_tag="Gbem_4063"
FT   CDS_pept        complement(187036..187269)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_4063"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_4063"
FT                   /db_xref="EnsemblGenomes-Tr:ADO00761"
FT                   /db_xref="UniProtKB/TrEMBL:E1P666"
FT                   /protein_id="ADO00761.1"
FT                   /translation="MKKVMSSIVAALVAVAFAGVVFAADAAPAAAPAAEVKKEEKAPAK
FT                   KAAPKKKKAAKKAAAKKEVKKEEAPAAAPAAK"
FT   gene            187556..190042
FT                   /locus_tag="Gbem_0158"
FT   CDS_pept        187556..190042
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0158"
FT                   /product="radical SAM domain iron-sulfur cluster-binding
FT                   oxidoreductase, DUF2344-containing"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37189"
FT                   /db_xref="GOA:B5E952"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR018768"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR023862"
FT                   /db_xref="UniProtKB/TrEMBL:B5E952"
FT                   /protein_id="ACH37189.1"
FT                   /translation="MSNNILLSVEKPARYMGGEMGTVSGREGALEFVLAFPDVYEIGMS
FT                   HLGLQVLYGVLKEVPWIMPERAYAPWPDLEESLRTQGKPLVTLERSLPLIEADVVGFTL
FT                   QYELSYTNILNMLDLSGIPLLASERNEGYPLILGGGPCAYNPEPLADFFDAFLIGDGED
FT                   AIVEIADCVRQWKEEKLPKSVLLEQLARIQGVYVPCFFEVSYRPDGAVEKIAPLLAGYG
FT                   SVKRRFVADLESAYYPTSPVVPFLKTVHDRVSVEISRGCTRGCRFCQAGYIYRPVRERS
FT                   PERVLEIVEETLGNTGYDEVSLLSLSTGDYGCLTPLLKGLMDRYASQKKAVSLPSMRVG
FT                   SLSPEMAEEIRRVRKTGFTLAPEAGSERLRRVINKGITEEALLENARAVYSNGWRLIKL
FT                   YFMIGLPTETMEDLDRIVEISREVKRQGKFAGNGGDVNVSVSSFVPKPHTPFQWEPQIT
FT                   EEEIVDKQRHLRGELKKKKLIMKWQDASLSGMEGVFARGDRRLSRLLIEAHRLGCRFDG
FT                   WWEHFDRLKWAQAFEASGIDASFYLRRRETDELLPWDHIDCGVKKEFLLAELAAALKET
FT                   ATPDCRFDKCTGCGVCDFDQIKLRLKDPVPFDTYATESAPEAPVEEAQRIRIRFEKVGR
FT                   MRFLSHLEMLTLFTRAVGRSGIPIRYSQGFHPHPKFSFATALSVGIVSYAEYMDFEVNA
FT                   GYTAAELERALNGSLPEGVRVLEATEIPLRAPALSVIMDKVRYRVTLPEELAHDLQAKV
FT                   EAFLALESSPLKREKKGKSTEFDLRHELAELKVEGSALEMVVGRGKPVEFTCAILDVQP
FT                   EALKEARLEKLEVLFS"
FT   misc_feature    190211..190234
FT                   /note="heptanucleotide repeats; Gbem_R7060"
FT   gene            190285..191775
FT                   /gene="cafA"
FT                   /locus_tag="Gbem_0159"
FT   CDS_pept        190285..191775
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cafA"
FT                   /locus_tag="Gbem_0159"
FT                   /product="ribonuclease G"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37190"
FT                   /db_xref="GOA:B5E953"
FT                   /db_xref="InterPro:IPR004659"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019307"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/TrEMBL:B5E953"
FT                   /protein_id="ACH37190.1"
FT                   /translation="MGNELVINTTSHETRIALIENGTIAELYVERSRVKGIIGNIYKGR
FT                   VVRVLPGMQAAFVDIGLEKAAFLYVADVFDAMDEYDSYIEGEQGDEPMPHPLHPIEELL
FT                   QEGQELLVQISKEPIGTKGARITAHISLPGRHLVYMPTVDHVGISRRIEDEAERERLKE
FT                   IVDRIKPVGGGFIVRTVSDGKSEEDLVADLHYLTKLWDEIAKKKDKAGAPTLIHSDLDV
FT                   TQKVVRDILTESVERIVVDSKPEYDKIVQFISTFMPKMKYSIELYDEEEPIFDHFGLEV
FT                   EISRALGRKVWLKSGGYIIIEQTEALTAIDVNTGRYVGKHNLEDTILKTNLEAVKEIAY
FT                   QLRLRNLGGIIIIDFIDMEKEVNREKVYGALEEALKSDKSKTNILKISELGLVEMTRKR
FT                   VRESLGRMMCEPCPYCEGRGYVKSKISVCHEIFRELRREMLDIRGTKVMLTVHPQVADL
FT                   LYDEERRGLEELEKNFKKRITVRAKPGFHQEQFEVAVS"
FT   gene            191810..192988
FT                   /gene="purT"
FT                   /locus_tag="Gbem_0160"
FT   CDS_pept        191810..192988
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purT"
FT                   /locus_tag="Gbem_0160"
FT                   /product="phosphoribosylglycinamide formyltransferase,
FT                   formate-dependent"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37191"
FT                   /db_xref="GOA:B5E954"
FT                   /db_xref="InterPro:IPR003135"
FT                   /db_xref="InterPro:IPR005862"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:B5E954"
FT                   /protein_id="ACH37191.1"
FT                   /translation="MIGTPLKNSATRMMLLGSGELGKEVALEAQRLGIEVIAVDRYADA
FT                   PAMQVAHRSHVIDMLDREQLDRVVRLENPSLIVPEIEAINTVYLLELEKEGFNVIPTAR
FT                   AANLTMNREGIRRLAAEELGLPTAAYRFATSMDEFREAVAAIGLPCVVKPIMSSSGKGQ
FT                   SVLRDAADLERCFKYAMEGARGASDKVIVEQFIPFDYEITLLTVRHAGGTSFCPPIGHR
FT                   QIDGDYHESWQPTPMVPAVLAEAQRQAEAVTGALGGRGIFGVEFFVTGDKVWFSEVSPR
FT                   PHDTGMVTMISQNLSEFELHVRAILGLPVPQVESLGCAASHVILSEGQAAEVAFEGVAK
FT                   ALEIPGSKLRLFGKPDTRKGRRMGVALAFGADCDEARQKAEQSAHCVGIVKR"
FT   gene            193040..193342
FT                   /locus_tag="Gbem_0161"
FT   CDS_pept        193040..193342
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0161"
FT                   /product="ferredoxin, Rieske superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37192"
FT                   /db_xref="GOA:B5E955"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:B5E955"
FT                   /protein_id="ACH37192.1"
FT                   /translation="MVFAAKVSEVPEFGKKLVEAGGVQVLLVKTKGTVYACEAECPHQG
FT                   APLQGAFIKEAGRLSCPRHGYRFDLATGACADHQEYTLKVYPVEIRGDEVFVEVG"
FT   gene            193461..193769
FT                   /gene="rplU"
FT                   /locus_tag="Gbem_0162"
FT   CDS_pept        193461..193769
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplU"
FT                   /locus_tag="Gbem_0162"
FT                   /product="ribosomal protein L21"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37193"
FT                   /db_xref="GOA:B5E956"
FT                   /db_xref="InterPro:IPR001787"
FT                   /db_xref="InterPro:IPR018258"
FT                   /db_xref="InterPro:IPR028909"
FT                   /db_xref="InterPro:IPR036164"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5E956"
FT                   /protein_id="ACH37193.1"
FT                   /translation="MYAVVKTGGKQYKVSEGDFLKVEKLEGAVGDTVEFSEILMVGGDK
FT                   VVIGTPLVPSASVVGKIVEQGKDKKILVFKSKRRKNTRKLNGHRQLRTILKIEKINA"
FT   gene            193837..194094
FT                   /gene="rpmA"
FT                   /locus_tag="Gbem_0163"
FT   CDS_pept        193837..194094
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmA"
FT                   /locus_tag="Gbem_0163"
FT                   /product="ribosomal protein L27"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37194"
FT                   /db_xref="GOA:B5E957"
FT                   /db_xref="InterPro:IPR001684"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5E957"
FT                   /protein_id="ACH37194.1"
FT                   /translation="MAHKKGVGSSRNGRDSDGQRLGCKKFGGEAVKAGNIIYRQHGTKI
FT                   HPGNNVGLGKDYTLFALIEGVVKFERMGKDRKKVSVYPAN"
FT   gene            194169..195185
FT                   /gene="obgE"
FT                   /locus_tag="Gbem_0164"
FT   CDS_pept        194169..195185
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="obgE"
FT                   /locus_tag="Gbem_0164"
FT                   /product="ribosome biogenesis GTPase ObgE"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37195"
FT                   /db_xref="GOA:B5E958"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR006074"
FT                   /db_xref="InterPro:IPR006169"
FT                   /db_xref="InterPro:IPR014100"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031167"
FT                   /db_xref="InterPro:IPR035101"
FT                   /db_xref="InterPro:IPR036726"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5E958"
FT                   /protein_id="ACH37195.1"
FT                   /translation="MSFIDEVKINVKSGDGGAGCVSFRREKFIPLGGPDGGDGGKGGDV
FT                   IVKVSSHLSTLLDLRQHPHQKAGRGKNGMGSDRHGANGHTLEILVPQGTVIKDAETGEI
FT                   LADLAEPDSSMVLLKGGRGGQGNARFKTATHKAPKFAQPGEPGEERWIRMELKLMADVG
FT                   LLGMPSVGKSSLIAKISAARPKIAEYHFTTLKPSLGVVQYKNYRSFVMADIPGLIEGAS
FT                   EGAGLGHRFLKHLERTGQLLHLLDLSWMPDRDPIAEYEAINRELALFNPELADKRQTVV
FT                   VNKIDLPHVRENLKEILPYFEERGIKVFPISAATGEGIPELLDDIAFNLWGEPEETW"
FT   gene            complement(195259..195585)
FT                   /locus_tag="Gbem_0165"
FT   CDS_pept        complement(195259..195585)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0165"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37196"
FT                   /db_xref="UniProtKB/TrEMBL:B5E959"
FT                   /protein_id="ACH37196.1"
FT                   /translation="MKELSFAEVVERSVQIRKRYHLLERELHGKEWSVEEDALAFLTDA
FT                   GLVGRLTMSQQGRWPTDGETMPELEHKLGECIWWLAVLAERMEININEALENFLTKTEK
FT                   LLKN"
FT   gene            complement(195654..197048)
FT                   /gene="nuoN-2"
FT                   /locus_tag="Gbem_0166"
FT   CDS_pept        complement(195654..197048)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nuoN-2"
FT                   /locus_tag="Gbem_0166"
FT                   /product="NADH dehydrogenase I, N subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37197"
FT                   /db_xref="GOA:B5E960"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="InterPro:IPR010096"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5E960"
FT                   /protein_id="ACH37197.1"
FT                   /translation="MIIPDLHTIMPIIITGVGALVVLLCGPLLLSGTTSSIAAVTAAAA
FT                   GLWAIFTAPSAVPAVAGLTFTPLAQFLIPLFCAAALLTLLLSHGYNENRAIKGEEYPAT
FT                   VLFALFALCVLPCASNLLILFLAIESVSFAFYILVTMDLQRAESGEAGLKYLLMGAVAA
FT                   AFTAFGFALIFAGSGTLELAGAVPHADNRAIVAAGWGVVIMGMAFKLSLVPAHLWTPDV
FT                   YQGAPAPVAAFLSTSSKVAAASLLLMLLTFSPPMPELRIPLVLLSLLSMVVGNLAALRQ
FT                   QNIKRMLAYSSIAHMGYLTLALLTGTREGYAALLLYGAIYTAMNLAAFGAIASLSLEKE
FT                   RDQIADYSGLGFSAPLRGGVLALAMLALAGLPPTGGFIGKFFIFYSAIKGGETALAIVG
FT                   IISAAVSSFFYLKVVASLYMHRSSSPAPRAAAAADAVALCCAAAFILLLGVFPAPLLRL
FT                   VDAALQ"
FT   misc_feature    complement(197073..197099)
FT                   /note="nonanucleotide repeats; Gbem_R9003"
FT   gene            complement(197130..197471)
FT                   /locus_tag="Gbem_0167"
FT   CDS_pept        complement(197130..197471)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0167"
FT                   /product="PDDEXK_3 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37198"
FT                   /db_xref="InterPro:IPR026350"
FT                   /db_xref="UniProtKB/TrEMBL:B5E961"
FT                   /protein_id="ACH37198.1"
FT                   /translation="MDPNLVTGHIIDAAMKVHTALGPGLLESAYEACLLYELHKRKMAA
FT                   SSQIILPVRYDGLKIDVGYRMDLLVENKVVVELKSVDFLQPIHTAQLLTYLKLSGKDLG
FT                   CLLTSMSLT"
FT   misc_feature    197477..197514
FT                   /note="nonanucleotide repeats; Gbem_R9004"
FT   gene            complement(197520..199004)
FT                   /gene="nuoM-2"
FT                   /locus_tag="Gbem_0168"
FT   CDS_pept        complement(197520..199004)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nuoM-2"
FT                   /locus_tag="Gbem_0168"
FT                   /product="NADH dehydrogenase I, M subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37199"
FT                   /db_xref="GOA:B5E962"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="InterPro:IPR003918"
FT                   /db_xref="InterPro:IPR010227"
FT                   /db_xref="UniProtKB/TrEMBL:B5E962"
FT                   /protein_id="ACH37199.1"
FT                   /translation="MTPDFPILSVLVFLPLAASLLLVALRPAQALARGFALAVALVELA
FT                   LAAFPLLGTSLSATYPSAPKGFFLFEDLPWIERFGIRYTLGMDGISQIMVLLTSFITVV
FT                   AVLISWKQIKERAPVYYALLLALQCSIQGVFLSLDLFLFYLFFEAMLIPIVFLSGVWGD
FT                   GRPVYSAIKFFLYTFVGSLLMLVSIITLYLMHGAQTGSYTFALPALVQTSVPYGLALWL
FT                   FAGFLVAFAVKIPLFPLHSWQPDAYADAPIAGTLILASLLSKTGAYGLIRFAYPLFPEA
FT                   ARAFTPVLYLAAVFVISYGAWIAFAQKDMKRLVAYSSLSHMGFIALGIAAWSPLALSGA
FT                   LLQMVNHAVTTGALFVVVGMLDERAGSRDLPAYGGIWEKVPALSFFFLFFCMASAGLPG
FT                   LNNFVGEFLVLVGAFKVAPAAALGAFLGIVLTLIYTVRLVQEVLFVRERKPLELKDLTM
FT                   REAGVLAILALVAVYLGVHPSPVLELFKGPIALLVK"
FT   gene            complement(199020..200891)
FT                   /gene="nuoL-2"
FT                   /locus_tag="Gbem_0169"
FT   CDS_pept        complement(199020..200891)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nuoL-2"
FT                   /locus_tag="Gbem_0169"
FT                   /product="NADH dehydrogenase I, L subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37200"
FT                   /db_xref="GOA:B5E963"
FT                   /db_xref="InterPro:IPR001516"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="InterPro:IPR003945"
FT                   /db_xref="UniProtKB/TrEMBL:B5E963"
FT                   /protein_id="ACH37200.1"
FT                   /translation="MQTYLSLMLLFPLFGSVVCALAGRKLPRVLVEVLACATVWGSFAC
FT                   AALAAAAYGAPQTVIIARWFASSDLQIPVSLYLDPLSLSLSLMVGFVCGLIHIYSVFYM
FT                   RGDEDYARYFALLNLFVFAMLALVLAESLPLLYLGWEGVGFCSYLLIGFWYRDKDNADA
FT                   GRKAFITTRIGDTALMVALAWLFQLFGTLSITQLNGMGFLMPGSIITALGILFLIAAMG
FT                   KSAQVPLMVWLPDAMAGPTPVSAMIHAATMVTAGVYLLARMLPLIGSSPTAMAAIAVTG
FT                   GVTAFYGATCALAQRDLKRVLAFSTISQIGYMMLGVGAGAVTAATFHLLVHAFFKALLF
FT                   LGAGCVITAMHHEQDIFKMGGLRRTLPVTFWSFLAGAACLAGLPLTGGFFSKDSILLAV
FT                   WHKGGLLYQSLYLFALLTALITAYYTFRMVYLVFGGSSHAAHETGGLKTMQAVLIPLAL
FT                   LALFGGMLDLPAYLGEGFLGSLFAGVPGGKMVEGPGNEEMALQAIAGALALAGLVAAHV
FT                   RYGRGREQRIEEAGDESPLFAFLLKGWYFDALYDMLLVRPYQAAARVLWQKVDERMIDD
FT                   SLDRLAGGVGWTGTWLGRWSTGRVSIYLLSFAAGVAFMIGYLAWIFI"
FT   misc_feature    200950..200985
FT                   /note="nonanucleotide repeats; Gbem_R9005"
FT   misc_feature    201009..201046
FT                   /note="nonanucleotide repeats; Gbem_R9006"
FT   gene            complement(201055..201363)
FT                   /gene="nuoK-2"
FT                   /locus_tag="Gbem_0170"
FT   CDS_pept        complement(201055..201363)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nuoK-2"
FT                   /locus_tag="Gbem_0170"
FT                   /product="NADH dehydrogenase I, K subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37201"
FT                   /db_xref="GOA:B5E964"
FT                   /db_xref="InterPro:IPR001133"
FT                   /db_xref="InterPro:IPR039428"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5E964"
FT                   /protein_id="ACH37201.1"
FT                   /translation="MTIPLYEVLILASILFAMGLACVVAWRANVIMMLIGIEIMLNAVM
FT                   LTFVGGSAHWGIAEGQVFSLMIMALTSAEVSLALAMVAYLHRRKQSVDTDDFSSMKG"
FT   gene            complement(201360..201842)
FT                   /gene="nuoJ-2"
FT                   /locus_tag="Gbem_0171"
FT   CDS_pept        complement(201360..201842)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nuoJ-2"
FT                   /locus_tag="Gbem_0171"
FT                   /product="NADH dehydrogenase I, J subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37202"
FT                   /db_xref="GOA:B5E965"
FT                   /db_xref="InterPro:IPR001457"
FT                   /db_xref="InterPro:IPR042106"
FT                   /db_xref="UniProtKB/TrEMBL:B5E965"
FT                   /protein_id="ACH37202.1"
FT                   /translation="MERTIFYILAAVTVIGTLCAITARQAVRAIVYLVTSFFALALIFY
FT                   LLGAPFVAALEVIIYAGAIMVLFLFVIMMVEVASPEKLAKPAFSDWWPALVLVLVVVAS
FT                   LTVLVTGQAPPVPGAGAQTVRQFSQVLFTRYGVAIELVSMQLLFALVGALYLGRRR"
FT   gene            complement(201864..202394)
FT                   /gene="nuoI-2"
FT                   /locus_tag="Gbem_0172"
FT   CDS_pept        complement(201864..202394)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nuoI-2"
FT                   /locus_tag="Gbem_0172"
FT                   /product="NADH dehydrogenase I, I subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37203"
FT                   /db_xref="GOA:B5E966"
FT                   /db_xref="InterPro:IPR010226"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:B5E966"
FT                   /protein_id="ACH37203.1"
FT                   /translation="MPILTDIKEILTGLSITFSHIWRKPVTVQFPEEQRPMPPRFRGSI
FT                   VLTRDPDGAERCVACYLCSGACPVDCISMAAAEGENGRRYAAWFRINFSRCILCGMCAE
FT                   ACPTLAIQMSPEMFRCKRQVMDMVYEKEDLLIDGTGKDPEYNYYRHAGIGVVQPRGSSP
FT                   SEQEPADPRSLLP"
FT   gene            complement(202522..202971)
FT                   /locus_tag="Gbem_0173"
FT   CDS_pept        complement(202522..202971)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0173"
FT                   /product="ankyrin repeat protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37204"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="InterPro:IPR036770"
FT                   /db_xref="UniProtKB/TrEMBL:B5E967"
FT                   /protein_id="ACH37204.1"
FT                   /translation="MTTTVEVELGAGFRAQVDAVDRNGHTALMDAAKAGNVTKVNDLLE
FT                   RGANLSTRSGKGKTALHFAAAHGSAEVVRLLLSKGAEVDARDRDGHTPLMLAANYGCTV
FT                   TTQLLVTSGADPLAMSYSGSTALVYAENNCHKQTLDVLLKSLRPN"
FT   gene            complement(203018..204010)
FT                   /gene="nuoH-2"
FT                   /locus_tag="Gbem_0174"
FT   CDS_pept        complement(203018..204010)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nuoH-2"
FT                   /locus_tag="Gbem_0174"
FT                   /product="NADH dehydrogenase I, H subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37205"
FT                   /db_xref="GOA:B5E968"
FT                   /db_xref="InterPro:IPR001694"
FT                   /db_xref="InterPro:IPR018086"
FT                   /db_xref="UniProtKB/TrEMBL:B5E968"
FT                   /protein_id="ACH37205.1"
FT                   /translation="MTTWDALDIALMLGKIVVLFAIILTLAAYMVLAERRILGWIQDRI
FT                   GPNRVGPFGLLQPLADVIKMLTKEDMIPKAADRFLFSVAPAMAAIPAILTFAIIPLGAP
FT                   TVLFGHEVNLQIADLDVGVLVFLALSSIAVYGVALGGWASNSKYALLGSIRGLSQLISY
FT                   ELSMGLSLVPVVMLAKSLRLSDIVNAQAQMPFIVYQPLAFAIFLVSILAECRRIPFDLP
FT                   EAEGELVAGFHTEYSGMRFGLFFVGEYINIISLSALASLFFLGGWRGPLLPPILWFFIK
FT                   VGLFAFVFIWVRGTLPRLRYDQLMHLGWKFLTPLALLNILATGWWLALR"
FT   gene            complement(204007..205953)
FT                   /gene="nuoG-2"
FT                   /locus_tag="Gbem_0175"
FT   CDS_pept        complement(204007..205953)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nuoG-2"
FT                   /locus_tag="Gbem_0175"
FT                   /product="NADH dehydrogenase I, G subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37206"
FT                   /db_xref="GOA:B5E969"
FT                   /db_xref="InterPro:IPR000283"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR006963"
FT                   /db_xref="InterPro:IPR019574"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:B5E969"
FT                   /protein_id="ACH37206.1"
FT                   /translation="MPKLIIDDIPVEVPPGTSVLEAARSVGITIPHFCYHPALAIAAAC
FT                   RLCAVKLLDGPVKGIQMSCSLPAQDGMVVSTTDPEALKMRSLVIEWLMLNHPHDCPVCD
FT                   EGGECLLQDFTIAGGHSRRRYVGKKRTFQNQYLGEGIHHEMNRCIECYRCVRFYQEYAG
FT                   GTDFGVTGSAGRVYFGRFAEGALESPFSGNLVDICPTGVFTDKTGRFRARYWDYEFAPA
FT                   VCQHCSVGCNTSPQNFQRELIKIVARRNDQVNGWFICDRGRFDKEYLNGPQRPRYPEIG
FT                   GAPGEYRLALEAAANRISEFCLQNGPAGLAFVGSGRLSLEGCLVLAELARVVGAPVSYF
FT                   AEAAPAQGSLAAVRLLNEQNAARIHDIEKAECIALFELDLMEEGAMLSLAVRKASLAGA
FT                   QVFRVGGAREGEKRQLPFRYQEVATLDEVPFEGGSKGVVICGAGGKSPELLSYLASSGA
FT                   RLVMLQPGPNAFGAALVSLERKGATLSDLVESGQIKAVVCFEADLPPWLLERVEVLACA
FT                   DWKRGGLTEKASVLLPTTTWVESNGTSINYEGRAQRFLRSRPAGLPLKGLDPKYYSSET
FT                   EAVALHPPHVHRNYIPGGAEREAWRVMADLMLELGGEPVNEPLTGTWGKLRDLDPEGEG
FT                   VRIYDLVSAQELS"
FT   gene            complement(205979..207244)
FT                   /gene="nuoF-2"
FT                   /locus_tag="Gbem_0176"
FT   CDS_pept        complement(205979..207244)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nuoF-2"
FT                   /locus_tag="Gbem_0176"
FT                   /product="NADH dehydrogenase I, F subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37207"
FT                   /db_xref="GOA:B5E970"
FT                   /db_xref="InterPro:IPR001949"
FT                   /db_xref="InterPro:IPR011538"
FT                   /db_xref="InterPro:IPR019554"
FT                   /db_xref="InterPro:IPR019575"
FT                   /db_xref="InterPro:IPR037207"
FT                   /db_xref="InterPro:IPR037225"
FT                   /db_xref="UniProtKB/TrEMBL:B5E970"
FT                   /protein_id="ACH37207.1"
FT                   /translation="MDLPLFRHNRRDRSVAFKEYRSEGGFEALKRAITGMTPAEVQQTV
FT                   IDSGLRGRGGAGFPTGKKWSFVPRDLPGPRWIICNCDEMEPGTYKDRVLLEHNPYSLIE
FT                   GMTLACYALGVRHGFIFIRKGYEQAAENLARAIDEAKKEGFLGERILGSEHSIDIDLHL
FT                   SAGRYICGEETALINALEGKRPNPRQKPPFPAVKGLWAGPTVVNNVETLANIPGILARG
FT                   AAWFKGLAMNPEGAGSKLFCVSGSVKDRACVELPIGIPLGDIIDGPCGGMRLGKRFKAC
FT                   IPGGASTQFLTAEHLKVPMDYDPVAKVGSRLGSGGIIVFDQDHCLVEATLNLITFFARE
FT                   SCGWCTPCREGLPYVREILTRIETGYGKEDDIAILREHIKYLNYSFCALAPGAMAPLDG
FT                   LLRHFEDEVREHIVKKKCPLKK"
FT   gene            complement(207254..207724)
FT                   /gene="nuoE-2"
FT                   /locus_tag="Gbem_0177"
FT   CDS_pept        complement(207254..207724)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nuoE-2"
FT                   /locus_tag="Gbem_0177"
FT                   /product="NADH dehydrogenase I, E subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37208"
FT                   /db_xref="GOA:B5E971"
FT                   /db_xref="InterPro:IPR002023"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR041921"
FT                   /db_xref="InterPro:IPR042128"
FT                   /db_xref="UniProtKB/TrEMBL:B5E971"
FT                   /protein_id="ACH37208.1"
FT                   /translation="MISEALKKSLTERVAGAITPREAAVDVMKELQAHYGWLTDEAVAE
FT                   AASLLGLSPLQVEELATFYEMIYRRPVGKKVIHVCDSISCWCADCDGIIEHLKKRLGVE
FT                   LGGTTADGMYTLLPCACMGRCGDSPAMSVGGTPYGHLTPHLVDEILEKERRA"
FT   gene            complement(207747..210131)
FT                   /gene="nuoBCD"
FT                   /locus_tag="Gbem_0178"
FT   CDS_pept        complement(207747..210131)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nuoBCD"
FT                   /locus_tag="Gbem_0178"
FT                   /product="NADH dehydrogenase I, B/C/D subunits"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37209"
FT                   /db_xref="GOA:B5E972"
FT                   /db_xref="InterPro:IPR001135"
FT                   /db_xref="InterPro:IPR001268"
FT                   /db_xref="InterPro:IPR006137"
FT                   /db_xref="InterPro:IPR006138"
FT                   /db_xref="InterPro:IPR010218"
FT                   /db_xref="InterPro:IPR014029"
FT                   /db_xref="InterPro:IPR020396"
FT                   /db_xref="InterPro:IPR022885"
FT                   /db_xref="InterPro:IPR029014"
FT                   /db_xref="InterPro:IPR037232"
FT                   /db_xref="InterPro:IPR038290"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5E972"
FT                   /protein_id="ACH37209.1"
FT                   /translation="MSQGDDDKIPENVLLASLDDMINWGRANSLWPMFFGLSCCFVEMM
FT                   TSFTSRYDVSRFGAEVLRGTPRESDLMVIAGTVFKKMAPSILRLYDQMAEPKWVISMGS
FT                   CANSGGMYDVYSVVQGVNQILPVDLYIPGCPPRPESFLEGLMLLQQKIRSEERPTRPVL
FT                   RMQGGTQGTVAPILVDGATKSRDTRGPGMEGIAIRGSAMQPPYFAAPRSDELWRPKQPR
FT                   LPYPDFNLQAELQGAFAGQVVLDETACDMLTYRAPARLVPELLRHLKERKESPFRRLED
FT                   IACVDESCRRDREKYKDFTVNYHLTCFDTPGRIRIKTELEGSYPEAPSITSVFPVANWY
FT                   EREAYDMFGIRFAGHPNLRRILMPPDWDGHPLRKEHPARATELPPYTAEDARRQKALPA
FT                   GDFFDRVDDETLILNLGPQHPGTHGVIRFVLKLSGEEIVDMDSDIGYHHRAAEKTGERQ
FT                   NWHQYIPYTDRVDYLSGVQNNLAYLNSVETLCGIEIPDRAIYIRVMLCELFRIANHLVW
FT                   LGTFASDLGAMTPVFYTFTDREKIFDIVEFITGGRMHPAWFRIGGVAEDLPEGWQEKVH
FT                   SFLEWFPGRLAEYEKLLSGNPIFVARLKGVSAITVDTALEWGITGPNLRACDFAWDLRK
FT                   KMPYGGYDRFEFEVATAQGGDCYARYQVRMEEMRQSLSIVRQAAAGMPGGRFISPDYRY
FT                   TLPQKRDALEDIESLIHHFVNSTRGISPPKGECYAPIEGSKGEYGYFAVSDGLHTAYRM
FT                   RIRTATFPHIQSLPVLSRGWLVSDFLAILGSLDFVLSDLDR"
FT   gene            complement(210128..210532)
FT                   /gene="nuoA-2"
FT                   /locus_tag="Gbem_0179"
FT   CDS_pept        complement(210128..210532)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nuoA-2"
FT                   /locus_tag="Gbem_0179"
FT                   /product="NADH dehydrogenase I, A subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37210"
FT                   /db_xref="GOA:B5E973"
FT                   /db_xref="InterPro:IPR000440"
FT                   /db_xref="InterPro:IPR023043"
FT                   /db_xref="InterPro:IPR038430"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5E973"
FT                   /protein_id="ACH37210.1"
FT                   /translation="MPVTAQQVELIPLAIYTLFAVGLIGILLLAARYLGSGKETSEKHI
FT                   PFESGMVPTGNARHASQVPFYLIAIFFIVFDVEGAFILAWATSWDLLGIPGLVHITLFI
FT                   TVLLLGLVWLWMKGGLDWGPSAMRARGKRS"
FT   gene            complement(210641..211816)
FT                   /locus_tag="Gbem_0180"
FT   CDS_pept        complement(210641..211816)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0180"
FT                   /product="GspIIEN domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37211"
FT                   /db_xref="InterPro:IPR007831"
FT                   /db_xref="InterPro:IPR037257"
FT                   /db_xref="InterPro:IPR042181"
FT                   /db_xref="UniProtKB/TrEMBL:B5E974"
FT                   /protein_id="ACH37211.1"
FT                   /translation="MRLGELLVDAGKITPTQLEETLKGQAIFGGRFGTNLVEMGYLDEQ
FT                   ELAHFLSQKTGIAHTSPEQLMEIPPHVVGAVPEEYVRKYRVMPVALNNRKLTLAMLDPS
FT                   DFQAIDEIAFATGYIVVPVIAPELRMLSAMEKYYGIKRELRYISVEGLSRNRAHNAAPA
FT                   AQPRPAAAAASHPLPAPEEDLWLSAEEAEILELPSLDESECFGDLSAEPSLDPLAGSSL
FT                   YQSAPEKDYSLDGVLTGLAHAGERDQIADLVVGHLGQQFRRVAIFLIKGGKATGWLAQV
FT                   DSKLVPGFETVEIPQFEPSVLQLVEETKSFYLGPLLSTTGNARLLDALGGGASPQNLLV
FT                   PLLMMGRVVAVLYVDGGNLPLDPELPQLQKLMAKASMAFEILILKSKILIT"
FT   misc_feature    212153..212188
FT                   /note="conserved nucleotide sequence; Gbem_R4006"
FT   gene            complement(212221..213225)
FT                   /gene="acuI"
FT                   /locus_tag="Gbem_0181"
FT   CDS_pept        complement(212221..213225)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="acuI"
FT                   /locus_tag="Gbem_0181"
FT                   /product="NADP-dependent menaquinol:acrylyl-CoA
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37212"
FT                   /db_xref="GOA:B5E975"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR014188"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B5E975"
FT                   /protein_id="ACH37212.1"
FT                   /translation="MAAERFDALVVEEEAPGSFTRRIKSRSIDELPPGELLVKVRYSSL
FT                   NYKDALSALGRPGVTKNYPHTPGIDAAGEVVSCSDGAFKSGEKVIVTGYDLGMNTPGGY
FT                   GQYIRVPSAWGVRLPEGLSLKESMAIGTAGLTAGLSLQKLVQAGVRPEHGEILVTGATG
FT                   GVGSVAVTLLAQAGYQVVAVTGKARETEFLTGLGARQVLNRDAFLQNSDRPLLKERWAG
FT                   VIDVVGGPMLAAAIKSTGYGGVVTCCGLAGSAELPLNVFPFILRGVSLLGVDSAQAPST
FT                   VRNEVWQRLAGDWKPQRILEQVQEVPLAQLEQKFDAILKGELRGRTVVNLAPR"
FT   gene            complement(213248..213703)
FT                   /locus_tag="Gbem_0182"
FT   CDS_pept        complement(213248..213703)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0182"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37213"
FT                   /db_xref="GOA:B5E976"
FT                   /db_xref="InterPro:IPR001437"
FT                   /db_xref="UniProtKB/TrEMBL:B5E976"
FT                   /protein_id="ACH37213.1"
FT                   /translation="MHQLIIERLATDLAVLTNAARAAHEAATHEENIPDNKYDTLSLEA
FT                   SYVAQGQANRAQEIRRALHAYRSLELQEFSAGQAIRLTALVTLEGEDGGGKTFFIGPQE
FT                   GGLKLEIEGKEVVVITLGSPMGQELIGKSAGDEARIGRVAYEIVAVS"
FT   gene            complement(213829..214377)
FT                   /locus_tag="Gbem_0183"
FT   CDS_pept        complement(213829..214377)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0183"
FT                   /product="[lipopolysaccharide]-lipid A 3-O-deacylase outer
FT                   membrane protein, PagL family"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37214"
FT                   /db_xref="InterPro:IPR018550"
FT                   /db_xref="UniProtKB/TrEMBL:B5E977"
FT                   /protein_id="ACH37214.1"
FT                   /translation="MKTSGYLLLTLLFLGLCHSSPALAEGGWGPFGIRGGFAAESKDRN
FT                   TTQYEVFGEYELPWSLRSKGGWGISTRLALTAGALKSQGQYGFVGSLGPAFSLGNPQLF
FT                   PLELDLGVSVALLSRERFGTRDYNGIEQFSSHGGFIYHINRNLGLSYRYQHMSNAGFNG
FT                   RQNPGLNMHLFGINWYPDR"
FT   gene            214595..214966
FT                   /locus_tag="Gbem_0184"
FT   CDS_pept        214595..214966
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0184"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37215"
FT                   /db_xref="UniProtKB/TrEMBL:B5E978"
FT                   /protein_id="ACH37215.1"
FT                   /translation="MKGYELVKQIREEKGHHPERMFIKWWRNEEDFIDFDLVSRFLDTL
FT                   KESSKIDGFELIGQDEMWRTVQARCKGRVTKEQREGDWVLRWTPPEGKEVEEKQREYLY
FT                   TPESLLKILDQETNYNYVD"
FT   gene            complement(215097..217355)
FT                   /gene="priA"
FT                   /locus_tag="Gbem_0185"
FT   CDS_pept        complement(215097..217355)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="priA"
FT                   /locus_tag="Gbem_0185"
FT                   /product="primosomal protein N', ATP-dependent helicase"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37216"
FT                   /db_xref="GOA:B5E979"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR005259"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040498"
FT                   /db_xref="InterPro:IPR041222"
FT                   /db_xref="InterPro:IPR041236"
FT                   /db_xref="InterPro:IPR042115"
FT                   /db_xref="UniProtKB/TrEMBL:B5E979"
FT                   /protein_id="ACH37216.1"
FT                   /translation="MQTPVPHIVEVAIPLPLEGSFHYLVPARLSPQVASGKRVLVPFGR
FT                   RKVTGYLLGDTDAPGAGELKEVLDILDEEPLFTASELDFYRWIAGYYLHPLGEVIKMAL
FT                   PAGINLVSRYRCEQGEDGTPVLKEFLAGGRNVRTERYFLPVADEERRPRGKGLEILEYL
FT                   LEIGECPAADLRKRFGNCTPQLNRLVQLGCARVEAREVYRDPFRSQEYQHDGPLPLNLA
FT                   QSESLTRLTAAIEASAFSPFLLHGVTGSGKTEVYLQSIAVALAAGRSALVMVPEIALTP
FT                   QLVGRFKRRFDCGIAVLHSGLSDGERYDEWRRIRRGEASIVIGARSALFAPLTEVGVIV
FT                   VDEEHEGSYKQSEGVRYNARDLALVRGKLAGAVVILGSATPLVTSYHAAMNGKLGYLQL
FT                   PDRVRELPMPQTEMLDARRQKGEVFLPPLIEAMGENLDNGGQTLLFLNRRGFATYLVCE
FT                   SCGHVLRCPNCEVTLTFHRLKGKHVCHYCDFSMLPPKNCPHCGDGEITLLGRGTERVEE
FT                   QVQQLFPHARVSRMDRDTTRGKGGHARVLKELEEGEVDILIGTQMIAKGHDFHGVTLVG
FT                   VLSADASLNLPDFRSAERTFQLVTQVMGRAGRGDKPGRVLVQTLAPEHYALTRAVSHDF
FT                   QGFYQEEIAFREEVGYPPFAHLASLTLSAVAASQGEHSADEAAALLQKIKRECRLRVEV
FT                   LGPVTAPLGKVRGRFRWQILLKGRERADLHRLLFHFRGGFSHPSTVRLTIDVDPVDML"
FT   gene            complement(217490..218677)
FT                   /gene="roo"
FT                   /locus_tag="Gbem_0186"
FT   CDS_pept        complement(217490..218677)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="roo"
FT                   /locus_tag="Gbem_0186"
FT                   /product="rubredoxin:oxygen/nitric oxide oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37217"
FT                   /db_xref="GOA:B5E980"
FT                   /db_xref="InterPro:IPR001226"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR016440"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:B5E980"
FT                   /protein_id="ACH37217.1"
FT                   /translation="MSGAVELGKGLHWIGVKDPSLTVFDDLFPTEYGTTYNSYLVQGDT
FT                   HTAIIDTVKRKRFDEFLANIRSITDLSKIDYIVVNHSEPDHSGSLALLLELCPEATVVS
FT                   SQAARTFLGNQIHTQFGSRIVKDNDTLDLGGRTLRFIAAPFLHWPDTMFTLLEEEGVLF
FT                   PCDAFGSHYTGEGIFADEMPDFSGETRFYFDCIMRPFKERILQAVAKLDDVELKMLCPS
FT                   HGPIYRSDARKPIELYRKWSMPKAAGRRIAIFYISPHGNTEQMAEAVAKGAGAAGVHVT
FT                   LCHINHASVADIRDLMEECDGLIFGTPTINRDIPKPMWDVLAYLSTVSLKGNIGGIFGS
FT                   FGWSGEACRMLEERLKSLNFKLPAPFVRAPFMPKAEALAECEALGRAVAEEVLKK"
FT   gene            complement(218827..220188)
FT                   /gene="rhlE-1"
FT                   /locus_tag="Gbem_0187"
FT   CDS_pept        complement(218827..220188)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rhlE-1"
FT                   /locus_tag="Gbem_0187"
FT                   /product="ATP-dependent RNA helicase RhlE"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37218"
FT                   /db_xref="GOA:B5E981"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B5E981"
FT                   /protein_id="ACH37218.1"
FT                   /translation="MSFETLNLSAPILKAIQACGYTQPTPIQAESIPLALSGRDLIGSA
FT                   QTGTGKTASFVLPALERLLTPSPLRGKGPRILVLTPTRELAIQVVDAVRSYGKFMRVRC
FT                   GSILGGMPYRDQMMLLAQPVDIIVATPGRLIDHLDRRSINFSRLEMLVLDEADRMLDMG
FT                   FSEDVDRIANAAPAERQTLLFTATMDDAMAKLAQRLLKDPVRVAVEGTEVANLQIEQRL
FT                   HVTDDMRHKNRLLQHLVSDASVTKAIIFSATKKDADQLAFELYSQGHAAAALHGDMSQG
FT                   ARNKTITMMRRGKVRLLVATDVAARGLDVTGISHVINYDLPKFAEDYVHRIGRTGRAGA
FT                   TGIAISFCSMNEVVYLDRIERFTGKKLPMHVVEGFEPTRPLRRGNSGAPGARKGRPSFD
FT                   PRKKGFAPKGRSDQGRSDQGRSGYAGRSGQGATAGRRDNQVVVEYRRGQGGAGK"
FT   gene            complement(220647..220931)
FT                   /gene="hup-1"
FT                   /locus_tag="Gbem_0188"
FT   CDS_pept        complement(220647..220931)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hup-1"
FT                   /locus_tag="Gbem_0188"
FT                   /product="histone-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37219"
FT                   /db_xref="GOA:B5E982"
FT                   /db_xref="InterPro:IPR000119"
FT                   /db_xref="InterPro:IPR010992"
FT                   /db_xref="InterPro:IPR020816"
FT                   /db_xref="UniProtKB/TrEMBL:B5E982"
FT                   /protein_id="ACH37219.1"
FT                   /translation="MTKAELVEAVAKSANIPKGAAEKAVGAFISSVSGALKKGDRVTLV
FT                   GFGSFEVASRQARTGRNPQTGKEIKIAEAKVPKFRPGKALKDAIAAKKK"
FT   gene            complement(221150..223633)
FT                   /gene="mrcA"
FT                   /locus_tag="Gbem_0189"
FT   CDS_pept        complement(221150..223633)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mrcA"
FT                   /locus_tag="Gbem_0189"
FT                   /product="peptidoglycan transglycosylase and transpeptidase
FT                   MrcA"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37220"
FT                   /db_xref="GOA:B5E983"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR031376"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/TrEMBL:B5E983"
FT                   /protein_id="ACH37220.1"
FT                   /translation="METYKAQPRQQNRRLKQRTGGKVLLAAFATVSTILFLAFIGYFFY
FT                   LLGALPKVDRLADYRPPILSQVYGADGALVGEFYLERRTVVPVDKMPKRLIQAFVSAED
FT                   SNFYQHKGIDYVGIARAAFKNLISMRKKEGASTITQQVAKSMLLTPEKKFSRKLKEAIL
FT                   AKRMEERLSKDEILYIYLNQIYLGAGAYGVQLAAETYFGKEVENLNLAEMAMLAGLPKA
FT                   PNSYSPIKHLDRAKERQAYVLERMVKEGYITQAEAQYAKATPIVIQPLKKVNAEQSAYF
FT                   LEQVRQQLVQKYGEERLYKDGLKIYTTMNGEMQKAAYTSVVNGLKAVDKRQGFRGAAKY
FT                   LQEAEVEPFCKKVEDEIDDLSLKEGNVYQGVVTGVDPAKRELTVQVGERTGTVPRKNME
FT                   WAGKLELIPRFGKPEAKRAIGLGAVLELQVKVPDQNRTGAVFALDQAPEAQAALIALDP
FT                   LTGGVRAMVGGYDFKKSQFNRAMQAKRNPGSAFKPVIYAAALDNGMTTASVIDDSQVEY
FT                   ESGAEKAWKPKNYDNVYRGPVTMREALTESINVVSVKILEQIGVGTAIEYAKKIGITSP
FT                   LASNLTLALGSSSVTPIELTSAYAVFASGGYRTTPYFVTKVLDRDGNVLEETAEPKIPV
FT                   FSRMSSAGEGDENTAPGENGEGAAPKPAEAGLNSAAGGAFPVIPPETAFIMTNLMQSVV
FT                   TSGTGGRARAVGRPVAGKTGTTNDMKDAWFVGYVPQLVAGVWVGYDQERSLGAGGSGGQ
FT                   AAAPIWTDFMQRALAGLPVKSFPTPGNVTFALIDPRTGHLAREGTPGAVQECFIAGTEP
FT                   TSYGAEPQADAGGAP"
FT   gene            224095..224898
FT                   /gene="citG-2"
FT                   /locus_tag="Gbem_0190"
FT   CDS_pept        224095..224898
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="citG-2"
FT                   /locus_tag="Gbem_0190"
FT                   /product="2'-(5''-triphosphoribosyl)-3'-dephospho-coenzyme
FT                   A synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37221"
FT                   /db_xref="GOA:B5E984"
FT                   /db_xref="InterPro:IPR002736"
FT                   /db_xref="UniProtKB/TrEMBL:B5E984"
FT                   /protein_id="ACH37221.1"
FT                   /translation="MRNYLEKLAHNLVRGAFMELYLTPKPGLVDLADSGPLPGLDIAIM
FT                   EESLKVVALYLLDLSQAVAGGADLAEQVRLGAAAERAVQRAIGSSCHKGYIFLGGLLIC
FT                   ASACAPSRDETALRASIAALAARFFEHGEPGSSTRVRNRFQGGGIREEALAGLPSLFEQ
FT                   ALPVFRREVASGNRGSAVFAMLGRLMQTVEDSTTLKSGGRSGLRTVREDGRYLERMVAQ
FT                   RDDFLAFLAERNSHYTSARLTMGGVAGVLALALAWLSHTGELEAA"
FT   gene            225103..226815
FT                   /locus_tag="Gbem_0191"
FT   CDS_pept        225103..226815
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0191"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37222"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR025497"
FT                   /db_xref="InterPro:IPR037257"
FT                   /db_xref="UniProtKB/TrEMBL:B5E985"
FT                   /protein_id="ACH37222.1"
FT                   /translation="MSFDGDLEHLPIVDVIQLLHATGKSGTLTLKSAKGESQLAFVDGF
FT                   VVSANHVNNSVRIGQIMLDMGLITKENLDLALKEQRSAGSQRKPIIQTLIEGGVVKTSD
FT                   AYKGLEALIEMTIVEVLTWTRGTFSLDVNESVVSDDYRYFPEQVKQEIHLNTQNLLMDA
FT                   LRIYDERKRDGTLTPEAMFGTAEPPMPEAPAGAAEISAVDLGLEELDELERRIPQHFAP
FT                   LAEELPDTPSNRLRDELTGIPVEEQQLLFRYLEQLPQPQEGAFAGTGVVLYTTDKVLRE
FT                   CVAAVCGASFLCATDDPSHIDAVLDQALSRQRLPLLLVDAGEPGDGAALLAFAQQRRER
FT                   HPDLPIVLLASPGDYALFARAFDVGASAFLPRATRKERAGSFIADAIESCRALAGYLEK
FT                   RSEEPGLALLPRFRSSFLALSEQRDPPEVTFALLQAACGFFKRGVTLVVVRSELIAERA
FT                   IGASDTGAVTSVKLRIPTGEPDLYQKALEGEIYYGDADRAVRETMFSAIGAPASSRILL
FT                   LPVRSFGRVIAVIYADFGSSAGGDPQLQLLEILSQHAGLIIDNVLYRKRCAQK"
FT   gene            226858..227928
FT                   /gene="pilT-2"
FT                   /locus_tag="Gbem_0192"
FT   CDS_pept        226858..227928
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pilT-2"
FT                   /locus_tag="Gbem_0192"
FT                   /product="twitching motility pilus retraction ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37223"
FT                   /db_xref="GOA:B5E986"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR006321"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B5E986"
FT                   /protein_id="ACH37223.1"
FT                   /translation="MDSKIFVQILEIAFSKKVSDVHFEVDNPPFFRGKGQIIRSKLPSL
FT                   TSEDTEFIASQIMAHNNRRWEADQKEYDTSFSLPSGARFRVSIFKQRGHFGIIMRVIPA
FT                   NIGTFEELRLPAVLGEVAKAPNGLILVTGPTGNGKSTTLASILRYINENLAYNCITIED
FT                   PIEFLFKSEKSCIIQREVGIDTDSFSSAVKAALRMDPDLIMVGEMRDTATIESCLMAAE
FT                   TGHLVLSTLHTQGAVSTINRIVGHFPPDAQEIVRQRLADILVATVSIRLVMNKTGEAIL
FT                   PVLEIMRATTTIQSCIREGRLDEIEAHMENGRSQYQMQTFDQHLIQLHEQEQITMEDAK
FT                   RLSHSMDLERKLMFTN"
FT   gene            228303..229652
FT                   /gene="gdhA"
FT                   /locus_tag="Gbem_0193"
FT   CDS_pept        228303..229652
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gdhA"
FT                   /locus_tag="Gbem_0193"
FT                   /product="glutamate dehydrogenase, NADP-dependent"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37224"
FT                   /db_xref="GOA:B5E987"
FT                   /db_xref="InterPro:IPR006095"
FT                   /db_xref="InterPro:IPR006096"
FT                   /db_xref="InterPro:IPR006097"
FT                   /db_xref="InterPro:IPR014362"
FT                   /db_xref="InterPro:IPR033524"
FT                   /db_xref="InterPro:IPR033922"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B5E987"
FT                   /protein_id="ACH37224.1"
FT                   /translation="MSPQIDEKVEPIFQEVLKRNPGEVEFHQAVREVLESLGPVLVKHP
FT                   EFAERKIIERICEPERQIIFRVPWQDDGGNVHINRGFRVEFNSSLGPFKGGLRFHPSVY
FT                   LGIIKFLGFEQIFKNSLTGLPIGGGKGGSDFDPKGKSDNEIMRFCQSFMTELYRHLGEH
FT                   TDVPAGDIGVGGREIGYMFGQYKRITNRYEPGVLTGKGLDWGGSLVRTEATGYGATFFV
FT                   DAMLKVRKESFDGKVCTVSGSGNVAIYTIEKIHQLGGKCISCSDSNGVIYHEKGLDLNL
FT                   IKQLKEVERRRIEDYAKYHKDAKYIPNGKIWDIPCQVAMPSATQNEINGKDAATLVKNG
FT                   CIAVGEGANMPTTPEGVKVFLEANIAYGPGKAANAGGVATSALEMQQNACRDAWTFEYT
FT                   EQRLAQIMKNIHDTCYQTAEEYGTPGNYVNGANIAGFIKVAQAMVAHGLI"
FT   gene            complement(229763..230443)
FT                   /locus_tag="Gbem_0194"
FT   CDS_pept        complement(229763..230443)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0194"
FT                   /product="protein of unknown function DUF480"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37225"
FT                   /db_xref="InterPro:IPR007432"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5E988"
FT                   /protein_id="ACH37225.1"
FT                   /translation="MRMNLSELEIRILGCLMEKELATPEIYPLTLNALASACNQKSNRD
FT                   PVMSVTEADLLRGLEALGARGLARLTTTGGRVAKYCHSATDNLRLAAAERAVLAELMLR
FT                   GAQTAAELRSRGERMTEMGDIESVEETLRKLQQHGPPLVVRLPRQPGRKEQRYLQVFAG
FT                   LPEFPDELDISEEMEPAAGPRAAAGRPAVGNERLERLEEGIGSLRQEIAALRREVQEMM
FT                   DAFA"
FT   gene            230658..231377
FT                   /locus_tag="Gbem_0195"
FT   CDS_pept        230658..231377
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0195"
FT                   /product="lytic transglycosylase, SLT, LysM and LysM
FT                   domain-containing"
FT                   /note="domains: SLT, LysM, LysM"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37226"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:B5E989"
FT                   /protein_id="ACH37226.1"
FT                   /translation="MTGKAKLLLAVAALNLALANDASAFCFEEAGQQYGINPQILRAIA
FT                   KVESNFNPAAVNYNTNGSYDFGLMQINSIWAPTIGKERWNSLGDPCNSVKTGAWILSMC
FT                   MEKYGYTWKAIGCYNSQTPEKRDKYSKKVFDQLQRVKPLKQEAAYTPLNRRIEDLVRDK
FT                   VEGWVDEAAQGKGEEFTVKVKGSIPSPKEVLKEETPSLADSSLQSALPGSIQQNSLAPS
FT                   AGDSGMEQGGTAASPIP"
FT   gene            complement(231390..232679)
FT                   /locus_tag="Gbem_0196"
FT   CDS_pept        complement(231390..232679)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0196"
FT                   /product="LysM domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37227"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/TrEMBL:B5E990"
FT                   /protein_id="ACH37227.1"
FT                   /translation="MTNPTKAKGMLLLALLSLPCQLHAAPPQYEIDLKELDRQKPAPAP
FT                   KPAKKEAPAQKHAPTKREAPGETPRPAKGAAPSSASGEYVRYTVKPGDHIFKILMVNFG
FT                   MSNEAAERLIPEIVRINNISNIKALTVGRTLLIPAQGKQTTSGHHPRKEKHKEKPRAAA
FT                   PEAKTSHEKAPAAPSAPAPQAPEAAPRAPEPAPRAPEPVPAPAPRPAEPAPAAPAAKPA
FT                   PALVPVPAPAPAVKAPAPAPAVKAPAPAPAPVPAPAAPAAVPAPLAVPQAATWVCPAAK
FT                   KNTAAIVDSLLNALSASWSKSKIIHSGSGAPTTFSIRVDRYFEYKGARYVISLGESDPY
FT                   NYTLIRLLEAAGYRVLMLSGGEDFKTTSEKLFKLVGIEPAFGNYPLSGGNQAAGYLLQQ
FT                   EDAGGRRVLLTEGAPPPGHKWVLPLGCGPK"
FT   gene            complement(232721..234187)
FT                   /locus_tag="Gbem_0197"
FT   CDS_pept        complement(232721..234187)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0197"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37228"
FT                   /db_xref="GOA:B5E991"
FT                   /db_xref="UniProtKB/TrEMBL:B5E991"
FT                   /protein_id="ACH37228.1"
FT                   /translation="MTSVLLISDTERVQRIFQTLEGKEVLKLHTASTLPSGEAQITASP
FT                   CDFTFVQSRISGFSGDILLRHLEKMLHKGAVLVLLAGDAEDAEQARKHGRQSVDLTLAD
FT                   DLLAQTLLAVVTGAPLPEQGTIEAPAATKPAAAKQEAAPFASPPDTEEKEAERSAAFAV
FT                   SPSRTTDPQASPFEEAMQRAASNVAPIKASLLEVEERVEIGKGGAGAGNTPAPPVPPAG
FT                   QPVRPDDIYAGETLLEAMRRAEKKKSRRPYLLILPALVLIAIPFISYTVGKRSPANIEI
FT                   APAFKPAAKPSASPQALPPKAAPAAPPAALAEKPGTPPAQPALPPATPQTAKPAPPPPP
FT                   ATAARPAPTAPAAQKAAPPAATAAKPAAKRGAERLPPVLEGTKPDPQYGKTHPGWERYL
FT                   GLRAEYKLFRENNLYKALQVVSVDGGTISEDLFRRILREFGGADDYRVESSEKKGGYLV
FT                   EQCSTKGNTALTIYRNHNNRKMKGFVVYYR"
FT   gene            234368..235207
FT                   /locus_tag="Gbem_0198"
FT   CDS_pept        234368..235207
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0198"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37229"
FT                   /db_xref="GOA:B5E992"
FT                   /db_xref="UniProtKB/TrEMBL:B5E992"
FT                   /protein_id="ACH37229.2"
FT                   /translation="MANSRQRAAGSKRTRSRAMRIIDLLERKLGRFAIPNLTLYLIAGQ
FT                   SFFYVMYLTGKLERSSTYFSADLLMAGEWWRIFTIPFDPPRSGVLFTLIAWYFFYMLGS
FT                   ALEEYWGAFRYNAYLFLGCLITLGASFLVPAYPISNAFLAGSVFLAFAALFPEFEILLF
FT                   FILPVKIKWLALLTWLGYAYQFIFGDWTARVMVLAATANFLIFFARDILLNLRQGRRQI
FT                   AKKVAKAPRKEQPLTHKCTTCGITDKTDPEMDFRYCPKCNGQYGYCRDHIFSHEHKK"
FT   gene            235235..235522
FT                   /locus_tag="Gbem_0199"
FT   CDS_pept        235235..235522
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0199"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37230"
FT                   /db_xref="UniProtKB/TrEMBL:B5E993"
FT                   /protein_id="ACH37230.1"
FT                   /translation="MLNQLNNIGDDVYQTWSYEQRHEEIGKLVEGFKNGLPVQILCHLS
FT                   TSVAGSTAEAADHLCAFLSRRERKAIVNREAGANKMLRELLEATLLPAKN"
FT   gene            235618..236142
FT                   /gene="aroK-2"
FT                   /locus_tag="Gbem_0200"
FT   CDS_pept        235618..236142
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroK-2"
FT                   /locus_tag="Gbem_0200"
FT                   /product="shikimate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37231"
FT                   /db_xref="GOA:B5E994"
FT                   /db_xref="InterPro:IPR000623"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031322"
FT                   /db_xref="UniProtKB/TrEMBL:B5E994"
FT                   /protein_id="ACH37231.1"
FT                   /translation="MQTMALIGMPGSGKSAVGRIIADRLGWDFLDTDRLIEQRFGLKLQ
FT                   AVIDQVGTEAFSRIEEETVLSLDPAERTVISTGGSVVYSEAAMRHLCSISTVVFLDLPI
FT                   DAIRSHISLEAPRGIVGMDEGGLELLYEQRFPLYHRHAQIVVLLDSCTTEEAAARVLSQ
FT                   WKEYVASDRQR"
FT   gene            236175..237515
FT                   /locus_tag="Gbem_0201"
FT   CDS_pept        236175..237515
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0201"
FT                   /product="nucleotide cyclase, HAMP and GGDEF-related
FT                   domain-containing"
FT                   /note="domains: HAMP, GGDEF-related"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37232"
FT                   /db_xref="GOA:B5E995"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:B5E995"
FT                   /protein_id="ACH37232.1"
FT                   /translation="MSSPTNTNAPAKLSLPRLTLIQKIGAGYAAMAFFTMAALVFSTFN
FT                   IYKSNNTSRQIANNDLPVMSALIELRTSLLAQEGFAGRYAILHDPAFIELFRQRESEAL
FT                   HNLAVLERSGAQQDAIHLKQLYLSYQGASAKLFSGTPASEIGLRRSARQLLDAVDATYI
FT                   KRKAILHAVLAKANEQQKATIWWTVAISLTGFLLAIGVAPFVTYRIFGAIRKLQSATHR
FT                   IAAGDFDYDPQIPLGDEISDLARDFTKMAARLKVLEQMSLDASPLTRLPGNFAIERELE
FT                   ERLKSGASFAFCYADLGNFKPFGDHYGYAKGSELLRLTGDLIQAAVKAQAGGAGFVGHV
FT                   GGDDFVMVVPTDRVKPVCETVIANFSAEVVKHYSQQDLKAGGIEGCDRYGVQRFFPVVT
FT                   ISIAAIICGRDQFSSAVDIARAAAKVKDSAKETPGSNYLVGTPGDAA"
FT   gene            237512..238015
FT                   /locus_tag="Gbem_0202"
FT   CDS_pept        237512..238015
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0202"
FT                   /product="lipoprotein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37233"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:B5E996"
FT                   /protein_id="ACH37233.1"
FT                   /translation="MKKQAALFIVISLCSGCAITGKNPQGNLVQRYTASRHLEQADEML
FT                   EKGDKAGAVKALHAVVSAPAAPGVTDQALFRLALLTLKPGLERPASAQAQQLLKRLAKE
FT                   YPKSPWTAQADHLNDLIEVADDLRRQNKSLKGNNQSLNKEINDLNKNLERLKQLDQELE
FT                   KSAR"
FT   gene            complement(238123..239109)
FT                   /gene="rdoA"
FT                   /locus_tag="Gbem_0203"
FT   CDS_pept        complement(238123..239109)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rdoA"
FT                   /locus_tag="Gbem_0203"
FT                   /product="protein serine/threonine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37234"
FT                   /db_xref="GOA:B5E997"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR032882"
FT                   /db_xref="UniProtKB/TrEMBL:B5E997"
FT                   /protein_id="ACH37234.1"
FT                   /translation="MKETSHPFSTLTPNFIMDAVESQGFRCDCRTSALNSYENRVYQVG
FT                   IEEEKPLIAKFYRPGRWSDEQIREEHQFCLELAEHELSVVAPWVNPAGETIFHFDGFRF
FT                   ALYPRQGGHAPEFDNDENLVILGRMLGRIHSIGAIRPFKVRPTLESRSFGHDSVALIKE
FT                   RFIPEEYRASYTAVTDQLLSAIDAAFANAQGVTQIRAHGDCHAGNILWRDGAPHFVDFD
FT                   DARMAPAVQDLWMMLSGERSRQLVQLEQLVKGYTEFRDFHPGELRLVEPLRALRMLHYS
FT                   AWLARRWEDPTFPITFPWFNTVRYWGEHILQLREQLSALDEPPLELP"
FT   gene            complement(239267..239833)
FT                   /locus_tag="Gbem_0204"
FT   CDS_pept        complement(239267..239833)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0204"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37235"
FT                   /db_xref="UniProtKB/TrEMBL:B5E998"
FT                   /protein_id="ACH37235.1"
FT                   /translation="MRKFILTQAVLFLLLLTQAGCTHLLPRGKSITESPFQNYSDAKTA
FT                   FDQIEIGKTTVEDLQKLGFDVTSAPNLKLLNYLDIAATVQAIPNKDLDPGLQACLKARA
FT                   DCRAYLFEPKRTYTKRIGNFWLDIFNFKRKSQETGWRFKALIVFVNHHVAYKLSSGEPK
FT                   IDQVNDQVNPLGPFQAPADMVTRAL"
FT   gene            complement(239931..240131)
FT                   /locus_tag="Gbem_0205"
FT   CDS_pept        complement(239931..240131)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0205"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37236"
FT                   /db_xref="UniProtKB/TrEMBL:B5E999"
FT                   /protein_id="ACH37236.1"
FT                   /translation="MKDKHDQQCGCSIEPRHKSCAACSGEDIFSYWCKTCDRSVPEGRC
FT                   PYCGLKAQKKKGEMGELSGKM"
FT   gene            complement(240160..243003)
FT                   /gene="uvrA"
FT                   /locus_tag="Gbem_0206"
FT   CDS_pept        complement(240160..243003)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="uvrA"
FT                   /locus_tag="Gbem_0206"
FT                   /product="excinuclease ABC, A subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37237"
FT                   /db_xref="GOA:B5E9A0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR004602"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041102"
FT                   /db_xref="InterPro:IPR041552"
FT                   /db_xref="UniProtKB/TrEMBL:B5E9A0"
FT                   /protein_id="ACH37237.1"
FT                   /translation="MATDKIIIKGACEHNLKCIDVEIPRDQLVVITGISGSGKSTLAFD
FT                   TIYAEGQRRYVESLSAYARQFLEQMEKPDVESIEGLSPAISIEQKTTSKNPRSTVGTVT
FT                   EIYDYLRLLFARIGKPHCYNCGRIITSQTVSQMVDQIAALPQGAKLTLLSPIVRGRKGE
FT                   YKKELTQFRKDGFARVVVDGETHDLSEEITLDKKKKHDIDIVVDRLVVKPGIEKRLADS
FT                   LETALSHAEGIVKVALSPDAERGIKDETLLFSESAACIECGISYPEMTPRMFSFNNPYG
FT                   ACPDCTGLGTRMYLDTNLVVPDHDLTLAEGAVAPWETRFSGWYQQTLAALGKSYGFDLH
FT                   TPYKQLSKKAKDVILNGSGGELVDFWWVDDAGKRHTYKKAFEGVLNNLERRHRETDSEQ
FT                   VREELEKYMDVMPCPTCQGARLKKEALFVRVGGENIQQVTAYSIQDALSFFDSLALTEK
FT                   EEDIARRILKEIRERLNFLVNVGLDYLSLDRSSGTLSGGEGQRIRLATQIGSSLVGVLY
FT                   ILDEPSIGLHQRDNGRLLSTLRHLRDIGNTVLVVEHDEETISEADWVIDMGPGAGIHGG
FT                   EVVAEGTPAEIMANPHSLTGRYLSGALTIAIPKKRRKGSRFLSIEGANENNLKDVSVDL
FT                   PLGVMTCITGVSGSGKSSLIIDTLYKTLNQRLYKSREKAGAVRAIHGMEVLDKVINIDQ
FT                   SPIGRTPRSNPATYTGLFTEIREIFAQLPESKMRGYKPGRYSFNVKGGRCEACAGDGII
FT                   KIEMHFLPDVYVQCEVCKGARYNRETLEVRFKGRSIAEVLDMTVSQALVFLEHIPRLKT
FT                   KLQTLEEVGLGYIKLGQSATTLSGGEAQRVKLAKELSKRATGRTIYILDEPTTGLHFAD
FT                   IAKLLEVLHKLVDAGNTIVVIEHNLDVIKTADWIVDLGPEGGDRGGEVIAVGTPEQVSR
FT                   VERSYTGQYLKKMLPHE"
FT   gene            243226..243969
FT                   /locus_tag="Gbem_0207"
FT   CDS_pept        243226..243969
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0207"
FT                   /product="pentapeptide repeat domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37238"
FT                   /db_xref="InterPro:IPR001646"
FT                   /db_xref="UniProtKB/TrEMBL:B5E9A1"
FT                   /protein_id="ACH37238.1"
FT                   /translation="MNRRLISHTASVSLAAWLVAVAVPVGDAHAAAPTAPASSAAPAAP
FT                   AKAGVAPATTGAAPKDAASADARALNEAKAKLAALAKEGASEGPSAAAEKKAQVKKKAP
FT                   AKKKKKGAAKAGSKAKGKAKKGAKSGEVKVKVLNRHMTQAELQGILSTTRDFSGTDLSG
FT                   VNLVGYDLTGANLSRANLHGANLERAKLDETDLELADLTGANLRGASLSQARLRGTRLA
FT                   GAKLEGALWTDKTVCRKGSLGSCIE"
FT   gene            complement(244053..244253)
FT                   /locus_tag="Gbem_0208"
FT   CDS_pept        complement(244053..244253)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0208"
FT                   /product="cold shock DNA/RNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37239"
FT                   /db_xref="GOA:B5E9A2"
FT                   /db_xref="InterPro:IPR002059"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012156"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019844"
FT                   /db_xref="UniProtKB/TrEMBL:B5E9A2"
FT                   /protein_id="ACH37239.1"
FT                   /translation="MAKGVVKWFNDSKGFGFIEQENGEDVFVHFSAIQGDGFKSLAEGD
FT                   SVTFDVQQGPKGLQAANVTRV"
FT   gene            complement(244359..247910)
FT                   /gene="por-1"
FT                   /locus_tag="Gbem_0209"
FT   CDS_pept        complement(244359..247910)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="por-1"
FT                   /locus_tag="Gbem_0209"
FT                   /product="pyruvate:ferredoxin/flavodoxin oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37240"
FT                   /db_xref="GOA:B5E9A3"
FT                   /db_xref="InterPro:IPR002869"
FT                   /db_xref="InterPro:IPR002880"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR011895"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR019456"
FT                   /db_xref="InterPro:IPR019752"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033412"
FT                   /db_xref="UniProtKB/TrEMBL:B5E9A3"
FT                   /protein_id="ACH37240.1"
FT                   /translation="MSRRMVTIDGNTAAAHVAHATNEVIAIYPITPSSVMGEISDEKSA
FT                   KGEKNIWGTVPSVSELQSEGGASGAVHGALQAGALTTTFTASQGLLLMIPNMFKIAGEL
FT                   TSTVFHISARAISAAALNIFGDHSDVMAARATGWGMLCSNNVQEVMDFALISQAATLRA
FT                   RVPFMHYFDGFRTSHEVQKVEELTFDDMRAMINDDLVQAHRLRALTPDRPVMRGTAQNP
FT                   DVYFQGRETVNAYYPAALKIVQEEMEKFAGITGRKYSVAEYVGAPDADRVVIVMGSAAD
FT                   TVQETIETLAAKGEKIGLVKIRLFRPFPVDALAACLPASVKKIAVLDRTKEPGSLGEPL
FT                   YLDVRTAIGEAMADGKTSFKNYPIIVGGRFGLGSKEFTPGMAKGVFDNLKADKPKNHFV
FT                   VGIKEDVTNSSLDFDKSFVNPSAGTYAAMFYGLGSDGTVGANKNSIKIIGEKTDNNVQA
FT                   YFVYDSKKAGSVTTSHLRFGKGAIRSPYLIDQADFIACHNFSFLEKYDMLTNAKQGGTF
FT                   LLCSPFDKEQVWDSMPVEVQQQIIDKKLKFYVINAIALGEKLGLGARINVIMQTAFFKI
FT                   SNIMPLDTALAAIKDAIKKSYGKSGDKVVDMNNKAVDAALENIFEVAVPAKASSALRKP
FT                   PVVGAHAPKFVQEVTAQLIAGYGDEVPVSMIPADGTFPTGTSQYEKRNIAVDIPVWDEQ
FT                   LCIQCGICSFVCPHASIRMKVYDADKLSGAPATFKSADARGNEFKGMKCTVQVAPEDCT
FT                   GCAACVANCPAKSKEDANKKAINMQFQAPLRTSEAANYDFFLAMPETDPKLVKLETLKG
FT                   SQLARPLFEYSGACAGCGETPYLKLMSQLFGDRAMIANATGCTSIYGGNLPTTPWAKNA
FT                   DGRGPAWSNSLFEDNAEFGFGMRLAVDKFNQAATELLDVVSLPAELVAEIKGADQQTQA
FT                   GVEAQRARVAKLKDLLAGSKDAAAKKLLSIADYLVKKSVWIVGGDGWAYDIGYGGLDHV
FT                   IASGKNVNLLVLDTEVYSNTGGQASKSTPMGAVAQFAAGGKPQAKKDLAMIAMAYGNVY
FT                   VAKVSLSNPAQVVKAFIEAEAYNGPSLILAYSHCIAHGIDMATAVETQKRAVASGHWPL
FT                   VRYNPDLAEQGKNPLQLDSKAPSISLEEYAYGENRYRVLKKSNPEAAATLMARSSELTA
FT                   RRFDLYKRMAEMDFENK"
FT   gene            complement(248065..248658)
FT                   /gene="recR"
FT                   /locus_tag="Gbem_0210"
FT   CDS_pept        complement(248065..248658)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recR"
FT                   /locus_tag="Gbem_0210"
FT                   /product="recombination protein RecR"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37241"
FT                   /db_xref="GOA:B5E9A4"
FT                   /db_xref="InterPro:IPR000093"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR015967"
FT                   /db_xref="InterPro:IPR023627"
FT                   /db_xref="InterPro:IPR023628"
FT                   /db_xref="InterPro:IPR034137"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5E9A4"
FT                   /protein_id="ACH37241.1"
FT                   /translation="MLHFSGSLTRLVGELKKLPGVGEKSAQRLAFHLLKHPSNIEALAQ
FT                   SLLQVGERVHLCSVCFAITEDDPCWICSGERDSGTICVVEEPQDLLALERSRAFSGRYH
FT                   VLQGALSPLNGVTPKDLRIAELMQRLQGGEVREVLIATNFTVEGEATALYLTRLIKPLS
FT                   IKVTRLAHGIPVGSDLEYVDAATVQRAVEGRSEL"
FT   gene            complement(248802..249116)
FT                   /locus_tag="Gbem_0211"
FT   CDS_pept        complement(248802..249116)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0211"
FT                   /product="DNA-binding protein, YbaB/EbfC family"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37242"
FT                   /db_xref="GOA:B5E9U4"
FT                   /db_xref="InterPro:IPR004401"
FT                   /db_xref="InterPro:IPR036894"
FT                   /db_xref="UniProtKB/TrEMBL:B5E9U4"
FT                   /protein_id="ACH37242.1"
FT                   /translation="MSKGLAQIMKQAQMMQQKMGKLQEEAAAKTAEVATGGGAVTVVVN
FT                   GKNQVLSLVIKKEAVDPEDVEMLQDLVLTAVNEALKKVHTEMSEEMSKITGGLSIPGLF
FT                   "
FT   gene            complement(249166..250914)
FT                   /gene="dnaX"
FT                   /locus_tag="Gbem_0212"
FT   CDS_pept        complement(249166..250914)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaX"
FT                   /locus_tag="Gbem_0212"
FT                   /product="DNA polymerase III, gamma and tau subunits"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37243"
FT                   /db_xref="GOA:B5E9U5"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR012763"
FT                   /db_xref="InterPro:IPR022754"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B5E9U5"
FT                   /protein_id="ACH37243.1"
FT                   /translation="MSYLVLARKWRPQTFSDLVGQEHVSQTLKNAIDGGRVAHAFLFTG
FT                   ARGVGKTSSARILAKALNCESGLTVEPCNTCSTCLEITEGNSVDVFEIDGASNTGVDDI
FT                   RELRDNIKYLPSRSRYKIFIIDEVHMLTTNAFNALLKTLEEPPPHVKFIFATTEPHKVP
FT                   ITILSRCQRFDFKRIALPRIVSRLRYIVDQEGVQVSDEALAVVARKGDGSMRDSLSTLD
FT                   QVLAFCGNQVADADVAALLGVVDRRLIMDGCRAVLSKEVREALQIVAQVDSFGYSMRQF
FT                   CRELIDQFRNVAILKAVGEPGDLLELSEAELGELRTLADAATGTDLQRHLTLLLKAEAE
FT                   MAHASFPRLVLEMTMMKMATLAPAVAVQELLSRLDSLESGAPAGPRPARQEGAPRAAAP
FT                   PVQAPPAARDQHAARPAAPPSAPAPQPPPAPPAASAAPAAADAGSGELWGSFVQFVKGK
FT                   RPMLGTELEQVYPVQVSRQLLEIGCLNGTFELKRMQDPERVTELKELAKTHFGGTPAVR
FT                   ITVLSEPPKDAPPSLSEKKNLENAERQATLRREAEEHPLVAAAVALFDGEIAEVKEIPG
FT                   KDVIQS"
FT   gene            complement(251004..251105)
FT                   /gene="ffs"
FT                   /locus_tag="Gbem_R0005"
FT   ncRNA           complement(251004..251105)
FT                   /gene="ffs"
FT                   /locus_tag="Gbem_R0005"
FT                   /product="signal recognition particle, RNA component"
FT                   /ncRNA_class="SRP_RNA"
FT   gene            complement(251136..251226)
FT                   /locus_tag="Gbem_R0006"
FT   tRNA            complement(251136..251226)
FT                   /locus_tag="Gbem_R0006"
FT                   /product="tRNA-Ser"
FT   gene            complement(251347..251691)
FT                   /locus_tag="Gbem_0213"
FT   CDS_pept        complement(251347..251691)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0213"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37244"
FT                   /db_xref="UniProtKB/TrEMBL:B5E9U6"
FT                   /protein_id="ACH37244.1"
FT                   /translation="MKQEDILHSDVINYFAGEFAALEERLKAGRLEDYRERVLVSRKIA
FT                   EALHLLAPYVRSDPRARHLVKSAETLKKELLSVKSIIEKQLLQQKDQQSLLQAIVSKRK
FT                   KARHSDEAAN"
FT   gene            251924..255397
FT                   /gene="mfd"
FT                   /locus_tag="Gbem_0214"
FT   CDS_pept        251924..255397
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mfd"
FT                   /locus_tag="Gbem_0214"
FT                   /product="transcription-repair coupling factor"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37245"
FT                   /db_xref="GOA:B5E9U7"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR003711"
FT                   /db_xref="InterPro:IPR004576"
FT                   /db_xref="InterPro:IPR005118"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036101"
FT                   /db_xref="InterPro:IPR037235"
FT                   /db_xref="InterPro:IPR041471"
FT                   /db_xref="UniProtKB/TrEMBL:B5E9U7"
FT                   /protein_id="ACH37245.1"
FT                   /translation="MTIPVPEYLKSIKEKLAPEKSRLSLAGVDGSAPAYLLSRLMTESG
FT                   PPLVVITSDQESADELARELRFFSCSHNAVLPFPGWDVTPFEAASPHPDLVGERLNALL
FT                   RLMDGGARAVVVPLAAALQRVIPRETLGGVCQYLVAGEELERETLVEKLVKLGYSHVPI
FT                   VEDRGSFSVRGGILDIFPPDQERPVRIEFFGDLVETMRLFDPATQRSLEPLDELVLLPS
FT                   REVILSEGVVKEFTPRLKRRCDHLGIGADRRRELLEQLQHAIYPPGVDFLQPLFHPGLE
FT                   TLFDYAGPGATRVLVDPAAIAEACERFEADLAKAAARAELRDAITCDPADLYLAPEEFH
FT                   DTLNAGRRLEFPRLELAGEGGETLRLRCVANSDLKLGVSPEGDRVLAPLTEKMVTWIAA
FT                   GNRVLVPCHQAGQARRLYELLSHYRLPLDSTQDCFADVAARPPGRVEILTGEISRGFRL
FT                   EEERLVVVAEEEIFGKRVKRRGLSEVKKQQLLTSLAELKPGDHMVHVDFGVAIYRGLQH
FT                   LSLTGLEGDFLLLEYAGGDKLYLPVDRINLVQRYVGAEGIEPRLDRLGAAGWEKAKAKA
FT                   RAEVQEMAAELLKIHAAREVQQGFKFSPADDMYRAFEASFAFEETPDQAQAIDQVIADM
FT                   ESPRPMDRLVCGDVGYGKTEVAMRAAFKSTLDGKQVAILVPTTVLAQQHAESFASRLKD
FT                   YPVRVEMLSRFRTPQQQKQILEGVKKGEVDIVIGTHRLLQKDVVFKDLGLLIVDEEQRF
FT                   GVAHKERLKQFRAVVDILTLTATPIPRTLYMSLMGIRDLSIIDTPPVDRLAIKTFVSRS
FT                   SDELIREAVLRELRRGGQVFFVHNRVQTIGAMAEELKRIVPEAKIAVGHGQMAEKELEQ
FT                   VMLSFMHGETNLLLCTTIIESGLDIPTANTLIVNRADTFGLSQLYQLRGRVGRSKSRAY
FT                   AYLLIPGEGAISPEARERLKILQELTELGAGFRIATHDLELRGAGDLLGARQSGDIAAV
FT                   GFELYTELLDEAVRTLKGEALPERVEPEIKLKVPAFIPEDYVRDPNQRLMIYKKLTQPT
FT                   DEAEIDDIRAELADRFGQLPMAAVYLLEVMRLRVTLKRLLVKEIELAGNELVLSFHERT
FT                   PVSPDAIMALLRKEKGKYRFTPDFRLYARLADGSFEGVLSEARNLLKCLG"
FT   gene            255457..256431
FT                   /locus_tag="Gbem_0215"
FT   CDS_pept        255457..256431
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0215"
FT                   /product="peptidylprolyl cis-trans isomerase lipoprotein,
FT                   PpiC-type"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37246"
FT                   /db_xref="GOA:B5E9U8"
FT                   /db_xref="InterPro:IPR000297"
FT                   /db_xref="InterPro:IPR027304"
FT                   /db_xref="UniProtKB/TrEMBL:B5E9U8"
FT                   /protein_id="ACH37246.1"
FT                   /translation="MHFTKTAAVLLLALCVAATGCKQKAESEAKKGPGNGIVLAEVNGA
FT                   KITDNDFYKEQAALPPYLKPMTETPEGKKEMLDTMVVRELILQQSKKEGIDSSAEVAAK
FT                   LEDLKKRVIVEAFLKKKVEESGNISDADMKAFYEKNKEKFQSGAQIRASHILVKSEAEA
FT                   KDIQNQLKKGASFEELAKKHSIDGAAQKGGDLGWFSKGSMIPDFEKVAFGLKEGETSGI
FT                   VKTQFGYHIIKKTGDRPAGARSFEDVKDQIKAAMVPERQQETFKKLKDELKKNAKLNIK
FT                   EDALKELKSAPAEGGKGAGAAPGAEPAKPAQQPAQQPAQPKAR"
FT   gene            256522..257475
FT                   /locus_tag="Gbem_0216"
FT   CDS_pept        256522..257475
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0216"
FT                   /product="peptidylprolyl cis-trans isomerase, PpiC-type,
FT                   SurA family"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37247"
FT                   /db_xref="GOA:B5E9U9"
FT                   /db_xref="InterPro:IPR000297"
FT                   /db_xref="InterPro:IPR027304"
FT                   /db_xref="UniProtKB/TrEMBL:B5E9U9"
FT                   /protein_id="ACH37247.1"
FT                   /translation="MSKIIIGIAVLALLALHPAASTAKQVSGIAAIVNDEIITTQELDK
FT                   EYLQIQKDADKVPGSDKSGLRGAALNRLVERKLIEQKIRELNINVSDEEVRLAIEDVKK
FT                   QNNLTQENLEQALVTQGLTLAQYRTQLKEQMERLRLMSQEVRSKVQVGEREMREYYQAN
FT                   IAAYGGSEVYSARHIFFKVDKKGGAGELSKAETRANEVLAKARAGEDFAALAKKYSDDP
FT                   AAAKDGGDLGTFKKADMLPEIGDTVSAMKPGEVSSIVRSPAGLHIIKLEGKKQDAGRPF
FT                   EQVKDSIEDTLYKKKSDERFAQWVKELRAGAAIELR"
FT   gene            complement(257560..258453)
FT                   /locus_tag="Gbem_0217"
FT   CDS_pept        complement(257560..258453)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0217"
FT                   /product="DnaJ-related molecular chaperone"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37248"
FT                   /db_xref="GOA:B5E9V0"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR002939"
FT                   /db_xref="InterPro:IPR008971"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:B5E9V0"
FT                   /protein_id="ACH37248.1"
FT                   /translation="MAQRDYYEVLGVKKGASVDEIKRAYRKLAVKYHPDKNPGDKQAEE
FT                   RFKEINEAYAVLSDPKKKEQFDQFGSTNFHQKFSQEDIFRGFNVDDMFRDQGFGTDDIF
FT                   SRIFGDALRRQRGGGHGRMAVRGEDFSMEIQVTFREAYDGAEKRVAFMRDGAREELSVK
FT                   IPAGIESGAKLRVAGRGGAGRMGGNSGDLYLTVTVGADPLFTREGADLVLNHEVKFSQA
FT                   VLGGYIEVPTMSGAKRIKIPASIQAGTKVRLKGLGFPLVGEQARGDMYVRIAVHVPEKL
FT                   SHRQRELVEQLAAEGL"
FT   gene            258607..259806
FT                   /locus_tag="Gbem_0218"
FT   CDS_pept        258607..259806
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0218"
FT                   /product="protoporphyrinogen oxidase-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37249"
FT                   /db_xref="GOA:B5E9V1"
FT                   /db_xref="InterPro:IPR002937"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B5E9V1"
FT                   /protein_id="ACH37249.1"
FT                   /translation="MKQFDAIVIGAGISGLSFANYSAAAGLNTLVLEKSGRVGGCFHSH
FT                   RFDGEAAGFWLELGAHTCYNSYQGLIGLMERHGMMESILAREKVSFKMLVDNEIKSITS
FT                   QLSFPELFGSAWRIFTLKKEGESVASYYGRIVGRKNYDRVFAPAFNAVISQRANDFPAD
FT                   MLFNKRPRRKDVIKSFTLQGGLNTVIDKLSAAAGITVVTGAEVARVAQGGKGYVVELAG
FT                   GEGFEAPRLVLATPPPASAQLSGEISPELSRLFTQIKVENIETVGAAVKKGKLTLPSMA
FT                   GIIPIGENFYSAVSRDTVPHDSYRGFSFHFKSGGGALEAKLKRVAAVLRVKPEDLEQVV
FT                   QRESQLPSPVVGHKALTDRIDQITSGQKLYVTGNYFAGMAIEDCIVRSRKEYERFTAAL
FT                   "
FT   gene            259968..260678
FT                   /locus_tag="Gbem_0219"
FT   CDS_pept        259968..260678
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0219"
FT                   /product="4helix_suffix domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37250"
FT                   /db_xref="InterPro:IPR012657"
FT                   /db_xref="InterPro:IPR026354"
FT                   /db_xref="InterPro:IPR036583"
FT                   /db_xref="UniProtKB/TrEMBL:B5E9V2"
FT                   /protein_id="ACH37250.1"
FT                   /translation="MENEALIPAHGGYRNLKSFQVAQLAYDVTVRFCDRYIGKSSRTHD
FT                   QMVQAARSGVQNIAEGSQASGTSKKTEMKLTSVARASLEELRLDYQDFLRQRGLPLWDR
FT                   SDPRRLALITRRCRTADEVARWVVETRNGHNGLSGRCGHGPDGPDGPDGPCAATESIKS
FT                   TGSIGSRSIESTRSTGTARSGYAEVAANAALTLIAVACSLLERQLAAQAAAFQKEGGFT
FT                   ERLYRTRTSSRKNP"
FT   gene            complement(260686..261189)
FT                   /locus_tag="Gbem_0220"
FT   CDS_pept        complement(260686..261189)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0220"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37251"
FT                   /db_xref="GOA:B5E9V3"
FT                   /db_xref="UniProtKB/TrEMBL:B5E9V3"
FT                   /protein_id="ACH37251.1"
FT                   /translation="MDPERWHHFSGVLLVILLAVLQGRVGRAGAFWQICWALPGTLLHE
FT                   LSHLIVAAVSGGRPVGFSILPRREGRERWVLGSVTISRPGMISAFPSALAPLLLNMVAY
FT                   YLYLQWGRWFPADLWHTLLMYAVIYVFCYSSVPSGQDFKVAFSRPSGVALYALLGCGAW
FT                   YLGS"
FT   gene            261384..261860
FT                   /gene="prx-4"
FT                   /locus_tag="Gbem_0221"
FT   CDS_pept        261384..261860
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prx-4"
FT                   /locus_tag="Gbem_0221"
FT                   /product="peroxiredoxin, 1-Cys subfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37252"
FT                   /db_xref="GOA:B5E9V4"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR024706"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B5E9V4"
FT                   /protein_id="ACH37252.1"
FT                   /translation="MFLEGQPAPNFSLQGSDAKTHTLKDYAGRILVLFFYPRDNTPGCT
FT                   AEAVGFAKLQPLFEQLGAVLVGVSKDSLKSHAKFSADFKLPFTLLSDPDASVMKAYGAY
FT                   GEKQQYGKTTIGSIRSTVVISPDGMVIKHWPKIPKASEHPDKVLDFFKMLAKGR"
FT   gene            complement(262023..263417)
FT                   /locus_tag="Gbem_0222"
FT   CDS_pept        complement(262023..263417)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0222"
FT                   /product="helix-turn-helix transcriptional regulator with
FT                   aminotransferase domain, GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37253"
FT                   /db_xref="GOA:B5E9V5"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B5E9V5"
FT                   /protein_id="ACH37253.1"
FT                   /translation="MFILDHHSKLPLYTQLYDQMKAGVLSGKLPSHSKLLSVRELAAEL
FT                   SISRNTVENAYLELCAEGYIYSKPRSGYFVSALAPDALPLPSPRIKEQRAHLPEPEPKG
FT                   SIDFHPARLDPDTFPTSLWRRCFLDSLRQSRSALAQYGAPQGELRLRSSIRRYLERSRG
FT                   VACDPEQVVICSGLQQSLDLVAQILKERRPAVAVENPGFHLPRSIFRNHGFETVPIAVG
FT                   SGGLDLDALESSGATLVYVTPSHQFPTGCVMPIANRLSLIEWANAGDRLVIEDDYDSEL
FT                   RYHGKPIPSLQGLHPDGNIVYLGTFSKVLSPALRVSYLVLPYALLSAYRRLFRDYACTV
FT                   SLLEQATLARFMEQGDWDRHLRRMRTLYQKKHDAMLRAVETHFGPKALVLGQGAGLHMV
FT                   LELSQHDLSEKELISRARSKGIELFPYSATCAEEVGSCSRVVLGFGGVKPDVIDRGVEL
FT                   LSRAWY"
FT   gene            263622..263993
FT                   /locus_tag="Gbem_0223"
FT   CDS_pept        263622..263993
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0223"
FT                   /product="pyridoxamine-5'-phosphate oxidase-related
FT                   FMN-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37254"
FT                   /db_xref="GOA:B5E9V6"
FT                   /db_xref="InterPro:IPR011576"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:B5E9V6"
FT                   /protein_id="ACH37254.1"
FT                   /translation="MFSEKLLDVIKHPGVAAIATQGEDGPHLVNTWNSYLQLPREGCLL
FT                   IPAGYMHRTEANLARDNRVLLTVGSHEVAGKMGPGTGFLLKGTAAFVSSGPDFDTIKAK
FT                   YAWARGALVVAVESATQTL"
FT   gene            complement(264179..265174)
FT                   /locus_tag="Gbem_0224"
FT   CDS_pept        complement(264179..265174)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0224"
FT                   /product="lipid A biosynthesis acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37255"
FT                   /db_xref="GOA:B5E9V7"
FT                   /db_xref="InterPro:IPR004960"
FT                   /db_xref="UniProtKB/TrEMBL:B5E9V7"
FT                   /protein_id="ACH37255.1"
FT                   /translation="MSNQAPRVPNRAAVAPVFAWWALQSAIFYGLTLLASSLPISLSRR
FT                   FGAWGGAFIPRILPRRLDVAVDNISRALPFMQAHPLWNPQNPPVEELAHQNFRNLGRNL
FT                   VEISRLYHGREEGVLDVIELRGRENLDRAKGKGKGVVCFSGHCGNWEVMALALGSIFGD
FT                   GVVVARRQKNPFLEKMITRMRMRYNSRVLDKQGALRGILKALKKGELVGILADQAVLPE
FT                   EGVLIEVMGRQAWASKAPVIIARASGAAVVPVFIHREEGRQVITFHPEYRFSSDESEAG
FT                   ITSDIQALSRYVEDFVVAHPTQWYWVHRRWKRAFAAGAAPLDEVALLTAG"
FT   gene            complement(265414..265572)
FT                   /locus_tag="Gbem_0225"
FT   CDS_pept        complement(265414..265572)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0225"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37256"
FT                   /db_xref="UniProtKB/TrEMBL:B5E9V8"
FT                   /protein_id="ACH37256.1"
FT                   /translation="MTTLILIILAIVAIVLTIWFLTIPAEVVAGTFKAFRHGDWKHRKP
FT                   GPPRVSG"
FT   gene            265765..268500
FT                   /locus_tag="Gbem_0226"
FT   CDS_pept        265765..268500
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0226"
FT                   /product="phosphoenolpyruvate carboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37257"
FT                   /db_xref="GOA:B5E9V9"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018129"
FT                   /db_xref="InterPro:IPR021135"
FT                   /db_xref="InterPro:IPR033129"
FT                   /db_xref="UniProtKB/TrEMBL:B5E9V9"
FT                   /protein_id="ACH37257.1"
FT                   /translation="MQDTKETPDKLQRDLDYLMDCLAEMFSGLQEKELSACLPRADSLA
FT                   PGADCRFVRAWSIAFQLLSMAEENFAVQSRRALEAEQGLVAEPGLWGRVLEQIKESGVT
FT                   AEELAAKLGQIRVEPVLTAHPTEAKRASVLRHLRELYLLLVKRENTVWTPAEKDDIRDD
FT                   IVAMLERLWRTGEIHLEKPHVLNELASMIYHLREIFPKAIPILDQRICRAWSEAGLAGA
FT                   ISPLTTALPRISFSTWVGGDRDGHPLVTPEVTEATLKELRLNALMLIHGQLTTLGSRLS
FT                   LSRRLIHPSAGLQRRLDQLAAHSGPAGSEALRRNPEEPWRQMVNLIKARLPVDVTGEEE
FT                   ILCGDLGTRYCHSDELAHDLRLLRDSLVAAGASRLALADVVPVLRTVEVFGFHLASLDI
FT                   RQNSSYHDKAVDQLLAAAGISDHRFSQWSEEKRLAFLDQELASPRPFVRADAKPGPEAE
FT                   GVLGCFRVLAAHIALYGTDAIGPLIVSMTRSVSDLLVVYLLAREAGLTAAGEGGAVCLL
FT                   PVVPLFETIDDLRGSSAILEAFLVHPATRRTLAHLHGDQPVQQVMVGYSDSNKDGGILA
FT                   SLWSLYRGQEAMLETARRLGVRLRFFHGRGGTISRGAGPTSRFLRGLPEGSTGGDLRLT
FT                   EQGEVISQKYSNPLNAAYNLELLLAGTAVVTLPPRQPAIPKERLESLMDRLAQRSRFAY
FT                   EQLLAEPGFIKFFRQATPIDVIECSSIGSRPARRSRSATLSDLRAIPWVFSWSQARYFL
FT                   SGWYGVGSALEELLNEDERSFRELAGHSQSWTALHYIISNTATSIATADLQIMQAYAGL
FT                   VLDQTVRDPIFALLKGEYLRTTRILEEIYGGALAERRASVYTSLARREGALKVLHDRQI
FT                   DLLRQWRRPETQQNRAQCEELLFWLLETVNAIAAGLGTTG"
FT   gene            268797..269258
FT                   /locus_tag="Gbem_0227"
FT   CDS_pept        268797..269258
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0227"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37258"
FT                   /db_xref="GOA:B5E9W0"
FT                   /db_xref="UniProtKB/TrEMBL:B5E9W0"
FT                   /protein_id="ACH37258.2"
FT                   /translation="MKQTDQKVVASPEERRRDFRLTPLIGIYLLCMLLTLSHLGEPYPF
FT                   MGKIYTGDSSESLIFVDSVISLYLIVGILKRQRLTLWLLIAYNFLESASGISNLLLLPV
FT                   QQIMTASGAMVPDYHYRINAFSVFVLFLLLNVFLYFNRDRFDNKSIYLW"
FT   gene            complement(269569..270198)
FT                   /locus_tag="Gbem_0228"
FT   CDS_pept        complement(269569..270198)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0228"
FT                   /product="acetate transporter AcpA family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37259"
FT                   /db_xref="GOA:B5E9W1"
FT                   /db_xref="InterPro:IPR000791"
FT                   /db_xref="UniProtKB/TrEMBL:B5E9W1"
FT                   /protein_id="ACH37259.1"
FT                   /translation="MSDLKLGNPAVVGLAGFGMTTFVLQCHNLGWCGIAPVLWLGLCFG
FT                   GTAQLVAGLMEMRTGNNFGFCAFTGYGAFWISLCLMIIFGKNPTLVASYPTLAFNANDL
FT                   GFYLVAWTIFTFILFIASMKHNATLAFIFLTLLLGFIGLDVKEFTGSALAGTFAAYDLL
FT                   ICAFSALYLMAVAVYAESGINLPVGEAWIKDKPQTEEAVATSKVTA"
FT   gene            complement(270490..272913)
FT                   /gene="mcp40H-3"
FT                   /locus_tag="Gbem_0229"
FT   CDS_pept        complement(270490..272913)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mcp40H-3"
FT                   /locus_tag="Gbem_0229"
FT                   /product="methyl-accepting chemotaxis sensory transducer,
FT                   class 40H"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37260"
FT                   /db_xref="GOA:B5E9W2"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="UniProtKB/TrEMBL:B5E9W2"
FT                   /protein_id="ACH37260.1"
FT                   /translation="MTIKAKLILNSCIVLVAVGAVSVSSFFSMTSIKGKLSYLTEKSTP
FT                   YQVRTVEFQRALQGATADLIKVGAAHDDLAYAAAKKEAEKSLEEVQKTLERLEKISGEK
FT                   LEASAELNGVAQELFSTMAAKLKSEKESGEARAVIVQKAQEANGKIRELENKVRSLQQS
FT                   SSAAYSSANEDADKLSKKLASIETLKVSLKDLQFIFYDILRTPEKKALHDRFAGTLTRI
FT                   QQNGNIKNNKALGSGFADFLIKANTAIKARTEGADPRQVDALMKEPNAALSEMWDLIED
FT                   EVDKSQLQVSKLSARLPGYVTKANAAVNVLSTNTEIVSLGKSLESLSSRLFLATSEKEL
FT                   DAIAADFGQQYQKLAVAERSVETLIKTAGTARETRILREASVSLAGIRDTVFMRNGILE
FT                   KLHQKMQLEAKADSAAIKLRDIVSKQAEKGKKTVSVAQEGQEVAIGTVNRTIRYSMMLI
FT                   ILIAIGSAVIGTLVGMWIYRSITGPIEHLITVAEEVAEGNLAVDLAATRNDEVGHVQNA
FT                   MSRMLVSIRNVVKSIGEATDTLAGSSVEMAATAGALETGAERQASRVDGSAATMAQMNQ
FT                   TTMDMAKNTADTANAADTMKAIAAEGKGAMQLTADELQAFAQSFTETAVMVEELGGQSA
FT                   QISEIGTLIRDIADQTNLLALNAAIEAARAGEQGRGFAVVADSVRELAERTATATAEIT
FT                   QTVKNMQVSVGRSVAKMSEEREAVGTILTRVNTTVGAIERIAQYVDQVNDMVRRIATAT
FT                   EEQSAASSEVSENVEEIALLTREVRASCSGIRESSDGLSRLAGDLHGMVAWFKV"
FT   gene            273186..274121
FT                   /locus_tag="Gbem_0230"
FT   CDS_pept        273186..274121
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0230"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37261"
FT                   /db_xref="UniProtKB/TrEMBL:B5E9W3"
FT                   /protein_id="ACH37261.1"
FT                   /translation="MAVLRRVVSFRKFPDPIFQYIAELEDIFVERLCLDSCGIEECIGK
FT                   DAHYGPDDYDFVMVPMASDIRYFSDNDRVIPWVFDVFPKDFEQFRLDIAKFKIVYLTDT
FT                   AVCRRLQSMGCGQVRFMPFSVSDAHVADGCPVKDIDIIHYGRRDTVLESYTETLLRQNP
FT                   QLHYVRTEYDSNRNRHYFHSNFGGMVGSSDVRDNFWKVLERCKVSLVSMPGFDHGRREG
FT                   LLTVPIRYFESAAKFCHMISRHPDSGDFLWLGISDIAENVSSYEEFELVTMRCLNNALS
FT                   PQKTRSYDEFLAHHVASRRADQVREDVASL"
FT   gene            complement(274669..274745)
FT                   /locus_tag="Gbem_R0007"
FT   tRNA            complement(274669..274745)
FT                   /locus_tag="Gbem_R0007"
FT                   /product="tRNA-Pro"
FT   gene            274997..276343
FT                   /locus_tag="Gbem_0231"
FT   CDS_pept        274997..276343
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0231"
FT                   /product="UbiD family decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37262"
FT                   /db_xref="GOA:B5E9W4"
FT                   /db_xref="InterPro:IPR002830"
FT                   /db_xref="UniProtKB/TrEMBL:B5E9W4"
FT                   /protein_id="ACH37262.1"
FT                   /translation="MAFKDLRGFIAGLEAAGELQRVAAEVDPDLEIACITDRQSKLPGG
FT                   GKALLFENVKGSPFPVATNLFGSPARMALALGVPKLDRLSEAMDELLLCPGRAPLPLLS
FT                   DRAPCREVVERAPNLLRYPFLKSWPGDGGRFITLPLVFTRDPETGADNCGMYRVRIFGE
FT                   RSAGVRWKNGSGGWQHHRKYLASGERMPVAIAIGADPALTLAASLPLPAGLDEVSFAGY
FT                   LRGEPVPMLRCLDSDLLVPADAELVIEGFVEPGVTRNEGAFGNHTGSYDPGEEVPLLTL
FT                   TCIARRRDPICQATVVGPPPMEDCWMAKAAERLLLPLIRRQCPEIVDLLLPLEGIFHGC
FT                   ALIAIEKSLPGQGRRVLETLRSEGWLKRGKLLVVVDAAEMPLTLSEGFWRALNAVNFPR
FT                   DLAVTPDGCLGVDATRKFPEEGGGQYKELKQDASVSAQVQKRWREYGFF"
FT   gene            276389..277258
FT                   /locus_tag="Gbem_0232"
FT   CDS_pept        276389..277258
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0232"
FT                   /product="menaquinone biosynthesis polyprenyltransferase,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37263"
FT                   /db_xref="GOA:B5E9W5"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR006371"
FT                   /db_xref="InterPro:IPR039653"
FT                   /db_xref="UniProtKB/TrEMBL:B5E9W5"
FT                   /protein_id="ACH37263.1"
FT                   /translation="MTLYARTRVFLEMIKFSHTIFALPFAFTGALLAAGGLPTVSQAGW
FT                   IVCAMVGARTAAMGLNRVIDAEIDARNPRTAGRAIPAGLLGRGAVICFIVLSVLLMLFA
FT                   ARMLNPLCLYLSPVALGFILLYSYCKRFTALAHVVLGICLAGAPLGAWIAIRGSADLPA
FT                   YLLAFAVLFWVAGFDILYALQDMEFDQAAGLHSIPAKLGVNGSLWTSRIFHLVACLFLA
FT                   ALYIFMHLGTFFLAGLAATCGMLLYEHHLLRGGDLSRLDAAFFNMNGYISVTLFAATLL
FT                   DRVSAGGM"
FT   gene            277255..277866
FT                   /locus_tag="Gbem_0233"
FT   CDS_pept        277255..277866
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0233"
FT                   /product="menaquinone biosynthesis decarboxylase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37264"
FT                   /db_xref="GOA:B5E9W6"
FT                   /db_xref="InterPro:IPR003382"
FT                   /db_xref="InterPro:IPR004507"
FT                   /db_xref="InterPro:IPR036551"
FT                   /db_xref="UniProtKB/TrEMBL:B5E9W6"
FT                   /protein_id="ACH37264.1"
FT                   /translation="MKPRHFTVAITGASGVVYGLKVVEELLRGGSRVSLLVSEAGFAVL
FT                   RQECGLDLAGTPGEILDGVRSHLGLPGELLGYYDLNDLFAPIASGSAAPDAMLVVPCSM
FT                   GTLSRISCGNSGNLLERAADVMLKEGRPLVLVPRETPFNAIHLEHMLKLARLGVRIVPA
FT                   MPGFYHDPETIEDLVDFVAGKVLDAVQVEHTLFRRWGSRP"
FT   gene            277885..278961
FT                   /gene="mqnC-2"
FT                   /locus_tag="Gbem_0234"
FT   CDS_pept        277885..278961
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mqnC-2"
FT                   /locus_tag="Gbem_0234"
FT                   /product="dehypoxanthinylfutalosine cyclase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37265"
FT                   /db_xref="GOA:B5E9W7"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR020050"
FT                   /db_xref="InterPro:IPR022432"
FT                   /db_xref="InterPro:IPR034405"
FT                   /db_xref="UniProtKB/TrEMBL:B5E9W7"
FT                   /protein_id="ACH37265.1"
FT                   /translation="MTFATIAEKVRAGGRITEPEALVLFEHPDLLALGELAQSVNERRN
FT                   GKRVFFNVNRHINHTNICVNRCRFCAFFRKAGDPGAYLMTLDEVRGRAEEAVKEGATEI
FT                   HVVGGLHPELPFEFYLELLATVKAVSPALHVKAFTAVEIAYLAKLSGLGIPATLEKLKE
FT                   AGLGSLPGGGAEIFAPEIRNQLCPEKISGAAWLSIMEQVHQAGLKSNATMLYGHLESVA
FT                   DRVDHMRQLRELQDRTGGFQVFIPLAFQPEHSQLKIAGSGTSGVDDLRTLAVARIYLDN
FT                   FANVKAYWVMLGEKIAQVSLSFGVNDLDGTVVEERIGHEAGADTPQTMSRDNIVTMIRK
FT                   AGRIPVERDTLYQELRVY"
FT   gene            279025..280098
FT                   /gene="mqnC-1"
FT                   /locus_tag="Gbem_0235"
FT   CDS_pept        279025..280098
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mqnC-1"
FT                   /locus_tag="Gbem_0235"
FT                   /product="dehypoxanthinylfutalosine cyclase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37266"
FT                   /db_xref="GOA:B5E9W8"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR020050"
FT                   /db_xref="InterPro:IPR022431"
FT                   /db_xref="InterPro:IPR034405"
FT                   /db_xref="UniProtKB/TrEMBL:B5E9W8"
FT                   /protein_id="ACH37266.1"
FT                   /translation="MSKMFHAIIEKVAAGAAITSEEALWCLTEGELLAVGRLADSIRRA
FT                   MHPDGCVSFVVDRNVNYTNVCESRCKFCAFYRDADAADAYLLDTEAIMAKIGELVAQGG
FT                   TQLLMQGGLHPSLDIVWFEELFREIKRRFPGVQNHSLSPAEVTQVAKLSGLGIGETLTR
FT                   LKRAGLDSIPGGGAEILVDSVRAEISPKKIGWQGWAQVMREAARLGMPTTATMMFGSRE
FT                   RAEDIVEHLFRVRALQDEGGSFTAFIPWTYQPGNTELGGEGASGVEYLKVLALSRIVLR
FT                   NVPNVQASWVTQGAKMAQVALFFGANDLGGTMLEENVVAAAGCRFRMSREEMITLIRGA
FT                   GFTPVRRTTLYQELERY"
FT   misc_feature    complement(280129..280159)
FT                   /note="heptanucleotide repeats; Gbem_R7011"
FT   gene            280211..281263
FT                   /gene="hisC"
FT                   /locus_tag="Gbem_0236"
FT   CDS_pept        280211..281263
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisC"
FT                   /locus_tag="Gbem_0236"
FT                   /product="histidinol-phosphate aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37267"
FT                   /db_xref="GOA:B5E9W9"
FT                   /db_xref="InterPro:IPR001917"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR005861"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5E9W9"
FT                   /protein_id="ACH37267.1"
FT                   /translation="MIALRENIAEMAGYVPGFQPLDVDSYIKLNTNENPYPPSPKVLEA
FT                   IAKEAGEGLRRYPDAASRLAREEAAKVYGFDPSWIIMANGSDEVLNNLIRACAGEGEEI
FT                   AFINPSYSYYGTLAEVQGARVRTFGLSESFEPEGIPEHYDGKLFFLTNPNAPLGFTYSQ
FT                   RYIADLAGRLSGVLVVDEAYVDFAEETSLELVRSFDNVVVTRTFSKSYSLAGMRLGLAI
FT                   ARPEIIAALNKIRDHYNLDRLAQAAAAAALADQPYFQECVRKIKETRAWFTAELQQLGY
FT                   QVIPSSGNFVFASPPDRDGTRIYQGLYDRKILVRHFTDPKLAHGLRISIGSREEMEQTV
FT                   KALRELGPGR"
FT   gene            281441..282574
FT                   /locus_tag="Gbem_0237"
FT   CDS_pept        281441..282574
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0237"
FT                   /product="ribonuclease D, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37268"
FT                   /db_xref="GOA:B5E9X0"
FT                   /db_xref="InterPro:IPR002121"
FT                   /db_xref="InterPro:IPR002562"
FT                   /db_xref="InterPro:IPR010997"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:B5E9X0"
FT                   /protein_id="ACH37268.1"
FT                   /translation="MQKKNNVTNPAAAHLVTDQKTLDELVERLSRESVLAFDLEADSLH
FT                   HYTEKVCLIQVSSTSEDRLIDPLAPIDVKVLAPIFANPAIKKIFHGADYDMRSLYRDFG
FT                   IEVVNLFDTMIASQFLGESEFGLAALLKKRFGVELDKRYQKADWSKRPFSQEMLDYAMK
FT                   DTSLLIELYRQLEAELKQKGRLAWVEEESELVAGVRSPSREGELMCLRFKGASKMKPRE
FT                   LAVLEELLRFRDEKARLADVPPFRILSNDLLRELAEKQPRNNFELVGIHTMSSKLIERL
FT                   GRGLLQAVANGLAVPQDKLPQVHSGRRPVLDRLQDERVKRLKVWREAKSAQLGLGIGLV
FT                   ANNTLLEALAEPGSQNITLLKRWQREAFGDELASLIS"
FT   gene            282755..283498
FT                   /locus_tag="Gbem_0238"
FT   CDS_pept        282755..283498
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0238"
FT                   /product="protein of unknown function DUF72"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37269"
FT                   /db_xref="InterPro:IPR002763"
FT                   /db_xref="InterPro:IPR036520"
FT                   /db_xref="UniProtKB/TrEMBL:B5E9X1"
FT                   /protein_id="ACH37269.1"
FT                   /translation="MTLYVGTSGYSYHEWKGIFYPADLPDRQMLHYYGGVFLSVEINNT
FT                   FHRMPTPALLESWSQEVPAGFKFALKAPQRITHFQRLKGVDDAVSYLFDVAGGLGDRLG
FT                   PVLFQLPPSLKKDLPLLRDFLALLPPAARASIQFRHRTWMDDEVFELLRRNDAALCLAD
FT                   LEDDVETPAVATATWGYLRLRRQEYGEAELKRWVDLVARQNWRDAFVFFKHEESARGPL
FT                   LARNFLEVAGGGRGKDQGAGKSRPR"
FT   gene            283542..283874
FT                   /locus_tag="Gbem_0239"
FT   CDS_pept        283542..283874
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0239"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37270"
FT                   /db_xref="GOA:B5E9X2"
FT                   /db_xref="UniProtKB/TrEMBL:B5E9X2"
FT                   /protein_id="ACH37270.1"
FT                   /translation="MNIATIWGIAKVAATRIPWGRVMENIPAVVDLAERAKGRFRGHGG
FT                   GDIEAKLRHLQEENRKLEQALLETSGHLQQTIRTLKVVVARQKMMMTATAVSLLTAIAA
FT                   LVVALR"
FT   gene            complement(283882..284622)
FT                   /gene="rsmE"
FT                   /locus_tag="Gbem_0240"
FT   CDS_pept        complement(283882..284622)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rsmE"
FT                   /locus_tag="Gbem_0240"
FT                   /product="16S rRNA (3-methyl-U1498)-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37271"
FT                   /db_xref="GOA:B5E9X3"
FT                   /db_xref="InterPro:IPR006700"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:B5E9X3"
FT                   /protein_id="ACH37271.1"
FT                   /translation="MRSFFLGDNAICGDSVTITGELYRHMARVLRIKQGSEVELIEDGD
FT                   SRHRGTVEEVGAKSLTVRISASAAPAAEEPGLRITLLQGMPKGEKLDLILQKCTELGVA
FT                   EVVAFDAARSVVKLRGDRSATRLARYEKIVREAARQSGRRSAPKVALGGTLADVLADSH
FT                   HEVKLLLYEGEEKTTLHGCFGAFEAPESVAVVVGPEGGLAPEEVRQALAAGFTPVTLGK
FT                   RILRTETAGLAMLSILQFHWGDMG"
FT   gene            complement(284626..285546)
FT                   /gene="prmA"
FT                   /locus_tag="Gbem_0241"
FT   CDS_pept        complement(284626..285546)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prmA"
FT                   /locus_tag="Gbem_0241"
FT                   /product="ribosomal protein L11 methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37272"
FT                   /db_xref="GOA:B5E9X4"
FT                   /db_xref="InterPro:IPR004498"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5E9X4"
FT                   /protein_id="ACH37272.1"
FT                   /translation="MTTDWAEIACEVPAEMVDSLADFLVELTGNGVGIDNLHLDTFSLD
FT                   TLEDTPLKSVKGYLPLDDSLEEMRIRIEQFLAQTGPSFPGYVYAPPVVTVIRNEDWANN
FT                   WKVHFKPVRIGQRLVIKPTWEEYLKLEGDLVIQIDPGMAFGTGAHPTTKMCLEALERIC
FT                   FDASGGKLPSPVLDVGTGSGVLSIAAALLGAKEIVAVDIDPEAVRVTMENLELNGVADL
FT                   VAASTTSLEQLPGGFRVVVANILAEELVRLADELTARVAPGGWLILSGILTEKEAFVCA
FT                   AFNSLELVENPKELEWSCLSFRKPL"
FT   gene            285816..286628
FT                   /locus_tag="Gbem_0242"
FT   CDS_pept        285816..286628
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0242"
FT                   /product="ADP--[pyruvate phosphate dikinase]-threonine
FT                   phosphotransferase and [pyruvate phosphate
FT                   dikinase]-phosphothreonine--phosphate pyrophosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37273"
FT                   /db_xref="GOA:B5E9X5"
FT                   /db_xref="InterPro:IPR005177"
FT                   /db_xref="InterPro:IPR026565"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5E9X5"
FT                   /protein_id="ACH37273.1"
FT                   /translation="MYHVYLLSDATGETVERVARAALTQFRDVDIRLRRMGQIRNREDI
FT                   LRALDEVDRAPGIIFYTLVNTELAQFVRNEVEARQLEAVDLITPLLYKLAEFLEMRPQK
FT                   LPGLQYEMNSEYYRRMEAVDFTVKQDDGQEPRNLHKADIVLIGVSRSSKTPLSMYLAHK
FT                   GYKVANVPIIQGIDPPGELEEVEPERVVGLIIDTQRLVDIRSARLRNLRQSPRGSYADY
FT                   RQVEEELAYCRRFYRAHPAWLVIDVTNKSVEESAAEILSRLHGDIRHD"
FT   gene            286662..287336
FT                   /locus_tag="Gbem_0243"
FT   CDS_pept        286662..287336
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0243"
FT                   /product="winged-helix transcriptional response regulator"
FT                   /note="domains: REC, trans_reg_C"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37274"
FT                   /db_xref="GOA:B5E9X6"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:B5E9X6"
FT                   /protein_id="ACH37274.1"
FT                   /translation="MRILVVEDEKKVASFIKRGLEEEQYEVHTAADGEEGLKLALEKPF
FT                   DLIVLDWMLPKKDGLSVLKELRERKNLTPILMLTAKDSVEDIVAGLDSGSDDYLTKPFA
FT                   FAELLARVRALMRRSELDRGAEIRFADLRLDLVTHKVWRKDKEIDLTAKEYGLLEYFMR
FT                   NPHQVLTRTMIAEHVWDYTFDSFTNIIDVYVNYLRKKIDREADKKLIHTVRGVGYILKE
FT                   EE"
FT   gene            287438..288814
FT                   /gene="degP"
FT                   /locus_tag="Gbem_0244"
FT   CDS_pept        287438..288814
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="degP"
FT                   /locus_tag="Gbem_0244"
FT                   /product="periplasmic trypsin-like serine protease DegP"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37275"
FT                   /db_xref="GOA:B5E9X7"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR001940"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR011782"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="InterPro:IPR041489"
FT                   /db_xref="UniProtKB/TrEMBL:B5E9X7"
FT                   /protein_id="ACH37275.1"
FT                   /translation="MQAAIVARFLVLSVFLSSIFSTVAGASVLTPDFAKLAKKLKPAVV
FT                   NISTSKTLAVKKRQIAPGQDPFQEYFDKFFEGPHQRPQKQRNLGTGFIISDDGYIITNN
FT                   HVVKDADEIKVKLSDGREFAGDVKGRDEKLDLALVKIDAKDHLPVAPLGDSDKMEVGDW
FT                   VMAIGNPFGLSQTVTAGIISAQGRVIGSGPYDDFIQTDASINPGNSGGPLFNTEGEVIG
FT                   INTAIVAGGQGIGFAIPVNMAKEILPQLKSAGKVTRGWLGVSVQLVTPDLAKSFGLDTE
FT                   KGALVADVVKGSPAEKAGLKGGDIILEYDGHPIKEMGELPRRVAATPVGKKVKVVVLRE
FT                   GRQEPLQVTVEQLKEGGEEDSAVTSDRLGVKVTELTPERAQQLRLQGDKGVVVTDVEPD
FT                   SLADRAGILEGDLIREINGVRVSGVSDYSKLIAAAKKGGYLKMLLRRGEASLFVALRLE
FT                   "
FT   gene            complement(288913..289944)
FT                   /locus_tag="Gbem_0245"
FT   CDS_pept        complement(288913..289944)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0245"
FT                   /product="ribonuclease Z-related hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37276"
FT                   /db_xref="GOA:B5E9X8"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:B5E9X8"
FT                   /protein_id="ACH37276.1"
FT                   /translation="MTPHFLPALVNPPFGDPGLYVDFLFARRAVLFDLGDLAPLPTRKL
FT                   LRVSDICISHTHIDHFIGFDLVLRIMLGRDKEVRLYGPSGILRQVEHRLASYSWNLIQS
FT                   YPTEFVLTVTELHPDGSAQRASFSSRRIFERENQQELMLPEGVVLDEGNLRIRATFLEH
FT                   SIPCLAYAFEEKLHVNFMKNRLAELGLPVGPWLSEVKRAVLRGEPDDTLVYPAAAGEER
FT                   PASGWTIAKLKEKVLQVVPGEKIAYVTDTAFTNENRRRIVELARDADYLFIEAVFLHVD
FT                   SERARDRAHLTARQAGELAREAGVARVLPFHFSPRHLGAEAELRREVNLAFAASPLQEE
FT                   ESG"
FT   gene            290062..290243
FT                   /locus_tag="Gbem_R0008"
FT   ncRNA           290062..290243
FT                   /locus_tag="Gbem_R0008"
FT                   /product="6S RNA, stationary phase repressor of
FT                   sigma-70-containing RNA polymerase activity"
FT                   /ncRNA_class="scRNA"
FT   gene            290402..290683
FT                   /locus_tag="Gbem_0246"
FT   CDS_pept        290402..290683
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0246"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37277"
FT                   /db_xref="InterPro:IPR007463"
FT                   /db_xref="UniProtKB/TrEMBL:B5E9X9"
FT                   /protein_id="ACH37277.1"
FT                   /translation="MRLKEEQIARLAEKVLGDLERAQLVEQKQGRAAVLAGIKSAIAED
FT                   LRLEEALERDAEALLEQTLKAVGGQGIDRHKMLRMIKEKLAKERKIVL"
FT   gene            290716..290988
FT                   /locus_tag="Gbem_0247"
FT   CDS_pept        290716..290988
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0247"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37278"
FT                   /db_xref="InterPro:IPR007463"
FT                   /db_xref="UniProtKB/TrEMBL:B5E9Y0"
FT                   /protein_id="ACH37278.1"
FT                   /translation="MHISEDRISHIAHRIYDKLWRDDLADFPDERRALDAVKGAIEGFF
FT                   SVMEQVDQAVRAKLASYSQAKVPGSREWEILYQKFYAEELAKRKW"
FT   gene            291147..291437
FT                   /gene="groES"
FT                   /locus_tag="Gbem_0248"
FT   CDS_pept        291147..291437
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="groES"
FT                   /locus_tag="Gbem_0248"
FT                   /product="chaperonin GroES"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37279"
FT                   /db_xref="GOA:B5E9Y1"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR018369"
FT                   /db_xref="InterPro:IPR020818"
FT                   /db_xref="InterPro:IPR037124"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5E9Y1"
FT                   /protein_id="ACH37279.1"
FT                   /translation="MNLRPLQDRIIVKRVEEATMTAGGLYIPETAKEKPQQGEVVAVGN
FT                   GKRGEDGKVYPIDLKVGDKVLFGKYAGSEVKLEGEDFLIMREDDILGVVEK"
FT   gene            291508..293151
FT                   /gene="groEL"
FT                   /locus_tag="Gbem_0249"
FT   CDS_pept        291508..293151
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="groEL"
FT                   /locus_tag="Gbem_0249"
FT                   /product="chaperonin GroEL"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37280"
FT                   /db_xref="GOA:B5E9Y2"
FT                   /db_xref="InterPro:IPR001844"
FT                   /db_xref="InterPro:IPR002423"
FT                   /db_xref="InterPro:IPR018370"
FT                   /db_xref="InterPro:IPR027409"
FT                   /db_xref="InterPro:IPR027410"
FT                   /db_xref="InterPro:IPR027413"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5E9Y2"
FT                   /protein_id="ACH37280.1"
FT                   /translation="MAAKIIKFDQEARNCILKGVNTLADAVKVTLGPKGRNVVIEKSYG
FT                   APLITKDGVTVAKEIELEDKFENMGAQLVKEVASKTSDVAGDGTTTATVLAQAIYRQGA
FT                   KLVAAGHNPMEIKRGLDQAVEALVAELKNISKPIKDHKEIAQVGTISANNDKTIGDIIA
FT                   EAMEKVGKEGVITVEEAKAMETTLETVEGMQFDRGYLSPYFVTDPERMEAAMDNVAILI
FT                   HDKKIANMKDLLPVLEQTAKSGRPLLIIAEDIEGEALATLVVNKLRGVLNVCAVKAPGF
FT                   GDRRKAMLEDIAILTGGKVISEEVGFKLENTTLDMLGQAKKITVDKDNTTIIDGYGAEA
FT                   DIQGRVKMIRAQIDETSSDYDREKLQERLAKLVGGVAVIKVGAATEIEMKEKKARVEDA
FT                   LHATRAAVDEGIVPGGGVAYLRALKVLEKLQLAPEQQFGVNVIKRALEEPIRQISQNAG
FT                   VDGSIVVDKVKNGKDAFGYNAADDVYVDMIEAGIIDPTKVSRSALQNAASVAGLMMTTE
FT                   AMIADKPKEEGAMPAMPGGMGGMGGMGGMM"
FT   misc_feature    293181..293214
FT                   /note="conserved palindrome; Gbem_R0089"
FT   gene            293414..295093
FT                   /locus_tag="Gbem_0250"
FT   CDS_pept        293414..295093
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0250"
FT                   /product="HEAT-like repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37281"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:B5E9Y3"
FT                   /protein_id="ACH37281.1"
FT                   /translation="MANPGGQHEEVSKEEYASANLVMTAMVKTSKALRIYLPNNPILIG
FT                   FTDDLNGKMTGHLEKYGEFTLDVEPFVLRYKGKDIYQNQDPKESMACRMFADGIRALFF
FT                   LPGVESSELMAFLGVAGFELSTSDEDVVTQLWERDLPHLRYLLEEDFIEGHLEEDLTDP
FT                   GSQQAAVTRVYQALAQQIPPQPRMIPKHLLMLTGEEEKWLRKARQVEARRNGLDDVVNI
FT                   LSAILAGVKEPVIFWDFVGIMGNLTTNMFLGGEIGQALRLIRFMDQLMKLGSTLPEQQR
FT                   LLAEALAGILNLQTVQVLQETLDGSEAVTHQELKELLLIFGLPSLGAICELLGRVEKLK
FT                   VRKVIIEVLVELGRENPAVFAPFLNDSRWYLVRNMVLVLSLVGTPVALDMIIKLIPHKE
FT                   ARIRREVLGYLERSGDLKAKAYIVKYLRDDSSALRIKALQVLAREKLPFALKPIVALTT
FT                   AEEFASRELSEKKAVYEALGELGGEEMLPMFRDMLLKKFWFQKTAEKESAQLAAAGLVR
FT                   MQTGQALALLQEARNSKRSGEVRDLLEQAIAALALARAKRSG"
FT   gene            295112..296548
FT                   /locus_tag="Gbem_0251"
FT   CDS_pept        295112..296548
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0251"
FT                   /product="cyclic diguanylate phosphodiesterase"
FT                   /note="domains: HD-GYP"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37282"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR037522"
FT                   /db_xref="UniProtKB/TrEMBL:B5E9Y4"
FT                   /protein_id="ACH37282.1"
FT                   /translation="MQLEKERDSLSNEMARLGKALVLQLFILLKTSSNYSEGHAALDLP
FT                   LANLLKVVRDIARRNEDASLRLRGGHLYLGELRLKPDIANFEAPRYVIEEMKRHLVGRL
FT                   SFMPEVSADDLRRFVYALREVDAAELLDAYTGLLDGMQQRMVAHIEVEVLRDDEVLIPD
FT                   TVQLQENNLKARPLYKKVLAAMDEVAAQMVAGRSLRLRESKRVVQQMIDLLFSHESDLL
FT                   GLSTMRSHDRSSQHHAANVCILSLVMGKRLGMSKFHLCELGLAALFHDLGKADVPKEIL
FT                   DKPSALTREERRIMENHVLYGVKKVMKLKGFDALSSRIITGIFEHHLQADFSGYPRFPY
FT                   QRLSLFGRIINIADCYDGLTSSRVSGRNAYPPHKALRVMLAQAGTAYDQPLLKLFINCI
FT                   GIHAIGSLLLLDSNELAVVVGNSADPTQWDNPRVRIIADAKGREVEGEIIDLGHPTCFR
FT                   TISATLDPYLYDLDVSRYFY"
FT   gene            complement(296573..297208)
FT                   /locus_tag="Gbem_0252"
FT   CDS_pept        complement(296573..297208)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0252"
FT                   /product="lipoprotein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37283"
FT                   /db_xref="UniProtKB/TrEMBL:B5E9Y5"
FT                   /protein_id="ACH37283.1"
FT                   /translation="MKGKLLGLVLVGLLLVMAGCGGGHDERPVIETTIPSDVAVDADIL
FT                   NSRGVLTVTPASTVNGVFAGVDPNPTKDDVYRAFLHFPLATVPLNARIRSADLSIVIKS
FT                   LTVLPPATTVPIRIELVSFTPPVEATDFNQLLPLQSVSIFPPISSADVNREVVVDVTPL
FT                   MVEAQIRGLRFFQVRIFQENDLTTPVPGLVEIDEETKVNAPLLTVVYD"
FT   gene            297558..299609
FT                   /gene="prkA"
FT                   /locus_tag="Gbem_0253"
FT   CDS_pept        297558..299609
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prkA"
FT                   /locus_tag="Gbem_0253"
FT                   /product="protein serine/threonine kinase PrkA"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37284"
FT                   /db_xref="GOA:B5E9Y6"
FT                   /db_xref="InterPro:IPR010650"
FT                   /db_xref="InterPro:IPR013153"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B5E9Y6"
FT                   /protein_id="ACH37284.1"
FT                   /translation="MTAKNETLRQHLAAVKAGERVFENAFQGIIRMILEPGFEKVVVNG
FT                   KTTYDFNIFRTGRKHTIGMYDEINSFVSFVKDAAEGGSSKEMAFVLVGEPGNGKTFFVE
FT                   FLCGKYRNFLQGKNRKYSFRFLNMDRLGNYGRIREIDSETYEDPMILAMNLFEDPDESR
FT                   RFIAEQGFSEAELDTLYRNYRPLGASTGYILNEIRDYLDNDVDKILESIAIMPVPMSES
FT                   LGTLTGKYPAKDKITSSAVDLLGEESIQRLLHLSDTNNPYRFDLRRGALARVAGGGVHF
FT                   SDEIFKNKKDLVQVYLGVIQNRAIEIDGYKWPIDSMIIATSNNSEFNRFLAEKEEAPIV
FT                   DRCRICYVSHNTNYRMQEGLTGYAIGSDSKTTLTREVLHQDPNLNYAASVGVVLTRLPR
FT                   SEKLTPIETMKLAAGEVAGEKSIKALAEVIDTLGQEPDITKRFGQRGLGHRSLGRSIQI
FT                   LKESSETNEGRCMVAYDVFRSLERVVLDYVVEPNERAKYLEDLKTGKQLYRERIMTEMF
FT                   NAYMDEPFAIKKDVQNYVNMIIGIDAENLGPDRMWKYKDPQTGELKALKIDERYVKSVE
FT                   ERIGLKTEEQRASFRTSIRKIYGQKISVDPSYDFMDNLELVKAVTDVRLKSDIAGAGSL
FT                   IGALANRTNEENQKLYDRMIVTMLGKLGYCRTCAQKTIEYFCTQEDES"
FT   gene            299775..301136
FT                   /locus_tag="Gbem_0254"
FT   CDS_pept        299775..301136
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0254"
FT                   /product="VWFA superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37285"
FT                   /db_xref="InterPro:IPR006698"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:B5E9Y7"
FT                   /protein_id="ACH37285.1"
FT                   /translation="MKDLGKYLEELKEKGLDPERYARYLDELAVTRDVPTSDRRGPFPN
FT                   FSKSLYSWQDLAVLQDQGRVPNSYQCHMKALDELLERDRQREKDGFPRKIKVGRLIKPG
FT                   KGGKGKIVVVPSTEEEKFLHDPTIRPPGEGGSTGGSGKGDEGEVIGEQKVRETGEEPGQ
FT                   GPGQGEGESHEMGASAYELGKVLTEQFQLPNLKEKGKKRSFTRYIYDLTDRNRGSGQVL
FT                   DKKATLRKIVETNISLGNVPDPGDMDPTRFLISPRDKVYRIFSQEKDYEPQAMVFFLRD
FT                   YSGSMAGKVTELVATQHVMIYSWLLYQYAGQVESRFILHDTEAKEVPDFDTYYNSRVAG
FT                   GTEVASAYKLVNEIVAKENLAADYNIYVFHGTDGDDWDTGGDKSIPELVKILSYVSRMG
FT                   VTIAEHAGTQWTEVARYLENSGLLRDKPDLLRLDVMHEDAEESRVIEGIKKLIS"
FT   misc_feature    complement(301149..301240)
FT                   /note="icosikaitrinucleotide repeats; Gbem_R7301"
FT   gene            301375..303000
FT                   /locus_tag="Gbem_0255"
FT   CDS_pept        301375..303000
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0255"
FT                   /product="SpoVR-like family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37286"
FT                   /db_xref="InterPro:IPR007390"
FT                   /db_xref="UniProtKB/TrEMBL:B5E9Y8"
FT                   /protein_id="ACH37286.1"
FT                   /translation="MELINQHTKEIMEGCKERARAAGLSFTDESLEYIVTNRDLIELSP
FT                   KVMIPTLYDYWVHDVEVLRGKGEYELYPHNPYETVINTRPPISFYNDNNPDWLNVMIFY
FT                   HVLGHIDFFQNNLYFRHTWEYDFTGQALSDKRVIAKLRAEKGRWVDYILEFARSIDNLV
FT                   AYHDELSPLFKSPDTVTSSRLDYYFDVFLQVEKKLPVAEYLKEVARYNEAVLQDKEEGE
FT                   RVFFAEVTTKYPEMEAHFAKSRNVKRVERRDLLRFLIENSEFLARDENRWMRSVLEVVR
FT                   KTSIFFQPQIRTKIMNEGWASYWHEKLFLVDDRIKGHEVDFARVHAGVTSMPRVGMNPY
FT                   ALGMRLMYQLKDMGDKGRTGYDFHRLSDANQRKEFDAKTEQGDEFLFKVRSNYCDYLFI
FT                   KEFVDQDFTNRYDLFVTGKRLDPQRMVWQYYVKSRDAREYRDMVLASLYHPPHIEIAPE
FT                   RGEDGSLYLVHHFEGKQLVSEYIANTMVGIEYLWGAPVQLETSEAVIEQTRGTAGKEGG
FT                   EEADITWQRVVYTMNEKTLSRQVL"
FT   gene            303016..305304
FT                   /locus_tag="Gbem_0256"
FT   CDS_pept        303016..305304
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0256"
FT                   /product="ATPase, AAA family"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37287"
FT                   /db_xref="InterPro:IPR010650"
FT                   /db_xref="InterPro:IPR013153"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B5E9Y9"
FT                   /protein_id="ACH37287.1"
FT                   /translation="MPDLQTVIKQLSRTIVEHKNAAHMSFEEFMQLATEQPERVMRNIF
FT                   QLFHDMVKNYVSEGTDEYPEDPESINFVPYDTRKLFVENSDRPFFADRLFANRFINHVA
FT                   AMKSGARQNKIYIFEGPPGSGKSTFLNNILMKFEEYASTEQGTCHEVVWHLDRRVLGSF
FT                   KEHQVSAFVEKLSHLLDEYELESHEHIDTRALLRGGDVVEVPCPSHDSPLLMIDKAQRR
FT                   AFFDDLFQNDSFKWKLFTEKEYDWVFRDSPCTICTSIFQALSARLEDPADIFSMIKVRP
FT                   YRFNRRLGEGITVFNPGDKSMKQNILTNDMLQRKIDLLLGDSNEVKYIFSNFAKTNNGI
FT                   YALMDVKSHNAERLLELHNIISEGIHKVEDIEENVRSLFIALMNPEDERSIEGVQSFSD
FT                   RIEFINIPYVMDLNTEVEIYRNIFGKHIDGSFLPRVLHNFARVIISTRMNVKSDALLEW
FT                   IGDPEKYRFYCDENLQILKMEIYTGHIPDWLTEEDRKRLNAKRRKKIIAESEHEGDHGF
FT                   SGRESIKIFSDFYAAYARKDKMITMSHLSTFFTRWHKELKESIPDGFMESLVHNYDYVV
FT                   LQEVKEALYYYNESQIERDILHYMFAVNFEPGAVEVCRFTGEKLEITEDFLAGIERRLI
FT                   GPKAEDEARLAFRQETQREYTGRTLTQEIMVEGKPAQDTTLFQSLHDRYVFNLKEKVLE
FT                   PFLENANFRRAIKDFDTEAFKTYDKRIRDDVTFLINNLSSEKFKYTKQFAKEICVYVID
FT                   NDLARKFHV"
FT   misc_feature    305308..305338
FT                   /note="heptanucleotide repeats; Gbem_R7012"
FT   misc_feature    complement(305471..305501)
FT                   /note="heptanucleotide repeats; Gbem_R7013"
FT   gene            complement(305505..306686)
FT                   /gene="mcp40H-10"
FT                   /locus_tag="Gbem_0257"
FT   CDS_pept        complement(305505..306686)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mcp40H-10"
FT                   /locus_tag="Gbem_0257"
FT                   /product="methyl-accepting chemotaxis sensory transducer,
FT                   class 40H"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37288"
FT                   /db_xref="GOA:B5E9Z0"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="UniProtKB/TrEMBL:B5E9Z0"
FT                   /protein_id="ACH37288.1"
FT                   /translation="MNRIWNYYLDLTIKFRLGLLCVCYSLCLVASVIASQADSPLIKYG
FT                   SVTLFIVAGGLFGWVNIWSIRNPLARAVCYLETMGHGDLSEQIVVNRHNEISQMLHAVK
FT                   KLQESMRGMLAGIKQTADHLTLASSELSATSQQMAQGTEHASRQSNSVSSAVVEMAGVS
FT                   NDIALSCQQMADRAGSTSSATTRGEETITRMTSVMEEIERMVIGTVDAVKALGTNSDKI
FT                   GDIVVAIEDIADQTNLLALNAAIEAARAGEQGRGFAVVADEVRRLAERTTASTHEVQSI
FT                   IRSLQGNVKNVVGLMERSAGSVRSGTEDVQHSSRAIGTIKEQITPLLEYVSQVAIAAEE
FT                   QSATTSNITDSMREIIGVVEEAASGAQNSARAAAELAASARSLQEMVNRFKTV"
FT   gene            306964..307785
FT                   /locus_tag="Gbem_0258"
FT   CDS_pept        306964..307785
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0258"
FT                   /product="iron-sulfur cluster-binding oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37289"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="UniProtKB/TrEMBL:B5E9Z1"
FT                   /protein_id="ACH37289.1"
FT                   /translation="MDEIISAEIRRFVQEESGNRFGESGERYFDDPLVGFAAADDPLFL
FT                   KYKEVIGEFHLTPEELAETAEGGCWHPRTVICWVLPITEATRASNRPETMYPSRAWAQT
FT                   RHHGETFNTSLRRHLVRFLVERGHRALAPQLHPGWREYGETPVGIASSWSERHAAYAAG
FT                   FGTFSLNDALITERGIAHRLGTVITDLALTPSPRPYLHHKINCLWHRNGTCGACIGRCP
FT                   VGALSKEGHDKRICRDHVYGTIPAKVAEQYQVASTGCGLCQTRVPCEGKIP"
FT   misc_feature    complement(308076..308128)
FT                   /note="conserved palindrome; Gbem_R1008"
FT   gene            complement(308151..309047)
FT                   /gene="sucD-1"
FT                   /locus_tag="Gbem_0259"
FT   CDS_pept        complement(308151..309047)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sucD-1"
FT                   /locus_tag="Gbem_0259"
FT                   /product="succinyl-CoA synthetase, alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37290"
FT                   /db_xref="GOA:B5E9Z2"
FT                   /db_xref="InterPro:IPR003781"
FT                   /db_xref="InterPro:IPR005810"
FT                   /db_xref="InterPro:IPR005811"
FT                   /db_xref="InterPro:IPR016102"
FT                   /db_xref="InterPro:IPR017440"
FT                   /db_xref="InterPro:IPR033847"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B5E9Z2"
FT                   /protein_id="ACH37290.1"
FT                   /translation="MSILINKSSRIVVQGITGRSGLFHTQQCREYGSNVVAGVTPGKGG
FT                   IHIEGIPVFNTVAEAVKYTSANVSMIFVPPPGAADAILEAAAAGLELAVCITEGIPVRD
FT                   MVPVKAVLQQSKLRLVGPNCPGVITPGECKIGIMPGHIHKPGKIGVVSRSGTLTYEAVK
FT                   QLTDMGLGQSTCVGIGGDPIIGMNFVDVLKMFNEDPGTEGVFMIGEIGGAAEEEAAVWI
FT                   QTHMKKPVAAFIAGVTAPPGKRMGHAGAIITGGKGKAADKIRTLTECGVTVATSPTKMG
FT                   EAMQTAMGSKGNGKKQK"
FT   gene            complement(309159..310319)
FT                   /gene="sucC-1"
FT                   /locus_tag="Gbem_0260"
FT   CDS_pept        complement(309159..310319)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sucC-1"
FT                   /locus_tag="Gbem_0260"
FT                   /product="succinyl-CoA synthetase, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37291"
FT                   /db_xref="GOA:B5E9Z3"
FT                   /db_xref="InterPro:IPR005809"
FT                   /db_xref="InterPro:IPR005811"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013650"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016102"
FT                   /db_xref="InterPro:IPR017866"
FT                   /db_xref="UniProtKB/TrEMBL:B5E9Z3"
FT                   /protein_id="ACH37291.1"
FT                   /translation="MNIHEYQAKEILSTFGIPVPRGRVALTADQVERAAKEMGGRCVVK
FT                   AQIYAGGRGKAGGVKLVHHPEQAQDLAKELFGKTLVTPQTGPEGLKVRRILVEEAVDIA
FT                   REFYLSITLDRGTSRYILIASAEGGMEIEEVATRSPEKIHTLTIDPFTGLRSFQARHIA
FT                   LQLGLSGSVCEDCVSLILNLYRVCLEKDCALVEINPLVVTRAGWLMAMDAKITFDDNAI
FT                   FRHREYPDMMDYSQLDPLEINAGKYDLAYIKLTGTIGCLVNGAGLAMATLDVLKEFGGE
FT                   PANFLDVGGGATREKVAEAFKIILQDSDVKGIFVNIFGGIMRCDVIAHGIIEAASEVNC
FT                   TLPIVVRMDGSQVEEGKRLLTESGLNVQCGDNLGDAAARIVKMLAG"
FT   misc_feature    complement(310679..310711)
FT                   /note="conserved palindrome; Gbem_R1102"
FT   gene            complement(310735..311055)
FT                   /locus_tag="Gbem_0261"
FT   CDS_pept        complement(310735..311055)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0261"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37292"
FT                   /db_xref="UniProtKB/TrEMBL:B5E9Z4"
FT                   /protein_id="ACH37292.1"
FT                   /translation="MTKILPIAILLLTAGAAQAEELVCQGNIVSTQGEGIVARKHRFEV
FT                   SGIAGADIGAVLEQCRKIALERQVRAARKNPGGSFRRISEVELECTRGPEKTKVRRNIQ
FT                   TE"
FT   gene            complement(311079..311537)
FT                   /locus_tag="Gbem_0262"
FT   CDS_pept        complement(311079..311537)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0262"
FT                   /product="protein of unknown function, DUF4124-containing"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37293"
FT                   /db_xref="InterPro:IPR025392"
FT                   /db_xref="UniProtKB/TrEMBL:B5E9Z5"
FT                   /protein_id="ACH37293.1"
FT                   /translation="MKTLVMLLAFALTASAAAAEMYTWKDSKGTTFYTNSLHEIPARYL
FT                   KRARVLDVATGKKGGPALASPGTPTAPTAPGGAASSPPQAPQLVQSAQVPQPQPIAPAA
FT                   APIAAPAPAAAVAPVPAAPSRSVSAERQQRSAGGDQRALRRHRRTLEE"
FT   gene            311747..312289
FT                   /gene="selR"
FT                   /locus_tag="Gbem_0263"
FT   CDS_pept        311747..312289
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="selR"
FT                   /locus_tag="Gbem_0263"
FT                   /product="peptide methionine sulfoxide reductase,
FT                   (R)-isomer-specific"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37294"
FT                   /db_xref="GOA:B5E9Z6"
FT                   /db_xref="InterPro:IPR002579"
FT                   /db_xref="InterPro:IPR011057"
FT                   /db_xref="InterPro:IPR028427"
FT                   /db_xref="UniProtKB/TrEMBL:B5E9Z6"
FT                   /protein_id="ACH37294.1"
FT                   /translation="MRKATFFAGLLTVLVASVLVVLESGKDSAIVNAASRIKVFSAEKG
FT                   TYVMSDEIVKSKDEWKKILTPEQYHVLREKGTERAFSGKYATSHEHGIYRCAGCGLDLF
FT                   RSEDKFESGTGWPSFTAPIAKENVKTEVDRSLFSTRTEILCRRCGGHLGHVFNDGPKPT
FT                   GLRYCMNSAALQFVATK"
FT   gene            312382..313017
FT                   /gene="msrA"
FT                   /locus_tag="Gbem_0264"
FT   CDS_pept        312382..313017
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msrA"
FT                   /locus_tag="Gbem_0264"
FT                   /product="peptide methionine sulfoxide reductase,
FT                   (S)-isomer-specific"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37295"
FT                   /db_xref="GOA:B5E9Z7"
FT                   /db_xref="InterPro:IPR002569"
FT                   /db_xref="InterPro:IPR036509"
FT                   /db_xref="UniProtKB/TrEMBL:B5E9Z7"
FT                   /protein_id="ACH37295.1"
FT                   /translation="MKRIRFAILTLTALFCAAGPTLAASATAPGGKGTQSAGHLEKATF
FT                   AGGCFWCMEHPFDELPGVVSVTSGYTGGHKINPTYEEVSSGTTGHAESIQVVYDPAKIG
FT                   YDKLLDVFWHNIDPLAKDRQFCDSGEQYRSAIFYHNEEQQRLALQSKKALESSKRFKEP
FT                   IATQIVAAGVFYPAEEYHQHYYKKNPIRYFYYRSSCGRDRRLKELWGR"
FT   gene            313029..314765
FT                   /locus_tag="Gbem_0265"
FT   CDS_pept        313029..314765
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0265"
FT                   /product="DNA polymerase IV (family X) domain and PHP
FT                   phosphoesterase domain protein PRK08609"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37296"
FT                   /db_xref="GOA:B5E9Z8"
FT                   /db_xref="InterPro:IPR002008"
FT                   /db_xref="InterPro:IPR002054"
FT                   /db_xref="InterPro:IPR003141"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR004013"
FT                   /db_xref="InterPro:IPR010996"
FT                   /db_xref="InterPro:IPR016195"
FT                   /db_xref="InterPro:IPR022311"
FT                   /db_xref="InterPro:IPR027421"
FT                   /db_xref="InterPro:IPR029398"
FT                   /db_xref="InterPro:IPR037160"
FT                   /db_xref="UniProtKB/TrEMBL:B5E9Z8"
FT                   /protein_id="ACH37296.1"
FT                   /translation="MKNREIARIFAEIADILEIKEGNVFKIRAYRRAALNLDGFSRDLA
FT                   QLSHKELLEIPGVGADLAGRIEEYLQTGTMAAYEELKQEVPAGVFALLAIPDLGPKTAK
FT                   AIYDALQIASIEELEKAALEHKLIGIKGIKQKTEENILKGIAAVKRGRERQPLGRMLPA
FT                   AQDLVEALKERAPVERIEVAGSIRRRRDSIKDIDIVATSPDPAAVMAAFVDLPQVHDVI
FT                   MRGPTRASVTIREGVQVDLRVVDPASYGAALAYLTGSQAHNVRLREMAQKRGLKINEYG
FT                   IFREEDNQRLGGVDEEDVYRLLDLAFVPPVLREDRGEIEAALLGKLPQLVTQADIRGDL
FT                   HVHSRWSDGAHGIAELVEAARERGLSYIAVTDHSQGLGVARGLTVERLREQAAEIKELN
FT                   RELKGFRVLHGTEMDILGDGALDFPDEVLKGLDIVVASIHSGFNNSKEVMTSRIVAAMR
FT                   NPYISIIGHPTGRILGEREGYQIDMDEVLRVAKETGTALEINAYPMRLDLEDKHVRRAK
FT                   ELGIMIAVNTDTHAKLQFDFLPYGISVAQRGWLEPADVLNTLDPDQLLKKLREKRKRMA
FT                   RK"
FT   misc_feature    314791..314875
FT                   /note="conserved palindrome; Gbem_R2003"
FT   gene            314979..315443
FT                   /locus_tag="Gbem_0266"
FT   CDS_pept        314979..315443
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0266"
FT                   /product="EVE domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37297"
FT                   /db_xref="InterPro:IPR002740"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="UniProtKB/TrEMBL:B5E9Z9"
FT                   /protein_id="ACH37297.2"
FT                   /translation="MPNYWLFKSEPSSFSLEDLKHRPNATEHWDGVRNYQARNFLRDEV
FT                   QVGDQVLFYHSNIAEPAVVGIAEVVRAGYPDFTAFDPESNYFDPKSNPEKPAWFMVDVK
FT                   FVRELPRPVTLSELKTVPELSGMALLNRSRLSIQPVRKEEWDLILKLAAV"
FT   gene            315475..316536
FT                   /gene="corA-1"
FT                   /locus_tag="Gbem_0267"
FT   CDS_pept        315475..316536
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="corA-1"
FT                   /locus_tag="Gbem_0267"
FT                   /product="magnesium transport protein CorA"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37298"
FT                   /db_xref="GOA:B5EA00"
FT                   /db_xref="InterPro:IPR002523"
FT                   /db_xref="InterPro:IPR004488"
FT                   /db_xref="UniProtKB/TrEMBL:B5EA00"
FT                   /protein_id="ACH37298.1"
FT                   /translation="MSIRKRSKKAGLAPGTLIHMGRAKTGATRIDLVEYDESHLEARSV
FT                   ESIEQCLVKKPLPTVTWVNVDGLADLEVLRHFGSCYGIHPLVLEDILATDQRPKAADYG
FT                   EYLYVVLKMITLDGESGELKSEQVSLVLGQNYLVSFQEGLEGDVFEQVRSRLNNEKARL
FT                   RAMGPDFLLHALLDVIVDHYFLVLEEISDRIEDIEDELIDNPTTATVQAIYRLKRQLLF
FT                   LHKAFWPLREAVSSLQRRDSQLIRDTTVIYLRDLYDHTVQVLDTLETLREMLSGMLDIY
FT                   LSSVSNRLNEVMKVLTIIATIFMPLSFIVGLYGMNFKYMPELEWHYGYYMVLFLSALIG
FT                   GGMLVYFKKRRWI"
FT   gene            complement(316609..319251)
FT                   /gene="pepN"
FT                   /locus_tag="Gbem_0268"
FT   CDS_pept        complement(316609..319251)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pepN"
FT                   /locus_tag="Gbem_0268"
FT                   /product="aminopeptidase N"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37299"
FT                   /db_xref="GOA:B5EA01"
FT                   /db_xref="InterPro:IPR001930"
FT                   /db_xref="InterPro:IPR012779"
FT                   /db_xref="InterPro:IPR014782"
FT                   /db_xref="InterPro:IPR024601"
FT                   /db_xref="InterPro:IPR027268"
FT                   /db_xref="InterPro:IPR035414"
FT                   /db_xref="InterPro:IPR037144"
FT                   /db_xref="InterPro:IPR038438"
FT                   /db_xref="InterPro:IPR042097"
FT                   /db_xref="UniProtKB/TrEMBL:B5EA01"
FT                   /protein_id="ACH37299.1"
FT                   /translation="MHTCQHQTVYQKDYSAPDYLVETVELSFDLDPELTWVASRLKIRS
FT                   NYDRAQGLRPLVLDGEELTLVSLKLDGVELEPARYTAGDGALTVTDPPESFLLEVTTQI
FT                   SPKANSALSGLYASGPMLCTQCEAEGFRRITYFTDRPDVMAVYTVILKADKGSCPVLLA
FT                   NGNLVEKGDLPDGRHFATWHDPFKKPSYLFAVVAGDLVHISDRFTTMSGRQVNLEIYVE
FT                   EKNQGKCDHALRSLIEAMRWDEEQFGREYDLDTYMVVAVDDFNMGAMENKGLNVFNSRY
FT                   VLASPETATDDDYQAIEEVIGHEYFHNWTGNRITCRDWFQLSLKEGLTIFRDQEFSADM
FT                   QSRPVKRIADVRLLRSSQFPEDASPLAHPVRPDSYVEINNFYSMTVYHKGGEVIRMLQT
FT                   LLGREAFRAGMDLYFERHDGQAVRVDEFVQAMADAGKRDLSQFMRWYNQSGTPVLTVSD
FT                   DFDQASGVYTLTVTQSCPPTPGQAEKEPFHIPLSIGLLNRQGRELPLQLEGEKSQGAIT
FT                   RVLELRQETQSFRFTGIASKPVPSLLRNFSAPVKLVYPYSQDDLTLLMTSDSDPFVRWE
FT                   AGQVQAVQVIMGLVREIQAGGTPTVPEAFIGSFGTLLTDQRQDRAFLAEALTLPAEGYL
FT                   AEQMKVIDPAAIHEARELVRATVGERLRAQLVGARAACAPKSPYHPDDGLAGCRRLKNL
FT                   CLSYLMAPGSREAIGMAMEQFKNADNMTDSLGALATLAGCDCPEREEALEAFYRKWRDD
FT                   RGVIDKWFSLQATSRLPQTLDRVLELLDHPDFDIRNPNRVRSLVGAFSQANQVRFHDAE
FT                   GRGYRFLGDQILRLNGINPQIAARMLTPFSRWRRFDAGRQELMKKELERILAEPGLARD
FT                   VYELAAKSL"
FT   gene            319465..320448
FT                   /gene="cbcZ"
FT                   /locus_tag="Gbem_0269"
FT   CDS_pept        319465..320448
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cbcZ"
FT                   /locus_tag="Gbem_0269"
FT                   /product="cytochrome c, 1 heme-binding site, with
FT                   cytochrome b5-like heme/steroid-binding domain, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37300"
FT                   /db_xref="GOA:B5EA02"
FT                   /db_xref="InterPro:IPR001199"
FT                   /db_xref="InterPro:IPR008457"
FT                   /db_xref="InterPro:IPR032694"
FT                   /db_xref="InterPro:IPR036400"
FT                   /db_xref="UniProtKB/TrEMBL:B5EA02"
FT                   /protein_id="ACH37300.2"
FT                   /translation="MSGDKAISCRMKIVLALLLLALFSWPCHATEQYAAQTGKSCSACH
FT                   LDPAGGGELTAEGKAFSASKASPGKAPGVSAPAKAPNVSAPAQASGITAAAKVFRFVIG
FT                   YIHMLTAILWFGTILYVHLVLKPAYAAGGLPRGEVRVGVLSMAVMGITGIVLTYFRVTS
FT                   WDMLLHTRFGVLLMIKIGLYLVMVCTAAYVVLFIGPKLKAKRREPATLPQGGDLTIDEL
FT                   ASCDGKEGRPAWFAYQGKLYDATASRLWKQGVHMGRHNAGEDLTEALKLAPHGSEKVAI
FT                   MPAVGALVAQTDRKAPLHERVFFFMAYMNLSIVFLVVLILALWRWA"
FT   gene            320485..321711
FT                   /locus_tag="Gbem_0270"
FT   CDS_pept        320485..321711
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0270"
FT                   /product="diguanylate cyclase"
FT                   /note="domains: GGDEF"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37301"
FT                   /db_xref="GOA:B5EA03"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:B5EA03"
FT                   /protein_id="ACH37301.1"
FT                   /translation="MKQLRIFPKSSSIRNPDSLLRLFVIIALVSTFVITIAAGLVFVEV
FT                   LQRHVIRNAEEDAIKVSSALLATDRARLTARQADGSVKVAVASADLPEMDRHFRKFLSP
FT                   FDIVKIKIYSADSTIVYSTEASLIGKVDNHNSRLDHALEGLFDSKLERKEEVKDLASEM
FT                   KFNVDVVETYIPIWDNGQVIGSFEVYIDVTEYRHDTANTASLALGALAGILVVVFGISY
FT                   FLVRKGTREIKEIQEVLKKQTMTDALTGTFNKGQIELLACKEFARCVRRNEKGLGDADL
FT                   GFIMIDIDRFKEVNDNYGHLAGDVLLQQFAARIARSLRNYDSIGRFGGEEFLVMLPGSD
FT                   LEQTRAVAQKIWSLLREEPYLVDGREIDLTASLGAAAVKEGDADLLHVLKRADQRLYAA
FT                   KSAGRDRVV"
FT   misc_feature    321771..321819
FT                   /note="conserved nucleotide sequence; Gbem_R2102"
FT   gene            322023..323303
FT                   /locus_tag="Gbem_0271"
FT   CDS_pept        322023..323303
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0271"
FT                   /product="nitrite/sulfite reductase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37302"
FT                   /db_xref="GOA:B5EA04"
FT                   /db_xref="InterPro:IPR005117"
FT                   /db_xref="InterPro:IPR006067"
FT                   /db_xref="InterPro:IPR036136"
FT                   /db_xref="UniProtKB/TrEMBL:B5EA04"
FT                   /protein_id="ACH37302.1"
FT                   /translation="MTVEKNLRLEGIYPQRQKEFYMQRVKLPAGIISAEQALKVAQLAE
FT                   RFAKGLVHLTTRGSIELHWLTEGDLEFVAGQLAMVGLYNRGACGGAVRGVVCGSLAAAG
FT                   APALEALVRRIHRHFTGNARFEKLPKKFKVGVEADVSSGRHLIQDLGLVPAASGEPSRF
FT                   DVWAAGGLGREPIPGFLLARDVAEDALIPLIERVARVYQANTPAGKRLKHLIREIGQDE
FT                   FRLRVLGDAEEISSAPTLTGSLVPVPADTSGRLEAHVFAGELSCQGLVALAEITREYCG
FT                   GILMITGDQNVKMHLSEGGEREKAVAALAAAGFAGESAREKVIFRVCPGTHECVMGLSA
FT                   TREVAAAVVEQMGEEALGLTWAISGCPNCCAQPQLAQAGIVSSRLVTDPAGRASRFDLY
FT                   RPGAGPFAEPVQQGLTLPQLLAEVKKI"
FT   misc_feature    complement(323309..323335)
FT                   /note="hexanucleotide repeats; Gbem_R6003"
FT   misc_feature    complement(323366..323392)
FT                   /note="hexanucleotide repeats; Gbem_R6004"
FT   gene            complement(323423..326764)
FT                   /locus_tag="Gbem_0272"
FT   CDS_pept        complement(323423..326764)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0272"
FT                   /product="sensor histidine kinase response regulator,
FT                   Cache_1, HAMP, PAS, PAS and sensory_box domain-containing"
FT                   /note="domains: Cache_1, HAMP, PAS, PAS, sensory_box,
FT                   HisKA, HATPase_c, REC"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37303"
FT                   /db_xref="GOA:B5EA05"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR033479"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B5EA05"
FT                   /protein_id="ACH37303.1"
FT                   /translation="MLVTSMKTKMTLAVFLLVGFLMSVTAVSSVLYYEQRFRRNISLQQ
FT                   STLLDSLAYQVDNRIFDFMSDLDQLAAGITPETLGSQKLAQQLLDAHKKQRAFFDNSLF
FT                   IFSNTGRLIAANPEGLNFIGKDFSFRDYFKQTMQTGKMSVSAPFVSIQKQSYPIIMFST
FT                   PVYDSKHRIIGILGGSIDLRRQRYLQSLAALKLGQKGFLSLYDSNRYVLMHPNPKRVLR
FT                   RDPPGSNDMVDRAIAGYEGTRESGTVAGLPVLRSVKRLKSTNWIMAVSYPLSEVYGPLY
FT                   TARNYFLAGSLAASLLSILIVWPFMGYLTRPLLSFTRHLEQLPSLKGSRRLAPVISDDE
FT                   IGQMARTFNKMLLEQERSRDFYLTLFENFPAMVWRAGTDGKCDYFNQTWLEFTGRPLEE
FT                   EQGDGWMQGVHPEELDFCCRTYLDAVENRRPFQMEYRLRHRSGSYRWITDMGRPFYGID
FT                   GEFVGYIGTCYDVTERQEAADKILKLSRVIEQSPNAVLIATLDGTIEYVNPMTVEATGY
FT                   EVAELVGSDMKRLLPHEAQLGFKLALRELVRRGKEWRGEIPARRKEGAIFWEQVTLSPI
FT                   KTMDGKATHLVCIKEDITQRRQFELSLKESEERYRLLFENNPHPMWAYDLKALSFLAVN
FT                   NAALRHYGYSMQEFLEMKLNDLSAHSSEGLELLPQGETSTAGAPLKRHVKKDGSVILVE
FT                   TISQVMKFAGVDAEIVMVHDVTEKLRAEQEKLALEHQLTQSQKMEAIGTLTGGIAHDFN
FT                   NILTAIIGYTTMMQLELDEEHPLQRKVGEILRASERAASLTRSLLAYSRRQAGNPAPTG
FT                   LNAIINNVDILLQRLIPENIELRSQLAPEELSIMADSGQIEQVIMNLVVNARDAMPEGG
FT                   VLSLSTESMALDREFVAKHGYGRPGSYALLAVADSGVGMDEKTRDRIFEPFFTTKAPGK
FT                   GTGLGLAMVYGIVKQHAGFINCYSEPGHGTVFRIYLPLIDAPAEMEAAQADQELRGGDE
FT                   TILLVEDDAVIREMVGELLEEFGYRVIKAVDGEDAVQTFRGAAAEVQLVILDVIMPKRN
FT                   GKEAYDEISRIRPGVKALFMSGYTADIITDSLIKGDPRHFVSKPISISELLGKVRDLLD
FT                   EQLNCR"
FT   gene            complement(327415..330861)
FT                   /gene="pyc"
FT                   /locus_tag="Gbem_0273"
FT   CDS_pept        complement(327415..330861)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyc"
FT                   /locus_tag="Gbem_0273"
FT                   /product="pyruvate carboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37304"
FT                   /db_xref="GOA:B5EA06"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR003379"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005481"
FT                   /db_xref="InterPro:IPR005482"
FT                   /db_xref="InterPro:IPR005930"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR011764"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:B5EA06"
FT                   /protein_id="ACH37304.1"
FT                   /translation="MEARKFRKVMAANRGEIAIRIFRACTELGISTVAIYSEEDKLSLH
FT                   RYKADEAYLVGKGKAPIDAYLGIDEIIALAKKREVDAIHPGYGFLAENAEFAEKCEANG
FT                   IAFIGPTAEMQRALGDKVAARKVAKAAGVTTVPGTEEPITHEEDALIFAKNHGYPIIIK
FT                   AAAGGGGRGMRVATDKKELLEGLQSASSEAKAAFGDPSVFLERYLKNPKHIEVQVLGDA
FT                   YGNLVHFYERDCSIQRRHQKVVEFAPSLALPGATRLALCTDALKIANQVGYRNAGTVEF
FT                   LLDEDGKYYFIEMNPRIQVEHTVTEMITGRNLVQAQILIAEGKRLSDPEINIPNQGSIE
FT                   MRGYAIQCRITTEDPGNNFAPDFGTLSTYRSSAGCGVRLDAGNAFTGAQITPHYDSLLV
FT                   KVSAWGLTFAEAAHIMDRSLQEFRVRGVKTNIGFLENVITHPVFLAGGCNTSFIDQHPE
FT                   LLVIPEKKDRANKVLQFLGDVIVNGSPGVAKPLRSAELIEATVPQIAPFAQRPKGTRDI
FT                   LREKGAEGLSKWVMEQNHLLLTDTTMRDAHQSLLATRVRTHDLLKIAEPTSHLASDLFS
FT                   LELWGGATFDVTMRFLKEDPWQRLHALSEAIPNVLFQMLLRGSNAVGYTNYPDNVVQRF
FT                   VAQAAESGVDVFRVFDSLNWTRGMQVAMEAVQKSGKICEAAICYTGDISDPTRTKYPLS
FT                   YYVSMAKELEKMGAHILAIKDMAGLLKPYAGYQLVKALKEEIGIPVHLHTHDTSGNGGA
FT                   LLVMAAQAGVDIVDAALSSISGLTSQPNLNALVATLKGTELDPKVNEHGLQQLANYWET
FT                   VRDFYAPFESGLKSGTAEVYHHEIPGGQYSNYKPQVAGLGLLERWEECKEMYHKVNVLF
FT                   GDVVKVTPSSKVVGDMAMFLVKNNLEPADVFVPGADLAFPESVVGFFKGMIGQPYQGFP
FT                   EELQKIVLKGQEPITCRPGELLEPTDFEKERATAEAKAGHPVNDEELMSYIMYPSVYVE
FT                   YAKHRQEYSDVSVIPTPVFFYGLEPGQETSIELQPGKTLIVKLNAVGKTQPDGTKQIYF
FT                   ELNGNSRSVTVRDQSVQSDDCGHEKADKSNPKHVGVPMPGKVIKMNVKTGDSVKAGDIL
FT                   AVTEAMKMETNIKAKEDGTVFEVRCKEGGKVEKEELLIVMA"
FT   gene            331152..331838
FT                   /locus_tag="Gbem_0274"
FT   CDS_pept        331152..331838
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0274"
FT                   /product="protein of unknown function DUF554"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37305"
FT                   /db_xref="GOA:B5EA07"
FT                   /db_xref="InterPro:IPR007563"
FT                   /db_xref="UniProtKB/TrEMBL:B5EA07"
FT                   /protein_id="ACH37305.1"
FT                   /translation="MIMQGTAVNAVAIVIGSVVGLKAGHLIPTRVRGTVMAGVGLAVLL
FT                   IGCQLALKSREPMIIIGCLIGGGIIGELLRIEERLEKLGNWIGDRFQGSGQVAEGFVTA
FT                   SLLFCVGAMAIMGSLQDGLGSRPEILYAKAALDGITSVALASTLGVGVLFSSLAVFVYQ
FT                   GAITLSATLAQQLMTPAVVQEMNAVGGLLILAIGLDLLGMKRVPVGNLLPAVFLAPPLV
FT                   MLFASS"
FT   gene            332212..333048
FT                   /gene="murI"
FT                   /locus_tag="Gbem_0275"
FT   CDS_pept        332212..333048
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murI"
FT                   /locus_tag="Gbem_0275"
FT                   /product="glutamate racemase"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37306"
FT                   /db_xref="GOA:B5EA08"
FT                   /db_xref="InterPro:IPR001920"
FT                   /db_xref="InterPro:IPR004391"
FT                   /db_xref="InterPro:IPR015942"
FT                   /db_xref="InterPro:IPR018187"
FT                   /db_xref="InterPro:IPR033134"
FT                   /db_xref="UniProtKB/TrEMBL:B5EA08"
FT                   /protein_id="ACH37306.1"
FT                   /translation="MAWKAIGIFDSGVGGLTVLKEVVRALPQEDTIYLGDTARVPYGTK
FT                   SPETVVRYSRQITRYLLSRDIKVLVVACNTASAVALSALQQEFSIPIVGVIEPGARAAA
FT                   AVTKSGKVGVIGTTATVASSAYTKAIKRINPEIEVVSRACPLFVPLAEEGWVDNEVARL
FT                   TAGIYLEDLKKHGVDTLVLGCTHYPILRKVIAEVMGPEVTLVDAAEQTALTVAGILAEQ
FT                   GLLRPKGERGNHHYYVTDIPAGFIRIGNRFLGGDFGDVYQVNLEQEQQEEEVEETD"
FT   gene            333032..333595
FT                   /locus_tag="Gbem_0276"
FT   CDS_pept        333032..333595
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0276"
FT                   /product="germane superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37307"
FT                   /db_xref="GOA:B5EA09"
FT                   /db_xref="InterPro:IPR019606"
FT                   /db_xref="UniProtKB/TrEMBL:B5EA09"
FT                   /protein_id="ACH37307.1"
FT                   /translation="MKKRTNRAKGTLLIAFLVFAVVVGLLVFRKYETATRVKPPAPAER
FT                   APDIRLVALFFGAPDGSGLLREGREIAVEDTTDDMLASVVDELVVGPLGSLAPTLPHNA
FT                   RVLGAHLKGDLAEVNFSHELVEGLPEGSSAEMTAVYSVVDTVATNFPQVKGVRFLIDGQ
FT                   PAKELKGHLDLSAPISPDYTLEKK"
FT   misc_feature    complement(333601..333624)
FT                   /note="heptanucleotide repeats; Gbem_R7061"
FT   misc_feature    complement(333742..333796)
FT                   /note="conserved nucleotide sequence; Gbem_R5017"
FT   misc_feature    333798..333831
FT                   /note="conserved palindrome; Gbem_R1103"
FT   misc_feature    333972..334002
FT                   /note="heptanucleotide repeats; Gbem_R7062"
FT   gene            334026..336461
FT                   /gene="metH"
FT                   /locus_tag="Gbem_0277"
FT   CDS_pept        334026..336461
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metH"
FT                   /locus_tag="Gbem_0277"
FT                   /product="5-methyltetrahydrofolate--homocysteine
FT                   S-methyltransferase, cobalamin-dependent"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37308"
FT                   /db_xref="GOA:B5EA10"
FT                   /db_xref="InterPro:IPR000489"
FT                   /db_xref="InterPro:IPR003726"
FT                   /db_xref="InterPro:IPR003759"
FT                   /db_xref="InterPro:IPR006158"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="InterPro:IPR017215"
FT                   /db_xref="InterPro:IPR036589"
FT                   /db_xref="InterPro:IPR036594"
FT                   /db_xref="InterPro:IPR036724"
FT                   /db_xref="UniProtKB/TrEMBL:B5EA10"
FT                   /protein_id="ACH37308.1"
FT                   /translation="MPFMQAVKERVLVLDGAMGTMLQERGLKPGQSPEEMNLTAADVVA
FT                   GVHQAYLDAGADIIVTNTFGGTKAKLEHYGLGDQVARINAEAVRIAREVAGEKAYVAGS
FT                   IGPTGRFLEPVGDMSFDEAVSLFREQAQALVDAGCDLISFETFLDIKEIRAGVIAVREI
FT                   SKEIPVIAMLTFEEKGRSVLGTPPEAAAITLEAVGATIVGSNCGLGPEGIYQILSGMRE
FT                   VTALPLISQANAGLPILKDGVTIFPATPDEMTSYHDRLIELGVRIIGGCCGTTPAHIAA
FT                   IKKALAAKQTPFVPKKEDGTTWLSSRGSFAAVGSAHPVALIGERINPTGKKLYSQELRE
FT                   GKVSYIRREALEQTGLGATLLDVNVGTPGIDEPAAMERAVFCITGAVQTPLVLDSSSPA
FT                   ALEAGLKAADGKVLINSVNGEEKSLAAVLPLAKKYGAALVCLTLDEAGIPAEAAGRVAV
FT                   AEKIAAAAKAAGVKRSDLVVDCLTLTVSAEPKGALVALEAVRQVSALGLNTTLGVSNIS
FT                   FGLPCRPLISSTFFSLAMAAGLTSAIVNVKEAPMMAAWRSSMVLLEKDVNAACYIEAYK
FT                   GQAVGATVEPAAAAGATGTRVAAVEPEGVRGRLAKAVINGEADNVVALVEEALAEGLTP
FT                   MQISSEALLVGLDEVGKRFGSGEFFLPQVMVSADTMKTAFARLKMELSTGGLQSIGKIL
FT                   MATVEGDIHDIGKNILVTLLENNGFEVIDLGKNVPADRILYEARAHQVDAVGLSALMTT
FT                   TMAQMDKVVKLLKAEGVKSFTMVGGAVVTQEYADEIGADLYAKDAMEAVARIKKLLAK"
FT   gene            336572..337024
FT                   /locus_tag="Gbem_0278"
FT   CDS_pept        336572..337024
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0278"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37309"
FT                   /db_xref="UniProtKB/TrEMBL:B5EA11"
FT                   /protein_id="ACH37309.1"
FT                   /translation="MVVGFNHNIRYKGELFHVQTEDSGIANPHIITLLYRGGTILASAK
FT                   TSYADIIKTEQLELVVESIMKEQHKEMMRRLKNGEFDARIFPDGAPACAEEPAAKEPPP
FT                   EKQSPPAEQAPKQQSAPAAKVIPPAQSANRSLDEVILDYLITGEDK"
FT   gene            337047..337871
FT                   /gene="tklA"
FT                   /locus_tag="Gbem_0279"
FT   CDS_pept        337047..337871
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tklA"
FT                   /locus_tag="Gbem_0279"
FT                   /product="transketolase, A protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37310"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:B5EA12"
FT                   /protein_id="ACH37310.1"
FT                   /translation="MKEKIADLEEKARRLRVAIVKTLHKSQSGHTGGSLSAIDMVCALY
FT                   FHKMRHNPQDPSWEGRDRFVLSKGHAAPALYVTLAECGYFPAEDLMMLRRLGSHLQGHP
FT                   DSKGTPGVDVCTGSLGQGLSMANGMALGFKLDGKDNRVYAVLGDGELQEGQIWEAAMAA
FT                   GHYKSDNLCALIDSNGLQIDGDVSKVMNVASIGDKFKAFGWNVIEIDGHDMGQIISALD
FT                   KAEAHKGAPTAIIAKTVKGKGVHLFENKASYHGVTPNDEELPEALRCLGCCD"
FT   gene            337978..338910
FT                   /gene="tklB"
FT                   /locus_tag="Gbem_0280"
FT   CDS_pept        337978..338910
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tklB"
FT                   /locus_tag="Gbem_0280"
FT                   /product="transketolase, B protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37311"
FT                   /db_xref="GOA:B5EA13"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/TrEMBL:B5EA13"
FT                   /protein_id="ACH37311.1"
FT                   /translation="MIATRDAYGEALAELGGENDKIVALDADLSGSTKTGVFAKKFPNR
FT                   FFNMGIAEANMVGTAAGLASVGKIPFLSTFAIFAAGRAWEQIRQSLAYPKANVKVVATH
FT                   GGVTVGEDGGSHQSVEDIAIMRAIPNMTVIVPADGEETKGAIRAAAAYKGPVYVRLGRN
FT                   KVANVFPAGHKFEIGKGNVVAEGKDLTFITTGLMTAQAVIAAEKLKEEGISARVLHLGT
FT                   IKPLDKELVLKAAQETGAIVTAEEHSVVGGLGGAVAEFLGEECPTLMKRVGIYDRFGLS
FT                   GKSDELLKYFGLNAETLIEQAREIVSRKK"
FT   gene            338907..339512
FT                   /gene="tklG"
FT                   /locus_tag="Gbem_0281"
FT   CDS_pept        338907..339512
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tklG"
FT                   /locus_tag="Gbem_0281"
FT                   /product="type II secretion system pseudopilin TklG"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37312"
FT                   /db_xref="GOA:B5EA14"
FT                   /db_xref="UniProtKB/TrEMBL:B5EA14"
FT                   /protein_id="ACH37312.1"
FT                   /translation="MMRRVLASSGGFTYMTVLVIVVVVGIAASRGAIVWKTAMQREKEI
FT                   ELLSRGTQIRDALRRWYKVKVVPGATEVTQIDPRVPEPPSPPELKALLKDPNLPGNVRY
FT                   LRPIALIDPMSEKPEKEWDVIRENGKIVGVKSSSEKEPLKQGNFPLDLHPADFEKKKKY
FT                   SEWEFRYKRVAPPPGTKTTAIPGATPAGQPALPGNAGR"
FT   gene            339633..341117
FT                   /locus_tag="Gbem_0282"
FT   CDS_pept        339633..341117
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0282"
FT                   /product="sensor histidine kinase, HAMP domain-containing,
FT                   putative heme-binding site"
FT                   /note="domains: HAMP, HisKA, HATPase_c"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37313"
FT                   /db_xref="GOA:B5EA15"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B5EA15"
FT                   /protein_id="ACH37313.1"
FT                   /translation="MLSICLLVFGIGTFAFLTLRREQMQLVNSARESSELLLNTIERSL
FT                   YNSMRIGNTEDVKVILEMVGQSENLVGVRIFHPHGVILKSSNPNEVGRVVDERDYKLFL
FT                   DNKREGVFNLDGHGEVLGMVKPIYNDRQCNLCHGSKSRIIGLLNVNYSLTETRNRIVEL
FT                   TKLFVMSTVAIIGFLSLAISLVMLKFVKKPLTQLAKNMARVEAGDLSVRMTPEGKDEIG
FT                   RLIVSFDSMVDRLDRAKKELENFHFQQMERADRLASVGEMAAGIAHEIKNPLTGIAAAI
FT                   TVLKDDFAPEDGRIQIIGEVLEQISRLDKTVNDLLFFGKPTVAEPTCTDINSALKKILV
FT                   FASQHRGGKNIEKRLELSENLPTVYVDPKQIQQVFLNLFLNAVQAMQAGGTLTVKSGLA
FT                   KVEGVDMVQVRVTDTGQGIPPQILEKIFTPFFTTKAQGTGLGLAISHRLIEQHGGRLSV
FT                   VSQDGMGTTFTVELPAYCPGQPGYSGPDAPPPTVCQ"
FT   gene            341194..342564
FT                   /locus_tag="Gbem_0283"
FT   CDS_pept        341194..342564
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0283"
FT                   /product="sigma-54-dependent transcriptional response
FT                   regulator"
FT                   /note="domains: REC, sigma54 interaction, HTH8"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37314"
FT                   /db_xref="GOA:B5EA16"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B5EA16"
FT                   /protein_id="ACH37314.1"
FT                   /translation="MRKIKIMVVDDEHLIRWSLEQNLKKQGYEVVTAGTGEDALRLARE
FT                   EQPDLVLLDYHLPGINGLEVLQRIKELDEDILVIMVTAQGGLETAVNTMRHGAYDYINK
FT                   PFNLDEMALVIRKALETSELRREVVQLRSEHKKQGPPTILGNSKHMKNVLEMMAKVAKS
FT                   DASTVLVQGESGTGKELVAKYIHYESARAEKPFVAINCAAVPATLLESELFGHEKGAFT
FT                   DAKNSKKGLFELADGGTVFLDEIGDMEIGMQAKLLRFLEDRTFRRIGGSKMIPVDVRIV
FT                   SATNKDLLKAIEDKSFRNDLYYRLQVIPIFLPSLRERKEDILVLANYFIEVFSKEFGKP
FT                   TKGISSMAEKLLVEYNWPGNIRELKNVIERAIILGNDENLLLENLPLEIVAKASQVTVP
FT                   LTTFKLPPEGIDIEEVERELIKQSLEMTDYNQSKAAKKLNLGIDAFRYRMKKFGFLK"
FT   gene            342849..344585
FT                   /locus_tag="Gbem_0284"
FT   CDS_pept        342849..344585
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0284"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37315"
FT                   /db_xref="UniProtKB/TrEMBL:B5EA17"
FT                   /protein_id="ACH37315.1"
FT                   /translation="MEVGGNSAHLPVRGRKEPLVRRMRMRELSNPESDRRSILRWGGLA
FT                   ASLALFLVALLAPARPASSSYLELPPIPAASAPQTAAPSPPAASASQAAASPAPADAVG
FT                   FQLAPAPRDAETARFRSQFRAEYPIEPWTALGDLTPSFVLQQGEYGGRGYAVLAEMGDI
FT                   RIKQTPNTLNEAAGRGGRFALLTGNSGNTAKLETFAASGQHGATHDDLLVGATGELSLM
FT                   GDSARFKTILLSGRRSLYSEGRWPSGAEKGDVLGLVAAVDPFGGRLAAEAEIDYSSYDG
FT                   DTTDETAATRDSARRLKVGGGWGASRYSALYERTGPRYRLLTGCGPERDTEGVSLGFGH
FT                   AFELHSFDVKLSRYNDNTEKNDLSPRLYRYEGLVDYHFKVFSKLQLSLQYKKRFVDSTK
FT                   EPLGYLPKEVEEDAVSGQLNYLTGRWDLGLRGGVSQRTDKLHRQRESSTESIGFLTKFS
FT                   AAGVTVLPDLSLKRVTDYSSSQRTDQYAVNLGLNGTLLEKRLDYEVKGGYKQERTGVPG
FT                   TGKQVVGAKVRAAYPLARLFKWFHPPSLGVKGEFKEINDRGADSRESDFSLLISLDGGN
FT                   FL"
FT   misc_feature    complement(344606..344620)
FT                   /note="hexanucleotide repeats; Gbem_R6005"
FT   misc_feature    344646..344672
FT                   /note="hexanucleotide repeats; Gbem_R6006"
FT   gene            complement(344690..345796)
FT                   /locus_tag="Gbem_0285"
FT   CDS_pept        complement(344690..345796)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0285"
FT                   /product="iron-sulfur cluster-binding oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37316"
FT                   /db_xref="InterPro:IPR007160"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="UniProtKB/TrEMBL:B5EA18"
FT                   /protein_id="ACH37316.1"
FT                   /translation="MSSKVFFADMRAGARENLFAKIGRLMKEAGVEDAVAPGDLVAVKV
FT                   HFGERGNHTFVRPIFVRRVVDEIKGCQGKPFLTDSSTLYPGERKEAVSALTCAIENGFA
FT                   YAVVGAPLIMLDGIKGHNAKDVQVDGEILKTVNIGAEILEADSLVAVSHFKCHELTGFG
FT                   GTLKNLGMGCSSRTGKMQQHSTVAPKVGERFCNGCEACLKSCAHAAIAIIEGKAQIDPA
FT                   ACVGCSRCITACQRKAINIQWNESASLVMRKMAEYAKGALHGKKGKTLFLNFITQVSPA
FT                   CDCYGHADAPIVNDIGICASADPVALDQACADLVNNARGNQDTALASGHEPGGDKFRGV
FT                   HPEIDWEVQLEHAEKIGMGSRKYELVKI"
FT   gene            346140..346877
FT                   /locus_tag="Gbem_0286"
FT   CDS_pept        346140..346877
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0286"
FT                   /product="response receiver"
FT                   /note="domains: REC"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37317"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:B5EA19"
FT                   /protein_id="ACH37317.2"
FT                   /translation="MIECDERELWILGLGDRVERGAVVCSYLAEGGHRARTAKVSELAN
FT                   CTPKAVLLDLSPWSDDGWGVLLALKENPETREIPILPMYLSEIGQVGAVFPVAGFFTLP
FT                   IDQKYLAKKLKQFGLTDESDDYDLQVMMVTRKGEEDVQHAITKLGFEVVNAYTGKEAVA
FT                   LGTIVHPYMIFCALMLPDQASFELLERFRLYPQTRNIPFFVLLKGAMKEGERMAMSRSI
FT                   EHLVRKSWLSRQEFLAYFKRGKE"
FT   gene            347111..348904
FT                   /locus_tag="Gbem_0287"
FT   CDS_pept        347111..348904
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0287"
FT                   /product="2-oxoacid decarboxylase/dehydrogenase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37318"
FT                   /db_xref="GOA:B5EA20"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:B5EA20"
FT                   /protein_id="ACH37318.1"
FT                   /translation="MATTTSDYLVQRLYDWGVRRVYGYPGDGINGVMAALRKQVERVEF
FT                   IQARHEEEAAFLACAHAKFTGEVGICIATSGPGAIHLLNGLYDAKLDHQPVVAIVGQQG
FT                   TTALGSDYQQEVDLISLFKDVAHHYVHMASDPSQIRHLIDRAIRIALAERTVTCVILPD
FT                   NVQEMEAVESPERKHGTTFTGLGFSRPDVTPARDDLARAAEVLNAGKKVAMLVGAGALG
FT                   ASDEVAIAADILGAGVAKALLGKAVVPDDLPFVTGSIGLLGTKPSWEMMMECDTLLMVG
FT                   SGFPYSEFLPKEGQARGVQIDISPRMLGLRYPMEVNLQGDSLLTLRALIPLLERKSDRG
FT                   WRQGIEKNVREWWEIMQARAMLSANPINPQRLFWELSSRLPDNCILTCDSGSAANWYAR
FT                   DVRIRSGMMASLSGGLATMCPGVPYATAAKINHPDRTVVAMVGDGAMQMLGINGLVTIS
FT                   KNWKSWSNPRLAILVLDNKDLNQVTWEQRVMSGDRKFSGSQDIPPFPYARYAEMLGLQG
FT                   IELDDPQLIGAAWDHALNADRPVVIDAHCDPDVPPLPPHITFEQAKGFMFSLAKGDPNL
FT                   GGIISQSVKQMMSTLLPRREE"
FT   gene            348921..349775
FT                   /locus_tag="Gbem_0288"
FT   CDS_pept        348921..349775
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0288"
FT                   /product="enolase superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37319"
FT                   /db_xref="GOA:B5EA21"
FT                   /db_xref="InterPro:IPR013341"
FT                   /db_xref="InterPro:IPR018110"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR029065"
FT                   /db_xref="InterPro:IPR034593"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="UniProtKB/TrEMBL:B5EA21"
FT                   /protein_id="ACH37319.1"
FT                   /translation="MAADAKIEQVEAQAYRIPTEDPESDGSYRWTSTTLVTVHIQGGGA
FT                   RGFGYSYADAAAATLITGKLAQIISGRNPVDIPCCWRLMLDGVRNLGEPGIAMLAISAV
FT                   DAALWDLKGKLLELSVVDLLGVAREAVTAAGVSWFEEPVVHHDLEGLRILRDRTPAGME
FT                   IAAGEYGFTLPYFRRMLQAGAVDVLQADATRCGITGFLQAATLCESHHLQLSAHCAPSL
FT                   HIHPCCAAPTLRHLEYFHDHARIESMLFDGFIQPVEGKLAPDRSRPGLGIELREGEASH
FT                   FRF"
FT   gene            349808..352738
FT                   /locus_tag="Gbem_0289"
FT   CDS_pept        349808..352738
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0289"
FT                   /product="FAD-dependent oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37320"
FT                   /db_xref="GOA:B5EA22"
FT                   /db_xref="InterPro:IPR004017"
FT                   /db_xref="InterPro:IPR004113"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:B5EA22"
FT                   /protein_id="ACH37320.1"
FT                   /translation="MPQPEENEIFVATQLNPGALEADLRYALDAEVRFDAGSRALYATD
FT                   ASNYRQIPIGVVLPRTTEAVIKTLEICHRHGAPVVSRGGGTGLCGQTCNVAVVIDHSKY
FT                   LNRILELDPEKGFAWVEPGVILDQLREQAENYHLTFGPDPATHTHNTLGGMIGNNSCGV
FT                   HSVMAGRTVDNILELDVITYDGVRITVGETTDLELEEIIAQGGRRGEIYAGLKSIRDRQ
FT                   AKRIRERYPKIPRRVSGYNLDELLPENGFNVAHALVGTEGTCVTILAAKVRLVHSPPAR
FT                   SILLLGYPDVYSAGDHVPEILKFEPVGLEGLDDLLVKFMQKKKLHPEDIELLPPGKGWL
FT                   LVEFGGETEEESDQKAKDAMEALKKLKDPPSMKLFIDEKEEKRIWEVRESGLGATANVP
FT                   GFPLSWPGWEDAAVAPDKIGGYLREFRKLLDRHGLNASLYGHFGDGCIHCRISFDLFSA
FT                   EGVANFTSFLDHASDLVVSYGGSFSAEHGDGQSKALYLRKMYGDELIEAFRQFKGLWDP
FT                   QWKMNPGKVVDPYHPDQNLRLGVTYDPWQPETRFRFPTDETSFARATLRCVGVGECRRT
FT                   HNAFMCPSFQATREEQHTTRGRAHLLFEMFRRDFIKDGWRSVEVRDALELCLSCKGCKG
FT                   ECPVNVDMAAYKAEFLHHHYHNRLRPRPAYSMGLFGIWGRLGAGMPRLANLVSHATLLS
FT                   GVVKWIGGIASQRSMPTFAPESFTSAYRRQEKQPEQKGKEVVLYPDIFNDCFYPEILHA
FT                   ACEVLERFGYQVIVPDQNPPAVRPPMDYGMLDYAMKRMEEVIDQLSPYVRRGIPVVILE
FT                   PSTAAVFRDELPELLPEHQDGKRLTAHTFLMSEFVLREGLTPPNLPGKVLLQAHCHEKS
FT                   VLSLHAKAAHELLAKMGLSVEEPEKGCCGMAGSFGFESGKYEVSMKIAEANLLPAVREA
FT                   GAETYIVADGFSCRTQIQQGAGKRALHTAELLHLAFTRTLLPPPAK"
FT   misc_feature    352750..352802
FT                   /note="conserved palindrome; Gbem_R1009"
FT   misc_feature    complement(352898..352950)
FT                   /note="conserved palindrome; Gbem_R1010"
FT   gene            complement(352950..355559)
FT                   /locus_tag="Gbem_0290"
FT   CDS_pept        complement(352950..355559)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0290"
FT                   /product="glycoside hydrolase, family 15,
FT                   DUF547-containing"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37321"
FT                   /db_xref="GOA:B5EA23"
FT                   /db_xref="InterPro:IPR006869"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR011613"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="UniProtKB/TrEMBL:B5EA23"
FT                   /protein_id="ACH37321.1"
FT                   /translation="MYKKISDYGIIGNMHSVALIGNDGAIDWLCLPHLDSPSVFAALLD
FT                   ADDGGSFSITPEGEWDSVLGYLEDSNILAGRFRTRSGSYTLTDFMQVPPPSDREPQPHE
FT                   FLLVRLLQVDRGRVRVKVSFDPRFDYGRGRPEFTILPGQCVLAASGSEQLRLCTSGKLT
FT                   LNNGHAEGTWELHEGERIALQLYYGRSEPDRFSELDAERVLVETLDFWRNWLYGSGTGF
FT                   FNDLGPHREQVIRSLLTLKLLTYQPRGTMAAAATTSLPETIGGVRNWDYRYSWVRDTSM
FT                   ALAALFEVGHVNETEQYLDWIEKVIVKNKQNELQVMYRMDGSSNLNEFELRHLEGFRGS
FT                   KPVRIGNGAATQKQFSIYGHVLMGADHLVSLDREVTEEMWHGLGLMCEFAKHHWREPDW
FT                   SIWEMRSDPRHYVHSKAMCGITLDRGVNIAARTGRQPGEDWERTRDEIRDDVMQHGWSA
FT                   QRQAFVLHYETDALDASSLLMSMNGFIPYEDPRMLATVEAIRLDLSYNGFIYRYHADDG
FT                   LPGREGTFLACTLWLITNLANQHELEEAELLLNKVEEVAGSLHLLAEEYDPIWQEQLGN
FT                   FPQAFSHEAYITAATMVTNVSGELRRNPKQQQYLLLQEEEKEVEAGFDPVLLAELVDEV
FT                   VREGGCHPGYGKDGSGDLAKRVGKMLAQLRWFDLARLQERQEKISFWCNLFNLLVLHGV
FT                   LSLRVKESVREVPRFYRRLGCRIGDELFTADIILHGILRGNRPSPGWLIPPLPAGDPRL
FT                   ANSIRLSDPRFLCAICTGTASSAPMTPLRPESLDADLNAAVRSFLEREAKVDAERKVLV
FT                   LSRIFKWYDDFGKSPHDVAVFVAGFLGESAGRPIREHPESYQLEYAGFDWRVPTGRT"
FT   gene            complement(355610..356614)
FT                   /locus_tag="Gbem_0291"
FT   CDS_pept        complement(355610..356614)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0291"
FT                   /product="oxidoreductase, short-chain
FT                   dehydrogenase/reductase family"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37322"
FT                   /db_xref="GOA:B5EA24"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B5EA24"
FT                   /protein_id="ACH37322.1"
FT                   /translation="MTDSKTRNVVITGASAGLGRAIAHAFASEDACIGLIARNRERLEA
FT                   ARAEVERLGGKGVVLVADVADPQQVEQAAAQMEQEFGPIDVWVNNAMTSVFSPFDQMTP
FT                   EEFRRVTEVTYLGAVHGTMSALKRMLPRDRGMVIQVGSALSERSIPLQSAYCGAKHGMR
FT                   GFTDSIRCELIHSKSRVHLTMVQLPAMNTPQFAWVKSRLPNKPQPVPPIFQPEVAADAI
FT                   LWASHHRRREIYVGMPTVKAMWGNKLVAGFADLYLGRTGYRSQQTGEPEDPNRPSNLWE
FT                   SVPGPFGAHGSFDDRAKGSSPQVWLVQNRWALCAIAAGLAAGAALGAKARRNR"
FT   gene            complement(356920..358287)
FT                   /locus_tag="Gbem_0292"
FT   CDS_pept        complement(356920..358287)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0292"
FT                   /product="voltage-gated chloride channel, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37323"
FT                   /db_xref="GOA:B5EA25"
FT                   /db_xref="InterPro:IPR001807"
FT                   /db_xref="InterPro:IPR014743"
FT                   /db_xref="UniProtKB/TrEMBL:B5EA25"
FT                   /protein_id="ACH37323.1"
FT                   /translation="MRKNLMVQLTLLASVLKWASYATAVGVLVGCGTAAFLRSLAWTSD
FT                   QYARFPDYYLLLPVTLVASTLLVRWLAPEATGHGTEKVIEAVHQRMGRIPLMVVPVKLA
FT                   ATVITLAGGGSAGKEGPCAQIGAGLASGFASLLRLNDVDRRKIVICGISAGFATVFGTP
FT                   IAGALFGVEVLVLGQVFYDVLFPSFVAGIVGFHVATLLGVTYPHLAVTIFPKVTGWNFA
FT                   EMLMLGIWCGLIALIFIEIMQWGHRLFARLSWHPVAKALFGGGLLVLVGRFVSLRYLGL
FT                   GVDSIEAGLNGAVLPMGSTFMKMLTTSITLACGGSGGVVTPIFFIGTAAGNLFAVLLHE
FT                   PLVATFSAIGMAALLAGAANTPIAASVMAMELFGAAIAPHAAIACMVSFLIVGYRSIYP
FT                   SQILGIEKSGSLKVETGKPMSQFDPEKLESAAVSLPGFILKGVKVIRRRSFEKKRK"
FT   gene            complement(358457..359071)
FT                   /locus_tag="Gbem_0293"
FT   CDS_pept        complement(358457..359071)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0293"
FT                   /product="peptidoglycan-binding outer membrane lipoprotein
FT                   Pal, OmpA family"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37324"
FT                   /db_xref="GOA:B5EA26"
FT                   /db_xref="InterPro:IPR006664"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR006690"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="InterPro:IPR039001"
FT                   /db_xref="UniProtKB/TrEMBL:B5EA26"
FT                   /protein_id="ACH37324.1"
FT                   /translation="MKTKTNMKLLVPVLCAGMFIYGGCAKQQTVKVDQPIAPSATTAAT
FT                   SATTQPAAKAAAVQPAAAPLPATKISSESIPPQSQQSVAGKAQAGASQADALETIYFDF
FT                   DSSLLSDTARATLAANLEKLKAKPGAALRIEGNTDERGSDDYNLALSERRAQSAKKYLQ
FT                   ALGFPASKLSVVGYGEEKPAVKGEGEEIWAKNRRDEFVIVR"
FT   gene            complement(359274..359603)
FT                   /locus_tag="Gbem_0294"
FT   CDS_pept        complement(359274..359603)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0294"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37325"
FT                   /db_xref="UniProtKB/TrEMBL:B5EA27"
FT                   /protein_id="ACH37325.1"
FT                   /translation="MIKNHLTQKSLLLLVACVTVISIAFTGMRVPDLSRPHRAKPTNRV
FT                   FIEKQFKNCQEEVKKSFDLLALPAKHSVPRPDVRYGAHFQAAFDCTGINPLFPNLSRAP
FT                   PTHCS"
FT   gene            complement(359695..361998)
FT                   /locus_tag="Gbem_0295"
FT   CDS_pept        complement(359695..361998)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0295"
FT                   /product="GAF sensor PilB/PulE/GspE family ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37326"
FT                   /db_xref="GOA:B5EA28"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR007831"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR037257"
FT                   /db_xref="InterPro:IPR042181"
FT                   /db_xref="UniProtKB/TrEMBL:B5EA28"
FT                   /protein_id="ACH37326.1"
FT                   /translation="MPGTDQLKEQLEHRKRFMEKINEIHSSGNLNTILIQLKDSIADLF
FT                   EAERLTIYVIDQKQKMLMSKVKSGEEIQQITLPIGNNSLAGFCALSGTLLNIRDAYDSH
FT                   ELKMISSGLSFDVTWDKKSGFRTKQVLCVPMKFNNQMIGVMQLINKKGGDTFDDTDLSY
FT                   ATELATSLSIAIHNIFRLAASAKLIRNKSRYNYLLDKNLLEEADIQKATAHPDVAAIGL
FT                   DHVLMRDYNIPREEMIKCLSLNFGTEFVSFDPDLPRLDDVLKKTKPDRLRKERWVPVKI
FT                   DHSVLQAAMEDPTDLAKQDLIKFVFQEYKRISFVGAFREDIGKFIDHYYHLAAESYEGP
FT                   TASISDLLSKLDNDEDPTIEQEVQKVSEQDSVIVQLVNKIICEAHEKNASDIHIEPAPG
FT                   REDVTVRLRVDGRCAVYQRIPYKYKHALTSRIKIMAGLDIAERRKPQDGKIDFKKFGPK
FT                   DIELRVATLPSAGQLEDVVLRVLASGEPIPFDNLGLTERNRQVFTDCIKKPYGLILVVG
FT                   PTGSGKTTTLHSAVSVINTPQTKIWTAEDPIEITQKGLRQVQVNAKIGFTFATALRAFL
FT                   RADPDVIMVGEMRDEETASIGVESSLTGHLVFSTLHTNSAPETVTRLLDMGLDPFSFSD
FT                   GLLCILAQRLARRLCSACKESYRPTEEELKEIITEYGEAEFGALGMDPSGITLSKAKGC
FT                   AKCNGSGYKGRLGLHEILDCGDQMKALIKTKAEVAELRKQAIADGMTTLKQDGILKCFQ
FT                   GLTDIHEVRRVCIK"
FT   gene            362205..364223
FT                   /locus_tag="Gbem_0296"
FT   CDS_pept        362205..364223
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0296"
FT                   /product="CHASE2 sensor adenylate/guanylate cyclase"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37327"
FT                   /db_xref="GOA:B5EA29"
FT                   /db_xref="InterPro:IPR001054"
FT                   /db_xref="InterPro:IPR007890"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:B5EA29"
FT                   /protein_id="ACH37327.1"
FT                   /translation="MQNPFNVRRSRFAAPSRRHLSSATIRFLIGCAVTALFCLLLVENP
FT                   LPLEITEAKLYDLRFHLRGPVKAPDQVVIAVIDEKSLARLGRWPWSREVMAGLVDKLAR
FT                   AEAAVIAFDVIFPESDEDDRILSRAIADAGNVVLPIVFDFETASKRRANPDLEPSALTA
FT                   ILEPELYRNFPPITSGGVPIMPVKPLRDSAMSLAHISMLPDYFDGTLRWEALVVAYDGL
FT                   LYPSLGLKSAAFFKGVSADKLQVHAASSIAVGNTVIPTDRWGRMPINYYGPGRTLRHIS
FT                   IADIVDGKVGAKELGNRIVFIGASAVGMLDLRVTPFTAVMPGVEKQATIAASILENRFL
FT                   VKATKGEDLLFLLLTGLAMALVLSRLRLLWGAVAVAAGGAAIAAAGVVLFSRFGVWVNL
FT                   ACPMGNVLCLFMSVTGWNYTVEERRARRIRAMFSSYVTTTIVNELIENPALARLGGEKR
FT                   EISILFSDVRGFTTFSEQHAPEEVVALLNEYLGEMTDVILKWGGTLDKFIGDAIMVFWN
FT                   APLPCADHAERAVRCALELQARLAELHGKWDREGKPKLSCGIGINTGEVIVGNIGAEGK
FT                   KMDYTVIGDEVNLASRVESLTRRFDAGILITEKTVEKLRGAIEAGTLSGIELSGISRVI
FT                   VKGKEQPVTLYTAVTNGTAPAVIIECEEMEPVRLTEK"
FT   gene            364389..365899
FT                   /locus_tag="Gbem_0298"
FT   CDS_pept        join(364389..364595,364595..365899)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0298"
FT                   /product="TPR domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37329"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR018759"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:B5EA31"
FT                   /protein_id="ACH37329.2"
FT                   /translation="MTKTSLAAAALIAAFTCAAPAQAANLDEGIIQYRVENFEEALALL
FT                   QKARAEEPKSSLAAFYLGMARKQGGDIPGAIKDLTDAATLKPPVLDSYLELADAWHVQG
FT                   DDEKALQWANRSENEGVNPARSAFLKGIILSGLGQREEAVASFEKAKLLDPSLTQSAQL
FT                   QIAMVMAGSRKLTRARDALRAVVAADPNSEIAGYAKEYEQSFTRILDSYQPLHLTLGLN
FT                   YLYDDNAISSPSNPGARAQIGNPTGQRDHAFMGNFRLDYTPLLENDYTFSAQYLVQSTK
FT                   YGDTNTDEENPSTVINSLTVNLGHAFGNSIFSAPISLSHVLLKEKAYQALVSVRPTWSW
FT                   QAAPQHILQAGASFTRRDMLQDPLVQDEDRDANIGGASAGYIFSYGELGGMAALRYDFS
FT                   YDDARGVNWKNRGHRYSVSGVIPLTVALKLNLSGEVSTQDYFKTNTVFDVQRDDTTWFG
FT                   TAGLSWNLNRNLALLAQYSHTKAESNIKVYDYSRNTFSTGIEFSF"
FT                   /artificial_location="low-quality sequence region"
FT   gene            365911..369915
FT                   /locus_tag="Gbem_0299"
FT   CDS_pept        365911..369915
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0299"
FT                   /product="FecR domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37330"
FT                   /db_xref="GOA:B5EA32"
FT                   /db_xref="InterPro:IPR006860"
FT                   /db_xref="UniProtKB/TrEMBL:B5EA32"
FT                   /protein_id="ACH37330.1"
FT                   /translation="MISARNNFSRPQAPASERNNDSTHPEIGAWERNNTFPCSQVPASE
FT                   HESNWKLRFPVQRRLVLISLLLPLLFLGVPGAALAEVVGKLTVVEGAVDIMPGGQLPAV
FT                   AAKVGGAVQKGDFVRTKSNARAELTFNDGSVVKIAQRSRIDVGEYSASNRKLALPRGKV
FT                   QATVVPAAAGGAVRTFEIRTPNAIAGVRGTSFYVYHQANVTGVAVLQGVVHTTSLSQPS
FT                   KGVTLVAGTATTVTKHNAPTPPRPVSDKEMNSHQSDVNPTGNKGGEPQGAAPAPAGNGG
FT                   AGTGSSSSQATSGSGGSTSLGSHASGPASTASGSPVGGDSPTPSTGGPGLSTPSFTDPS
FT                   PVLSAPPTQAPISQAPMTPTTSPTTVVIPVTTASTQARDQFTQAATSGSTISADGTGTT
FT                   GGTTGGTTGGTPPVFRGTLAGGLMSRLSVIDPASNLLTIVSDPSFAPVISGTTSLWATK
FT                   SASISLTGSYPTLPLQQPNHYWFGRFFSDSTTTQTTTDGGAFFGYFGGRSIDNAATGTT
FT                   IDTSLSGIYVDPTGKIGLMQGGAAGGTATGKVSGTGSLTLTEMTPTSTLVPTSFTADWW
FT                   NSKTGTTMVELTGPVLTGNMGGKNQAEGFLFDAALNYSGTIADRGDVLQIAHLAADPTF
FT                   GIWTRESFGSYAGSGSQLVLSSNGEWGTVDAAGIFNLENAVKVVSLGNWQQGALTGKAD
FT                   GVWGDLAAGSLRLLTGNLTGSVNSGANATTFGAVTTGVYIDVNRFLANPTLAAGLGFPT
FT                   LAGPDSFTLSGSNATGSVSFGTIKFYNRTASPISLWVAQNVSGSFGGSLQHQNFSLMDA
FT                   AAPSVSNVMGNLWVAGVSTAGNTWLGNVNAIGETGTSFRRGFDGIAVGTVSGTTFSGSA
FT                   AGIAHPVTFFNKIVGDLKRFSAGALTSYGTVNGVMGGMSLWGSTPLLTADFKGIGFLTP
FT                   SQALTNIDYIFTAPISSFDVPTGQALTADGGAYYGHMVGGVSTAGGSPGNPGIIGVASA
FT                   LYIDPSGRAGVLQGKFSGFLDPSSKIWQNEGDMFPVQLEAAPTVTAATLNSAGSIITAT
FT                   TNFGAGTSFVGNGVTLGGGSVDTFTRSFLANSPQWGIGQFGFYAPYSAGATGNTNWSID
FT                   FVLPDPNLTMVGTMGGQMWNPGAGQMAAGVRAAWYEMVNVSPTAIPMTGIFIGETVGTF
FT                   NPVTLQSMTSGIWLETSKYVSMAVAKDPDGILNKLKIPAVEVGKADFSGGNSEYSVALQ
FT                   NVRFFAPVATGRPQLFATDSISGSYVSVPTPGSAATLTQGVSTNASGFSPTFTVKQWDA
FT                   TNSKWSGSLQFNGNSGMVGTQPNVQFTGVAAGRSDAGTSTFTGTAAGVVK"
FT   gene            369942..371159
FT                   /locus_tag="Gbem_0300"
FT   CDS_pept        369942..371159
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0300"
FT                   /product="sensor protein, DUF3365 and HAMP
FT                   domain-containing, heme-binding"
FT                   /note="domains: DUF3365, HAMP"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37331"
FT                   /db_xref="GOA:B5EA33"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR021796"
FT                   /db_xref="UniProtKB/TrEMBL:B5EA33"
FT                   /protein_id="ACH37331.1"
FT                   /translation="MLRTTTRKMFLSLHVFLFLIVSAAIILTVNNQQRAQALVEAQEKA
FT                   RLILDRNLAIHSYFSNQLKPQIFHLTDKYRPEQYFDPVWMSSTYAVREIDLYNKAFSKS
FT                   DIYYKECAINARSPRNEADPVERAFLEEIRKDAGLSVKSFVRQIDGKPFFVVMRRGESM
FT                   EKSCLRCHSTPAAAPADMVARYGPERSFSRQDGELVSAISIRIPLQEAYANANKLSFEL
FT                   CLLLLAILGVSSAAQFLAMNRMLLNPLTDLRDRTDAILRDESKLGQDIPQLSRAEELKE
FT                   LTATFNDLSRHLRREKDGLVEQVQERTAELESANKALEEDVLVREQIQLELAAKVAQLE
FT                   QALAKVRTLEGILPICSYCKKIRTDEESWQQLEQYIIEHSDAHFSHGICPSCFKELKEG
FT                   FKKLER"
FT   misc_feature    complement(371260..371293)
FT                   /note="conserved palindrome; Gbem_R1104"
FT   gene            371430..372065
FT                   /locus_tag="Gbem_0301"
FT   CDS_pept        371430..372065
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0301"
FT                   /product="flavodoxin, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37332"
FT                   /db_xref="GOA:B5EA34"
FT                   /db_xref="InterPro:IPR005025"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:B5EA34"
FT                   /protein_id="ACH37332.1"
FT                   /translation="MKMVAFNGSPNREGNTYHAIKLVAAELEKEGIETEIVHVGNKTIR
FT                   GCIACMQCAKHQNEQCALKDDEVNEWVQKMKSADAIILGSPVHYAGIGGTLKSFLDRAF
FT                   FVGGVNGGLFRHKVAASVVAVRRSGGVTTTDQLNHFINYSEMLVATSNYWNVIHGRAPG
FT                   EVLQDGEGMQIMRVLGKNMAWMMKLVQHGKEAVPAPEKEDKVYTHFIR"
FT   misc_feature    372066..372117
FT                   /note="conserved palindrome; Gbem_R1011"
FT   gene            complement(372130..375504)
FT                   /locus_tag="Gbem_0302"
FT   CDS_pept        complement(372130..375504)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0302"
FT                   /product="[acyl-]glycerolphosphate acyltransferase and
FT                   acyl-(acyl carrier protein) ligase, major facilitator
FT                   superfamily domain-containing"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37333"
FT                   /db_xref="GOA:B5EAM4"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:B5EAM4"
FT                   /protein_id="ACH37333.1"
FT                   /translation="MTSNSRSNPLAWLNATQFLGALNDNILKLLIIFFLIGTHGAAEAG
FT                   AVTAGVGAAFVLPFLILSAPAGSLADKLAKSRLIFGVKLFEAAATLLAVIAFALRLEPL
FT                   LYLVVFLMGCHSALFAPAKYGIIPELVPKEGLSRANGLIESFTFLAIIVGTALASALTQ
FT                   AAGGRFWLAACACLAVALTGLGSARLMGNTVHCDASRPVALLPTRILKTVNEMRRDRHL
FT                   MLAVIGLAWFMFIGAFAQLNLIGYGMEELGLTEAQSGYLFLAAAFGIGIGSLLAAKLSG
FT                   RDVEFGIVPLGATGLTLAPVLLHAVPGNLAASLVIIVGFGVSAGVFSLPLQTFIQLRAD
FT                   DSNQGEVLAASSFINWVGILAASGLTWLFSGPLGMSAAQGFSLVGAMTLLLTALSFRAL
FT                   PDFLLRFIALVTMRIFYRIRIIGRENLPVEGPALLIPNHVTWADALLLTATNQRRIRFV
FT                   MERSIYNTPVLNALFRLMGVIPVSSTDGKREMLQFIKSARAALDEGYMVCIFAEGALTR
FT                   NGMLGEFRGGFERIVKDSGHPIVPVYIGGAWGSILSYAHGRLLSRLPALAPYPVTILFG
FT                   IPMPAKSRAIEVRQKVAELSCDYFESKKEQRRPLPEYFVRTARQQWNRNAIADSSGKNL
FT                   SYGRTLAGAVALAGKVERELGASVHVGILLPPSAGGALANLAVSLLGRIPVNLNYTATE
FT                   SSFRSAIEQCGISTVITSRVFLEKLPALPRLSGMIYLEDLAPAISGWDKLTAVLKARLF
FT                   PVRLICRSGAFHPDRTATVIFSSGSTGEPKGVMLSHHNIMSNIEALRMVFRVDLNDNVC
FT                   SALPFFHSLGFTGTLWFPLVSGFSAAYHPNPMEGEKIAAVAREHKSTLLLATPTFLLAY
FT                   LRRAKVEDFAALRLVITGAEKLKVKVADAFEEKFGVRPMEGYGATELSPVITLSLPDVE
FT                   IDGVRQHGSKEGSVGHPIPGVAIKVVDPESGAVLEPGAAGMILVKGPNVMSGYLGRADK
FT                   SAEVLRDGWYLTGDIGVMDEDGFIRITDRMSRFSKIGGEMVPHGAIEDELHTCLGQTGV
FT                   LAVTAVPDDKKGEKLVVVYARGATDAVTMQRHLAESALPNLWKPARDCYLEVESLPMLG
FT                   TGKLDLKGLKELALAGL"
FT   misc_feature    375574..375684
FT                   /note="conserved palindrome; Gbem_R2004"
FT   gene            complement(375669..376673)
FT                   /locus_tag="Gbem_0303"
FT   CDS_pept        complement(375669..376673)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0303"
FT                   /product="metal-dependent hydrolase superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37334"
FT                   /db_xref="GOA:B5EAM5"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR032465"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:B5EAM5"
FT                   /protein_id="ACH37334.1"
FT                   /translation="MPNDTRKNIIDIHCHTAGIGAGESGCFVSPALMGSWKYWVYLRAF
FT                   GVTEQELKREGDGLVMRRTSERLAQSERVASAVILAMDGVVDANGNLDRSRTEMFIPNE
FT                   FVAKETAKYPNLLFGASINPFRPDAIERLERAAESGAVLLKWLPAIQHIDPADERLIPF
FT                   YLKLKQLGLPLLTHTGKESSFTSAKEELGDPERLRLPLFLGVTVIAAHAASSGKSQGED
FT                   NHDRFLRLCREFPNLYADISALTQINRLGHLQRLLKQTELHGRLLYGTDMPLLRTPLVT
FT                   PFAYSHVLPLRRMVEIARIANVWDRDVALKEALGVPELVFNNVQWMKDTPPLP"
FT   misc_feature    complement(376690..376744)
FT                   /note="conserved nucleotide sequence; Gbem_R5018"
FT   gene            376999..378549
FT                   /locus_tag="Gbem_0304"
FT   CDS_pept        376999..378549
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0304"
FT                   /product="sigma-54-dependent transcriptional regulator"
FT                   /note="domains: sigma54 interaction"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37335"
FT                   /db_xref="GOA:B5EAM6"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B5EAM6"
FT                   /protein_id="ACH37335.2"
FT                   /translation="MKSSKATDKEWTFLETVARAAFANPFGETRDDLDIAISGAAPDSS
FT                   ADEILHAVVTRIEVKLQSLRDRGVADLRNLDGHRREVMRRVCLFHVFHRYVDHFDELIK
FT                   TQLKEGDKHCRVPFARHVLGELTAFGIGDQDAVRMFAVFYQLRRAFYFIKNGLVGTSPS
FT                   MKTLRRHLWDCVFTHDIRWFEAGLWDKMEEFSILLLGETGTGKGAAAAAIGRSGFIPFD
FT                   VARNAFTESFTRNFVSINLSQYSEGVLESELFGHKKGAFTGAVDNHEGLFSRCAPHGVI
FT                   FLDEIGDVSIPVQIKLLQVLQERIFFPVGSHEARRFSGRIVAATNRSLDEMLESGKFRD
FT                   DLYYRLCSDVITLPPLRVRLKEDPQELDNLLGVLLSRLAGEMPGREKHLVKRILKRDLG
FT                   RHYAWPGNVRELEQAIKRIILTGRYQGMKREEPKQDAAARLAQEIVEGAMNAEELLSAY
FT                   CSSLYASFGTYEEVARRTRLDRRTVKKYVEMGKVSPSLDGRGTLFGNCSIQTGRCLES"
FT   gene            378738..379247
FT                   /locus_tag="Gbem_0305"
FT   CDS_pept        378738..379247
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0305"
FT                   /product="peptidoglycan-binding protein, OmpA family"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37336"
FT                   /db_xref="GOA:B5EAM7"
FT                   /db_xref="InterPro:IPR006664"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR006690"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="UniProtKB/TrEMBL:B5EAM7"
FT                   /protein_id="ACH37336.1"
FT                   /translation="MFKKVAIAAVLSLMVSGVAYAGLDALKGLGKEAGKGVAASAKEGA
FT                   LSAVTNKLKKVQNEKGPIKFKTGKAEIDPSCDKTMTAIAAIMTDYPGFHVQVDGHTDNV
FT                   GKPEANQKLSQDRADAVVKYLVDKKAVDAKRLSAKGFGDSKPIADNKTKAGQAKNRRVD
FT                   FTVTKM"
FT   misc_feature    complement(379320..379363)
FT                   /note="conserved nucleotide sequence; Gbem_R4007"
FT   gene            379637..380434
FT                   /locus_tag="Gbem_0306"
FT   CDS_pept        379637..380434
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0306"
FT                   /product="arylamine N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37337"
FT                   /db_xref="GOA:B5EAM8"
FT                   /db_xref="InterPro:IPR001447"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:B5EAM8"
FT                   /protein_id="ACH37337.1"
FT                   /translation="MDIDLFLQRIGLQSLPDSPMKRLRALYAAMTKTVPFENVAVMEGK
FT                   SISLEPGDIFAKVVEQGRGGYCFELNGLLAHLLEQFGYRIERLIGRVWASGAPAPLLTH
FT                   MTLRVFVEDRPYLCDVGFGGGTLREPLPWVTGAVAIQGPDRFRLDATDNGETMLSRLVD
FT                   AEWKNMYSLLPCPVRSQDYIPANHYTSTHPNSHFTQGLVAALVTDSGRVTLRDRLFRTV
FT                   GAEGETERELTTFDEVVQVLGQEFGLRNLDLAALQSRLSYLFA"
FT   gene            380468..381349
FT                   /locus_tag="Gbem_0307"
FT   CDS_pept        380468..381349
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0307"
FT                   /product="helix-turn-helix transcriptional regulator, LysR
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37338"
FT                   /db_xref="GOA:B5EAM9"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B5EAM9"
FT                   /protein_id="ACH37338.1"
FT                   /translation="MSLRSLRILTAIAGKGTFAAAADQLGLTQSAISLQVKKLEDEFGV
FT                   QLFERTGRSPKLNMNGRYVVERASEILLIYDEMKARLSPLGGVQGLLTLGAVPTVITGS
FT                   LPPALGRLRTRYQDMQVKLVSGLSTELVRKVEEGDLDAALTTEPPYAVPPQYEWIPYDE
FT                   EPFFVVAPKEAGINDVALLFERFPFVRFDKMAWAGAMVDHELMLQGIRPREVMEFDSLE
FT                   MALALVEEGLGIAVVPLSKSRLEQVANHFTLTPFGTPQLSRRVGMYQKRQHPRQPLTRA
FT                   VLDELSQQVNLK"
FT   gene            381440..382357
FT                   /locus_tag="Gbem_0308"
FT   CDS_pept        381440..382357
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0308"
FT                   /product="membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37339"
FT                   /db_xref="GOA:B5EAN0"
FT                   /db_xref="InterPro:IPR004776"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:B5EAN0"
FT                   /protein_id="ACH37339.1"
FT                   /translation="MTVIINALTPVLALIVLGFLIRRTEFIPSTFWPAAEKLTYYLLMP
FT                   AMLIHSLAGKEIGSSPWLNILLTVGGAILASVLFVMLGWLPRRHMGGAAFTSLFQGGVR
FT                   FNTFVALALAENLFGKEGLFLASLGAGFMILIINVLCVSAFSVAVGHGVFDLKRLARDL
FT                   VRNPLIWGCTLGIGLNASGVILPAAMDGSLVLIGKAAFPVGLMAVGAAYQPGNIALHWQ
FT                   PLLTSCGIQFLCKPAIAWWLAAATGLSGVAAGVAVLLFSVPTAPSAYILSRQMGGDHDS
FT                   MAVIITVQTCLSFFTLPLTLWLLR"
FT   misc_binding    382536..382659
FT                   /bound_moiety="cyclic diguanylate"
FT                   /note="cyclic diguanylate-responsive riboswitch;
FT                   Gbem_R3001"
FT   gene            382719..383318
FT                   /locus_tag="Gbem_0309"
FT   CDS_pept        382719..383318
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0309"
FT                   /product="outer membrane protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37340"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="InterPro:IPR027385"
FT                   /db_xref="UniProtKB/TrEMBL:B5EAN1"
FT                   /protein_id="ACH37340.1"
FT                   /translation="MKKIIVLAVLLALVSLVPGAAMADSIKGRLGVTGKVGFIVPSDNE
FT                   AEFGFGTNHTDTGLVVGGGLLYGIDDHFAAELDVTNSSFDSEIGDFDVTDISFGGQYRF
FT                   TNMRDRRLVPYIGAGLDIISSDFDSDFGGRRHVDTTLGVHLSGGLDYFVEKHVALTAEA
FT                   KVVLAPDADITDDGFHSGSFDPTNFSTTFGVRFFFN"
FT   misc_feature    complement(383334..383359)
FT                   /note="conserved nucleotide sequence; Gbem_R2103"
FT   gene            383494..384210
FT                   /locus_tag="Gbem_0310"
FT   CDS_pept        383494..384210
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0310"
FT                   /product="rubredoxin and metal-dependent hydrolase domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37341"
FT                   /db_xref="GOA:B5EAN2"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:B5EAN2"
FT                   /protein_id="ACH37341.1"
FT                   /translation="MNREQHVCLVCGFNMIGFHPANCPFCGASAMHFITSEECSARFHV
FT                   SSTQVNEKVSRLNSQPALGIEHAAYRIETGNGACWIDCPSCFDSSLPKADSILFTHHHF
FT                   LGASNLYRDRFAAEVRIHQLDSTHDICRPFSFDTTFQENFVHKGIEAFHIGGHTPGFTC
FT                   YIFEDVFFICDYVFLDGDGVKYNPFGPADLTIAGGRVIEDVIRNRQLSTVCGYNYVIGY
FT                   DDWKRRFDAGPVFGGY"
FT   gene            384376..384657
FT                   /locus_tag="Gbem_0311"
FT   CDS_pept        384376..384657
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0311"
FT                   /product="antitoxin, XRE family"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37342"
FT                   /db_xref="GOA:B5EAN3"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR039554"
FT                   /db_xref="UniProtKB/TrEMBL:B5EAN3"
FT                   /protein_id="ACH37342.1"
FT                   /translation="MKDKHVGSNFDAFLVEEGLRADAEAAAIKRVIAYQIELEMKQANL
FT                   SKTAMAEKMHTSRTALDRLLDPTNVSVTLQTLERAALALGKNLKVELA"
FT   gene            complement(384678..386480)
FT                   /locus_tag="Gbem_0312"
FT   CDS_pept        complement(384678..386480)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0312"
FT                   /product="aldehyde:ferredoxin oxidoreductase,
FT                   tungsten-containing"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37343"
FT                   /db_xref="GOA:B5EAN4"
FT                   /db_xref="InterPro:IPR001203"
FT                   /db_xref="InterPro:IPR013983"
FT                   /db_xref="InterPro:IPR013984"
FT                   /db_xref="InterPro:IPR036021"
FT                   /db_xref="InterPro:IPR036503"
FT                   /db_xref="UniProtKB/TrEMBL:B5EAN4"
FT                   /protein_id="ACH37343.1"
FT                   /translation="MSGKPGYHGKILNIDLSTGKIETVPVPAEDFDKFVGGQGLGMKIL
FT                   WDRLKKPGVDPLSPDNLLMFMPGPFSGLPVPSSSRTCVVTKSPITSPLKSDYTHPSTVT
FT                   YSNMGGFFGPEVRFAGYDGIVITGKARVLSYVVIEDDKVEIREAAKFKGMRTDAFDRAF
FT                   LAELGDRRFKTVYIGPAGENLVPYSSILHTAGRAAGRGGTGCVMGSKNLKAIAVRGTGQ
FT                   PTVADHKAFLAALENARRALNGSAFAKSWAEQGTARAIVGNSNAGTEAVRNYREGTFTE
FT                   ADKIGGDAARRDVWVKDIACYCCPLACKKSGMTKGKHGGVVHDGPEYETGVMLGSNLMI
FT                   SDMPGLLKAITTIDDLGLDQISTGNVIGFLMEAYERGLINRSFLDGIDLKWGSVDATLA
FT                   MIEKIAAKEGVGALAAEGVRGLSWHIGKGSDKFAIQVKGLELAAHNIQANQPRGLSYVT
FT                   ASRGACHMSGDNIAMQNRRAMMDSTGMCFFPTFEPTLEEPMLALLSAITGRKFDKAEFE
FT                   KVGERIFTLEKLFNYREGFRREDDRLPDRFFEDAFTVGPKKGAVLDREKFESMLTQYYQ
FT                   DRGWDPETTEPGKKKLKELGLDTI"
FT   gene            complement(386477..387202)
FT                   /locus_tag="Gbem_0313"
FT   CDS_pept        complement(386477..387202)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0313"
FT                   /product="iron-sulfur cluster-binding oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37344"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR019546"
FT                   /db_xref="UniProtKB/TrEMBL:B5EAN5"
FT                   /protein_id="ACH37344.1"
FT                   /translation="MDKGKMESCGSYDRTTLTRREFIKGVGIGGGALVLLGQFGVHSAA
FT                   WALAGDPALNMVLIDYAKCTGCRTCEAACSSRNRPVSLKGQELPGLGNPRYANIRVHSF
FT                   NPDVDVPNVCAMCADTPCVKACPVEPDSKTGRRALYRDNVTHTIHNDSDRCLGCRSCAK
FT                   ACAAQRTGVISPDPATGKPERMCTLCGGAPQCVKRCPFGALSYVEVRRDRKFYGLDPEK
FT                   IAAELAKTWYGTADFGGLK"
FT   gene            387500..389251
FT                   /locus_tag="Gbem_0314"
FT   CDS_pept        387500..389251
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0314"
FT                   /product="sensor histidine kinase, GAF and PAS
FT                   domain-containing"
FT                   /note="domains: GAF, PAS, HisKA, HATPase_c"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37345"
FT                   /db_xref="GOA:B5EAN6"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B5EAN6"
FT                   /protein_id="ACH37345.1"
FT                   /translation="MTTEELLQDLKMRGELDERHLLASIRLLHLLASGKSSQEVMSTLL
FT                   PFFQELSGCEAVAVRLREEEDYPYFQTVGFPSEFVNAENYLCAKDLAGQIKRDAIGHPV
FT                   LECMCGNILCGRFDANKSFFTPNGSFWTNSTSELLESTAEEDRQSATRNRCSADGYESV
FT                   ALVPLHHNEDIIGLIQFNDRRKDRFSKGFIALVELLADSVTVAVLRRWEEESLRKREEY
FT                   YRAMVTAFDGLIYICSANYRIEFLNEAMKRRIGHDAIGELCYEALHGLDAICPWCKNDR
FT                   IFAGESHRWVVQSPKDNRWYEVSNTPIRKNNKIVSKQAMIMDVTDRQQLHEELLQKQQD
FT                   LILANDLLESRVAERTSNLEAAMREQESFSYSVSHDLRAPLRHINSFSAIVMEEFSNEL
FT                   PAPVKDYLVRIRSASNRMGGLIDHLLELSRVGRAALKLEPVDLSMMAASILTALQETEL
FT                   KRTVKIFVEEDVRVLGDRTLLQQLLENLLGNAWKYTSKTVTAHIEFGSSKRGDSTIFYV
FT                   KDNGAGFDMQYKDNLFIAFQRLHTAEFEGEGIGLTTAQRIIHRHSGDIWAEGEVGKGAT
FT                   FYFTLPN"
FT   gene            complement(389913..390563)
FT                   /locus_tag="Gbem_0315"
FT   CDS_pept        complement(389913..390563)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0315"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37346"
FT                   /db_xref="InterPro:IPR036116"
FT                   /db_xref="UniProtKB/TrEMBL:B5EAN7"
FT                   /protein_id="ACH37346.1"
FT                   /translation="MSEIFDIQSFKDLGDGDLAFQAETLADRMEGHEAFKDKAIPPCIP
FT                   GPTQIRENAQQVKQTSSAARLDPSKEAERRAARKKMIQSIRFSCQYVVMYADHTDNPGL
FT                   LDTIGVDRAHRAIRHTTVKAPTSFYRFTVTHGKESGTVKVHVSSWEGKGSVELHVCYGN
FT                   PGSEESWQPSKISHYCHFTVEGLEPARRAYFRARLLKDSGVAPWSEAVELIII"
FT   gene            390837..391181
FT                   /locus_tag="Gbem_0316"
FT   CDS_pept        390837..391181
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0316"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37347"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:B5EAN8"
FT                   /protein_id="ACH37347.1"
FT                   /translation="MLISRTWHGSVPLEHGDAFAAYLEKTGVQESRSIPGSAAAYVHRV
FT                   EQDAHSHFFLCTLWSSWEAVRAFAGETPEIAVTYPEDAKYGLISDPIVIHQEVNTDLNP
FT                   FSRAESGLKD"
FT   gene            391217..391561
FT                   /locus_tag="Gbem_0317"
FT   CDS_pept        391217..391561
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0317"
FT                   /product="cupin superfamily barrel domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37348"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:B5EAN9"
FT                   /protein_id="ACH37348.1"
FT                   /translation="MSELFPDPVRNLPQADIPLKGITAYLSQADSHQIIFMQFDEDVEL
FT                   PEHSHESQWGVVLEGRIELVIDGIKRSYVKGDRYFIPQGVPHSGRIYAGYADMTFFDQP
FT                   DRYKIREPNE"
FT   gene            complement(391695..391973)
FT                   /locus_tag="Gbem_0318"
FT   CDS_pept        complement(391695..391973)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0318"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37349"
FT                   /db_xref="UniProtKB/TrEMBL:B5EAP0"
FT                   /protein_id="ACH37349.1"
FT                   /translation="MRLTATLAGLTLLAASTAFAAPKTYQVTGPVLEVKADTIVVEKGK
FT                   EKWEIAKDKDTKITGDLKVGSKVTVMYTMKAATIDVKGEAKPATKKK"
FT   gene            392292..392921
FT                   /locus_tag="Gbem_0319"
FT   CDS_pept        392292..392921
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0319"
FT                   /product="alkylmercury lyase"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37350"
FT                   /db_xref="GOA:B5EAP1"
FT                   /db_xref="InterPro:IPR004927"
FT                   /db_xref="InterPro:IPR024259"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B5EAP1"
FT                   /protein_id="ACH37350.1"
FT                   /translation="MAGGTLHDVLAGLHCDHPRVWLFLLRALAKGRPVSRTTIANALNS
FT                   SLSEIEAALASFADTVYDEKGDVVACGLSLMPTPHSFTVCGNQLYTWCALDALMYPVAL
FT                   EQVAQVESHCPVTGIPVRMTATPTGVVDPSPAGVSLSMVAPSEQAGCCSVRNSFCSGVH
FT                   FISSAEAAASWLSLHPEASIVSLEEAWQIGHAVMQQRLSHGETSRP"
FT   misc_feature    392950..392978
FT                   /note="conserved nucleotide sequence; Gbem_R5064"
FT   gene            393181..393639
FT                   /locus_tag="Gbem_0320"
FT   CDS_pept        393181..393639
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0320"
FT                   /product="protein of unknown function DUF107"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37351"
FT                   /db_xref="GOA:B5EAP2"
FT                   /db_xref="InterPro:IPR002810"
FT                   /db_xref="UniProtKB/TrEMBL:B5EAP2"
FT                   /protein_id="ACH37351.1"
FT                   /translation="MNIVWWHWLTLGLILIGLELIIPSFTIIWFGLGAVIVSIVLASLP
FT                   SCPLSVQILIWTVASALLTFAWFRFFNTRLDRTKAGSSKGAVIGETGLVIRGAQQYDKG
FT                   TVKFHLPLLGADEWPCVADDPLAVGDRVRVVDVEGHVMKVEKIAKGDK"
FT   gene            393639..394493
FT                   /locus_tag="Gbem_0321"
FT   CDS_pept        393639..394493
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0321"
FT                   /product="flotillin band_7_stomatin-like domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37352"
FT                   /db_xref="GOA:B5EAP3"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR001972"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:B5EAP3"
FT                   /protein_id="ACH37352.1"
FT                   /translation="MEPAAVVFAILFLVVVVTIFMGVRLVPQGFEFVVQRLGKYHSTLK
FT                   PGLNFIIPYVDIVAYRLTTKDIPLEIGAQEAITKDNAVIVANAIAFIKIVDPVKAVYGI
FT                   SNYEYAIQNLVMTSLRAIIGEMELDLALSSRDIIKARLKDIISDDVTDWGILVKSVEIQ
FT                   DIKPSESMQKAMEQQATAERLKRAMILEAEGKKEAMIREAEGKLEAAKKEAEAQMMLAE
FT                   ASAKAIQDIAVAVGDKELPALFLLGDRYVNAIQKLSTSPNAKNFVLPADILGAVKGIAG
FT                   RSV"
FT   gene            394578..394843
FT                   /pseudo
FT                   /locus_tag="Gbem_0322"
FT                   /note="alkylmercury lyase; C-terminal fragment"
FT   misc_feature    394872..394900
FT                   /note="conserved nucleotide sequence; Gbem_R5065"
FT   gene            395103..395561
FT                   /locus_tag="Gbem_0323"
FT   CDS_pept        395103..395561
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0323"
FT                   /product="protein of unknown function DUF107"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37354"
FT                   /db_xref="GOA:B5EAP5"
FT                   /db_xref="InterPro:IPR002810"
FT                   /db_xref="UniProtKB/TrEMBL:B5EAP5"
FT                   /protein_id="ACH37354.1"
FT                   /translation="MNIVWWHWLTLGLILIGLELIIPSFTIIWFGLGAVIVSIVLASLP
FT                   SCPLSVQILIWTVASALLTFAWFRFFNTRLDRTKAGSSKGAVIGETGLVIRGAQQYDKG
FT                   TVKFHLPLMGADEWPCVADDPLAVGDRVRVVDVEGHVMKVEKIAKGDK"
FT   gene            395561..396415
FT                   /locus_tag="Gbem_0324"
FT   CDS_pept        395561..396415
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0324"
FT                   /product="flotillin band_7_stomatin-like domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37355"
FT                   /db_xref="GOA:B5EAP6"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR001972"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:B5EAP6"
FT                   /protein_id="ACH37355.1"
FT                   /translation="MEPAAVVFAILFLVVVVTIFMGVRLVPQGFEFVVQRLGKYHSTLK
FT                   PGLNFIIPYVDIVAYRLTTKDIPLEIGAQEAITKDNAVIVANAIAFIKIVDPVKAVYGI
FT                   SNYEYAIQNLVMTSLRAIIGEMELDLALSSRDIIKARLKDIISDDVTDWGILVKSVEIQ
FT                   DIKPSESMQKAMEQQATAERLKRAMILEAEGKKEAMIREAEGKLEAAKKEAEAQMMLAE
FT                   ASAKAIEDIAVAVGDKELPALFLLGDRYVNAIQKLSTSPNTKNFVLPADILGAVKGIAG
FT                   RSV"
FT   gene            396590..397321
FT                   /locus_tag="Gbem_0325"
FT   CDS_pept        396590..397321
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0325"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37356"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:B5EAP7"
FT                   /protein_id="ACH37356.1"
FT                   /translation="MGQFFVQQIAETDVDLDIIQSADEANVVLMFSGGRDSTLAAARLN
FT                   SIGVPVTLVTITSKHLEGIGRVHLRLAELARTLPPGTDWLHIEQPDQLQTDTSFYDQTC
FT                   LPCHHAYVVVSVAIAKKINASKMAFGYTHYQSDWPEQTPLAIARLKTTLARHGIELLLP
FT                   VYDLPSREVAIEELGAYGLSTSSLEQKCLRQITNVALSEERLIQQVDLWEDAIERSMLN
FT                   IADIAISVISHKKIGDFHDGA"
FT   gene            397308..398405
FT                   /locus_tag="Gbem_0326"
FT   CDS_pept        397308..398405
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0326"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37357"
FT                   /db_xref="GOA:B5EAP8"
FT                   /db_xref="UniProtKB/TrEMBL:B5EAP8"
FT                   /protein_id="ACH37357.2"
FT                   /translation="MMVPELSPWSVLTASGALTAFHIGLYTLVGRERKSPYLINSAFPV
FT                   FLLSLFVAALAAIASLLLGCYKSVVLAVSTCVLAGSFIYSLFVVLRLYTRFVLFVDSIN
FT                   PKHWPGIRHFRRWKKKKGHRTPYAHSSVPVPPEFEKKIIGVLEKFGINGGIFTRQEKTL
FT                   KSLAVSTQNQDQCSELLAELALSFLKQGFTIQYMTASRHPVEFIEYLKKYMSDNGDDLG
FT                   NYINKIVVIDAHSPHFGFTDSIYDEKTKELKSLNIAFVTSEMTYAGMHSATTSAFNTLE
FT                   SQMVDKTARQPSLNIYEGIYALTDLESPEQYRIFLRHVLPAERMWNSMFTVFVESYQPE
FT                   NDWMLLKAYASMVLDLRKVGSTENK"
FT   gene            398436..399713
FT                   /locus_tag="Gbem_0327"
FT   CDS_pept        398436..399713
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0327"
FT                   /product="metal-dependent phosphohydrolase-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37358"
FT                   /db_xref="GOA:B5EAP9"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="UniProtKB/TrEMBL:B5EAP9"
FT                   /protein_id="ACH37358.1"
FT                   /translation="MATPLWKKPFTDSLYGRISFDDTIVDLIQEPIVQRLRHVRLSNID
FT                   SIDMPGISNISRFEHVLGVAHLASIIKFRKPLSKFDNLALVSSALLHDWAITSYGHLIE
FT                   EALQYVGTGFEHESTLREILSNGDEHVVGGIDFQILSGRPTNLRKWSRKNVGVESDTLI
FT                   EDITKYIGGEGTLGRIISCDIDIDNIDNVFRMAFHMGINVDRGVPTRLAGSIVGVDDGG
FT                   PIFSISAREDIETWCSTRKNVYQHLMLSERDFIGKIMMLYASVLAFENQEITKEDWCLV
FT                   DHTLLSTFAKSKTKEVCEAVQRWISGDLWVCSPLFWLHGDRPKYSKLLEFSQEVSSVLG
FT                   RECFAYGIKDKRDRHLAISFDTGEKEEFGTHSKQWLLGVGSSKRAAFKTDELEQIFQLS
FT                   ESYFSTTIIGLAANNNSHNDIQECLF"
FT   gene            399701..400852
FT                   /locus_tag="Gbem_0328"
FT   CDS_pept        399701..400852
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0328"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37359"
FT                   /db_xref="GOA:B5EAQ0"
FT                   /db_xref="InterPro:IPR002941"
FT                   /db_xref="InterPro:IPR017985"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B5EAQ0"
FT                   /protein_id="ACH37359.1"
FT                   /translation="MSVLSLKRLDRINWDFPSAGTELGSVHSIHWFPGNYIPQIPAALI
FT                   QVLSRTGEVVFDPFGGSGTTAIEALKLGRFAVVSDRISACVQITEAKLSLLGNPLDRDV
FT                   CNKIFSSLTFEHLCQSTQIGVNGEGRAEDLECWYSSETLGQLRYIWKIIELQSSQVQKV
FT                   LFALFSNVLFACASTNGSRTHTGKLRRHHWGWVADNVRPKELIFHNAIELFCKNLRAVM
FT                   DTNRGPISTTAKVIQQDARNMELEDESVDLVVTSPPYAGVIDYTHANRLLYLWMGWPMG
FT                   EERADEIGARYRRNRKNAVEEYLSDMRLCRDQIHRVLKKGSYCAIVVGESKKFPNTASL
FT                   LIEDFSQSMPIVWGPKSRYLSRRRVSDRVAGDPVEFVCVFQKL"
FT   gene            400849..401352
FT                   /locus_tag="Gbem_4064"
FT   CDS_pept        400849..401352
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_4064"
FT                   /product="cytidylate kinase-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_4064"
FT                   /db_xref="EnsemblGenomes-Tr:ADO00762"
FT                   /db_xref="GOA:E1P667"
FT                   /db_xref="InterPro:IPR011994"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E1P667"
FT                   /protein_id="ADO00762.1"
FT                   /translation="MIISFFGSSCTGKSTLARPLAKYLGLPLRSCGEEIKQRAKAIGSS
FT                   IDDMPISEHLLIDEETIKWASDNCCCIIEGRYLNYVLSSHKHGIILVQLTASATARRNR
FT                   MALRVGKEVSLDEICEIDRKDQAFRVLNYKSLLPLDPTFTIDTSLLTVNECLELIKTKL
FT                   KPLL"
FT   gene            401310..402563
FT                   /locus_tag="Gbem_0329"
FT   CDS_pept        401310..402563
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0329"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37360"
FT                   /db_xref="GOA:B5EAQ1"
FT                   /db_xref="InterPro:IPR017985"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B5EAQ1"
FT                   /protein_id="ACH37360.1"
FT                   /translation="MLRADKNQVKATALKTRLSRLHPYPAMVADELAVALVEKFIPTKS
FT                   AVMDPFCGSGRLLAAVENAKLRVGIDTNPLAWLLTKTKLSAVDPAKIMKLGNTIEQARL
FT                   IQSASCLDLASDRKVPWFSARAKNELACIVEWINGLQLDEPELLLLGSVLSATTRDVSY
FT                   ARQGGWKLHRLNADAREKLDISAWDSLKKRLMYCCTALKSGQTLEGPSYVEIGDSRDHA
FT                   TFSNTTKQYGLFDVVITSPPYGDSLSTVQYGAASSLSLEVVGYLKGLEHLPRAGKTIDG
FT                   TCLGGGTLPIDMSPNLNSYWVGSNESSRVRPIAKFLYDYDLFCKNVAACLRVGGKAILV
FT                   VGRRSTGGALLNLDDFTVDCFESLGFSLTQKEVRPLTQKRFPSKINRFARSKSAVNREH
FT                   GQVTTMQNEIILVLEKTC"
FT   gene            complement(402734..405511)
FT                   /locus_tag="Gbem_0330"
FT   CDS_pept        complement(402734..405511)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0330"
FT                   /product="sensor sigma-54-dependent transcriptional
FT                   regulator, GAF and GAF domain-containing"
FT                   /note="domains: GAF, GAF, sigma54 interaction"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37361"
FT                   /db_xref="GOA:B5EAQ2"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="UniProtKB/TrEMBL:B5EAQ2"
FT                   /protein_id="ACH37361.1"
FT                   /translation="MDQQLKKLGDRIVSFGKENLDEMLHLVGEGSRLVSEQERVRIYLE
FT                   DLTKGALSCAFSCGSFATEIRQETFPIISAEAAVSRTFVTQQVAQYQNPAETGLPLDQE
FT                   FSRRFQIEGTTMLPITSLGKSIGVACLDGGTLSQERIDTLIPFLARAGERVDQARKYHQ
FT                   QLLLARRVELYKRREAAGFMVRSAVNLIDGLTLASVLVPVKGAMEVLASHAQDPDLKYR
FT                   YDNVGGIDLKHGTSLVSRYVNEDGVVTDPSLLKPIFFPDLFDQSIQRRALTEEMGLRTL
FT                   YMVPRVEPETRRIICLMNYFTRDVTSYTDFEMGLLQTHAEMVERVINEVGGEHLEIKVL
FT                   SEISDLLQEPNEGLHGFLTKVLSKATELIGADTGSIAIVQEREGVKWLVVENEEGTIVG
FT                   AKNKEWLKKKIPPFKIGGADLSPEERSLTGYVAWTKEPKIIEQVADQSQHDGFHRPMNE
FT                   LIQSEMAVPVISDDEVIAVICLNSLQDGYFTEEHKRILQIIDRLTSRHISDIQRIERLQ
FT                   SEVNKLQSDIAYKDPKVSSYRLGNIIGNSRKAQEIVAFINTVAQPLSNRIGLWSKHILQ
FT                   EATIGLPSILVLGPTGAGKEFFFNNLYNKLNELYRQQINPEGELPVKKTNIAAYSGDLT
FT                   YSELFGHIKGAFTGAYSDRKGIIEEAAGGIVFLDEIGDADPKTQVQLLRFLDNGGFVRL
FT                   GENRERISRVLLVAATNKDLSKEIAMGNFREDLFHRLTELSVVVPSLNERREDIPDLST
FT                   HFLGKLYRTYRSREEEARDDEPSLSKDAKDALVSHNYKGNIRELRSILLRALFFRTGKI
FT                   ITGEDIKKAIRDGMREQMTPAAERLSEEVAGGILAEIEAGSDFWEAVYQPYSQSQISRD
FT                   VVRLIIEKSRVAAGKNMPEIARYLKAITGDPQVDEEERKRFFRFKNFLYKTVKI"
FT   misc_feature    405670..405707
FT                   /note="conserved nucleotide sequence; Gbem_R4008"
FT   misc_binding    complement(405703..405738)
FT                   /bound_moiety="conserved nucleotide sequence"
FT                   /note="conserved nucleotide sequence; Gbem_R4009"
FT   gene            complement(405768..407612)
FT                   /locus_tag="Gbem_0331"
FT   CDS_pept        complement(405768..407612)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0331"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37362"
FT                   /db_xref="InterPro:IPR031040"
FT                   /db_xref="UniProtKB/TrEMBL:B5EAQ3"
FT                   /protein_id="ACH37362.1"
FT                   /translation="MFKDIRLHGYANDQIEFYAITAGTEAYSRYFFNTDPSDPDEIRFF
FT                   SPGNEFVIGRKGITHRGNGGSFCEYMFGVDQPIADLAKEEVSNRLIVYGTHYDNRTGTL
FT                   KFSDRTEGYHSYDKIFFDGNAIFNYFFALTGSSFTGAMHEQQERIVKVLGKALKRSDAV
FT                   GEEQDNLIIDEILNIVDDPGAHLFLFKLINVRHREYGDYFKTLYFNNKKITDSDFQVLA
FT                   GLAECYGIDRYQQERIRIDVMYKHPDNRRIVDEYRNILIACNRKGEINKLENARLTRLK
FT                   TLSVRNKIPGALFYTLDEMLKKDKKLVDLEESNYISETRQILEGMFLSERHIESTIEPE
FT                   DMLKLLFAKKQAAENRDHAFEEMLLDASKACDEKIRDGADISILEGYSYIITYFDRYDA
FT                   TSSAINQLAFMENVKISEEMIRSLLGNKSAFDMLAPDLFTKLFLSGIFEDKYLGIYGRK
FT                   KVTNLAAGLKLIEENRLTTTGLLEQLVRIDSDERLYLTLLDHVKDRIRNFYSKYATKGD
FT                   QDALKKELAEELVHKKILSGEIPDRLFQEAILTIKKEAVYIHNLLPQIINEKNCLLRED
FT                   FLENSGLDRFYVEELEREFFELNGLNLEDLYQIRKGFN"
FT   gene            complement(407647..408402)
FT                   /locus_tag="Gbem_0332"
FT   CDS_pept        complement(407647..408402)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0332"
FT                   /product="metal-dependent hydrolase, beta-lactamase
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37363"
FT                   /db_xref="GOA:B5EAQ4"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:B5EAQ4"
FT                   /protein_id="ACH37363.1"
FT                   /translation="MKITILGSGTSTGVPMVGCHCQVCGSTDPRDKRTRASILVESCGQ
FT                   RILVDTSTDLRAQALREGIPHVDAVLFTHTHADHIHGIDDLRGFYFIHRRIIPCYGSPG
FT                   TMQSATDKFAYIFDGLTSEGYSPLLEPFPVEDPFELFGCRVVPVPIKHGSFDATGYRFD
FT                   NAAYLTDCSEIPEGSLPLLEGLELLIIDALRFSPHPNHFNIEGALQMAQKLRPRRTLFT
FT                   HLTHEVRHSDGSRLPAGVEFAYDGMTVEL"
FT   gene            408559..409578
FT                   /locus_tag="Gbem_0333"
FT   CDS_pept        408559..409578
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0333"
FT                   /product="glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37364"
FT                   /db_xref="GOA:B5EAQ5"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:B5EAQ5"
FT                   /protein_id="ACH37364.1"
FT                   /translation="MRVGIISPNYFAEETGNAVTVRRIERHLRALGCEVKVFATDRVAG
FT                   EQLQAAVKEFAPDILHAFHAYHGGRVACALAKALGVPYLVTFTGTDIYKALCDQRNMEL
FT                   HGALRGASRLVAFHGCIRHRLAEHMPTLEERTAIIPQGVDLPDDYSPLPPAEEQAFTFL
FT                   LPAGLRPVKNVLFPLEPLAALYADHPQVRLLLAGPVLDKDYAAQVMEALERYPFARYLG
FT                   VVGHDRMGDLYRRVDVVLNSSLSEGGMANTVLEAMAYAKPLLVADIEGNRSVVKENVTG
FT                   LLYRDAGDLVAKAGKLAANARLREKLGNNGRAQVRDHYSPDKEAASYLTLYRDILQKN"
FT   misc_feature    409710..409749
FT                   /note="conserved nucleotide sequence; Gbem_R0090"
FT   gene            409936..411441
FT                   /locus_tag="Gbem_0334"
FT   CDS_pept        409936..411441
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0334"
FT                   /product="oxaloacetate decarboxylase, carboxyltransferase
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37365"
FT                   /db_xref="GOA:B5EAQ6"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR003379"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:B5EAQ6"
FT                   /protein_id="ACH37365.1"
FT                   /translation="MDRIIDITELALRDAHQSLIATRLGIDDMVPVCEDLDQAGYWSIE
FT                   CWGGATYDACIRFLNEDPWVRLRTFKELMPKTPLQMLLRGQNLLGYRHYQDEVVDRFVQ
FT                   KSAENGIDVFRIFDALNDLRNLERSVQAVKQCGKHAQVAISYTISPIHTTAKFVEQAKR
FT                   LVDMGCDSICIKDMAALIKPHATYDLVRGIKEACGDRIRIQLHAHATSGVTMVSYMKAV
FT                   EAGVDGVDTAVSSMSLGPGHNPTESFAEMLENTGYTTRIDLGRVNKVKEHFAKVLPRYS
FT                   EFLSTITGAETEIFRSQIPGGMLSNMESQLKQQGAGDRMRDVLEEIPLVRKDTGYVPLV
FT                   TPTSQIVGTQAVLNVLMGRYKVLTGEFADLMLGYYGLTPGERNPEVVEQARRHANKEPI
FT                   ECRPADLLEPEWGKLRAAALPLEGCDGSDEDVLTYALFPQVAPKFFATRSEGPRNLGRD
FT                   PVTGASETSIPEGHPGKITGPVTYTVTLSGQPHKVTVAPYGQE"
FT   gene            411469..413013
FT                   /locus_tag="Gbem_0335"
FT   CDS_pept        411469..413013
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0335"
FT                   /product="biotin-dependent propionyl-CoA
FT                   carboxyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37366"
FT                   /db_xref="GOA:B5EAQ7"
FT                   /db_xref="InterPro:IPR000438"
FT                   /db_xref="InterPro:IPR011762"
FT                   /db_xref="InterPro:IPR011763"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR034733"
FT                   /db_xref="UniProtKB/TrEMBL:B5EAQ7"
FT                   /protein_id="ACH37366.1"
FT                   /translation="MSIEEKIKALNDKKSKLKLGGGRSKIDQQHAQGSLTARERIEALV
FT                   DKDSFQEIGIFARHRCTNFGMAGKELPAEGVVTGAGSVGGRMVHLASQDFTVAGGSAGE
FT                   VHSDKIVQAMLGSLKTGTPFVFMNDSGGARIQEGIDSLAGYGKVFYHNVMLSGVVPQIS
FT                   LICGPCAGGAAYSPALTDFIIQTAKARMFITGPSVIKEATGEEISAEELGGPLSQMNHS
FT                   GVAHFVAENDLVALRICKKLLSYLPSNNIEDPPQLESDDVIVPDKTLNSIVPSEQKKAY
FT                   DVRNVITRLIDGGDFLEVQPLFAANIVVGFGRILGRSVGIVANQPSVLAGALDINASDK
FT                   GARFVRFCNAFNIPLVTLVDVPGFLPGVQQEKGGIIRHGAKMLFAYAAATVPKITVIMR
FT                   KAYGGAFLAMCGKELETDRVFAWPSAEIAVMGPQGAVNVIFRNEIAQAEDPKKKRDELI
FT                   ASYQGTFATPYAAAARRDVDDIIEPADTRRHLAMTLDILSTKREFRPMKKHGLIPL"
FT   gene            413024..413221
FT                   /locus_tag="Gbem_0336"
FT   CDS_pept        413024..413221
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0336"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37367"
FT                   /db_xref="GOA:B5EAQ8"
FT                   /db_xref="UniProtKB/TrEMBL:B5EAQ8"
FT                   /protein_id="ACH37367.2"
FT                   /translation="MDEEMEQEHDPEITPELLMVMSAAIAAYLGKTVRIRRARFVDPNL
FT                   INAWGQSSRVVLQASHNLRR"
FT   misc_feature    413228..413262
FT                   /note="conserved nucleotide sequence; Gbem_R4010"
FT   gene            413312..413707
FT                   /locus_tag="Gbem_0337"
FT   CDS_pept        413312..413707
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0337"
FT                   /product="biotin/lipoyl attachment domain-containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37368"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001882"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="UniProtKB/TrEMBL:B5EAQ9"
FT                   /protein_id="ACH37368.2"
FT                   /translation="MQLTMTIDGKKYRVDVEVEEGEEVRTEGAFPPTATMQAYPVYSAH
FT                   PTATPPLAAPTPASSSEKICRSPIAGVVFKIVAQVGQHLEMNDLLVVLEAMKMETNITA
FT                   HMSGKVEKILVSVGEAVQPGQAIAEFA"
FT   gene            413799..414263
FT                   /locus_tag="Gbem_0338"
FT   CDS_pept        413799..414263
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0338"
FT                   /product="CHRD domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37369"
FT                   /db_xref="InterPro:IPR010895"
FT                   /db_xref="UniProtKB/TrEMBL:B5EAR0"
FT                   /protein_id="ACH37369.1"
FT                   /translation="MKRVRLLLLVVLAAFFAVSTGYAAEHSFKAKLSPKEEVGKPDAKS
FT                   SGKAEFKLSKDGKELTYKLHVKDVVDASAAHIHVGKKGENGPPIVGLFSGGKKGKFSGV
FT                   LSEGKVSGNDLMGDYKGKFDELVKLMRSGDTYVNVHTDKYPDGEIRGQIK"
FT   gene            complement(414470..415606)
FT                   /locus_tag="Gbem_0339"
FT   CDS_pept        complement(414470..415606)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0339"
FT                   /product="transposase of ISGbem_A"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37370"
FT                   /db_xref="GOA:B5E9I0"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:B5E9I0"
FT                   /protein_id="ACH37370.1"
FT                   /translation="MPWRPVDTMTLRFEFVHLALQEGSNIAFLCKRFNISRPTGYKWIS
FT                   RFLETGVEGLIDLSRKPLTCPHKTVTATEDAILKLREEHQAWGARKLRKRLEKLGHQGV
FT                   PVPSTITAILRRNGCIDPAESDKHTAFQRFEHPYPNDLWQMDFKGSIPMKHHGRCHPLT
FT                   VLDDHSRFSVVLVACANERTETVKAALIEAFRQYGLPYRMTMDNGSPWGNDQYNDLTPL
FT                   TVWLIRNEIRVSHSRPYHPQTQGKDERFHRTLVAEAIAGRVFEDLADCQLRFDTFRHCY
FT                   NLERPHESLGMETPMTRYKPSRRTYSEILPEIQYAPDDEIRKVQAEGKVSFKGRCVRLA
FT                   KALRGQPVAFRPTIRDGEYGVYFCSQKIAEVDLKEQKV"
FT   misc_feature    415679..415791
FT                   /note="conserved palindrome; Gbem_R2005"
FT   gene            complement(415878..417194)
FT                   /locus_tag="Gbem_0340"
FT   CDS_pept        complement(415878..417194)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0340"
FT                   /product="DNA recombination protein, RmuC family"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37371"
FT                   /db_xref="GOA:B5EAR2"
FT                   /db_xref="InterPro:IPR003798"
FT                   /db_xref="UniProtKB/TrEMBL:B5EAR2"
FT                   /protein_id="ACH37371.1"
FT                   /translation="MTPDLFQLIILLLGAATFVFAFLCYLHLKRAHIAEARFDQLEKGL
FT                   ERLERTLQAELGRNREELGGNLRQFGEAVQKRMVDIASLQKGQLEGFTQQLGSLTASNE
FT                   QRLDKLRETVELRLKWLQDDNSKKLEQMRATVDEKLHETLEKRLGESFKQVSGQLEQVH
FT                   KGLGEMQSLASGVGDLKKVLSNIKTRGTLGEVQLHNLLEQILTPDQYGANVATKPGSDA
FT                   RVEFAIRLPGKDDKPLWLPVDAKFPQEDYLRLVEAQEQGNQAAVQEATRQFDKTVAAMA
FT                   KLICEKYLAPPDTTDFAVMFLANEASYAQVLSRPGLFDAILREHKVIVAGPTTIAALLS
FT                   SLSLGFKTLTIEKRSSDVWRLLGAIKTEFMTFGTLLEKTRKKLDEASSSIDTAATRTRR
FT                   IQRKMQGIEQLPEHEAKGLLGGEFGAAEPESEVILIDEA"
FT   gene            complement(417206..418003)
FT                   /locus_tag="Gbem_0341"
FT   CDS_pept        complement(417206..418003)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0341"
FT                   /product="hydrolase or acyltransferase, alpha/beta fold
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37372"
FT                   /db_xref="GOA:B5EAR3"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR000639"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B5EAR3"
FT                   /protein_id="ACH37372.1"
FT                   /translation="MLTQINNIRLAYDDLGHGPAVLLIHGFPLNRQMWQPQLKPLADAG
FT                   YRAIAPDLRGFGASDAPAAGYSMDRFADDLVALLDALQIDKAVVGGMSMGGYILMNLLE
FT                   RRPDRVRAAAFIATRSNADDEAARQRRSEMAAQAERLGANPITKIFAELLFADDTTVSR
FT                   PELIAQVTSWMRSTNPNGLAGGLVAIRDRKEYTPLLASFGKPSLVIAGTEDRAAPLDVA
FT                   RVLIEALPGCRTKIIEKAGHMVNMEQPELFNKTLVDFLDSLPD"
FT   misc_feature    418021..418051
FT                   /note="heptanucleotide repeats; Gbem_R7014"
FT   gene            complement(418055..418411)
FT                   /locus_tag="Gbem_0342"
FT   CDS_pept        complement(418055..418411)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0342"
FT                   /product="protein of unknown function TIGR02436"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37373"
FT                   /db_xref="InterPro:IPR012657"
FT                   /db_xref="InterPro:IPR036583"
FT                   /db_xref="UniProtKB/TrEMBL:B5EAR4"
FT                   /protein_id="ACH37373.1"
FT                   /translation="METNAVKDKSFAFALRIIKLYQYLCERKEFVISKQLLRSGTAVGA
FT                   LVREAEQAESRADFIHKLAIALKEANETEYWLELLHQSNYLEDKNYQSISSDSKCLLRL
FT                   LTSIIKTTKMHNKK"
FT   misc_feature    complement(418426..418456)
FT                   /note="heptanucleotide repeats; Gbem_R7015"
FT   misc_feature    complement(418491..418514)
FT                   /note="heptanucleotide repeats; Gbem_R7016"
FT   gene            complement(418508..420307)
FT                   /gene="recD"
FT                   /locus_tag="Gbem_0343"
FT   CDS_pept        complement(418508..420307)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recD"
FT                   /locus_tag="Gbem_0343"
FT                   /product="exodeoxyribonuclease V, alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37374"
FT                   /db_xref="GOA:B5EAR5"
FT                   /db_xref="InterPro:IPR006344"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR027785"
FT                   /db_xref="InterPro:IPR041851"
FT                   /db_xref="UniProtKB/TrEMBL:B5EAR5"
FT                   /protein_id="ACH37374.1"
FT                   /translation="MAAETFQFNDIDRQFASFICRQAASRDAHLEAAAALLSRGVTAGD
FT                   VCLDLESALEDARAAGYRIESVAAWRQKLAAHPVVGEPGEFKPLILDHADRLYLQRYWR
FT                   YEDELAEAIMKRGKTVRFDRALLQKGLARLFPPTPGETDWQRVAALAAVTRRFCVISGG
FT                   PGTGKTSTVVKVLSLLLEQAEEAGTGAGLRIALAAPTGKAAARLKESISDGARFAEEGV
FT                   RGLIPEDVFTLHRLLGYLKGSSGFRHNADNPLPYDVVIVDEASMVSLPLMAKLVCALRH
FT                   DTRLILLGDRDQLASVEAGAVLGDICDTGGVHGFSPAFAALAADLAGDAVTSSSGMSPL
FT                   GDAVVQLQRSYRFSSAGGIGKVGSLVNAGDAPGALSACLDSAVAGVTLAPLPTAAALAD
FT                   ALAKRISEGYGAYLREESPEAAFAEFSRFRILCAMRSGPFGVEAINLLVRQRLSQAGMI
FT                   HPRGRWYAGEPVMITRNDYNLGLFNGDVGLILPDAETGGELRAFFPSGTGGMRKVLPLR
FT                   LPEYECAFAMTVHKSQGSEFDRVLLVLPDRDAPVLTRELLYTAITRAKTSVDILANQEL
FT                   FLSTVTRRIVRRSGLRDKTWKPN"
FT   misc_feature    420361..420388
FT                   /note="conserved nucleotide sequence; Gbem_R0091"
FT   misc_feature    complement(420394..420429)
FT                   /note="conserved nucleotide sequence; Gbem_R4011"
FT   gene            complement(420611..424003)
FT                   /gene="recB"
FT                   /locus_tag="Gbem_0344"
FT   CDS_pept        complement(420611..424003)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recB"
FT                   /locus_tag="Gbem_0344"
FT                   /product="exodeoxyribonuclease V, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37375"
FT                   /db_xref="GOA:B5EAR6"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR004586"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR011604"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="InterPro:IPR038726"
FT                   /db_xref="UniProtKB/TrEMBL:B5EAR6"
FT                   /protein_id="ACH37375.1"
FT                   /translation="MKRFDLLHTPLAGRNLIEASAGTGKTFTIAGVYLRLVLEQKFDVS
FT                   RILVVTFTEAATKELKERIRNKLKEAENGFLTGATDDFLIEGLLKSTQDHSEARRLLSS
FT                   AIRSFDEAAIFTIHGFCQRMLQDNPFESGSLCDTELVTDQGKILMEIAQDYWRINCYGQ
FT                   PEERIAAAGAAKVSPESLLKLVQRVCGDPNAAVIPDPPADANELDDWLQGLKRGFFDYL
FT                   RAELPKRKRLKNLRSFDDLLLDLHAALLRPASTLPRLIRERYQAALIDEFQDTDPLQFA
FT                   IFDAIYPVGHEAPFFLIGDPKQAIYSFRGADIFAYMGAAQATKERHTLLQNFRSEAGLI
FT                   DAVNALFASRELPFLYPQIGFNKVEAAPKEKSRLVEAGQRKAPLKLWLAPRKDAGKPIN
FT                   KGDAWEQLPETVAAEISRLLRDGADGKLTVEELRKDAEEGSENWVQRAVEPRDIAVLVR
FT                   ANRQAKLMQRALTHRGIPSVLCSAGNLFESDEAAELLRLLSAVAQPGHESLLRGALATD
FT                   LVGVSGTELARLMDDEKGWEEILEEFRSYHDTWNSGSCMSMALQFMEKREVRKRLLAEP
FT                   MGERRLTNLLHAIETIHQAQVNERLGMEAVISWLACRITEEPKKDEYEIRLETDEAAVQ
FT                   LVTIHKSKGLEYPIVFLPFCWAEYAGKDEGALFHDEDGRVVLDIGSEQMGEHKAQAARE
FT                   ALAESLRLLYVALTRGKHRTYLTWGVFKDAGDSALHYLLHPGETPVKGQVTLSDADIRK
FT                   RLDTLAASSAGRIEVLDLPAADLAPYRAHDKKAPDLAPLPFTGAISRDWRVASFTSLSS
FT                   HKHHTAELPDRDEGSPVEERPVHDVEPTGIFAFPKGAKAGIFLHKIFEDLDFTRVGEQL
FT                   SPLVKEQLDKHGFAPDWSQAVRDMVQNVLQAPLGDGEIALAQVGLERRLTEMEFFFPLS
FT                   HVTSDRLREAAARFTAGHGTAGVAGLPVDLADLFSRLSFAPVQGMLLGFIDLVFEHGGR
FT                   YYIVDWKSNHLGNTPGNYGQAALKKEMEENFYPLQYLLYTVALDNYLRLRIPGYDYDRH
FT                   FGGVFYLFLRGVDGTGNGVYADRPPRELIAHLAEVLLPESARPSRIDEPSPSPLPSPAG
FT                   RGGVGKKPRKTEIEGQLSLDLFD"
FT   misc_feature    424051..424162
FT                   /note="conserved palindrome; Gbem_R2006"
FT   gene            complement(424197..427421)
FT                   /gene="recC"
FT                   /locus_tag="Gbem_0345"
FT   CDS_pept        complement(424197..427421)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recC"
FT                   /locus_tag="Gbem_0345"
FT                   /product="exodeoxyribonuclease V, gamma subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37376"
FT                   /db_xref="GOA:B5EAR7"
FT                   /db_xref="InterPro:IPR006697"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR013986"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041500"
FT                   /db_xref="UniProtKB/TrEMBL:B5EAR7"
FT                   /protein_id="ACH37376.1"
FT                   /translation="MPLKIYTSNRMERLVDELERVVRAPRPAPCTPFDKELVVVQNKGM
FT                   QRWLSMELATRIGVWANGDFLFPNKFVEEVFAYVLPESPADAPLFAPEVMTWRILELLQ
FT                   QSAGRAGFEEVAGYLADDGDGLKRMQLARRISDTFDRYTIYRPKELLRWEQGEEEHWQA
FT                   QLWRALNDRAGQKHRARLLHDFLASRKNDRSWRRRISVIGIPSLPPFHLDVLAKVAEHA
FT                   EVNLFLLNPCRQYWGEIVSERELARLEKHGQGEEQWYETGNPLLASWGKLGRDFFKAII
FT                   DDCGDHEREDSFYELPQGVLLHEVQADIVELRGAEAGPRQVQAGDLSLKIHSCHSPMRE
FT                   VEVLYDTLLSLFDADPLLSPRDVLVMTPDIEAYAPYISAVFDNPEEDRKRIPYSIADRS
FT                   LKNEGEAARALVAILGLCGGRYGVATVLDILESPPVARRFGLSGDDLENVRDWLRGANI
FT                   RWGIDASQRAEHGVPPFSENSWAAGLDRLLLGYAMNGDGRSFYNGILPYDDMEGGVALS
FT                   FGRFLTFCEKLFAQTGALSRPRVPSEWVPALRQILDDFILPDQEGEREFLLLIEMAKKL
FT                   GEFPAAAGFEEEIGIEVVRYWVEQQLGASKRDLGFLTGNVTFCAMLPMRSIPFPVVALL
FT                   GMNEGEFPRRNPPQGFDLMTREPRSGDSSPRDEDRYLFLEALLSARKRLHISYVGQSIK
FT                   DNAELPPSVLVSELLDYLERAFVTPEGKPAAEVARHPLQPFSLQYFNRDSALFSYSQQN
FT                   CEGAKAKLSSPTPREPFLDAPLPAWEEEGTVTLKTLIDFLCNPAKELLRRRLGIRIEQG
FT                   VEPLEESEPFALDTLAKYQLEQEMVTALLRGEELDTPYAVACARGDLPPGVCGSALFRK
FT                   LGEPAQEFAAKVVEASDGEPLPPLDIDLVLPGGRIIGRIENLRTDRMVRYRYTKLKAKD
FT                   QLRLWVEHLALNCAKAEGYPLESSFVASDSTIHLPPVEACTEHLDRLLELYRMGMTCPL
FT                   KFFPESSLEYAKKSRDPKKAAKALADALGKWHGSEFYEGEGKDEHCRRCFGDDAPLDEE
FT                   FATLALQVWEPLLELQKAKGKGKDRL"
FT   gene            427759..428691
FT                   /locus_tag="Gbem_0346"
FT   CDS_pept        427759..428691
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0346"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37377"
FT                   /db_xref="GOA:B5EAR8"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:B5EAR8"
FT                   /protein_id="ACH37377.1"
FT                   /translation="MKLITEEMVARAYYWVKPLMSRKLQILLRRVVARRKRALHRSIWP
FT                   IDPDAGGKPAGFPGWPNGNRFSVVLTHDVDTARGLERCEELMELEKEMGFRSSFNFVAH
FT                   DYVLPPELRRKLVEQGFEVGVHGLEHNRKLYESPDTFARQAALINGYLKEWGAVGFRSP
FT                   CVYHNFEWLHQLDISYEASAFDTDPFEPQSDSLRTIFPVHQTAVPGREYVVLPYTLPQD
FT                   FTMFILFREKGIGIWKEKLRWIAEHGGMALLITHPDYMNFDGNRQFDEYHCELYRELLE
FT                   HIRTEYQGEYCHLLPHEIASFWTERVALR"
FT   gene            428767..429798
FT                   /locus_tag="Gbem_0347"
FT   CDS_pept        428767..429798
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0347"
FT                   /product="endonuclease/exonuclease/phosphatase family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37378"
FT                   /db_xref="GOA:B5EAR9"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/TrEMBL:B5EAR9"
FT                   /protein_id="ACH37378.1"
FT                   /translation="MRPVLWLNLLYAAVIAAIALSHRIGADRFWPGALNLYLPQVMWAL
FT                   PGIILLPVTWKAERPWVWLPLCALMWVIGPVMGYNWPLNREKGEVSGTPLRVMTWNIKY
FT                   GKHDLMPLVEELERSRPDIVLFQDAVRAGAGPLAGYFKDWHLLSQGRYLIASRYPLSAA
FT                   EVFELPYSGRSKEYLLRCKVRVGSSEISLYDVHFKTPRRSLNAFRKAKQGPWYIPDAVE
FT                   RFEDNVTLRLIQARTVAGYLSREKGPVLVAGDLNSPDSSLVCRTLREAGLADAFAAAGE
FT                   GYGYTYGHFLLKNRIPLLRVSWMRIDHVMTNSWLTASRCRVGTGRASDHRPVIADFLLK
FT                   NSP"
FT   gene            429914..431143
FT                   /gene="ackA-2"
FT                   /locus_tag="Gbem_0348"
FT   CDS_pept        429914..431143
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ackA-2"
FT                   /locus_tag="Gbem_0348"
FT                   /product="acetate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37379"
FT                   /db_xref="GOA:B5EAS0"
FT                   /db_xref="InterPro:IPR000890"
FT                   /db_xref="InterPro:IPR004372"
FT                   /db_xref="InterPro:IPR023865"
FT                   /db_xref="UniProtKB/TrEMBL:B5EAS0"
FT                   /protein_id="ACH37379.1"
FT                   /translation="MLILTLNCRSFSVQYQLFDWGQNRTLASGNVERIVIGDTFLIHKV
FT                   PGKEPRQLDADCADHTQALQFVLDTLTDAKDGVLPDVASIRAIGHRVVHGGERFTRSVL
FT                   IDDDVVAAIKETANLAPLHNTPNLAGIRAAQELLPDLPQVAIFDTAFHQTMPEKAYIYP
FT                   LPYDWYKQHGIRRYGFHGQSHLHAARRGAALAGVPLERCNLVTVHTGNGVSLCALKNGV
FT                   SVDTSMGLTPLEGVMMGTRCGDIDAGIVPFMINEAGISATDMDLFLNQKSGLAGIVGRR
FT                   VSRRTVVDEAVVGDARCQLALDMESYRLRKYIGAYIAVIGKPDAIVFTYGEGWEDWPVR
FT                   GMALKGMEQFGIEVDLKRDEEALRGEREMLISADSSKVKVFALPSGEEMMLNEDVAAIM
FT                   GWPVREAGAA"
FT   gene            complement(431140..432243)
FT                   /gene="metX"
FT                   /locus_tag="Gbem_0349"
FT   CDS_pept        complement(431140..432243)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metX"
FT                   /locus_tag="Gbem_0349"
FT                   /product="homoserine O-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37380"
FT                   /db_xref="GOA:B5EAS1"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR008220"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5EAS1"
FT                   /protein_id="ACH37380.1"
FT                   /translation="MSYGIVTEQIATFDTELRLESGRILGPIDIAYETYGTLNESRSNA
FT                   ILVTHAWTGSAHLAGRYSEDEKRAGWWDEIVGPGALLDTDRYFVICSNVIGSCFGSTGP
FT                   TSINPKTGKRYNLAFPVITVRDMVKAQALLMDRLGIGKLFCVLGGSMGGMQALEWATQF
FT                   PERVGSAVVLATTPRPSAQAISLNAVARWAIFNDPNWKKGEYRKNPKDGLALARGIGHI
FT                   TFLSDESMTAKFDRRFSARDGQFDFFGQFEVERYLTYNGYNFVDRFDANSFLYLAKALD
FT                   LYDVASGCESLEEAFAPVTAPIQFFAFTSDWLYPPAQTEEMVASLKTLGKQVEYHLITS
FT                   AYGHDAFLLEHQTFTPLVESFLDRVKV"
FT   misc_binding    complement(432343..432449)
FT                   /bound_moiety="S-adenosylmethionine"
FT                   /note="S-adenosylmethionine-responsive riboswitch;
FT                   Gbem_R0079"
FT   gene            complement(432519..432689)
FT                   /locus_tag="Gbem_0350"
FT   CDS_pept        complement(432519..432689)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0350"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37381"
FT                   /db_xref="GOA:B5EAS2"
FT                   /db_xref="UniProtKB/TrEMBL:B5EAS2"
FT                   /protein_id="ACH37381.1"
FT                   /translation="MKKLLSLAAVTLLTSAFLDPLIYSGLDKPIPWGRDALMAVGGVVC
FT                   FYLLVKYRNDL"
FT   gene            complement(432686..433549)
FT                   /gene="ghr"
FT                   /locus_tag="Gbem_0351"
FT   CDS_pept        complement(432686..433549)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ghr"
FT                   /locus_tag="Gbem_0351"
FT                   /product="glyoxalate/3-oxopropanoate/4-oxobutanoate
FT                   reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37382"
FT                   /db_xref="GOA:B5EAS3"
FT                   /db_xref="InterPro:IPR002204"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR015815"
FT                   /db_xref="InterPro:IPR029154"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B5EAS3"
FT                   /protein_id="ACH37382.1"
FT                   /translation="MEQYGFLGLGIMGSAMAKNLLKAGFKVTVWNRSQEKCAEFAALGA
FT                   TVAATPAEVTSSCSVTIAMLADPAAAHAVCFGPEGALEGIGAGRGYVDMSTVDAATAQE
FT                   IGAAVTGKGGRFLEAPVSGSKKPAEDGTLIILAAGDRGLFDQALPLFEKMGKKSLYLGE
FT                   VGRGAQMKLIVNMVMGGMMTIFCEGLALADKAGLECSDLLDVIDAGAMANPMFKLKGAQ
FT                   IGQENFATAFPLKHMQKDMRLAVALGDQLGQPLFSASAANESFKRARSQGFSDQDFSAV
FT                   FKAIAS"
FT   gene            complement(433820..434689)
FT                   /locus_tag="Gbem_0352"
FT   CDS_pept        complement(433820..434689)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0352"
FT                   /product="protein of unknown function DUF2400"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37383"
FT                   /db_xref="GOA:B5EAS4"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="InterPro:IPR014127"
FT                   /db_xref="InterPro:IPR023170"
FT                   /db_xref="UniProtKB/TrEMBL:B5EAS4"
FT                   /protein_id="ACH37383.1"
FT                   /translation="MRSSLELKTVLDSLYAVRSQEHLANDPLSFCHRYADPRDQEIAGL
FT                   IASSFAYGNVKIIKKNLAWIFDRMGDSPRRFVERLEPEQGSRLFAGFKHRFNDARDLCA
FT                   LLFACRTMLEQAGSVEGWLLQFHVQGEEDLTGTLSGFSEAVKSLDFTPVFGAATPPADS
FT                   YFPFFFPSPASGSACKRLCMYLRWMVRPADGIDLGIWKGIRPDQLVIPVDAHIQRICRL
FT                   LGFTARKQADWRMAREITAALRELDPADPVKYDFSICHLGISEGCDGKDHLKCVACPIA
FT                   GLCPVGSP"
FT   gene            434785..435156
FT                   /locus_tag="Gbem_0353"
FT   CDS_pept        434785..435156
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0353"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37384"
FT                   /db_xref="GOA:B5EAS5"
FT                   /db_xref="InterPro:IPR011576"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:B5EAS5"
FT                   /protein_id="ACH37384.1"
FT                   /translation="MRLAELFPEGGRGIIATADAAGVVNQAVFAIPHVVDEQTLAWGFS
FT                   EGRTIANLRENPHASYLYLAPSRGYNGWRLTLTMAEEAGEGEMLENIRERTAQVASPQA
FT                   SAAVTRVAYFKVEEVRPLM"
FT   gene            complement(435157..435606)
FT                   /gene="dtd"
FT                   /locus_tag="Gbem_0354"
FT   CDS_pept        complement(435157..435606)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dtd"
FT                   /locus_tag="Gbem_0354"
FT                   /product="D-aminoacyl-tRNA deacylase"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37385"
FT                   /db_xref="GOA:B5EAS6"
FT                   /db_xref="InterPro:IPR003732"
FT                   /db_xref="InterPro:IPR023509"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5EAS6"
FT                   /protein_id="ACH37385.1"
FT                   /translation="MKAVIQRVKEAKVSVEGRVVGEIGKGVLVLLGVEIGDGCAQADWM
FT                   AEKIVNLRIFADNEGKMNLALPEVKGEMLAVSQFTLAGNCSKGRRPSFDTAAAPEEANR
FT                   LYSYFMGQVWERGVPVQSGIFQADMEVSLVNDGPVTFILETPPKR"
FT   gene            complement(435603..436136)
FT                   /gene="ymdB"
FT                   /locus_tag="Gbem_0355"
FT   CDS_pept        complement(435603..436136)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ymdB"
FT                   /locus_tag="Gbem_0355"
FT                   /product="O-acetyl-ADP-ribose deacetylase"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37386"
FT                   /db_xref="InterPro:IPR002589"
FT                   /db_xref="UniProtKB/TrEMBL:B5EAS7"
FT                   /protein_id="ACH37386.1"
FT                   /translation="MSATKLSERVEIIRGDITRIAVDAIVNAANGTLLGGGGVDGAIHR
FT                   AAGPELLAECRTLSGCATGEAKITAGYRLPARHVIHTVGPVWHGGSRGEPELLRSCYRN
FT                   ACRLAHENGLSSIAFPAISAGVYGYPMRLACRIALEEAKAALEGYPDLKKVVFVPFSPE
FT                   AEQIYQELLQEVFS"
FT   gene            complement(436156..437007)
FT                   /gene="nfo"
FT                   /locus_tag="Gbem_0356"
FT   CDS_pept        complement(436156..437007)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nfo"
FT                   /locus_tag="Gbem_0356"
FT                   /product="endodeoxyribonuclease IV"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37387"
FT                   /db_xref="GOA:B5EAS8"
FT                   /db_xref="InterPro:IPR001719"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR018246"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5EAS8"
FT                   /protein_id="ACH37387.1"
FT                   /translation="MDLLGAHVSIAGGIHNAVDRGVSSGCGVIQIFTQNSNQWKGKAVS
FT                   PADAQLFRDKLTASGLSHVVSHDIYLINLAAAPGEVKDKSLIAFKEEMQRCAALGIDKI
FT                   VMHPGSHTGDGEETGIRRICEAFDQLFAEVPEFTGKVLLENTAGQGTNLGYRFDHLKSI
FT                   IEGSSYPTRFGVCFDTCHAFASGYPIADRDGYRRTFDEFDSALGIDKLMAFHLNDSKKG
FT                   LGCKVDRHEHIGAGALGLEPFRFILNDPHFKLVPKFIETPKGDADEMDVVNLKLLRSLV
FT                   EG"
FT   gene            complement(437065..437487)
FT                   /locus_tag="Gbem_0357"
FT   CDS_pept        complement(437065..437487)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0357"
FT                   /product="histidine triad (HIT) family hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37388"
FT                   /db_xref="GOA:B5EAS9"
FT                   /db_xref="InterPro:IPR001310"
FT                   /db_xref="InterPro:IPR011146"
FT                   /db_xref="InterPro:IPR026026"
FT                   /db_xref="InterPro:IPR036265"
FT                   /db_xref="UniProtKB/TrEMBL:B5EAS9"
FT                   /protein_id="ACH37388.1"
FT                   /translation="MNCPICSKWQDDPDQRVVELKHTLVSLNRDQFFAGYCFVYTRNHV
FT                   TELFHLSEQVRNGVMAEVTAVAQALHSVFSPDKINYELLGNMAPHMHWHIVPRRSKDPL
FT                   WPRPQWSEPHQEVVLKPEEYRERAALIKAQLKNILG"
FT   gene            complement(437484..438320)
FT                   /gene="dapF"
FT                   /locus_tag="Gbem_0358"
FT   CDS_pept        complement(437484..438320)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dapF"
FT                   /locus_tag="Gbem_0358"
FT                   /product="diaminopimelate epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37389"
FT                   /db_xref="GOA:B5EAT0"
FT                   /db_xref="InterPro:IPR001653"
FT                   /db_xref="InterPro:IPR018510"
FT                   /db_xref="UniProtKB/TrEMBL:B5EAT0"
FT                   /protein_id="ACH37389.1"
FT                   /translation="MKFTKMQGAGNDYVYVNCFEEAVHDPAAVAIKVSNRNFGIGSDGL
FT                   ILIMPSEVADVRMRMFNSDGSESEMCGNGIRCVAKYAYDHGIVTKNEITAETGAGILTL
FT                   QLFTDAGCKVEKVRVNMGPPRLTRKEIPMLGEPEERVVNVPLNVLHSSFNITCASMGNP
FT                   HCVIFVDDVDTFQVEKYGPLIENHELFPRRTNVEFVQIVSRTEVRQRTWERGAGETLAC
FT                   GTGSSAVTAACVLNGLTEKRILNHLTGGDLEMEWGEDGNIYMTGPAVEVFTGEIDL"
FT   gene            438454..438663
FT                   /locus_tag="Gbem_0359"
FT   CDS_pept        438454..438663
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0359"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37390"
FT                   /db_xref="UniProtKB/TrEMBL:B5EAT1"
FT                   /protein_id="ACH37390.1"
FT                   /translation="MELKNRIWMNGNLEWYAYIGDAEVFLGSREVPIPLEEGDKWTNAY
FT                   GDVFEIIDSAIVHVGRVEPPQRYW"
FT   gene            438777..439235
FT                   /gene="iscR"
FT                   /locus_tag="Gbem_0360"
FT   CDS_pept        438777..439235
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="iscR"
FT                   /locus_tag="Gbem_0360"
FT                   /product="helix-turn-helix iron-sulfur cluster-binding
FT                   transcriptional regulator IscR"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37391"
FT                   /db_xref="GOA:B5EAT2"
FT                   /db_xref="InterPro:IPR000944"
FT                   /db_xref="InterPro:IPR030489"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B5EAT2"
FT                   /protein_id="ACH37391.1"
FT                   /translation="MRLSTKSRYGLRALFDIAYNAGSQPAQIQDISRRQDISPRYLEQI
FT                   FQGLKKHGILKSKRGPQGGYCLAKSPEEITVRAVIEATEGDTLIVDCASRKKGECNFDG
FT                   SCVTQTVWEESNNRLNEFFESITLKTLCDRGETLGIKREQDHRFMYFI"
FT   gene            439309..440115
FT                   /locus_tag="Gbem_0361"
FT   CDS_pept        439309..440115
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0361"
FT                   /product="adenosine nucleotide alpha-hydrolase superfamily
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37392"
FT                   /db_xref="GOA:B5EAT3"
FT                   /db_xref="InterPro:IPR005232"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR022310"
FT                   /db_xref="UniProtKB/TrEMBL:B5EAT3"
FT                   /protein_id="ACH37392.1"
FT                   /translation="MQTAQDKYLKLQEILREMGSLLVAFSGGVDSTFLLKAAFDTLGAE
FT                   RVLAVTATSPTYPESELAEAKRLATRIGARQELVVSNELEIPGFRHNPKDRCYHCKSEL
FT                   FRICTEKARDNGFAFVADGSNTDDLGDYRPGRTAACELKVRSPLLEAGLSKGDIRELSR
FT                   GLGLPTWDKQAYACLASRFPYGTEITEQRLNQVERCEEFLKGEGFTVYRVRFHLESARI
FT                   ELSEAELPRMLEPSLRGRTIEFFRAAGFTYVSLDLQGYRTGSMNEG"
FT   gene            complement(440129..440563)
FT                   /gene="hspA-1"
FT                   /locus_tag="Gbem_0362"
FT   CDS_pept        complement(440129..440563)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hspA-1"
FT                   /locus_tag="Gbem_0362"
FT                   /product="ATP-independent chaperone, alpha-crystallin/Hsp20
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37393"
FT                   /db_xref="InterPro:IPR002068"
FT                   /db_xref="InterPro:IPR008978"
FT                   /db_xref="UniProtKB/TrEMBL:B5EAT4"
FT                   /protein_id="ACH37393.1"
FT                   /translation="MAIVRYNPLSELRSMQDKMNRLLDMAWTREVGEEIREGVWHPPAD
FT                   VYEDASAVTIKVEVPDMEQKDIEIKVEEQTLTVKGERRHSEEIRKENFHRIERYFGPFQ
FT                   RSFALPADLNTDAVSASCDYGVLTIVLPKTGVMPVTVEVK"
FT   gene            complement(440671..440844)
FT                   /locus_tag="Gbem_0363"
FT   CDS_pept        complement(440671..440844)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0363"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37394"
FT                   /db_xref="UniProtKB/TrEMBL:B5EAT5"
FT                   /protein_id="ACH37394.1"
FT                   /translation="MARNEERTIDELAQEMEINLAVDYDRKDLKAQRELTKQHLYDGSK
FT                   KLKHTVPKGKRV"
FT   gene            441030..441203
FT                   /locus_tag="Gbem_0364"
FT   CDS_pept        441030..441203
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0364"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37395"
FT                   /db_xref="UniProtKB/TrEMBL:B5EAT6"
FT                   /protein_id="ACH37395.1"
FT                   /translation="MLQYKVVELSHVSDETIEEALNEWTQKGWKFDALQFAMRDGSRRP
FT                   AMAFVVFTREEP"
FT   gene            441203..443881
FT                   /gene="polA"
FT                   /locus_tag="Gbem_0365"
FT   CDS_pept        441203..443881
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="polA"
FT                   /locus_tag="Gbem_0365"
FT                   /product="DNA polymerase I"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37396"
FT                   /db_xref="GOA:B5EAT7"
FT                   /db_xref="InterPro:IPR001098"
FT                   /db_xref="InterPro:IPR002298"
FT                   /db_xref="InterPro:IPR002421"
FT                   /db_xref="InterPro:IPR002562"
FT                   /db_xref="InterPro:IPR008918"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR018320"
FT                   /db_xref="InterPro:IPR019760"
FT                   /db_xref="InterPro:IPR020045"
FT                   /db_xref="InterPro:IPR020046"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="InterPro:IPR036279"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:B5EAT7"
FT                   /protein_id="ACH37396.1"
FT                   /translation="MTTETETLYLLDGSSYIYRAYFAIRHLSSPSGFPTNALYGFTQML
FT                   LKVMKDRAPAHVAVIFDAGKITFRNELFPAYKATRSAMPEDLAQQIEPIKQMVRAFNIP
FT                   ALELPGFEADDIIGTIAKKCEAQGMACVVVTGDKDLMQIVSDRVTLLDTMKEKSFGIAD
FT                   VYEKFGVAPERVVDVLALWGDASDNIPGVPGIGEVTAKKLLQEFGSLDELLARAGEVKG
FT                   KNGERLVEFADQARLCRTLATIDCNVPIEYSVDDFAVTPPDNRRLAALFREYGFVTLLK
FT                   DLTSSPTLSCDRYSLVLTEEELRRVVAELEAAPAFAIDLETTSLNPREARVVGYAVSCR
FT                   PHEARYIPVGHRYLGAPEQLPEALVLEILGPLLKDPARRKIGQNLKYDYQVLRMAGFEM
FT                   EGIWCDTMLAAYLVNPARNSQGLDALALEYLDHRMISYAEVAGSGKCELNFSEVDLDRA
FT                   GPYSCEDADATYLLHEILLPKVREQGMEELLFDLEMPLMRILADMELHGVKLDVDLMKE
FT                   LSAGFGKQLIELEAQIHEHCGGPFNINSPKQLGEMLFERMGLAVGKKTKGKTGWSTNVE
FT                   ELERLAEEHEVARLLLQYRSISKLKSTYTDALPKLVDPATGRVHTSYNQAVTSTGRLSS
FT                   SDPNLQNIPIRGEEGRGIRRAFIAEPGSLMLSADYSQIELRVLAHLSGDRVLCEAFAAG
FT                   EDIHRRTASEVFGMFPELVTSEMRRQAKVINFGVIYGQGAFSLAKELGVTPKQAKAFID
FT                   SYFERHSGARSFLDSCIREAEVCGFVTTIMGRRLCIPEIASKNGNVRAFAQRNAVNYPI
FT                   QGSAADIIKAAMLRVIRRMQQERVASRLIMQVHDELVFEVPEAERDLMEELVRTEMEGA
FT                   LPLSVPLKVDLNFGLNWSEAH"
FT   gene            443951..444940
FT                   /locus_tag="Gbem_0366"
FT   CDS_pept        443951..444940
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0366"
FT                   /product="PilZ domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37397"
FT                   /db_xref="GOA:B5EAT8"
FT                   /db_xref="InterPro:IPR009875"
FT                   /db_xref="InterPro:IPR040638"
FT                   /db_xref="UniProtKB/TrEMBL:B5EAT8"
FT                   /protein_id="ACH37397.1"
FT                   /translation="MTEQLEQYQAHFQEGGRVRVGVPLKGGGAFSEWGTVASLDDDLLQ
FT                   LYLSRDSLPEQARLELGRTLDLALDGKQGPLACRGVLVADHAADHRLVLRLVEDVVPYE
FT                   PREYFRQDVYLPLIYRRTLSQVAEEVRLRWEHSRREIELAAQDPDPDEPEEVADAREEI
FT                   RARLEKRKTAPPLAANLSGGGARLNIAERFAEGELVELSIYLPQHSRMIEIIGEVVQVT
FT                   ALPDRVRFSTALRYRFIDEADRDRLIGYISAEQLHQMSQHGPRVLLPPPEEPSVWRRRL
FT                   QVTFVLALLAGFLGCQARAILVAKQRGEKWEVQRVFDQGFMEFLRRQR"
FT   gene            complement(444924..445781)
FT                   /locus_tag="Gbem_0367"
FT   CDS_pept        complement(444924..445781)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0367"
FT                   /product="metal-dependent phosphohydrolase, HDOD
FT                   domain-containing"
FT                   /note="domains: HDOD"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37398"
FT                   /db_xref="GOA:B5EAT9"
FT                   /db_xref="InterPro:IPR013976"
FT                   /db_xref="UniProtKB/TrEMBL:B5EAT9"
FT                   /protein_id="ACH37398.1"
FT                   /translation="MHSRPFVEVVKEQLESESLNLPVFHPIALKLQGILAATDFSIDQV
FT                   VALIIKDQALTSQILRLANSAFFSGLAKVTTITDAVIRLGAREIASVAMLASQQSSYNS
FT                   FTMPELKSHSQLLWKHAIGCAIGTRWLCEKSGYKQLAQEGFIAGLLHDIGCLLILRVLE
FT                   GIMLADSGQKGVSRELTNEIMTAMHAETGYQLMQKWNLPEIYCTIVRDHHKEQSDTSDV
FT                   LLTLVRLVDHACRKLGLGSPPEPNLMLAATFEAQGMGIKEIMLAELEITIEDAMEMVTV
FT                   TSAA"
FT   gene            complement(445783..447699)
FT                   /gene="pulE-2"
FT                   /locus_tag="Gbem_0368"
FT   CDS_pept        complement(445783..447699)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pulE-2"
FT                   /locus_tag="Gbem_0368"
FT                   /product="type II secretion system ATPase PulE"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37399"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR007831"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037257"
FT                   /db_xref="UniProtKB/TrEMBL:B5EAU0"
FT                   /protein_id="ACH37399.1"
FT                   /translation="MESHGNYKLEADRKEGMDDSGLEIAALLMKSGYLADTQLSYAQRV
FT                   KAKLLSPRTLVGVLLELGFFTREQLRETLRSNMVSVKLGALLVELGYLKPGELQAALGI
FT                   QRDGENCKMLGEILVEQRFIEEYTLAEVLAFQLGFPFIDLDASSIDRALLGRVPQHWLA
FT                   QHSFVPVKEEEGKVLVAIADPLNLEGRKTAEKLFGQNTTSFAICTMKAIRDALSLLKRG
FT                   MVQGDGTATDEHTVTGIVNSIFEEALKEGASDIHIEPMRSALRVRFRRDGMLVLYKDFA
FT                   RELALPISSRIKVMAEADIAERRRHQDGRICYESAKSGNTLDMRVSFYITIHGEKIVLR
FT                   LLSMKAELLDLKEIGMSGRMLERFIDDALDTPSGVLIVTGPTGSGKTSTLYSCVHHLND
FT                   LNTSIVTAEEPVEYVIEGIAQCSINQKIGVTFEETLRHIVRQDPDVIVLGEIRDSFSAE
FT                   TAIQAALTGHKVLTTFHTEDSVGGLLRLMNMNIEAFLIASTVVCVLAQRLLRRICPECS
FT                   ESYLPTPTELRRIGYSNADLRGAEFRIGRGCAKCRYSGYRGRVGVFEMLILNELVKDAI
FT                   LSKKTSYEIRKISTESTGMVTLLESGLCKAAAGLVSLHDTVRLLPRIGKPRPISEIRRL
FT                   LGD"
FT   gene            448068..448778
FT                   /locus_tag="Gbem_0369"
FT   CDS_pept        448068..448778
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0369"
FT                   /product="Smr domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37400"
FT                   /db_xref="InterPro:IPR002625"
FT                   /db_xref="InterPro:IPR036063"
FT                   /db_xref="UniProtKB/TrEMBL:B5EAU1"
FT                   /protein_id="ACH37400.1"
FT                   /translation="MKKKEKPKQKQKEFSASPFKALKGAALDLSAEAQPQAPAPQKPQK
FT                   SAPNLSDELLFLDAVADVRPLRATAVTPAKANANAKAHGAARREREEEEQRAFLQALDQ
FT                   LKLDVRFQDEFAEPESPDRPAPVNRLRQIRRGGIRIDLQLDLHGLTREEALENLDRFVK
FT                   GAYNRGQKGVLVITGKGNNSAGEPVLKSAVAGWLREKGKGMVSEFIQAPNDMGGSGAVV
FT                   VFLKEKKAPEPEQG"
FT   gene            448810..449723
FT                   /gene="mak"
FT                   /locus_tag="Gbem_0370"
FT   CDS_pept        join(448810..449244,449244..449723)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mak"
FT                   /locus_tag="Gbem_0370"
FT                   /product="D-fructose 6-kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ADO00763"
FT                   /db_xref="GOA:E1P668"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="UniProtKB/TrEMBL:E1P668"
FT                   /protein_id="ADO00763.1"
FT                   /translation="MPASEPYRIGVDLGGTKTEVVVLDPQDGVVFRERRKTPLVEGYHA
FT                   VLNCVADLVRDGACRVPAANSCTVGIGIPGSVDAVSGMVRNANSVCLIGRPLQADLERL
FT                   LGRRIGVRNDADCFAMAECRKGAGAGYGLVFGVIMGTGCGGGICVDGVVREGPHRICGE
FT                   WGHFSLDPSGPPCYCGNRGCIETKISGSGVEAAFAARYGESLSMKEIVTGARLGDPRCA
FT                   TAFNAFLDDFGRSLGGVISILDPDAVVLGGGLSNIDELYLAGVERVRHYAFHNDLRTPI
FT                   LKHMLGDSAGVFGAAWIGTGSAP"
FT                   /artificial_location="low-quality sequence region"
FT   gene            449872..450291
FT                   /locus_tag="Gbem_0372"
FT   CDS_pept        449872..450291
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0372"
FT                   /product="peptidylprolyl cis-trans isomerase, FKBP-type"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37401"
FT                   /db_xref="GOA:B5EAU2"
FT                   /db_xref="InterPro:IPR001179"
FT                   /db_xref="UniProtKB/TrEMBL:B5EAU2"
FT                   /protein_id="ACH37401.1"
FT                   /translation="METQPGKRVNIRYKCKLDDGRVYLVGERNTLEFLVGSGRVPKSLE
FT                   AGLLGMQQGDHRVVRVPAAEAELFPFPKGSHFAFSTGGAPGIAYDFGPGAGGDVSHSIP
FT                   GNRDYREPLPAGTDVLFEVEMLSVKDEVTASPGRS"
FT   gene            complement(450266..450562)
FT                   /locus_tag="Gbem_0373"
FT   CDS_pept        complement(450266..450562)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0373"
FT                   /product="protein of unknown function DUF77"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37402"
FT                   /db_xref="InterPro:IPR002767"
FT                   /db_xref="InterPro:IPR029756"
FT                   /db_xref="UniProtKB/TrEMBL:B5EAU3"
FT                   /protein_id="ACH37402.1"
FT                   /translation="MKVLVDLCVVPLGVGVSVSSYIAACEKVLTEAGLKIALHSYGTNI
FT                   EGEWDEVFAAIKRCHEVVHGMGAPRITTTIKLGTRTDRNQSMEDKIRSVREKL"
FT   gene            450779..451711
FT                   /locus_tag="Gbem_0374"
FT   CDS_pept        450779..451711
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0374"
FT                   /product="SDR_a2 family oxidoreductase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37403"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B5EAU4"
FT                   /protein_id="ACH37403.1"
FT                   /translation="MSTSNSKKPMVLVTGATGFIGRRLVAALAEEGIPVRCLVRNVESP
FT                   VPACGEVVQGDLLQSDTLDRALEGIETAYYLVHAMSGDRAGFERRDREAAENFVAAAAK
FT                   QGLRRVIYLGGLGDEKDDLSEHLASRLEVARILQGGPFKTTYLRAAVIIGAGGASFEMI
FT                   RALVERLPVMITPRWVSTRCQFIAVGDVIAYLVGCLLHEQTAGKTYDIGGPEILSYREM
FT                   MERFAEIEKKFIKILPVPFLTPKLSSYWVWLVTPIKPSISAPLIEGLGVEVVCRDDKIR
FT                   EIIPLKLTSYDDAVRIALEEESAPPKESS"
FT   gene            451879..452277
FT                   /gene="cheY34H-2"
FT                   /locus_tag="Gbem_0375"
FT   CDS_pept        451879..452277
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cheY34H-2"
FT                   /locus_tag="Gbem_0375"
FT                   /product="response receiver CheY associated with MCPs of
FT                   class 34H"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37404"
FT                   /db_xref="GOA:B5EAU5"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:B5EAU5"
FT                   /protein_id="ACH37404.1"
FT                   /translation="MNCLIVEDNEFSREALRLFLAPHAEIELAADGQEGVELFQNALAR
FT                   GNRFDLVLLDVVMPKLDGQQALKLMRQAEKDYAVTEKQKAVIIMTTALTSAEQMQQALW
FT                   DGDCTDYLVKPIVRADLLALLRRYRLLV"
FT   gene            452313..453029
FT                   /locus_tag="Gbem_0376"
FT   CDS_pept        452313..453029
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0376"
FT                   /product="PilZ domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37405"
FT                   /db_xref="GOA:B5EAU6"
FT                   /db_xref="InterPro:IPR009875"
FT                   /db_xref="UniProtKB/TrEMBL:B5EAU6"
FT                   /protein_id="ACH37405.1"
FT                   /translation="MEPYYYRENIRKTLEEDSAEIAAGFIDIIKGNLRVQLKLVNYFKG
FT                   LPISYPATPVEMAGCVLELDVHPQQAVALEQTGSTFIKCSYFDRPMLADVKDADVRRMM
FT                   ASLFNFRFVEILAEQRVSLRLKLEPPCDAQIVGAGGPVDGKVLDISLGGVSIRTSGPSN
FT                   LRESDEVALKLMVPNLLQSGGTSLEVRSTVVAVGSEEEGEVCRFSIELDPHVEGVISRF
FT                   IFQRQVDLIRELKEQS"
FT   gene            453072..453776
FT                   /locus_tag="Gbem_0377"
FT   CDS_pept        453072..453776
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0377"
FT                   /product="cytidylate kinase-like domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37406"
FT                   /db_xref="GOA:B5EAU7"
FT                   /db_xref="UniProtKB/TrEMBL:B5EAU7"
FT                   /protein_id="ACH37406.1"
FT                   /translation="MPDNLFIPSVDLRIGSLEEYNRRQKEKASLRHAKAKPRPCITISR
FT                   EYGCTGYPTAELLRERLMQRTGDEWVLIDKAVLEEVAKRHNLSEEILQTLGAENRILDE
FT                   ILATFSPRWKSSYDYFLPLSRHVVALAEQGNVIILELGGAIISRHIENSYHFRLFGSAH
FT                   FKTATLASRLGLESEPAEKLMHKQQKARDHFTRDFLNQDDHDPVLYDLLFNNDRCPTDR
FT                   IAHAIADFVLAR"
FT   gene            complement(453811..454425)
FT                   /locus_tag="Gbem_0378"
FT   CDS_pept        complement(453811..454425)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0378"
FT                   /product="response regulator"
FT                   /note="domains: REC"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37407"
FT                   /db_xref="GOA:B5EAU8"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:B5EAU8"
FT                   /protein_id="ACH37407.1"
FT                   /translation="MVKKKLLVVDDTPENLIILYKILRKEYEVLGANSGKEALLALAEN
FT                   RPDLILLDVMMPEMDGLEVCRILKDDSRYRDIPVIFVTALSDEVDESRGFKAGAVDFLS
FT                   KPVNPVILSHRVAVHLELQSQKEALTRKNQELQEALSRVKELSGLLPICMTCKKIRDDQ
FT                   GYWNQLESYISLHSEALFSHGYCPECAAAAMKKILPVPNLR"
FT   gene            complement(454465..456408)
FT                   /locus_tag="Gbem_0379"
FT   CDS_pept        complement(454465..456408)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0379"
FT                   /product="sensor histidine kinase response regulator, PAS
FT                   domain-containing"
FT                   /note="domains: PAS, HisKA, HATPase_c, REC"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37408"
FT                   /db_xref="GOA:B5EAU9"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B5EAU9"
FT                   /protein_id="ACH37408.1"
FT                   /translation="MDESRDNHSFAFLEQKVEERTRELKQEIQERLRAEGQLAEARDHY
FT                   LNILAEAPALIWRADTQAKCDWFNHTWLSFTGRTMEEEYGDGWAQGVHPDDLERCVAIW
FT                   LGAFHQKAPFEMEYRLRRHDGVFRWILDIGRPFSGLDGSFAGYIGYCFDITDRKGAEME
FT                   LVLAREAAEAASKAKTEFLANMSHEIRTPMNSIIGMTQLLAYTELSAEQKEYVEGILTS
FT                   SEGLLAIINDILDLSKVEAGKIELESRNFSLRQSINEIIRTQTAAAHEKGLQLKVSIPE
FT                   EIPDAVVGDRLRLKQVLLNIIGNAIKFTASGSIAVTVALAEKKEEAARITFSVTDTGIG
FT                   IAPESLDRIFAPFAQEDTSTTRRYGGTGLGLSISTKLVRLMGGRIWAESRKNAGSTFHF
FT                   EIPFRLCAKKARPKASLNTAKKAVWDGAKLRILLADDQEMNRNIMEKLLGRLGHDLESA
FT                   ADGGEALGKWEKGNFDLILMDVEMPGIDGTEATRVIRETETPLGKRTPIIALTAHALKS
FT                   HQEMLLGLGYDGYVPKPVEIPTLLQEMKRCLHLPDLDTAGNGDAADGVPMTPAANQLGT
FT                   VDRQQLADILTAVSSLLRQRNMKVIDKVNDLSALIPGSPLLEQLNQQIRQFDCQSALNT
FT                   VGQILLNYDIHS"
FT   gene            complement(456729..457259)
FT                   /gene="hycP"
FT                   /locus_tag="Gbem_0380"
FT   CDS_pept        complement(456729..457259)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hycP"
FT                   /locus_tag="Gbem_0380"
FT                   /product="periplasmically oriented, membrane-bound
FT                   [NiFe]-hydrogenase maturation protease"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37409"
FT                   /db_xref="GOA:B5EAV0"
FT                   /db_xref="InterPro:IPR000671"
FT                   /db_xref="InterPro:IPR023430"
FT                   /db_xref="UniProtKB/TrEMBL:B5EAV0"
FT                   /protein_id="ACH37409.1"
FT                   /translation="MPLRQNSSPRILVLGIGNTIMSDDGVGAKVVQELQREFHFPSGVD
FT                   VVDGGTMGLDLLPLLEGRSHVIMVDAVETGKRPGSCVRLTGEELPSALEAKLSPHQIGL
FT                   KDLLGVAQLTGHAIPELVLIGVQPKSIAVGSELTAEVNLQMETMKGAVLKELERIGAHV
FT                   KPLAKSSPFRWDQ"
FT   gene            457840..458673
FT                   /locus_tag="Gbem_0381"
FT   CDS_pept        457840..458673
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0381"
FT                   /product="fibronectin type III domain lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37410"
FT                   /db_xref="InterPro:IPR003961"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR036116"
FT                   /db_xref="UniProtKB/TrEMBL:B5EAV1"
FT                   /protein_id="ACH37410.1"
FT                   /translation="MKKLMVIVTLLVTSLLFGCGGGGGGSGSSSNNNNSDTASNSADSG
FT                   TGGSTGGTANPAGGTGDSAAGANGGGAGDTGATPVQSPAAAIPGAPTEVMLQPGNGQVT
FT                   LSWNPVADATSYNVYWSTASGAALSQGARKTGVVSPCLVTGLQNGTTYYFVVTAANQYG
FT                   ESRASAEMSAAPAVFFVAEMVSGKSFDYTFSTGAAGTVSFSADGTFTGQNLSVGMPLTG
FT                   QWVIKDGVLTCVYPGGITETLTLISSTSTSFIVTYFVTYADGSSSNSVEGTFVMK"
FT   gene            complement(458805..459440)
FT                   /locus_tag="Gbem_0382"
FT   CDS_pept        complement(458805..459440)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0382"
FT                   /product="PEP motif-containing protein, putative exosortase
FT                   substrate"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37411"
FT                   /db_xref="InterPro:IPR013424"
FT                   /db_xref="UniProtKB/TrEMBL:B5EAV2"
FT                   /protein_id="ACH37411.1"
FT                   /translation="MKTRITNMLRLSFAAVSALAILWTAVPAGATFVVDPNPGGISFYL
FT                   NNEMISPNHFTGNVGGNDISYPAIDVVTMGAVTVASGYANIKQSGTDLLTSLTFTPLGE
FT                   EKYGDFSFRGQLVSAGTIQVNVTNQNGVNTGLTFDIDQARRNFERIGIVSPDGDWIDAV
FT                   NISFAEGFEQVKQIDFSPQAAPIPEPSTFILLAFGLAGVGLLRKRSKA"
FT   gene            459883..461985
FT                   /gene="mcp40H-27"
FT                   /locus_tag="Gbem_0383"
FT   CDS_pept        459883..461985
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mcp40H-27"
FT                   /locus_tag="Gbem_0383"
FT                   /product="methyl-accepting chemotaxis sensory transducer,
FT                   class 40H, DUF3365-containing, heme-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37412"
FT                   /db_xref="GOA:B5EAV3"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR021796"
FT                   /db_xref="InterPro:IPR025991"
FT                   /db_xref="UniProtKB/TrEMBL:B5EAV3"
FT                   /protein_id="ACH37412.1"
FT                   /translation="MSMLGSGLSTKITICVAVALIVSFVANIAYFSVNTRNEAYEAVKS
FT                   KARAVLLQAESSRNFMASLRSNKAFNEVELKSAFDDKLKSATDKVAAARETVFFNTIPI
FT                   IAAMKIAGEHASESGFKLKVPKVQARNKQNEPDSTELVLLDRLQKENLPELFMVDKASN
FT                   VIRYLRPIKLTGECLVCHGVPSDTLNKDGLDLLGMKAEGWKAGEQHGAYEILDDLGAIE
FT                   TAIRHKLLVSFAITFVITLASILLLIWMTKAVIIRPLRTIVVRMQQVADGDLSSVSEEL
FT                   RNDEVGELSRSIHGAVDKMRTTLTTVLESSCHVATAVGTVYATSEEIAIGADEVAIQAS
FT                   TVATAGEEMAATSCDIASNCQMAAEGARAATGEATEGAEIIRSSIDIMSRIADQVRASA
FT                   NTVASLGNRSDQIGEIVGTIEDIADQTNLLALNAAIEAARAGEQGRGFAVVADEVRALA
FT                   ERTTRATHEISGMIKAIQQETKDAVQAMNEGVREVEQGTAQATHSGEAIERILNLINDL
FT                   GMQVNQIATAAEEQTATTGEISSNMTRINDIGRSVAGHAHTSALQAGHLNAGAEALLSS
FT                   LGKFKLNESDRLVLRKAKSAHMIFVGKIRAHLHGAQTVDHNLLPTHLTCAFGKWYQGDG
FT                   QSSCGQFDLFKKIDAPHAKVHELGKQAIIAHNSGDKAKAGQCCDEMVEASMHLIGILDN
FT                   LAAQCK"
FT   gene            462344..463270
FT                   /locus_tag="Gbem_0384"
FT   CDS_pept        462344..463270
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0384"
FT                   /product="type I glutamine amidotransferase-like domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37413"
FT                   /db_xref="GOA:B5EAV4"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR032633"
FT                   /db_xref="UniProtKB/TrEMBL:B5EAV4"
FT                   /protein_id="ACH37413.1"
FT                   /translation="MSKKILVILSEWGFWGEELVGPLEVLQSRNYKPVLCTPTGRRPRA
FT                   LPPSMDPGYKDPPLGKTVATPEMAEKVRRLDDPSNPYLANQRSLKAMLPERPYWSDLGE
FT                   LGYPDERGQMKMSYYPLRKWEGYCRARAQAQQALVEEFEALLLVGGSGPMIDLVNNYRV
FT                   HDAILAFKQADKPIAAECYGVACLAKARNFDDPRSIIWGKHVTGHPQEYDYRDLAGVLD
FT                   PETGAMLSREAGNPDRWVNFGPPFYTLEHILRDATGPEGGVHGSVGRPHSVIVDYPLIT
FT                   GRSTADSYTTGEKLVEVLEKGLRRYGW"
FT   gene            complement(463373..463448)
FT                   /locus_tag="Gbem_R0009"
FT   tRNA            complement(463373..463448)
FT                   /locus_tag="Gbem_R0009"
FT                   /product="tRNA-Asn"
FT   gene            complement(463718..464044)
FT                   /pseudo
FT                   /locus_tag="Gbem_0385"
FT                   /note="transposase, ISL3 family; N-terminal fragment"
FT   misc_feature    464301..464381
FT                   /note="conserved nucleotide sequence; Gbem_R0166"
FT   gene            464384..464818
FT                   /gene="mscL-1"
FT                   /locus_tag="Gbem_0387"
FT   CDS_pept        464384..464818
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mscL-1"
FT                   /locus_tag="Gbem_0387"
FT                   /product="large-conductance mechanosensitive channel
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37416"
FT                   /db_xref="GOA:B5EAV7"
FT                   /db_xref="InterPro:IPR001185"
FT                   /db_xref="InterPro:IPR019823"
FT                   /db_xref="InterPro:IPR036019"
FT                   /db_xref="InterPro:IPR037673"
FT                   /db_xref="UniProtKB/TrEMBL:B5EAV7"
FT                   /protein_id="ACH37416.1"
FT                   /translation="MLKEFKQFALKGNVLDLAVAVVLGAAFGKIVSSFVSDILTPPIGK
FT                   LLGNIDFSSLFLNLTSTPIRSVAEAKALGAPVIAYGLFLNAVFDFIIIAFALFLLVRQV
FT                   SKMLPPPTPPVATKECPHCCTMIPVKASRCPNCTSSQSEA"
FT   gene            464838..466217
FT                   /locus_tag="Gbem_0388"
FT   CDS_pept        464838..466217
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0388"
FT                   /product="peptidoglycan-binding outer membrane protein,
FT                   OMP_b-brl, OmpA and OmpA domain-containing"
FT                   /note="domains: OMP_b-brl, OmpA, OmpA"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37417"
FT                   /db_xref="GOA:B5EAV8"
FT                   /db_xref="InterPro:IPR006664"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR006690"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="InterPro:IPR027385"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="UniProtKB/TrEMBL:B5EAV8"
FT                   /protein_id="ACH37417.1"
FT                   /translation="MKKYLQLVLVPALLLGLFTQSYAEVKPESFSVSPYVAGYSFFGRE
FT                   RLETGPAVGLRGGYNFTSHFGMEAVLTYISTEGKDGSGIGDVDALNYHLDMLYHFMPEN
FT                   TLVPYLAMGYGGHWRDYEGDGEVNRSAFNYGGGVKYFLTDAMALRGDVRHIIMKDRDET
FT                   FHDLEYGLGVDFIFGGAKAAPAVAAAPVAAPVVQPPAAEAPLEPVPAAEPAPGHYKYCV
FT                   TLQGEFDIDKAEIRPEYRDEVATVGKFMKQYPTTTAVIEGHTDNVGDPQYNLDLSKRRA
FT                   QAVVDYLVDNYGIERSRLEARGFGMARPIATNNTDEGRQANRRIEAIIDCAFDVKEVQP
FT                   PDRLCMTLLLEFDSGKADIKPQYRDEMAKVGEYMNKYPTTTAVIEGHTDNVGGSDYNMK
FT                   LSQRRAENAVQYLVQNFGIDKSRLSAKGYGYTRRIAYNSTPEGRAKNRRINAVIDCVIK
FT                   K"
FT   gene            complement(466429..467082)
FT                   /locus_tag="Gbem_0389"
FT   CDS_pept        complement(466429..467082)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0389"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37418"
FT                   /db_xref="UniProtKB/TrEMBL:B5EAV9"
FT                   /protein_id="ACH37418.1"
FT                   /translation="MLKLDYTIARKFEELAEKGKKVNSSQQINDIAAVVDSKLFQDWAN
FT                   SALSLLQQVFGEESAYYRNFEAIYAKIINITYKESFDNCRAIVQSARTEFERGGLTEVK
FT                   LFLDHAVLEYLGGRTLDFLRRGELATASILASVLLEQALTLICGSNSIPAGDLSKMNEA
FT                   LYQAKVYQVGTYQRVKDWCYMKEDFIAGDGSRYRTADVEDMLRGVQKFIAKEIG"
FT   gene            complement(467172..467753)
FT                   /locus_tag="Gbem_0390"
FT   CDS_pept        complement(467172..467753)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0390"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37419"
FT                   /db_xref="UniProtKB/TrEMBL:B5EAW0"
FT                   /protein_id="ACH37419.1"
FT                   /translation="MTTLNLTGELERLIRDITARTPQLQHVIPDKLLVCVSTGRTTRGG
FT                   SLAKIHPLRFAGGERSVKARRGRRSVLCTMPTIKHQGEEMLYVIYFLVPRFLELPQREK
FT                   LITIFHELYHISPACDGDIRRFPGRNYAHGSSTKSYNLLMGKLVDAYLELIPEPSALDF
FT                   LEGDLASLRTRHKAIVGRRLQAPRISITPA"
FT   gene            complement(467755..468048)
FT                   /gene="dhc2"
FT                   /locus_tag="Gbem_0391"
FT   CDS_pept        complement(467755..468048)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dhc2"
FT                   /locus_tag="Gbem_0391"
FT                   /product="cytochrome c"
FT                   /note="2 heme-binding sites"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37420"
FT                   /db_xref="GOA:B5EAW1"
FT                   /db_xref="InterPro:IPR036280"
FT                   /db_xref="UniProtKB/TrEMBL:B5EAW1"
FT                   /protein_id="ACH37420.1"
FT                   /translation="MRIGKKDWFFIIIIAAVFGTFYLISGEETTKRVPLDNNHKASYEI
FT                   FKKTGSKIEADKGCPACHYEPGGVPFPAKHPVKPKDGPSRCLFCHKLRLAGV"
FT   gene            complement(468142..468912)
FT                   /locus_tag="Gbem_0392"
FT   CDS_pept        complement(468142..468912)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0392"
FT                   /product="(R)-2-hydroxyacyl-CoA dehydratase-radicalizing
FT                   ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37421"
FT                   /db_xref="InterPro:IPR002731"
FT                   /db_xref="InterPro:IPR008275"
FT                   /db_xref="UniProtKB/TrEMBL:B5EAW2"
FT                   /protein_id="ACH37421.1"
FT                   /translation="MPDKLKIGIDLGSRKAKFALMRGANIVRLADLDTISFYKKYGSMV
FT                   NDELSLDLLGSGIFTAEELAEAEITVTGYGRNSINLHGARVISEIKAHVAGARTQTGLA
FT                   NFTLLDMGGQDTKVAQVVGGRLTDFVMNDKCAASSGRYLENMAAVLEVSLEELSSHSAD
FT                   PVALDATCGIFGESELIGQILRGYAPERLCAGVNLTLVKRVMPMLKRFPSDTLVITGGV
FT                   ALNRAMVTLLRQQCGMQVVIPEHPQHNGAIGCAS"
FT   gene            complement(469074..470057)
FT                   /locus_tag="Gbem_0393"
FT   CDS_pept        complement(469074..470057)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0393"
FT                   /product="(R)-2-hydroxyacyl-CoA dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37422"
FT                   /db_xref="InterPro:IPR010327"
FT                   /db_xref="UniProtKB/TrEMBL:B5EAW3"
FT                   /protein_id="ACH37422.1"
FT                   /translation="MRRVGFTTTIPLEVLIAAGVVPIDLNNVFITHHDNASLIEDAELT
FT                   GFPRNVCAWIKGIYGAVVQSGVTELIAVTEGDCSYTKALMEVLSLNGVHVYPFAYPAGR
FT                   EAVPLKKEIEKLMGQFGVDWDHVGEAKKRLDRIRAKVHEIDRLSWQEDKVTGEENHYFQ
FT                   VCTSDMNGDPDAFEAEVDAFIAAAAVRAPRHERLRLAFLGVPPIISGLYGFLEEVGARV
FT                   VFNETQRQFSMPFGIEDLVEQYRAYSYPYDIFHRLADISREIEKRRIDGVIHYVQSFCF
FT                   RQIEDMVLRKSIKLPIMTLEGDKPGAIDARTKIRVEGFLELLEDRD"
FT   gene            complement(470061..470399)
FT                   /locus_tag="Gbem_0394"
FT   CDS_pept        complement(470061..470399)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0394"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37423"
FT                   /db_xref="GOA:B5EAW4"
FT                   /db_xref="UniProtKB/TrEMBL:B5EAW4"
FT                   /protein_id="ACH37423.1"
FT                   /translation="MDKEAVVQKTVETLAPFETANLVHLIKTLTVKSAMSNPWIIGAFL
FT                   VIAFYAIVVRSKFVLSMLFAAVSLLLLLRYTLPTEGDTLSVSSTLPFAFGGLAIGAVLI
FT                   YLNFIKTE"
FT   gene            470541..471632
FT                   /gene="gcvT"
FT                   /locus_tag="Gbem_0395"
FT   CDS_pept        470541..471632
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gcvT"
FT                   /locus_tag="Gbem_0395"
FT                   /product="glycine cleavage system T protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37424"
FT                   /db_xref="GOA:B5EAW5"
FT                   /db_xref="InterPro:IPR006222"
FT                   /db_xref="InterPro:IPR006223"
FT                   /db_xref="InterPro:IPR013977"
FT                   /db_xref="InterPro:IPR027266"
FT                   /db_xref="InterPro:IPR028896"
FT                   /db_xref="InterPro:IPR029043"
FT                   /db_xref="UniProtKB/TrEMBL:B5EAW5"
FT                   /protein_id="ACH37424.1"
FT                   /translation="MEDLKATPLQAHHEGLKALMAPFGGWLMPIQYEGIIAEHRWCREK
FT                   AALFDICHMGEFRFRGDIQAGGLEDVFTFSVKGIPIGRSRYGFLLNPSGGVIDDLIVFR
FT                   LAEDEVMIVVNAATAPNDFKVIASRLKEPAQLVDISVQTGKLDLQGPLSREVLVEHLGS
FT                   ELGALPFFKFTRTRVLGEDAIVSRTGYTGELGYEIFLPSGKTAELWELLLKDPRVAPAG
FT                   LGARDLLRLEMGYSLYGNDIDEKISPIAAGLTAFVNLDKDFVGKDALLKERETGPENVK
FT                   VAFRVDSRRSPRHFYEILHQGAQVGMVTSGAFSPMLSCGIGMGYVKPEAAALGTRLTIK
FT                   HERVEMEAQVVELPFYTGGSLRA"
FT   gene            471755..472126
FT                   /gene="gcvH"
FT                   /locus_tag="Gbem_0396"
FT   CDS_pept        471755..472126
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gcvH"
FT                   /locus_tag="Gbem_0396"
FT                   /product="glycine cleavage system lipoyl carrier protein
FT                   GcvH"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37425"
FT                   /db_xref="GOA:B5EAW6"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR002930"
FT                   /db_xref="InterPro:IPR003016"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR017453"
FT                   /db_xref="InterPro:IPR033753"
FT                   /db_xref="UniProtKB/TrEMBL:B5EAW6"
FT                   /protein_id="ACH37425.1"
FT                   /translation="MAKFFTKEHEWVEMDGAQAIVGISEHAAHELGDITFVELPKIGKS
FT                   VKQFDTLAGIESVKAASDIYAPVSGKVAQVNDKLEDAPELVNQGAESEGWICRLEGVDA
FT                   SELGALLDAAAYAKYLEGL"
FT   gene            472129..473466
FT                   /gene="gcvP1"
FT                   /locus_tag="Gbem_0397"
FT   CDS_pept        472129..473466
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gcvP1"
FT                   /locus_tag="Gbem_0397"
FT                   /product="glycine cleavage system P protein, subunit 1"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37426"
FT                   /db_xref="GOA:B5EAW7"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR020581"
FT                   /db_xref="InterPro:IPR023010"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5EAW7"
FT                   /protein_id="ACH37426.1"
FT                   /translation="MGYCPNTPDEIREMLAVIGAGSIEELFAPIPAELRAKSFDLPPGM
FT                   SEFELMRIMREKAAAGGAEIVPFIGGGIYDHIIPAAVDHLSSRAEFYTAYTPYQPECSQ
FT                   GTLQALFEYQSVICRLTGMEASNASLYDGGTAVAEAALMSLRITERNRVVLDASINPLH
FT                   REIVTGYLHGLSAEAVEVAPDGCGSDLKRLIDSIDEETAAVIVQNPNFFGSVQDFSELA
FT                   VKAHEKGALLIISGYPIALGLVASPGEMGADIAVGDGQSLGNPLSFGGPYFGFIATRKR
FT                   FIRNLPGRIVGETIDNQGRRGYVLTLQAREQHIKRHKATSNICSNQSLCALRGLIFCAS
FT                   LGRKGFEELAVLNYDKAQYAKSRLTGVKGVSVMNAGTTFNEFTLSLPKDAAPVVEKLLA
FT                   CGVAAGVPLVQYYPGMDNALTVTVTEKRSKAEIDRLAALLEEALCS"
FT   gene            473457..474896
FT                   /gene="gcvP2"
FT                   /locus_tag="Gbem_0398"
FT   CDS_pept        473457..474896
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gcvP2"
FT                   /locus_tag="Gbem_0398"
FT                   /product="glycine cleavage system P protein, subunit 2"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37427"
FT                   /db_xref="GOA:B5EAW8"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR020581"
FT                   /db_xref="UniProtKB/TrEMBL:B5EAW8"
FT                   /protein_id="ACH37427.1"
FT                   /translation="MQLIFEKSVPGRNGVRVPLSDVPKASPFPDALRRKEPVLLPEVSE
FT                   LDLVRHYTNLSRRNFSVDTNFYPLGSCTMKYNTKVTENAGGLFAGCHPFLPLLPGGERL
FT                   VQGPLSLVHGLEQQLAEITGMDEVTTQPLAGAHGEMTGIMVIAAYHKARGDKKRKYVIV
FT                   PDSSHGTNPASAAMAGYEIVTIPTAPYGDMDLEQFKNAMNDEVAAVMMTCPNTLGLFNP
FT                   HIAEICAIAHQAGALTYYDGANLNAILGKVRPGDVGFDVIHVNLHKTFSTPHGGGGPGS
FT                   GPVGVKKGLIPYLPTPRVQRKGDGSFAVEAHPEGIGRVSDFFGNFAIMARAYAYITLLG
FT                   REGLIEVSEHAVLNANYIMARLKGEYELPFDQTCMHECVFSASRQLQDGVHAIDIAKYL
FT                   IDRGFHPPTVYFPLNVKEAIMIEPTETESKQTMDLFIDVMLEAARIAREDPEALHRAPV
FT                   TTPVGRLDETRAARAQQVCCE"
FT   gene            475091..475891
FT                   /gene="lplA"
FT                   /locus_tag="Gbem_0399"
FT   CDS_pept        475091..475891
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lplA"
FT                   /locus_tag="Gbem_0399"
FT                   /product="lipoate--protein ligase A"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37428"
FT                   /db_xref="GOA:B5EAW9"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="UniProtKB/TrEMBL:B5EAW9"
FT                   /protein_id="ACH37428.1"
FT                   /translation="MFTWRLIDTGPLEGPANMALDEALLNCFDKDRSQPLLRLYGWDPP
FT                   ALSVGRFQDAAAALKLDLCREEEVPVVRRMTGGGIIYHAQELTYSIVCAPGHIGGAAGV
FT                   KDGFRRLCAFLMGTYQKLGLEASFAADLNPDGERLGARTTFCFAGKEEFDIVVRGRKIG
FT                   GNAQRRVNGAILQHGSIPLVSRVQHGLRYLKEPAPGAAGAVSLAELGIAVEASQLKRTL
FT                   VESFQERLGVSLRPHPPTEAELGAAALLETRKYRNANWNLEGRT"
FT   misc_feature    475902..475954
FT                   /note="conserved palindrome; Gbem_R1012"
FT   gene            475972..476847
FT                   /gene="lipA"
FT                   /locus_tag="Gbem_0400"
FT   CDS_pept        475972..476847
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lipA"
FT                   /locus_tag="Gbem_0400"
FT                   /product="lipoate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37429"
FT                   /db_xref="GOA:B5EAX0"
FT                   /db_xref="InterPro:IPR003698"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5EAX0"
FT                   /protein_id="ACH37429.1"
FT                   /translation="MDPIRKPAWLQKKIIPAAHAEMEGLLKELRLNTVCQQARCPNITE
FT                   CFGKRQATFLILGRICTRLCSFCSVSKETPLPLEPGEAASVAEAVKRLGLSHVVITSPT
FT                   RDDLPDGGASVYAETVARIRSVSPATKVELLIPDFRGDWAALAAVVESAPDILGHNLET
FT                   VPRLYSIRSGADYRRSLDLLAQARRMAPGLNTKSGLMLGLGEEEAELFAVMEDLLKAGC
FT                   GYLSLGQYLAPSRMHHPVQRYVEPELFERYKERALTMGFEHVESAPYVRSSYHAENYLE
FT                   SKFPPPEGEG"
FT   misc_feature    complement(476866..476899)
FT                   /note="conserved palindrome; Gbem_R1105"
FT   misc_feature    complement(477028..477053)
FT                   /note="conserved nucleotide sequence; Gbem_R2104"
FT   gene            complement(477192..478250)
FT                   /gene="mtd"
FT                   /locus_tag="Gbem_0401"
FT   CDS_pept        complement(477192..478250)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mtd"
FT                   /locus_tag="Gbem_0401"
FT                   /product="mannitol dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37430"
FT                   /db_xref="GOA:B5EAX1"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR029752"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B5EAX1"
FT                   /protein_id="ACH37430.1"
FT                   /translation="MPNAKAYSAASATSPLASTTISRREPTERDVQIEILFCGICHSDL
FT                   HSVRNEWSSVMPTVYPIVPGHEIVGRVTKVGSAVTNFKPGDLAGVGCLVDSDQSCPHCH
FT                   ENLEQLCPNQVLTYNSPDRHLGGVTYGGYSESIVVDEHFVLHVPGNLELAGVAPLLCAG
FT                   ITTYSPIHRWGDIKGKKVGIVGLGGLGHMGVKFAHAFGAHVVVFTTSPGKKEDALRLGA
FT                   DEVIISTSAEEMKKHAGSFHFILDTIAADHDINAYLGMLTHDGNLTLVGAPETPLAVSA
FT                   FALLFGRRSLSGSIIGGIKETQEMLDFCGAHNITSDVEVIPIQRVNEAYERLLKSDVKY
FT                   RFSIDMASLKAE"
FT   gene            complement(478285..479292)
FT                   /locus_tag="Gbem_0402"
FT   CDS_pept        complement(478285..479292)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0402"
FT                   /product="oxidoreductase, aldo/keto reductase family"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37431"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:B5EAX2"
FT                   /protein_id="ACH37431.1"
FT                   /translation="MQKRILGKSGLEVSALGLGCMGMSFSYGPPKDKQEMIALLHAAVE
FT                   RGITFFDTAEVYGPYINEELVGEALSPLRDKVVIATKFGFDINPDKDPRGMKGAPALNS
FT                   RPQHIKEVAEASLKRLRIDAIDLFYQHRVDPDVPIEEVAGAVKELIQEGKVKHFGLSEA
FT                   GVQTIRRAHAVQPVAALQSEYSLWWRRPEEEVLPTLEELGIGFVPYSPLGKGFLTGKID
FT                   ASTTFDSTDFRTTLPRFTPEARQANQALVDLIGQIAARKQATPAQIALAWLLAQKPWIV
FT                   PIPGTTKLERLEENIGAVKLELSPGDLAEIGSAASKIQVEGARYPERLEELTGR"
FT   gene            complement(479801..480325)
FT                   /locus_tag="Gbem_0403"
FT   CDS_pept        complement(479801..480325)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0403"
FT                   /product="thioredoxin-related protein disulfide reductase,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37432"
FT                   /db_xref="GOA:B5EAX3"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B5EAX3"
FT                   /protein_id="ACH37432.1"
FT                   /translation="MKRQIPSKKFAAKIIPLALAGLLLSTQPAAAILQKGEAAPPIKLV
FT                   TTSGQPITLNNYKGYVLVMDFFATWCIPCKESIPHMNALRQKYGKQGLQVLGVSVDEGS
FT                   DREVRSFIGEKRISYPVAIAGEEMQTDYGLRSIPTVYVINKRGVVAEKFQGFSDQTAKA
FT                   MEDTIKRLLAE"
FT   gene            complement(480328..480657)
FT                   /gene="trxA"
FT                   /locus_tag="Gbem_0404"
FT   CDS_pept        complement(480328..480657)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trxA"
FT                   /locus_tag="Gbem_0404"
FT                   /product="thioredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37433"
FT                   /db_xref="GOA:B5EBG4"
FT                   /db_xref="InterPro:IPR005746"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B5EBG4"
FT                   /protein_id="ACH37433.1"
FT                   /translation="MASENVHTFTDDNFEKEVLQSNIPVLVDFWATWCAPCKAIAPLID
FT                   TIASEYDGRIKVGKVNVDDNPGTPAKYGVRGIPTVILLKDGKVVDQVVGAIPKAQLEAL
FT                   IKKAL"
FT   gene            480893..481567
FT                   /gene="cysG"
FT                   /locus_tag="Gbem_0405"
FT   CDS_pept        480893..481567
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysG"
FT                   /locus_tag="Gbem_0405"
FT                   /product="precorrin-2 dehydrogenase and sirohydrochlorin
FT                   ferrochelatase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37434"
FT                   /db_xref="GOA:B5EBG5"
FT                   /db_xref="InterPro:IPR006367"
FT                   /db_xref="InterPro:IPR028161"
FT                   /db_xref="InterPro:IPR028281"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B5EBG5"
FT                   /protein_id="ACH37434.1"
FT                   /translation="MRYYPINVDLHGQSVLIVGGGKVAARKAKRLLAAGARLTVVAPVL
FT                   VPALAELAEQGTLRHLERGYRHGDLAGAMLAFAATDDPQLNREVAAEAKERGILADVVD
FT                   APAQGAFTTPAVLEQGDLLITVSTGGASPALSRQIVTMIEPLFGPEYAEAVSLLGTVRE
FT                   KLLTEKVRNAYNDPVFAELAALNLPALIKNGQRDVIDQILLKLSATGARPGPDGADKKE
FT                   PS"
FT   gene            481564..482379
FT                   /locus_tag="Gbem_0406"
FT   CDS_pept        481564..482379
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0406"
FT                   /product="ResC/HemX-like cytochrome c biogenesis membrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37435"
FT                   /db_xref="GOA:B5EBG6"
FT                   /db_xref="InterPro:IPR002541"
FT                   /db_xref="InterPro:IPR003557"
FT                   /db_xref="InterPro:IPR017562"
FT                   /db_xref="UniProtKB/TrEMBL:B5EBG6"
FT                   /protein_id="ACH37435.1"
FT                   /translation="MNALLFNSTLVIYAVATVIYLAYLVKPKQSLGRAGFWLTVAGFVV
FT                   HLGFTLNRFLEAGHTPITNLHESLSFFSMATVGIFIMFERRYKASILGSFVMPLALLIL
FT                   AISATFSAVIPPLNPALKSKWLAIHTIMAFLGYAAFAISFGVSVMYLIQSHFLKKRRLG
FT                   PMFQKLPPLDMLDDISYRCLTFGFPLLTFAIISGAIWAETAWGTYWSWDPKETWSLITW
FT                   FIYAALLHGRLTTGWRGRKAAMLSIFGFVIMLFTFLGVNLLLSGLHSYK"
FT   gene            482440..483744
FT                   /gene="hemA"
FT                   /locus_tag="Gbem_0407"
FT   CDS_pept        482440..483744
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemA"
FT                   /locus_tag="Gbem_0407"
FT                   /product="glutamyl-tRNA reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37436"
FT                   /db_xref="GOA:B5EBG7"
FT                   /db_xref="InterPro:IPR000343"
FT                   /db_xref="InterPro:IPR006151"
FT                   /db_xref="InterPro:IPR015895"
FT                   /db_xref="InterPro:IPR015896"
FT                   /db_xref="InterPro:IPR018214"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036343"
FT                   /db_xref="InterPro:IPR036453"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5EBG7"
FT                   /protein_id="ACH37436.1"
FT                   /translation="MNIIVVGLSHKTAAVEIREKVAFAPTQMEKPLQAVVALPDITEAV
FT                   IVSTCNRVEIYATTRDVAGGMARIKRFLADYHNVPLELLEKHLYSYHGEDATRHVFRVA
FT                   SSLDSMVVGEPQILGQIKTSYGYAAEYKSSGIILNRFLHKAFSVAKRVRTETKIASSAV
FT                   SVAFAAVELAKKIFGELSDKTVLLIGAGEMCELAAKHFINTGVRGVMVTNRTYERAEKL
FT                   AEEFDAKPVHFEALMETLPKADIILSSTGAPHFIIHEKDMEEVLRRRKHKPMFFIDIAV
FT                   PRDIDPKVNNVENCYLYTVDDLNGVVATNLEQRKVEAAKAEAIVEQEIGQFFKWLSSLE
FT                   VTPTIVALRTHFDEIRKAELSKTISGWKDLPPGAEKKLDALTNAIMNKLLHQPTSVLKR
FT                   IDQGNRNDLYVDALRNLFDLEVGGESQDNMMELED"
FT   misc_feature    complement(483882..483909)
FT                   /note="heptanucleotide repeats; Gbem_R7103"
FT   gene            483934..484890
FT                   /gene="hemC"
FT                   /locus_tag="Gbem_0408"
FT   CDS_pept        483934..484890
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemC"
FT                   /locus_tag="Gbem_0408"
FT                   /product="hydroxymethylbilane synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37437"
FT                   /db_xref="GOA:B5EBG8"
FT                   /db_xref="InterPro:IPR000860"
FT                   /db_xref="InterPro:IPR022417"
FT                   /db_xref="InterPro:IPR022418"
FT                   /db_xref="InterPro:IPR022419"
FT                   /db_xref="InterPro:IPR036803"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5EBG8"
FT                   /protein_id="ACH37437.1"
FT                   /translation="MALKELRIGTRASQLALWQANWVKSELEKRYPDMTVTLTKIKTIG
FT                   DKILDVPLAQVGGKGLFVKEIEEAMLRGEIDIAVHSMKDVPTEFPEGLGLYCITEREDP
FT                   RDAVISNGVKFADLPQGARIGTSALRRQAQLLKVRPDLEMVIIRGNVQTRMDKLKTEGL
FT                   DAVILAAAGLNRLGFADQITEMLPTDLSLPAIGQGALGIECNLSNQDVKDAISFFNSPD
FT                   TSRAVRAERALLWRCEGGCQVPIAAFGEVTGDQLKLTGFIASVDGKVSVKGVVTGPADD
FT                   CEKLGVKLAEQLLSEGGHAILAEVYQREVSREKEIPV"
FT   misc_feature    complement(484908..484943)
FT                   /note="nonanucleotide repeats; Gbem_R9007"
FT   misc_feature    484972..484997
FT                   /note="conserved nucleotide sequence; Gbem_R2105"
FT   gene            485161..486705
FT                   /gene="hemD"
FT                   /locus_tag="Gbem_0409"
FT   CDS_pept        485161..486705
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemD"
FT                   /locus_tag="Gbem_0409"
FT                   /product="uroporphyrinogen III C2,C7-methyltransferase and
FT                   uroporphyrinogen III synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37438"
FT                   /db_xref="GOA:B5EBG9"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR003043"
FT                   /db_xref="InterPro:IPR003754"
FT                   /db_xref="InterPro:IPR006366"
FT                   /db_xref="InterPro:IPR012409"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="InterPro:IPR036108"
FT                   /db_xref="UniProtKB/TrEMBL:B5EBG9"
FT                   /protein_id="ACH37438.2"
FT                   /translation="MSADMKNGYVYLIGAGPGDPGLITVKGRDCLTKAQVVMYDYLANE
FT                   ELLRLAPKGAELIYAGKVGGEHNREQSQINELLVQKALSGKIVARLKGGDSFIFGRGGE
FT                   ECEALVEAGIPFEIVPGITAAVGATSYAGIPLTHRGVTTSVAFVTGHEKKGKASSEIDW
FT                   EGLSLGSGTVVFYMGVTNLPHIACSMMEHGRAPQTPVALIRWGTRPEQEVLVGTLANIA
FT                   EKAKAAEFKAPAITVVGEVVNLRETLRWFDNRPLFGRSVLVTRGADQAGGFTSKLEQLG
FT                   ARAYCCPTIEITPPTDHSALDEAIEGLDSFNWIIFTSYNAVKYFFARLSEHNLDTRALG
FT                   RCRVCAVGPKTAAALAQYGIRADLIPSDYKAEGVIEIFSEMDMAGQWVLFPKGDRAREV
FT                   ITEELGRMGAQVIAPVAYANHTPDDIPAEALAALEDGRIDCATFTSSSTVQNLAAILGE
FT                   NRFLHLMQGVKVASIGPITSKTCRDLGLEVHMEPAEYTLDALAAEMIEYFRAGELR"
FT   gene            486824..487843
FT                   /gene="hemB"
FT                   /locus_tag="Gbem_0410"
FT   CDS_pept        486824..487843
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemB"
FT                   /locus_tag="Gbem_0410"
FT                   /product="porphobilinogen synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37439"
FT                   /db_xref="GOA:B5EBH0"
FT                   /db_xref="InterPro:IPR001731"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR030656"
FT                   /db_xref="UniProtKB/TrEMBL:B5EBH0"
FT                   /protein_id="ACH37439.1"
FT                   /translation="MFYPLYRARRIRGKEVFRNMVRETSLSANDLIYPMFSAFGKGIKK
FT                   EISSMPGIYQQSIENIVEEAQEVYELGVPAVILFGIPEQKDAMGTDAYSDTGIIQETIR
FT                   AIKKSVPKLAVITDVCMCEYTDHGHCGVIKNGDVDNDETLELLAKEALSHAKAGADMVA
FT                   PSDMMDGRVAAIRESLDNNGFNQIPLMSYAVKYASGYYGPFREAAESTPQFGDRRSYQM
FT                   DPANRLEAIREARMDVEEGADILMVKPGLPYLDIVREVRNEFNLPTAVYNVSGEYSMIK
FT                   SAAKMGWIDEDRVIMETMMSFKRAGADLILTYHSKEVAKLLRKGYEADISDRCGCGCR"
FT   misc_feature    complement(488008..488056)
FT                   /note="nonanucleotide repeats; Gbem_R9069"
FT   misc_feature    488065..488102
FT                   /note="nonanucleotide repeats; Gbem_R9008"
FT   gene            complement(488107..488439)
FT                   /locus_tag="Gbem_0411"
FT   CDS_pept        complement(488107..488439)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0411"
FT                   /product="cupin superfamily barrel domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37440"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:B5EBH1"
FT                   /protein_id="ACH37440.1"
FT                   /translation="MAEKKGVALGEKLNLVNLAGYQDGAVVSRTVIDKPVGTITAFAFD
FT                   AGEGLSEHTAPYDAFVQVLDGEAEINIDGTAHNVAAGEIIIMPANKPHSLRAVKPFKML
FT                   LVMIRA"
FT   gene            488542..489624
FT                   /locus_tag="Gbem_0412"
FT   CDS_pept        488542..489624
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0412"
FT                   /product="ribonuclease Z-related hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37441"
FT                   /db_xref="GOA:B5EBH2"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:B5EBH2"
FT                   /protein_id="ACH37441.1"
FT                   /translation="MPKPFRYLEPTFFAGLFDDPLLLVRVRPTGRALLFDCGKMHHLAK
FT                   RVYTSIDAIFISHAHMDHFMGMDSVVRHSHASPRTIDVFGPPGLAARMGHKFSCYDWNL
FT                   ADTFWGNFRVSEIDDGRISSTLFSGPDAFAASREGERSGVLYSNRHLTVTSAQCEHRIP
FT                   VLAYKVEEGAAFVIDDERMAEACVRKGAWLKDLEKLFRDGEMKGNPVRHLCVSGEEVEE
FT                   RLEPDAAALYQRIRKFEEPASIGYVTDIGYSEENMASLEGLVKGVTLLVCECAFLASEQ
FT                   TKARLSRHMSTADFNMMLDRLRPKYVLPMHFSKTYQRGSEPLYREIEPPPGVTVLKIPD
FT                   RLTPRPIMESEVPRPVELKT"
FT   misc_feature    complement(489624..489655)
FT                   /note="octanucleotide repeats; Gbem_R8001"
FT   misc_feature    489664..489695
FT                   /note="octanucleotide repeats; Gbem_R8002"
FT   gene            489753..490121
FT                   /gene="yciH"
FT                   /locus_tag="Gbem_0413"
FT   CDS_pept        489753..490121
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yciH"
FT                   /locus_tag="Gbem_0413"
FT                   /product="translation initiation factor-related protein
FT                   YciH"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37442"
FT                   /db_xref="GOA:B5EBH3"
FT                   /db_xref="InterPro:IPR001950"
FT                   /db_xref="InterPro:IPR005872"
FT                   /db_xref="InterPro:IPR036877"
FT                   /db_xref="UniProtKB/TrEMBL:B5EBH3"
FT                   /protein_id="ACH37442.1"
FT                   /translation="MKKTSSNNDAPVVYSSEFGRMCPGCGKPLKDCVCRKNASAPAGDG
FT                   VVRLRRETKGRGGKTVIVIAGLPLDADKLTALAGELKRRCGCGGTAKDGIIEIQGDHAD
FT                   VLLAELAKRGYKAKRAGG"
FT   gene            complement(490129..490326)
FT                   /locus_tag="Gbem_0414"
FT   CDS_pept        complement(490129..490326)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0414"
FT                   /product="S4 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37443"
FT                   /db_xref="GOA:B5EBH4"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:B5EBH4"
FT                   /protein_id="ACH37443.1"
FT                   /translation="MKIDTEFIKLDSFLKAVDAVCSGGEAKIIISEGMVSVNGEVELRR
FT                   GRKLRRGDKVQVEKKTFLVE"
FT   gene            490423..490986
FT                   /gene="efp-1"
FT                   /locus_tag="Gbem_0415"
FT   CDS_pept        490423..490986
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="efp-1"
FT                   /locus_tag="Gbem_0415"
FT                   /product="translation elongation factor P"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37444"
FT                   /db_xref="GOA:B5EBH5"
FT                   /db_xref="InterPro:IPR001059"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR011768"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013185"
FT                   /db_xref="InterPro:IPR013852"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR015365"
FT                   /db_xref="InterPro:IPR020599"
FT                   /db_xref="UniProtKB/TrEMBL:B5EBH5"
FT                   /protein_id="ACH37444.1"
FT                   /translation="MYTTNDFKKGLVIQLDGAPCVLVDVSFQSPSARGANTMVKTKYRN
FT                   LITSQVLEKTFRSGDKVDEADFERHKGQFLYADGGRGVFMDLETYEQFEMEEDNFSAIA
FT                   PFLLDGTEVQLGIFQERMVNVDLPMTVELVVTETAPAMKNATATAQTKEAVLETGLRLQ
FT                   VPPYLEAGEKIKVDTRDGRFISRA"
FT   gene            491187..491262
FT                   /locus_tag="Gbem_R0010"
FT   tRNA            491187..491262
FT                   /locus_tag="Gbem_R0010"
FT                   /product="tRNA-Phe"
FT   gene            491371..491814
FT                   /locus_tag="Gbem_0416"
FT   CDS_pept        491371..491814
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0416"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37445"
FT                   /db_xref="GOA:B5EBH6"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR018841"
FT                   /db_xref="InterPro:IPR036782"
FT                   /db_xref="UniProtKB/TrEMBL:B5EBH6"
FT                   /protein_id="ACH37445.2"
FT                   /translation="MNKPPRIEEVTVTVPAGLVIRWTTGETMQADIGDWMLRFALLEPL
FT                   KDSEVFKKARVGWYGHSVEWSEDIELGADHLYTRCKAQAGEPSPEEFNEWMKRNDLSLS
FT                   TAAEALGMTRRMITHYRTGSKRIPRNIWLACIGWETLKHKHAA"
FT   gene            complement(491894..492571)
FT                   /locus_tag="Gbem_0417"
FT   CDS_pept        complement(491894..492571)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0417"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37446"
FT                   /db_xref="InterPro:IPR025285"
FT                   /db_xref="UniProtKB/TrEMBL:B5EBH7"
FT                   /protein_id="ACH37446.1"
FT                   /translation="MIIPDRKEKYVCRACDNQCFHRPASNGKSFGKRSGTGSEWHYKTY
FT                   EVLQCEHCENVVLCIHHWTNPGPMIGDSYITKTEFFPPKQFWKKPLWFPKLSKAYQKIF
FT                   SEVYSALDSSLFILAATGIRTALDKVMVEKIGDIGRFETKVDRLVEKEIITPADKELLM
FT                   AVVNAGSASAHRGYSPTIKATTHMMEITEHIFYKLCFEQNKTADLLSKARTLRRATPGR
FT                   KKA"
FT   misc_feature    complement(492589..492653)
FT                   /note="conserved nucleotide sequence; Gbem_R0092"
FT   gene            complement(492693..493232)
FT                   /locus_tag="Gbem_0418"
FT   CDS_pept        complement(492693..493232)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0418"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37447"
FT                   /db_xref="GOA:B5EBH8"
FT                   /db_xref="UniProtKB/TrEMBL:B5EBH8"
FT                   /protein_id="ACH37447.1"
FT                   /translation="MEWNCPDCKTNNSEDITRCTCGYDIDRGSPSKSTTAESRIHAPKS
FT                   NNNIVRNPFVIGILILLTIIALFFMFAPSERVNSVKETWLRIRKDPAQICLDNARLKLL
FT                   DPDNARIISFSYVPEEFSYVLKYKSKNSYGAYVEGEYFCDAKGGPDDSIERLTKKIKAE
FT                   NAEREKTLNRAKPAAR"
FT   gene            complement(493324..493896)
FT                   /locus_tag="Gbem_0419"
FT   CDS_pept        complement(493324..493896)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0419"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37448"
FT                   /db_xref="UniProtKB/TrEMBL:B5EBH9"
FT                   /protein_id="ACH37448.2"
FT                   /translation="MTIPFKNVDAILFLAELNLQCDFAERAATRLQLARAGWLKETDSI
FT                   RMPPIEIFEACHQLLLASGVISKILFGAGVRAQNRGKLLRELMLLPELPLLAERSVRNS
FT                   YEHVDERLDKMTHKFLPGVKISPLSVSDNKPEPNEIILKRFSPKDMRIYFSEQFVDLMG
FT                   LISEIDSVRRGVNFGMANMNGRPEKVL"
FT   misc_feature    complement(493928..493996)
FT                   /note="conserved nucleotide sequence; Gbem_R5045"
FT   gene            complement(494038..495411)
FT                   /locus_tag="Gbem_0420"
FT   CDS_pept        complement(494038..495411)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0420"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37449"
FT                   /db_xref="GOA:B5EBI0"
FT                   /db_xref="UniProtKB/TrEMBL:B5EBI0"
FT                   /protein_id="ACH37449.1"
FT                   /translation="MRMTNQTDSIERALVAASAWLVEHGFQLNNREWASLILIGVLAAW
FT                   LLPQPHIRHSIRSVIRSAMSPKLLIIWISYVLWIALFVFLAQWQCLWDQSLTKDTVVWA
FT                   VTVGFVSLAGFTDAHKPGFFSRAVWKTAGISVLMEYLVNLSAFPLFVEIILQPVIIVFS
FT                   TAPVLIKTSDEKKKWQGWSSRFFLILAAALLGNTAISLSSAWDSIDFRLFVLRAGWPVG
FT                   LGLWVLLLVFLWSLVSSYEQAFIRLELARPDPQGVWKVKAGLVLGLGPNLEWIHRAAKG
FT                   GTHHIARTESVWATVQAAREFKHEQLAKKKAEQSYQADLKRFAGNPDVDEQGRPVDKRE
FT                   FRETREALDWLHTCHMGWFRHAPTVYKHELLDRIGDDFTRQGLQIPSGIVMEVADDGTK
FT                   WYAWRRTIGGHHFAIGANGDPPNQWRYDGRNPPTGFPGIAPEWGKSPFEADVAPNWHE"
FT   gene            complement(495529..496731)
FT                   /locus_tag="Gbem_0421"
FT   CDS_pept        complement(495529..496731)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0421"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37450"
FT                   /db_xref="InterPro:IPR041229"
FT                   /db_xref="UniProtKB/TrEMBL:B5EBI1"
FT                   /protein_id="ACH37450.1"
FT                   /translation="MPDKNYTFQLLTVDSSRTSKIQTEEQMLYSLMSNNDLWNSPKLHK
FT                   NKIEWGGLSVTVTEVDMKGTSESPQKAFTISSVGHIEPLEKFRLPLTSHIQKQDFSLVY
FT                   ILTDEISEQIACEIYPKLNRIENRLRHYLIKFFVTKLGPDWWRLTADAEMQKKAHQRRN
FT                   NERVFSQHIDNKAYLIDFFELGKIVYAQTSGYIEKDDIISKLMSLDESVEALKRFKEEL
FT                   QSNYTKYFKETFKDKGFQDKWIRLEEIRHKVAHNNLFVHEDLIKANEYIDSLQSIIDEA
FT                   EQKIDEVAFSKGEQAAIQESIMESLSQPVTSPTGQFSAITKEILLDELEKQERIEREHG
FT                   GYVGLSRFVKICLGDQGYDYVSSYNIINELVEAKELELYDKSTADGYPARAIRRMKIAE
FT                   D"
FT   misc_feature    496772..496815
FT                   /note="conserved nucleotide sequence; Gbem_R0093"
FT   gene            complement(496820..498124)
FT                   /locus_tag="Gbem_0422"
FT   CDS_pept        complement(496820..498124)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0422"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37451"
FT                   /db_xref="GOA:B5EBI2"
FT                   /db_xref="UniProtKB/TrEMBL:B5EBI2"
FT                   /protein_id="ACH37451.1"
FT                   /translation="MSNQRIKIPRASDRSIVDAFKELGETYGVSSAHISALGFSNLGEV
FT                   NIGGNASGDLAALLELKSAVIDGMSLQIRGLGISYSRGGQYQPEQKSPIFDEIVLSYNQ
FT                   QGNLSNTEKMQIVAFINKKLKAFDPGRLAGRGVSEEQNQMIAIHESTLERLELLNEDLV
FT                   RQSSAFRENLEVQYADKVTKLEEANLQQKAILEEDYKEKSVSLKEKEKLLEEKIKTIDD
FT                   RDNTHVRREIRDRMLEDVKTRISNFGVSSNTERKRKPVFFGMLTLVVILLTLLLYSGLE
FT                   AKMAITGTDKLPMYWLWGRFTLYSLGLVGTILYYIKWENKWAEQHSSSEFQLQQFYIDV
FT                   NRANWIIESCLEWRKETQSTLPKTLIEGISRNLFVKEQDETEKVIHPADQLASALMGRA
FT                   SKLKLRLGENELEFDKPGKIPNKPLRVRPVSETDT"
FT   misc_feature    complement(498155..498426)
FT                   /note="conserved nucleotide sequence; Gbem_R5031"
FT   misc_feature    498572..498697
FT                   /note="conserved nucleotide sequence; Gbem_R5019"
FT   gene            498748..499326
FT                   /locus_tag="Gbem_0423"
FT   CDS_pept        498748..499326
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0423"
FT                   /product="ABM domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37452"
FT                   /db_xref="GOA:B5EBI3"
FT                   /db_xref="InterPro:IPR007138"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR038762"
FT                   /db_xref="UniProtKB/TrEMBL:B5EBI3"
FT                   /protein_id="ACH37452.1"
FT                   /translation="MNAVISADPKPIEGATVVITHRLRENKQAEYESWLKEIAPLCKAS
FT                   PGHLDWHIVRPISGLSETYTIIIRFDTEAHLREWMESPTRARLIEKVRPLFVTDDDFFI
FT                   SSGLDFWFTPAGAKAKVPVRWKQYLVTWSAIYPLALGIPLIVTPILQFLGIPNNRLIAT
FT                   LAVTGLVVFLMVYVVMPRYTRLVQRWLFR"
FT   gene            499491..500102
FT                   /locus_tag="Gbem_0424"
FT   CDS_pept        499491..500102
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0424"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37453"
FT                   /db_xref="UniProtKB/TrEMBL:B5EBI4"
FT                   /protein_id="ACH37453.1"
FT                   /translation="MPLSKLSHPEIITKSAVVTATYNKEMFDYLLSLIPTPDFYIELHE
FT                   RYATNFAGSLKGDPEKIKACAADRQLIDQNLSILLGLAKVVTAKDPSVMESFGLNRPAE
FT                   KTAASAVVLERPKNFRVSFDKKGHPQVSLTKIMGAKGYEVWACDADPSLEENWRLVEWS
FT                   TKCQSIPITGLNRTQLNWLRIRGKRGDIFGPWSNPISLFP"
FT   misc_feature    500291..500314
FT                   /note="repeat; Gbem_R5070"
FT   misc_feature    500332..500355
FT                   /note="repeat; Gbem_R5071"
FT   gene            complement(500608..501849)
FT                   /locus_tag="Gbem_0425"
FT   CDS_pept        complement(500608..501849)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0425"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37454"
FT                   /db_xref="InterPro:IPR010870"
FT                   /db_xref="UniProtKB/TrEMBL:B5EBI5"
FT                   /protein_id="ACH37454.1"
FT                   /translation="MHKKLVTSTLAAALIAVSSIAGASEIDTLRKQVDDLSDQVKLLQT
FT                   NSATPTEASGFRKKLWDNTRFGGYGELDYIVKRENGNGKGSNTFDPHRLVLYVNSDLSD
FT                   WITLNTELEWEHAGVNEDLASETELSGEVVVEQAFLDFKLQREFNVKAGIMLVPLGATN
FT                   LYHEPTNFNSTERPELDRYLIPSTWREMGVGIHGALGDRVDYQLMVMNGLDGTEFSAKN
FT                   GIREGRQNMNKDLNRNKAVTGRLEVRPATNLYTNLSFYTANSAKDGSAYTTVAAFDGRY
FT                   SIGRLDLGGEYVHVFQNNPALLSDDVGHNMSGYWVEGAWHAMPESWKKGKLANADAVVF
FT                   VRYSEIDTQDGGAINPAKQNGRFDRNYTTFGVSFKPVTQLAIKADYQIYDDHGTGGSTK
FT                   LDNDKFQVTLGFVF"
FT   gene            complement(502211..502648)
FT                   /locus_tag="Gbem_0426"
FT   CDS_pept        complement(502211..502648)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0426"
FT                   /product="protein of unknown function DUF2495"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37455"
FT                   /db_xref="GOA:B5EBI6"
FT                   /db_xref="InterPro:IPR020948"
FT                   /db_xref="UniProtKB/TrEMBL:B5EBI6"
FT                   /protein_id="ACH37455.1"
FT                   /translation="MWKADVVDLNLTRFYEMSTRVVLSFLILAILLAIVAGVGCAVYDL
FT                   RLIFQTDFHAAFKTIMVDMLTVLAIIEVLRTALAYFSEGRVKVTYIIDTVIVTVLTEVM
FT                   AFWYKNIRWEEVAMTISLVISLSLVRVMAVRYSPAAIRKEL"
FT   misc_feature    complement(502740..502771)
FT                   /note="octanucleotide repeats; Gbem_R8003"
FT   misc_feature    502788..502818
FT                   /note="octanucleotide repeats; Gbem_R8004"
FT   gene            complement(502873..503991)
FT                   /locus_tag="Gbem_0427"
FT   CDS_pept        complement(502873..503991)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0427"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37456"
FT                   /db_xref="GOA:B5EBI7"
FT                   /db_xref="InterPro:IPR007657"
FT                   /db_xref="UniProtKB/TrEMBL:B5EBI7"
FT                   /protein_id="ACH37456.1"
FT                   /translation="MKHEHEKAVKEKRRLAQKLSLELLGPIIGKMPKSSIESLEKLSYL
FT                   PKIQRHILDIIQVADPRVVRHDLKAAFPPFIRTEAAFGKRNLYLLKDAVVSPDSGMVWI
FT                   GNRILEESVGSLRRIMDWGDMLHEPLLPVSELKSDEPVVVCPPAAGYYHWLLEVLPNLL
FT                   FALSRFPEVKIVLPENSPAYVMDGLSMILGPEAADRFIFCSTPLKVRNLVMPQYLTAPE
FT                   FTSPQVIDLLKSQVKPKVVAEETSGVPASGTKLYISRRKSRRRRLLGEEELERKLQEKG
FT                   FSILHLEGVSFQEQIRIFHQADTVVSTHGAGLSNLVWSEPPCRVIEIFPKNYILDCFAW
FT                   LSFSQGFDYRYVICSTGHKIDDEAMAAVLRQL"
FT   misc_feature    504021..504108
FT                   /note="conserved palindrome; Gbem_R2007"
FT   misc_feature    complement(504268..504320)
FT                   /note="conserved palindrome; Gbem_R1013"
FT   gene            complement(504333..504992)
FT                   /locus_tag="Gbem_0428"
FT   CDS_pept        complement(504333..504992)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0428"
FT                   /product="membrane protein, MarC family"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37457"
FT                   /db_xref="GOA:B5EBI8"
FT                   /db_xref="InterPro:IPR002771"
FT                   /db_xref="UniProtKB/TrEMBL:B5EBI8"
FT                   /protein_id="ACH37457.1"
FT                   /translation="MIQSAATHMEQLIVFVVQLFVIVDPLAAVPIFLAITVSHTKQERR
FT                   SIARRGCSIGLLAIVFFLVAGPSLLRYFAINTSAVQISGGLLLFVIALELLYGNPTGTQ
FT                   TSSKEERLAEKKEDVSVTPLAIPLLAGPGAIVTCLVFSSQASDALSVLILIGGAVIVFS
FT                   AAYLLLHWADELARIFGELGMKVAVRIIGLILAFIAVQYVINGITALWPAVKVPSA"
FT   gene            complement(505088..507955)
FT                   /locus_tag="Gbem_0429"
FT   CDS_pept        complement(505088..507955)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0429"
FT                   /product="sensor histidine kinase response regulator,
FT                   Cache_1, PAS and PAS domain-containing"
FT                   /note="domains: Cache_1, PAS, PAS, HisKA, HATPase_c, REC"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37458"
FT                   /db_xref="GOA:B5EBI9"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR033479"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B5EBI9"
FT                   /protein_id="ACH37458.1"
FT                   /translation="MVQKFVKKGGLALLILAFTCLCTAIFYFSYQKAKQSAISRLNDEQ
FT                   FIHAKQAARGIEEYFVTWTGILTSLSRLDAIVAMDPAGKRQMEFFYDAHKDQIRSFTRM
FT                   DEKGNILFAVPNREISGRNIAQQKHVQELIATKKPVVSDVFRTIQGYDAIALHVPVFEG
FT                   SRFRGSIAIIVNFQSLAQRYIEVIRVGKTGYALVVSRDGTELYCPVPGHSGTNILAAAK
FT                   ESPSVLPMVRAMLKGESGTASYDFNTKDGASVKPVKKHAVYLPIHLGNTFWSIVVASSE
FT                   QEILSSLASYRNRLALVFSGILFGGIIICILVLRALLIVREEDVRQQAEAELRASEQRY
FT                   RYLFEQNPAPMLIYEKGTLQMLAVNDAFAIGYGYSNEEALALQLIDLYPEEEKPKITEV
FT                   AAGLSGHTYVGEWHHRRKDGTVFPIFVTSHDMTYSGRTARVAVITDITDRKLMEKALEE
FT                   EANFNRLLFDHSPDGIVIIDPKTARFINFNASVCRQLGYSREEFAQLRVFDVEAVETQE
FT                   DTRRRIDGIVRDGRGDFETMQRTREGELRNVQVTAQILTIQDRPVYYCIWRDITEHKKL
FT                   EEQLRQSQKMESVGRLAGGVAHDFNNMLGVIIGSADLCQHQIPADSPLQKYLDHILKAA
FT                   KRSSDITRQLLAFSRKEVVSPKAVNLNSLIIDSEKMLCRLIGEDVKLTFKPSTGLWTVL
FT                   IDPAQFDQILMNLSANSRDAMPNGGTLDIATGNVHLDAGYCRHHSDTVPGDYVKITVAD
FT                   TGTGMDRETKDHIFEPFFTTKGVGVGTGLGLATVYGIVTQNNGFINVYSELDQGSVFNI
FT                   YLPRLLEDGAAEEEAEAAPPPKGTGTILLVEDEEMLLWTTTKILEEMGYTVQQAESPAK
FT                   AIEICENGKQIDLVLTDVVMPGMNGREMVDRIRSTRPDIKVLFMSGYTADIVAQRGIVE
FT                   EGMFYISKPLDAQQLHEKIVQTLAS"
FT   gene            complement(508142..509455)
FT                   /locus_tag="Gbem_0430"
FT   CDS_pept        complement(508142..509455)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0430"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37459"
FT                   /db_xref="GOA:B5EBJ0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR018632"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B5EBJ0"
FT                   /protein_id="ACH37459.1"
FT                   /translation="MEATDNKVPLLKLSNIRKSYKKSDSGEHLVLDGVNLTIADGEIVA
FT                   LLGRSGSGKSTLLRIISGLAQPGSGEALYCGKPITGPTQGLAMVFQSFALFPWLTVLEN
FT                   VELGLDAMGVPQAERRRRALEAIDLIGLDGFESAYPKELSGGMRQRVGFARALVVEPTL
FT                   LLMDEPFSALDVLTAETLRTDLIELWLERRIPTKGILLVSHNIEEAVLLADRIIILGSN
FT                   PGRVVSEIKIPLAHPRDRDAPLFRQLVDTVYGQMTQRSRAAGKVEAVPISYLLPEAHVN
FT                   QLSGLLEALAAEPYNGKADLPELADQMGFGVDQLFPLLEALDILNLARIEGGDADLTAS
FT                   GRSYVDADILRRKEIFAEHLVRHVALAAHIRRVLDDRPGNRAKEDRFLRELEDFFSEET
FT                   AETVLQVAIEWGRYAELFAYDEGSGILSLENPASGEQG"
FT   gene            complement(509468..511204)
FT                   /locus_tag="Gbem_0431"
FT   CDS_pept        complement(509468..511204)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0431"
FT                   /product="ABC transporter, membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37460"
FT                   /db_xref="GOA:B5EBJ1"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B5EBJ1"
FT                   /protein_id="ACH37460.1"
FT                   /translation="MANRSTPFSKTTGRAAPNFWDLAAFLMVMGLVTLFAWGSREMGIP
FT                   YMPGEQIPLSLDPVNLPEYALRTVLRMAAALAFSLLFTFSYGTLAAKSRRAERILVPLL
FT                   NILQSVPILGFLSVTVTGFIAMFPGKLLGVECAAIFAIFTSQAWNMAFSFYQSLKTIPS
FT                   DLSEASVLFGLSPWQRFWKLDAPFAMPPLIWNMMMSVSGGWFFVVASEAITVGKTSVTL
FT                   PGIGSYVAQAIHYRSLSAIGWALLTMLLVILVYDQLLFRPMVAWADKFKFETTESGEGS
FT                   GSWVLTLFQRARLLRAAGRFLVNRWIRLTDLLPRRKQRASFRDATQATIPKAQEIAWNA
FT                   LLAIGVAGGAWLLVQFVGGEVDGAEIWKVFYLGFLTLVRVTVLLIIASLIWVPIGVYIG
FT                   LNPKWATRVQPLAQFLAAFPANLFFPVAVFFMVHYHLSPEIWTAPLMILGTQWYILFNV
FT                   IGGASAIPTDLREAARNFGVSGWKLWKTLLLPGIFPSLVTGLVTAAGGTWNASIVAEIV
FT                   TWGNTTLTATGLGSYIAIWTEKGDYPRIALGIAVMSIYVLVLNRFFWERLFTVSQTRYR
FT                   LG"
FT   misc_feature    complement(511598..511760)
FT                   /note="conserved nucleotide sequence; Gbem_R5041"
FT   gene            complement(511796..514378)
FT                   /locus_tag="Gbem_0432"
FT   CDS_pept        complement(511796..514378)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0432"
FT                   /product="cyclic nucleotide-binding sigma-54-dependent
FT                   transcriptional regulator, CAP_ED domain-containing"
FT                   /note="domains: CAP_ED, sigma54 interaction"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37461"
FT                   /db_xref="GOA:B5EBJ2"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR018488"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B5EBJ2"
FT                   /protein_id="ACH37461.1"
FT                   /translation="MAAISSETISGIRLFSTLNREQLDRIARHLQLREFAPGQIILSRN
FT                   EPALELYVILAGRIRVELLDEGGQVLTLTELGIGNVIGERAILTDEKRSADVRAITEVQ
FT                   AARLSREDFEELLDQIPALYANLSRIFAAQLGSWAHRHQREESEHREVITNIIGWQLLP
FT                   EFGQFPGASHWVRLLNQRLQQLGGTRSHVLILGEPGTWKDLAARLIHFHSEADRPVLFL
FT                   DCASPPPVLEEENEPAEGASQRGVLLGLAQEAALFGHASQGAVYARRVRRGMIELAAGG
FT                   DMILRNVDCLALAVQEELVDFLDTGHFTRRGETKLRSARVRIIATSGKALEPLIDSGKF
FT                   NGELYRKLCGETVELAPLRERKKDIPVIAKSLLASLNAKHNRNVRRLSQDALNRLVDHD
FT                   WPLNATELYQVVSRAVVVCSDTEIQPEHISLQGHPFEDGRFNLLTLPSLERLAWNPRFP
FT                   KVLRWLTVPAFLLITLYTLLGPASDNAANLAAWTLGWPALILTAFLFARGWCSFCPMEA
FT                   IGERLGVTSRVVRDPAPWLRSFGPSLSFAALVLILLMEQATGMFSHAAATGLLLSGMLT
FT                   ATVSADLVIGRRGWCKFLCPLGRIVSLVSRISPLEMHSNHNVCLSRCRVDDCIKEKACP
FT                   MGLHPSGVDSSDHCVLCLNCVRNCPHHSMQLDLRNPTCGVFNKARRGFREAFFSVTLLG
FT                   AVIAAKGTPLLAGRQPELFPRTLWTLEDYLLALCLVAGFTFLALIASVAVRGARWRSVF
FT                   TSSGLAYLPLAAAGLFLIFFRPLVEGGARLVPLAVSALGAENFLDATALTPELGTLRLL
FT                   IYPIILLAALFSWVVLARLQRLDGLPPAALLRHRLLILGATAILIKIL"
FT   misc_feature    514511..514622
FT                   /note="conserved palindrome; Gbem_R2008"
FT   gene            complement(514651..515787)
FT                   /locus_tag="Gbem_0433"
FT   CDS_pept        complement(514651..515787)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0433"
FT                   /product="transposase of ISGbem_A"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37462"
FT                   /db_xref="GOA:B5E9I0"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:B5E9I0"
FT                   /protein_id="ACH37462.1"
FT                   /translation="MPWRPVDTMTLRFEFVHLALQEGSNIAFLCKRFNISRPTGYKWIS
FT                   RFLETGVEGLIDLSRKPLTCPHKTVTATEDAILKLREEHQAWGARKLRKRLEKLGHQGV
FT                   PVPSTITAILRRNGCIDPAESDKHTAFQRFEHPYPNDLWQMDFKGSIPMKHHGRCHPLT
FT                   VLDDHSRFSVVLVACANERTETVKAALIEAFRQYGLPYRMTMDNGSPWGNDQYNDLTPL
FT                   TVWLIRNEIRVSHSRPYHPQTQGKDERFHRTLVAEAIAGRVFEDLADCQLRFDTFRHCY
FT                   NLERPHESLGMETPMTRYKPSRRTYSEILPEIQYAPDDEIRKVQAEGKVSFKGRCVRLA
FT                   KALRGQPVAFRPTIRDGEYGVYFCSQKIAEVDLKEQKV"
FT   misc_feature    515821..515865
FT                   /note="conserved nucleotide sequence; Gbem_R0094"
FT   gene            complement(515918..517150)
FT                   /locus_tag="Gbem_0434"
FT   CDS_pept        complement(515918..517150)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0434"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37463"
FT                   /db_xref="UniProtKB/TrEMBL:B5EBJ4"
FT                   /protein_id="ACH37463.1"
FT                   /translation="MILPLLFLISLLLLPCTAEANDFSGYAELKGFAYSERYDGEPYGA
FT                   GSGTLFSKWEHRPGEAQLTASLRAEWLTSPQDQLSFDPADRRLRRSPLSLRDLWVRLPL
FT                   APSHDVEFGRFQLGWGQTDGYSPADAFLPRDLTDPFTDEKLPLWALRVSGQEESFRYQA
FT                   VLAPVTTPWRLPPLGSRYAPIAAGALPQQTVLREREDDPPVPGFIALRLLATRGDWDLG
FT                   LWMRTGVRPAPLLQFSLDPALQTGPAPIVSVERRYAREQGVGVELSRVAGLYVLRAELA
FT                   GLLSKDPELGDAVIGTASVERGFGDGKLLVTLAANAIEPPVNQTLLFDRALLPALIAAW
FT                   NQTEPWGDWKVVSTTGLEHMDGMAKGEVGYNMTDTWKITTGGDLPYGSDNGALGALKKA
FT                   RRIYLALRRSW"
FT   gene            complement(517147..517953)
FT                   /locus_tag="Gbem_0435"
FT   CDS_pept        complement(517147..517953)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0435"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37464"
FT                   /db_xref="InterPro:IPR033399"
FT                   /db_xref="UniProtKB/TrEMBL:B5EBJ5"
FT                   /protein_id="ACH37464.1"
FT                   /translation="MIARFARPLAAAAAALFFFSLCAGTALAAPDARTLLKDSENRHRT
FT                   KTQQYAGDLTVVNKEGKVRKKGWRSYREGYAGDAKNLIRFTDPPEVKGVGFLSLSRPGS
FT                   DNPDQWLYLPSMKRERRIAPQDRDASFVGTDFNYEDMEEFDHEKYKVSLIGEETAEGVP
FT                   CYVIAAIPNDKGTKSVYQKIVLYLRKDILYLVREDLIRKGEKEPAKRMILSDLKNVEGH
FT                   WVAGRMEMTDLKKGSKTTVNLKQITFNRPHPASRFTLQNLTREGGD"
FT   misc_feature    518082..518120
FT                   /note="conserved nucleotide sequence; Gbem_R0095"
FT   gene            complement(518124..520673)
FT                   /gene="lolE-2"
FT                   /locus_tag="Gbem_0436"
FT   CDS_pept        complement(518124..520673)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lolE-2"
FT                   /locus_tag="Gbem_0436"
FT                   /product="lipoprotein release ABC transporter, membrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37465"
FT                   /db_xref="GOA:B5EBJ6"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR025857"
FT                   /db_xref="UniProtKB/TrEMBL:B5EBJ6"
FT                   /protein_id="ACH37465.1"
FT                   /translation="MRFLLRTLSLSYARRHLGKTILTLLGVVVGVTTFSSIKTAQDALV
FT                   KGIGSTVDRVAGKAHLQVTMDGGVPEEIQEKLRSLPGIRATSPVIEQIVVPEKAELGSL
FT                   MVVGIDLLGDREMRDYGFEGDDADLDDPLLFLAQPDSALFTRDFARRAGLSTGKALSLK
FT                   LPTGYKQVTARGVMSPKGFAEAFGGNLMVVDVYAAQDLFGRGRRFDRIDVRLQDGVTVA
FT                   QGTATLQKALGPAYQVETPARRGEQMERLVANFTAGFNVSSAFALAIGVFLIFNAFNVA
FT                   VNRRRRDIGTLRALGATPRQVQVLFLAEALILGIMGGVLGCLAGTAFSQGLLVSMGQST
FT                   EAVYGISGSGIVHLTPAIALQSILLGVGASLAGAWGPALAASRIPPTEAFAKGVFQARV
FT                   ERRVAPRLAGAAALLAAAVYFALFSGLSGNQMLLAVLLLGGTGLILLLGPLSRTLLVAA
FT                   APLLSRFFPSAGPLSSDALMANPRRSAGTIMAMTLSLTFVLGLGGYLGSTKGTIVRWMD
FT                   DVLTCDLFVRASANFTRGDFLYPGALREELAQLPGVRAVESIRAIRPQFSGKRILINSV
FT                   EIGQLLDRTKYEFAQGDARAMREGAPKGMCAVSENFYRNFHLGVGDQVELMTPGGLVKF
FT                   PISAVLRDYSCDQGSILLDRPVFLKHWNDDRVDIYDVSVHPGVDPKAVREEIRAKLAGR
FT                   YPALVSTRAEFKAEIGKAIDAFYAVMRITVFLALGVAFLGIVTSLLISVAERTRDIGIL
FT                   KALGAVPSQIARSIVIEALVLALAGLLLALPAGNLFASFMEGPVAVAFTGWSMPHNYPW
FT                   DVLVQLLIALPLVSALAAWVPARQAAKVKVTEAIEYE"
FT   gene            complement(520670..521359)
FT                   /gene="lolD-2"
FT                   /locus_tag="Gbem_0437"
FT   CDS_pept        complement(520670..521359)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lolD-2"
FT                   /locus_tag="Gbem_0437"
FT                   /product="lipoprotein release ABC transporter, ATP-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37466"
FT                   /db_xref="GOA:B5EBJ7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B5EBJ7"
FT                   /protein_id="ACH37466.1"
FT                   /translation="MLQLRDVVKSYDGKSTVTALAGITLSIAPGEMVAIMGPSGSGKST
FT                   LLNLMGGLDVPTSGQLLVAGKDLARESEKARSLFRRNSVSYIFQAYHLMPTLRVRQNVA
FT                   LPLQLAGVSAKKAALQVERVLAEVGLEKRGDHLPDELSGGERQRVAIARALATDAPLLL
FT                   ADEPTGNLDSARGREILALLRSIHANRNTTIVMVTHDHDAASVCDRLIRLRDGRVEDDG
FT                   VVIGGGR"
FT   misc_feature    521436..521547
FT                   /note="conserved palindrome; Gbem_R2009"
FT   gene            complement(521603..523024)
FT                   /locus_tag="Gbem_0438"
FT   CDS_pept        complement(521603..523024)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0438"
FT                   /product="protein kinase, ABC1 domain-containing, putative"
FT                   /note="domains: ABC1"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37467"
FT                   /db_xref="GOA:B5EBJ8"
FT                   /db_xref="InterPro:IPR004147"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR034646"
FT                   /db_xref="UniProtKB/TrEMBL:B5EBJ8"
FT                   /protein_id="ACH37467.1"
FT                   /translation="MSCNVAVAPASRERLMQLLPRDEDAAARQRLAELVETACSNRPPT
FT                   SSLSRLWILGSMQAKVAGAYVAWWLRSRLVDPDEKERTKNETHLKAALELFGTMGYLRG
FT                   AVMKVGQMLTLPEMVPEQYARLLSSLSFEAPPMHYAMVREVFFDEFGREPEEMFASFEK
FT                   KAFAAASLGQVHRARLHTGEQVAVKIQYPGIARTIQADLKNLRLLLQPMRMGDDWPNLL
FT                   DKLAEVESVLLAETDYLKEAELAQAVRSHFEPGDGIVVPRVYTECSSLRVLTTEYLQGV
FT                   HIDEFLASDPSQELRDRFTHLMTMATIRLLYRTHCIMADPNPGNYIFMPDGRLGVIDFG
FT                   CARMYTDEEWRMQCEAEAAAFRQDEKEMERIIVEASLYESAQEMGAERVELVGRVISWQ
FT                   LEPWLSEGLFDFGDRDFFLRGMEAMRQATKKGYLRGMPLHIWTTRFVLGARAVVYRLKG
FT                   RCHFKEIYRQESAPR"
FT   gene            complement(523014..523631)
FT                   /locus_tag="Gbem_0439"
FT   CDS_pept        complement(523014..523631)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0439"
FT                   /product="transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37468"
FT                   /db_xref="GOA:B5EBJ9"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR041673"
FT                   /db_xref="UniProtKB/TrEMBL:B5EBJ9"
FT                   /protein_id="ACH37468.1"
FT                   /translation="MRITEQAKQQCRARILEKASELFCARGFDQTTTRDIALAAGVAAG
FT                   TMFNYFPSKETMAMTMVSDALAEGEAEFRGRTCGELVEDLFGFIASGLRRLRPLRPFLG
FT                   PVLERSLSPFPRKNVCPVGEAARQRHLDFMQQILARHGFSSAPDYVATTIYWSLYLGVL
FT                   AFWTSDPSPNQEASQALVDYSVRTFVHIISGSAGVDGGEHVL"
FT   gene            523800..524240
FT                   /locus_tag="Gbem_0440"
FT   CDS_pept        523800..524240
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0440"
FT                   /product="winged helix-turn-helix transcriptional
FT                   regulator, MarR family"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37469"
FT                   /db_xref="GOA:B5EBK0"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B5EBK0"
FT                   /protein_id="ACH37469.1"
FT                   /translation="MSTPAPRNVIDQIAKIREAANLLIERELQRRGITGIVPAHGLVFS
FT                   FLFRQNEAIPIKALVQQSGRVKSTVTGMINTLEKHGYIYKQNCSDDARSTLIGLTERGN
FT                   AIRRDFEEISVILEKQVYGEMLQDDRECLMKLLSVIENNLKA"
FT   gene            524360..524758
FT                   /locus_tag="Gbem_0441"
FT   CDS_pept        524360..524758
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0441"
FT                   /product="cupin superfamily barrel domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37470"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:B5EBK1"
FT                   /protein_id="ACH37470.1"
FT                   /translation="MEKTGKNYKTVSLGNIKELGRVVLNEQLSLTGSEISINELPAGVS
FT                   VPFVHAHKRNEEVYVILSGKGRFYIDGEEFAIETGDVVRIDPAGERCIAADPETSIRFI
FT                   CIQTEANSLVQFTQNDGIPVEGKPSWLN"
FT   gene            524787..525767
FT                   /locus_tag="Gbem_0442"
FT   CDS_pept        524787..525767
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0442"
FT                   /product="hydrolase or acyltransferase, alpha/beta fold
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37471"
FT                   /db_xref="GOA:B5EBK2"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B5EBK2"
FT                   /protein_id="ACH37471.1"
FT                   /translation="MRNKTFLAICAISFILSVSDAIAAPALAVLGRDYEFPNKISGLPA
FT                   KLSDFKDLEIKFFNTSDGVRLSYWEAGKGKPLIFVPAWSANGAEYVNVLFLLSKQYHVY
FT                   VLDPRNQGLSQNIDSGMRISRLSMDLKEFTDHIGVKSADYCGWSMGASVLWSYIDLFGI
FT                   NGVRKVIFVDEPPSILTRPGWTEQERLNAAAMADSPQQVLNALTSGAPHPLVERFNAMD
FT                   SPYYENSKSFARLFIKSDMKYMSLIMYDHASNDWRDVISKKIKVPTAIFTGEYSSYNLP
FT                   SQRWMASVIPNARLYVYTKEEQGDHFLMFKNPFKFTQDLREFLER"
FT   gene            525847..526029
FT                   /locus_tag="Gbem_0443"
FT   CDS_pept        525847..526029
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0443"
FT                   /product="4-oxalocrotonate tautomerase superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37472"
FT                   /db_xref="GOA:B5EBK3"
FT                   /db_xref="InterPro:IPR004370"
FT                   /db_xref="InterPro:IPR014347"
FT                   /db_xref="UniProtKB/TrEMBL:B5EBK3"
FT                   /protein_id="ACH37472.1"
FT                   /translation="MPVVRVTWFEGKDTQTKKAVAAEITESIVRNTGTDPKYIYVIFED
FT                   VAPSDWAGEGKLFSE"
FT   gene            526196..526375
FT                   /pseudo
FT                   /locus_tag="Gbem_4065"
FT                   /note="cytochrome c; C-terminal fragment"
FT   gene            526480..530076
FT                   /locus_tag="Gbem_0444"
FT   CDS_pept        526480..530076
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0444"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37473"
FT                   /db_xref="UniProtKB/TrEMBL:B5EBK4"
FT                   /protein_id="ACH37473.1"
FT                   /translation="MLRSLLAYMRALRFKKIMFVGAVTALAGVIAIVLLVVFLPTLLST
FT                   SQAQSLLRLQLSKSLKKPVSWSNLTLSWSQGLTLSGLTVGDGPPPLLNANLAELRVKPG
FT                   LEWDDSGRYTVSLDVKLRKLEASLAPGPKQPPPEKPAKDPLTQVAEAVQKFQGMEWPLP
FT                   VDVRLAVDAAPMTVSYLDPASGRQTVLREVSFALAAPSLARLPIDTSLEGSVALPDAKP
FT                   QRVHFKARLSDLVTAKDKIKPAAALLSVQAGFPGVTLDAGGGVNRPGGLKAKLRVNLPE
FT                   LAPLATAMAHRELPTLDGKLALDLGAELDRNADLMVLLDLACDRLSVGKIPGKKGTAGP
FT                   LDLKLHQKLVSDHKRQRVTFSDGALESPGLLSAAWSAVVDRPTERSRSVAADLGPLRLD
FT                   LAAARRLAAPFLPANLPVQVLTGTASVAKLAARFKGPDNDGELTLEKAGVDLPQLGLRL
FT                   ANGSLQGEGLSLVLERAAVPLKKLAPLSLAADLRLGAKKVELSGKKKVLLQGGEGALAL
FT                   ALTELDLKHKRARALIGQSLEFALVQVGPELAVEGLREELQLEGRALSGGELEATLPGL
FT                   KLSATKLSANQGGKQVVLTPLSATLVAEGVHLPKKGEGSATVKRAHFTATAADALAIEA
FT                   QAGLSGLIKQVAATTGKARFDLNKLMPVAAPFVPAGLDAKGLAAATWDMEAPLPVATLA
FT                   KEKNPLRAARGACALLDKGNLALQLDGLDLRIPAAKTTYKVQNLSTTKPLSFSLPAAGK
FT                   PLAIDGAFSFAGITGLAGAAGQLPLQSGALTLEGELSQWKDLRLTEELQVRSLGLSQVA
FT                   ELTVGGIDRLLDDSAKLDTPTLLKRLDATMFAHLEGNFPREAKQALAGLKLSGNVAAGA
FT                   RLDLTAARELRMRGYTKCRDFGVADGKGMSAQGIRADLVFDRSYALAQGKGGEWIPLSA
FT                   LLVRPAPVAPPLAANSDLAARIYQDLRGEASGPRKIGIKSASFNSGAVPLSATALEADL
FT                   LLEPDTLGLSFLQAEVGGGTVRARGVIDLSREVPVLSTYCYFSRLDPALLFPASGGARP
FT                   GEELTGELSLSAPLAAEQRALLEGLKMNLNLRRFSSRILDRALFAIDPYQRNEKVVAQR
FT                   KSLQLADLKGLRVSAVDGALDCEGELLVKGVGVDIPKLERLRLSELPIRKELERLIAGI
FT                   ASSKALLELARADTLVVGADGALSLKRRSNER"
FT   gene            530066..530755
FT                   /locus_tag="Gbem_0445"
FT   CDS_pept        530066..530755
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0445"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37474"
FT                   /db_xref="InterPro:IPR008309"
FT                   /db_xref="UniProtKB/TrEMBL:B5EBK5"
FT                   /protein_id="ACH37474.1"
FT                   /translation="MKDKTRSTFNVQRSKTETIKAGSTFNVQRSGVRVGSGASLLLLAA
FT                   LLFGGCTLAKVDVNVVSERTSLENQVLGTYNALSEDVLLVASVRGVSPTGKVDAPQKHS
FT                   PEHQEAAQALEAIAFHADDVDTFKRLGWVGESLEGTLAPFERALPEKAPADLKAFAARF
FT                   TEGEFKQVVDEVNRSREILMLRVVRTNENFTAKDLPAIRKVFARINRQNSAPGTRVQGD
FT                   DGKWVNQ"
FT   gene            530752..538977
FT                   /locus_tag="Gbem_0446"
FT   CDS_pept        530752..538977
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0446"
FT                   /product="TPR domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37475"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR011659"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR024983"
FT                   /db_xref="UniProtKB/TrEMBL:B5EBK6"
FT                   /protein_id="ACH37475.1"
FT                   /translation="MRGAPARIALLLALASSLAGIGAGAAPLGEELLAPAAPRPAPRSR
FT                   PESAPAPAVYTPRSVLYAARSRDGKLVATVERGDAGYELWLHAPGNAEALPRLLRQSPM
FT                   RISAPAFNAAATLLAYADERDDLKGDIWLIDLARLDAEPRRVTGNDAGEDAPAFSPDGS
FT                   ALLYQRQLPGSERREIIRLELAAGGAKALPIGIDAAFAAPSPDGEKLAFVSREKDAGGD
FT                   LWLYDRGSLTQLTSGPERDLYPTWQDSDTILFTRFAPPSGDSATGPEGGAIFRLKLSRK
FT                   GSDGLPAAFPLTSGLLSTAAPLAAPDRVLFVAGETGGGQVLSLPLSGELPDRPDLAGQW
FT                   QLARLILERQPADPAMARLACLRVLAREEEPSREGALASLALAGVLEEGGDLPGAEARY
FT                   VEAARRYASFPAESALAEIARIRLEAARRCGEVVVSGRRKDVIAEARKDMVQAGEGKGA
FT                   DAAARALVDGARLMAEFGSGAEDQLAAIALLEKAGNGAGADEAIRAEAAYRRAALLSRI
FT                   EGGEGAVAALTEVARRYDGQERWAEAAIAEILRQLTAQAGDPRERLAALAEKFRTTLPR
FT                   LSMGAWNRIGDLAYRGDDWVRAKDAYRTVLEKYPPVATPTAAARFALAEILYREERFGE
FT                   ATALYEKEMAQHPEDAPLYQLARAAFIRKSLAAGESLYRQGEVSAARAAFLDLIRYEGR
FT                   SLEAHRGYIKSVAAQNQAPELLALYQRMLTSYPDDPVLLYAAGLCQTYLPGKERLLEGG
FT                   RLIARAAERLPGSEYPPQTRGYIAEVLETVHGERGGLERALNFYRRAKLLNRPQENPDN
FT                   AANLDLNIGNIAYLLGRNSMAWNHYTARLASAVPFDNPDTELLFQQRYAAVAFQVHEKE
FT                   GALNGYQRALKLNESRLDTARPLEQFGRLTRRAVERFFSGAKLSAPQEEGLREQQAINA
FT                   ELELLGADRVEPPPSAAWLRFDAALRRLISRERKLVAASGREAAQAKHVQELQGMLAGV
FT                   ERDLDAVPRLVETGAELHDRLGLAALDADRFALAREHFDRAFKLNRDLGRTENLVANRR
FT                   SASIAAYREAAEASGADRHRLLTEARDGFREVLSLIDQYPPRQKASAGRGGGLFKVQAN
FT                   VALDKGGATEAAFGFSAEQERRLAESYLARIYGDLGDNASSAQLFAKLLERYPKKVEEL
FT                   TEGDLFGVGLLIHRSAQLAFARGERDAAAAQFRDATAIAVRSGNAVGAMLNLVNYGMLI
FT                   PEKDAGVEAGRFLELEARTSALISSYRETLPPDALARYGNDVGAILSRLAAGLPADGSR
FT                   EALLYRAVAGWDRVLALKASAGKEEAADLPRSKLAARLNRAETLAALGLPDAAQAGFAA
FT                   TLAEAQKSGSDSFAWRSMAALSRYDEALALLERISPAAYDLVRGELTARFAPRLEALAA
FT                   KDAEQAFALLERLSELERVQILGRTLLGLSDPVTAQALKSAAPRLAELDRVNAELAKPP
FT                   AQGELSYLQLRRQQEQTVIDSLLGKDLEQLPSFYRLAGPGTLRLAAFVLALPGGGEKER
FT                   ERFDSLFSGFRKGCAAGKGEPFCALLTPQPVEAIDVLERLPGKPVLRLARLSGDRFLLF
FT                   TLGGKAGVAAETLDRTALLTRLQDPAAVAVYEEPGSFASAPVLTWGVTATQLLRSVDGR
FT                   RPLRSRVLDEAAWWPTLEPFVKLPPHSLPDAHTLALAGGAGLLAAVPNRPGEGGRATAA
FT                   YEDAAGARHDLLELAQGESVSLVVAPKDGLDRAWELGQLASLVGVPSLLVSDKGAGDAQ
FT                   PFVRAYATESLALARRKLPAGWLLVGDFGGDAAESAKLAKKQFAEMVKKGVKAHNDGRY
FT                   PQALALFDNALVIAASTPELAKNTAPLHRHARESAFGAGLTERAVEHANLLVQRLAKEK
FT                   PYSAEHADALLRLGLLQGRLERFGEAASALKEGVGILADLGLTKDQAAALSDFGAVMEN
FT                   AVDYPAARSLFEEAAGLRLQLKDELSLADQYRNLGRIYDLRLNQFAVAESYYKKAQELY
FT                   AKNGSGALEAEAILDRGRCQRLLGNFPAADLLYREALGKVGNSELKTRMRIVLEQGNNA
FT                   WFQGRYQEAFDLREQVEKAAVKENWPLEQVMAKNTGGLIWWTLGDNKRALLELREALAK
FT                   AGKLEVRRDESATTLNNIGLVQRESGDYQGALETLGKALEIDRSLGSRWAIAYDLRNLG
FT                   QTRLKMGDPAGALKLLTESAQLADAIGDKVNQAKIHLALGDARAKSLLNAQAEASYRKA
FT                   LELADAMLVREVRWRALLGLARLQQQGGDSKAAIESYRQALDTVEGLRAEIRLDQLKDG
FT                   FLADKMDVYTGLVGLLVDLARADEAFAVAERSRARNLIDILGRQRLSLSGAGDQELYDR
FT                   QNRLKEQILEQEQLSVQAVKQTERAMYAEALERLKADYQDLLLDIERRRPELLSLVKVA
FT                   PVGGDEVRSLLEPGVTLLSYYQLPDRLLCWRLTKEGSKLFVLPVAAKDLAEKISNYRRM
FT                   LQNLEPLEKSSRELYQLLLAEPLAGVKELQPVGIVPHGSLHYLSFATLYDGRNYLIDRQ
FT                   TLFHLPAASVLRHTLSRRQAQKNLRILAVGNPDLGNSALDLPFAEKEAGTLRWNYSDVT
FT                   TLTRERATETWVRENISRFGIIHLASHGEFDTVNPLFSSIRLAKDAKADGRLQAEEVFG
FT                   LDVKADLVVLSACQTGLGDVRSGDDVIGMNRAFLFAGTHALMSSLWRVSDVSSAVLMKQ
FT                   FYRDYSRSSKAEALRLAMLHVRNRYPHPGYWGAFVLTGDYQ"
FT   misc_feature    complement(539057..539082)
FT                   /note="conserved nucleotide sequence; Gbem_R2106"
FT   gene            539198..539701
FT                   /locus_tag="Gbem_0447"
FT   CDS_pept        539198..539701
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0447"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37476"
FT                   /db_xref="InterPro:IPR003646"
FT                   /db_xref="UniProtKB/TrEMBL:B5EBK7"
FT                   /protein_id="ACH37476.1"
FT                   /translation="MKKTTVALLLLALAAAPALGAEKRWVVSEGTALKAEQSVTAASVA
FT                   ELPVGAELTVVEGAGRWLKVRSANGKEGWVYAGRVSDTAPVAEVGGGDGLFGDSMQKSQ
FT                   INTAKADSARSIRGLSPEVAQYAKQRGTPESLKKELDKILSRKVSDKEVRTFLKEGKIG
FT                   EYAQ"
FT   gene            539714..540592
FT                   /locus_tag="Gbem_0448"
FT   CDS_pept        539714..540592
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0448"
FT                   /product="peptidase, M48 family"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37477"
FT                   /db_xref="GOA:B5EBK8"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="UniProtKB/TrEMBL:B5EBK8"
FT                   /protein_id="ACH37477.1"
FT                   /translation="MKSFTMTLFLALACLCSTEAHAGWQDKLQNLMNPESKEGKILSGA
FT                   TQVVSSSQEMTYATERTVGQSLALESMQRFGKPVSNEALQKYVNLVGNAVARNSRRSTI
FT                   PYQFVVLDSPVRNAFAAPGGMVFISRGLLDVVENEAELAAVLAHEVGHVAEKHALKSIR
FT                   RAQFLQGVGTISAATMKGSEGKKFESMIGDLQSTLFDKGLDQGMEYEADLAALETTYRT
FT                   GYDPAAMISVLQKLKKLEASDSGKGSWFSTHPPLDERIARLSSSLEKYPDHASLAKVSA
FT                   RFAKTVKTAKK"
FT   gene            540880..541863
FT                   /locus_tag="Gbem_0449"
FT   CDS_pept        540880..541863
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0449"
FT                   /product="ABC transporter, periplasmic substrate-binding
FT                   lipoprotein, NMT1/THI5-like domain-containing"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37478"
FT                   /db_xref="InterPro:IPR015168"
FT                   /db_xref="UniProtKB/TrEMBL:B5EBK9"
FT                   /protein_id="ACH37478.1"
FT                   /translation="MQRAAIILILSLLVLGCQSKTPAEPLRPLPLRLAYTMQPDCALVH
FT                   IAMAKGYFLEEGVLLQPSLFGFGRQALAAVIEGKADLATVAETPFVFAALNGKRISLVA
FT                   SIFTSWQNNGVVARGLTSPPELRGKRIAYTPGTTSEMFLDTFLMAQRIERSEVTLVGLS
FT                   PQQMPAALAAGEVDAASTWNPAMKEAATGLGAAGRIFYDPYLYTETYVLAGNRSYVTAN
FT                   QDLVQRVLRALLKAEAFASLHPAEARTLVAATLKLSPELLGEFWNASRFRVSLEHSLIL
FT                   LLEEESRWALRRKPVPEAAMPNYLEYIDVRPLQEVKPEAIKINTRR"
FT   gene            541868..544210
FT                   /locus_tag="Gbem_0450"
FT   CDS_pept        541868..544210
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0450"
FT                   /product="sensor histidine kinase"
FT                   /note="domains: HisKA, HATPase_c"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37479"
FT                   /db_xref="GOA:B5EBL0"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B5EBL0"
FT                   /protein_id="ACH37479.1"
FT                   /translation="MTFAERMKISSIMFFSLLVFGAAVLFWSSRELNSARQNDVLSDDI
FT                   QTIVFERATLRDEFFLYGLERARVQWFGLNRDAEASIRLGNEHLRAPQEREVLEKVQAD
FT                   LRESELVSQRLVELLRGKSGPELERAHHDELASRLYSQIMLKDSALQQSSAALQELTRQ
FT                   RYNRANFRTIFLTFAFVLLVVAGGRANAFFINSLLRRRLQLLNEGVARIAAGDFSHRMQ
FT                   CRGSDELALFAGVFNCVLDKVQDYTGQLEKSHDLLSGLSSQVPGILFQACLTPDGLFST
FT                   PYVSRGGDELNQGDAAAPLQEPAQLFERLHPEKYQAILGTFRRSAETLEPWEHEFRIDV
FT                   PDRGMRWLRGQARPMRLPDGGTLWHGFISDITERKRAEEALHRSESRYRMQLQELTNIY
FT                   THTAVGLFAVDREMRYLRLNEQMAGYNCRPMDEHVGRTIDEVHPPAFVVALKEMWRPVL
FT                   ERGESLLNLEVQGQADWPSGERHWLVSFQPLFAETGAVIGLTGSVMDITERKVAEQVLL
FT                   GARQQLEREVQLRTAKLSLTNKHLIQEIEVRKKVEVELLAQQQKLQEMAFEISMAEERE
FT                   RDRIASELHDQVGQRLILAKIKLDSLASNLPLGECEAEAMGVETLIEQTLQDIRSLTFQ
FT                   IRPPVLATAGLEAALRWLGEELHADFGLEVEFSDDGKDKPLRYEVRSTVFQAVRELLLN
FT                   VAKHAGTKKCRVRFTRVGDRIVIEVEDDGTGLKPGAGDGTRSRSGGFGLLNVQQKVEHL
FT                   GGVFSIESRPQGGTRAAIEVPVETETK"
FT   gene            544221..544871
FT                   /locus_tag="Gbem_0451"
FT   CDS_pept        544221..544871
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0451"
FT                   /product="helix-turn-helix transcriptional response
FT                   regulator, LuxR family"
FT                   /note="domains: REC, HTH_LuxR"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37480"
FT                   /db_xref="GOA:B5EBL1"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:B5EBL1"
FT                   /protein_id="ACH37480.1"
FT                   /translation="MSMKVLIVDDHTIVRQGLRVLIDKEQDMEVIAEAATGAEAIRLAR
FT                   EKRPDVTVMDITMPDLNGIDATRAIIAEWPQARVLALSMESDRRFVVEVLKAGANGYVL
FT                   KDSAFAELATAIRAVATGETYLPSRVTTLLIKEYLQRIPDEVPATYENLSQREREILQL
FT                   IADGRNAKEIAFSFGVSVKTVENQRHSIMKKLDLFSIAELTKYAVRQGLTSLS"
FT   gene            545176..545355
FT                   /locus_tag="Gbem_0452"
FT   CDS_pept        545176..545355
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0452"
FT                   /product="CsbD family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37481"
FT                   /db_xref="InterPro:IPR008462"
FT                   /db_xref="InterPro:IPR036629"
FT                   /db_xref="UniProtKB/TrEMBL:B5EBL2"
FT                   /protein_id="ACH37481.1"
FT                   /translation="MKPSTKDQTKGKLHELKGQVKEEAGNISRNVSMEHQGRAEKVTGK
FT                   VQKTAGKAEKKTEK"
FT   gene            545540..545731
FT                   /locus_tag="Gbem_0453"
FT   CDS_pept        545540..545731
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0453"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37482"
FT                   /db_xref="GOA:B5EBL3"
FT                   /db_xref="UniProtKB/TrEMBL:B5EBL3"
FT                   /protein_id="ACH37482.1"
FT                   /translation="MPLIQVLLVLIVVGVLLWLVNTYVPMAGSIKSILNAVVVIVVVIW
FT                   LLNVFGLMENITRLRVGK"
FT   gene            545793..545942
FT                   /locus_tag="Gbem_0454"
FT   CDS_pept        545793..545942
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0454"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37483"
FT                   /db_xref="GOA:B5EBL4"
FT                   /db_xref="UniProtKB/TrEMBL:B5EBL4"
FT                   /protein_id="ACH37483.1"
FT                   /translation="MLWTIVVILLILWLLGLVTSYTLGGFIHLLLVLAIIVVIINLIQG
FT                   RRPL"
FT   gene            546012..546911
FT                   /locus_tag="Gbem_0455"
FT   CDS_pept        546012..546911
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0455"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37484"
FT                   /db_xref="UniProtKB/TrEMBL:B5EBL5"
FT                   /protein_id="ACH37484.2"
FT                   /translation="MRITAAVITVLALAAVPCFAANGGATAGRAGGTGAAATIRQVPPG
FT                   QQMNQEMMPTPAHLLMRAYHRNVANFAQTLYQAADQGPVVQPSLARTAVSEMRRSVDEM
FT                   EKQRATALGAMRLPPERQKMMDEHLVQVKTHLRQLEEMVQKERIDSGLVKKELQSIFVE
FT                   CDGAGCCARPSPVGRGRQGKGPYGGRPGCDCPKGNPDHAMMMDDMMEKVKSQDAELAQL
FT                   VQRMRQADGQAKLDLVAETVATMVQQRAELTADMQKMHDMMQGEYPGSDQMLNDDEDQD
FT                   QGGDEEYDFEDEEDVTAD"
FT   gene            complement(547018..549579)
FT                   /locus_tag="Gbem_0456"
FT   CDS_pept        complement(547018..549579)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0456"
FT                   /product="sensor diguanylate cyclase/phosphodiesterase,
FT                   PAS, PAS and PAS domain-containing"
FT                   /note="domains: PAS, PAS, PAS, GGDEF, EAL"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37485"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:B5EBL6"
FT                   /protein_id="ACH37485.1"
FT                   /translation="MNDADSKNAVNRSRDRNAFDSDNANLSTEELVRELQVYTDLYEFS
FT                   PVGLFTLDDAGNIRSVNNTGASLLGRARPELVGVPFEQAVAEPSKGDFSVLLNDARTSQ
FT                   SKSACELTLISDSSRQLPVRIDALCCKEGTEYRLSVLDITKRKQSELALQRSEARYRRL
FT                   FETAKDGIMIVEADSGAIAEVNPFLVDILGCKREALLGKTVWELGFFARIVPGASDFKA
FT                   MQQKEYFHGDDLLLATVGGRDIPVEVVSNCYQSEQSSVVQFNIRDISIRKNAEQALLTS
FT                   EEQCRTIVSNINEYVYSVRFEEGDITSVYHSPKCFDITGYTPDEYYRDPLLWFTMIHEE
FT                   DRNLVVEFLNGIFAGLDHEPIRHRIIHKDGSVRWIVNNCAVQRQRRGDRLSITRLDGFI
FT                   LDITDIKRAEENIFFLAHHDPLTKLPNRSTLYERMEQVICAAQKSSRNVALLFLDIDGF
FT                   KQINDSMGHDVGDRLLQSVAKRLSDCTRSCDVVSRLGGDEFVVMLWDCGETETTVVAEK
FT                   VINAGFPVLGSNVTVTPSIGISVFPDDGRDYLTLLKHADIAMYHAKKSGGNNFQFFTHR
FT                   LNEIAHERFVLEAELRRALDREEFVLYYQPKVDLSTGRFSGMEALIRWQHPAHGLMLPE
FT                   SFIRIAEESGLLTQISKWIIPTVCRQIQQWQQQGINSVSAAVNLSASFFQHPDFEETIE
FT                   DSLLQTGIAPECLELELTEATIMSDPQRVLGSMAAMKALGLQLSIDDFGTGYSSLSYLK
FT                   KLPVDKLKIDQSFIHNIARDADNAAVVRAVISIGRSMQLRVIAEGVENASQLAWLQAEG
FT                   SEEAQGYYFSRPLPVAKMTALLKQRANFLHNPRGKTQSKTL"
FT   gene            549832..551355
FT                   /gene="lpdA-4"
FT                   /locus_tag="Gbem_0457"
FT   CDS_pept        549832..551355
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lpdA-4"
FT                   /locus_tag="Gbem_0457"
FT                   /product="dihydrolipoamide dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37486"
FT                   /db_xref="GOA:B5EBL7"
FT                   /db_xref="InterPro:IPR001100"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR012999"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B5EBL7"
FT                   /protein_id="ACH37486.1"
FT                   /translation="MSDQFVFQPDTAENRELEANVCPKSWINPVPSGRYNLVVVGAGTA
FT                   GLVCAAGAASLGARVALVERLALGGDCLNVGCVPSKALIRASRAVFDARHSGGFGVVGG
FT                   DALLADFAAALQRMRRLRAGISRHDSALRFRDELGVDVYLGQGTFTAPDTLQVEGAALH
FT                   FAKAALCTGARAAIPPVPGLEEAGCLTNETVFSLTSLPARLAVIGSGPVGCELAQAFAR
FT                   FGSKVTLVERGSGILGREDRDAAAILETAFRREGIELELGAKLVRAWSSGSEKRLLLER
FT                   DGVGFEIAVDAILVGAGRAPNTEGLGLEAAGVEYDKSGVKVNDYLQTTNRRIYAAGDIC
FT                   SGYKFTHVADAQARIVIENSLFPGRRKNSSLTVPWCTYTDPEVAHVGMYQADALARGLK
FT                   VETLTIPFGDVDRAVLDGESEGFARVHLKKGSDVILGATIVARHAGEMIGEVALAINAG
FT                   LGLSAIGRTIHPYPTQAESLRKLADSYNRGRLTPRVKKLMGAWLRWQRE"
FT   gene            551515..552189
FT                   /locus_tag="Gbem_0458"
FT   CDS_pept        551515..552189
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0458"
FT                   /product="membrane protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37487"
FT                   /db_xref="GOA:B5EBL8"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="UniProtKB/TrEMBL:B5EBL8"
FT                   /protein_id="ACH37487.1"
FT                   /translation="MNLKKILILVAAVIAVALFFYLDLGRYLTLESLKANRQALIQYYA
FT                   AHQAATVAGFMALYILQTALSLPGAAILSLAAGAIFGSLAGTFYAVMAATVGATLAFVV
FT                   TRYLLRDLVLDKFGPKLEGLNRELETRGFNYLLFLRLVPLFPFFLINLAAGLTRLPLRV
FT                   FVPGTLIGIIPGGFVFVNAGASLATINSLSDVASPRVLGSFALLGLFALVPVIYGKIKK
FT                   NA"
FT   gene            552356..553411
FT                   /gene="bkdA"
FT                   /locus_tag="Gbem_0459"
FT   CDS_pept        552356..553411
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bkdA"
FT                   /locus_tag="Gbem_0459"
FT                   /product="branched-chain 2-oxoacid dehydrogenase complex,
FT                   E1 protein, alpha subunit, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37488"
FT                   /db_xref="GOA:B5EBL9"
FT                   /db_xref="InterPro:IPR001017"
FT                   /db_xref="InterPro:IPR017596"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:B5EBL9"
FT                   /protein_id="ACH37488.1"
FT                   /translation="MPEEVLATFQVKRVSVLNENGSADLDLMPELSADQIWRMYQLMVL
FT                   SRCFDERAVSLQREGRLGTYPPIRGQEAAQVGSAFALKADDWVFPSFREMGVHLTLGYP
FT                   IPQLLQYWAGDERAQKTPPQLNIFPFCVAVGSQIPHAVGAALAARYRRDSAAVAVYFGD
FT                   GATSKGDFHEAMNMAGVYQLPIVFICQNNQWAISVPLKGQTASASLAQKALAYGFEGVQ
FT                   VDGNDVLAVYRATKQALEKATSGGGPTFLECLTYRMADHTTADDAGRYRSDEEVALWNG
FT                   RDPILRLERFLAASGAWTPEQGRGVKEEATSLIDRGVGEMEAVPPPDPAELFDATLAAL
FT                   TPRQAGQRKGR"
FT   gene            553413..554375
FT                   /gene="bkdB"
FT                   /locus_tag="Gbem_0460"
FT   CDS_pept        553413..554375
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bkdB"
FT                   /locus_tag="Gbem_0460"
FT                   /product="branched-chain 2-oxoacid dehydrogenase complex,
FT                   E1 protein, beta subunit, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37489"
FT                   /db_xref="GOA:B5EBM0"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/TrEMBL:B5EBM0"
FT                   /protein_id="ACH37489.1"
FT                   /translation="MAQLNMVQAINQALADEMARDDRVVLLGEDVGRDGGVFRVTDGLQ
FT                   DRFGAERVLDTPLCESAIMGAAIGMAAYGLRPVPEIQFMGFTYSAFEQLFAHAARLRSR
FT                   SRGRYSCPLVVRTPYGGGIKAPELHEESTEAIFCHIPGLKVVVPSGPYNAKGLLLAALR
FT                   DPDPVLFLEPTRLYRMVKEEVPEGDYQLELGKARVARKGSAVTVVAWGSMLERVLRAID
FT                   GYDAEVIDLLTLNPLDLEALLSSVQKTGRAVIVHEAIKTCGLGAEIAATLAEEAMLHLR
FT                   APILRVTAPDVPVPLAKLIDQYLPGPDRIRAALDEVLKY"
FT   misc_feature    complement(554402..554446)
FT                   /note="nonanucleotide repeats; Gbem_R9009"
FT   misc_feature    complement(554466..554492)
FT                   /note="nonanucleotide repeats; Gbem_R9010"
FT   gene            554561..555781
FT                   /gene="bkdF"
FT                   /locus_tag="Gbem_0461"
FT   CDS_pept        554561..555781
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bkdF"
FT                   /locus_tag="Gbem_0461"
FT                   /product="branched-chain 2-oxoacid dehydrogenase complex,
FT                   E2 protein, dihydrolipoamide acyltransferase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37490"
FT                   /db_xref="GOA:B5EBM1"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001078"
FT                   /db_xref="InterPro:IPR003016"
FT                   /db_xref="InterPro:IPR004167"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR036625"
FT                   /db_xref="UniProtKB/TrEMBL:B5EBM1"
FT                   /protein_id="ACH37490.1"
FT                   /translation="MSIDFKLPDLGEGIAEVELRRWLVAEGDAVAEHQPLVEVETDKAV
FT                   VEVPSPRAGVVARLHCKEGETVQVGATLVTFAEAKEAAKKEEPEGERRPAQRPPSVGIV
FT                   GSLPEPEEEATPAAPAGFEGLATPMVRKMARERGIDLKSVRGTGPRGCIKPEDLDQVPL
FT                   AAQKAKPAPPDGERVPLRGLRRTIARNVLASQRTTAFVTSMEEVDITDIWEMRGREQGE
FT                   VESRGAHLTFLPFFIKAVQHALREHPLLNGSIDDEAQELVLKKHYHFGIAVDTPEGLMV
FT                   PVIRDVDKKSIIELAQAVQELGRKARERSISLEELRGSSFTITNYGHFGGTFATPIINW
FT                   PDVAIMGFGRIVERPWVHRGQIAIRKILPLSLTFDHRATDGADAARFLGKVLRYLEDPA
FT                   LLFLDSA"
FT   gene            556190..557014
FT                   /locus_tag="Gbem_0462"
FT   CDS_pept        556190..557014
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0462"
FT                   /product="rhomboid-related membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37491"
FT                   /db_xref="GOA:B5EBM2"
FT                   /db_xref="InterPro:IPR022764"
FT                   /db_xref="InterPro:IPR035952"
FT                   /db_xref="UniProtKB/TrEMBL:B5EBM2"
FT                   /protein_id="ACH37491.2"
FT                   /translation="MSSTKCSRCGRQIDAREPQCIWCGAPRPSFGARFREMLRGGLDAG
FT                   FVVQAIIAANALFYLLSLLVSGRRGFDMNPLSFLSPDQNSLLLLGATGTIPVLELGRVW
FT                   SLISANYLHGGLLHILFNMMALRQIGPWVSAEFGASRMFVIYTLSGVAGYVASFFAGIP
FT                   FTIGASASVCGLIGALFYFGKSRGGNYGAAVSREVSGWLISLVLFGLIMPGINNWGHGG
FT                   GVVGGIVLAKLLGYQERSHENSAHRLLALICVVATVAVLCYAAYFSLAYRFS"
FT   misc_feature    557018..557070
FT                   /note="conserved palindrome; Gbem_R1014"
FT   gene            557183..557812
FT                   /gene="upp"
FT                   /locus_tag="Gbem_0463"
FT   CDS_pept        557183..557812
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="upp"
FT                   /locus_tag="Gbem_0463"
FT                   /product="uracil phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37492"
FT                   /db_xref="GOA:B5EBM3"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005765"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR034332"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5EBM3"
FT                   /protein_id="ACH37492.1"
FT                   /translation="MSVHEVNHPLVKHKIGLMREAGISTKKFRELTSEIACLLAYEASR
FT                   DFQIEPRTITGWDGSKVMIQQLKGKKVTVVPILRAGIGMLDGVLDMIPNAKVSVVGLAR
FT                   NEETLEAHTYFERFVGSLDERLALIIDPMLATGGSMAATIEMLKKNGCLQIRVLCLVAA
FT                   PEGLAKITAAYPEIDIYVAAIDERLNEQGYILPGLGDAGDKIFGTK"
FT   gene            557879..559156
FT                   /gene="uraA"
FT                   /locus_tag="Gbem_0464"
FT   CDS_pept        557879..559156
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="uraA"
FT                   /locus_tag="Gbem_0464"
FT                   /product="uracil transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37493"
FT                   /db_xref="GOA:B5EBM4"
FT                   /db_xref="InterPro:IPR006042"
FT                   /db_xref="InterPro:IPR006043"
FT                   /db_xref="InterPro:IPR029935"
FT                   /db_xref="UniProtKB/TrEMBL:B5EBM4"
FT                   /protein_id="ACH37493.1"
FT                   /translation="MSQAKEPVWRQALSGAQILFVAFGALVLVPILTGLNPSMALLGAG
FT                   VGTLIFQLCTKREVPIFLGSSFAFIAPIVYSVQTWGMPATLGGLFAAGWLYLALSLVIY
FT                   LRGADFIHRIMPPVVVGPIIMVIGLGLAGVAVNMAMGKTGDGKGVLVDYETAILVAAVS
FT                   LATTVAVAVRAKGIFRLLPVLSGVAVGYVLSIFLGLVDFTKIAAAPWIEVPTFVTPQFN
FT                   WAAVLFMIPVALAPAIEHVGDVVAIGAVTGKDYTVKPGLHRTMLGDGLAVCTAALIGGP
FT                   PVTTYAEVTGAVMITRCYNPVIMTWAAGFAIVMAFFGKFNAILQSIPVPVMGGIMMLLF
FT                   GSIASVGLNTLIHAQVDMHRPRNLVIVSLVLVFGIGGLSLNVAGQHLHGVSLCGIAAIL
FT                   LNLVLPKGEAPPMGVETDDAEPETVP"
FT   gene            559521..559988
FT                   /locus_tag="Gbem_0465"
FT   CDS_pept        559521..559988
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0465"
FT                   /product="bacterioferritin, cytochrome b1"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37494"
FT                   /db_xref="GOA:B5EBM5"
FT                   /db_xref="InterPro:IPR002024"
FT                   /db_xref="InterPro:IPR008331"
FT                   /db_xref="InterPro:IPR009040"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="UniProtKB/TrEMBL:B5EBM5"
FT                   /protein_id="ACH37494.1"
FT                   /translation="MKGNERVIEQLNVRLAEELTATNQYMVHAEMCENWGYKRLHAKIR
FT                   ERAIVEMKHAEKLIERILFLEGRPIVSRLDPIHIGGEIPKMHQFDHALEETAIKGYNES
FT                   IRLAVELGDNGTRELLQSILDQEEEHIDDIEAQLDQIVQMGVQNYLVDQVG"
FT   gene            complement(560086..560529)
FT                   /locus_tag="Gbem_0466"
FT   CDS_pept        complement(560086..560529)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0466"
FT                   /product="PAS domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37495"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:B5EBM6"
FT                   /protein_id="ACH37495.1"
FT                   /translation="MNELQDDELHRQLVQECNDAIIFSDRQGVIRLWNKGAERMLGFTA
FT                   EEAIGRSLDIFIPENQRARHWEGYFRVMETGYTHYQTDLLAAPALRKDGTRISSEFSMT
FT                   IIRDADGRVAGTAAVMRDVTAKWQKEKSLRARVAELEKELGQS"
FT   gene            560809..562890
FT                   /gene="mcp40H-2"
FT                   /locus_tag="Gbem_0467"
FT   CDS_pept        560809..562890
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mcp40H-2"
FT                   /locus_tag="Gbem_0467"
FT                   /product="methyl-accepting chemotaxis sensory transducer,
FT                   class 40H, putative dimer with helix-swapped heme-binding
FT                   site-containing PAS domain"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37496"
FT                   /db_xref="GOA:B5EBM7"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="UniProtKB/TrEMBL:B5EBM7"
FT                   /protein_id="ACH37496.1"
FT                   /translation="MFKNKLMHKILSIIGINLFIGITIVGCLAIWLQYRSSMELQAKNS
FT                   RNMEAVIAEEVAAFMMKDDSKSVANLAKVAKEKRFGFDVQVYNKEGKDTVSEKVDRQVA
FT                   DSLASGKRMEIRQVLDGIHTLRSAVPLLNEERCKQCHDGSDKYLGALLLTSSMEEGYQS
FT                   AIRMIAILLVAGIVFFLAMMLCMYLFFKKTVVRDLLFFSEKLKDIAEGEGDLTKEIPVR
FT                   SSDEIGDLARHINHLVRKLRETVTVLYELAENISISLCHVSNRAQKTVGYSAEQKDRSE
FT                   TVAVATEEMAATLNLVAGNTHQAAGFSAEVDEAANRGMSVVDDACRSIVSVRENVAQTL
FT                   DTVGKLESSSAQIGDIINLIEDIADQTKLLALNAAIEAARAGEHGRGFAVVADEVKMLS
FT                   EKTATSTKEIAKIITNIQLESREAARSISQEQERVEDGVAKSTAARECLEKILGLAGET
FT                   AQLINQIASATEEQSATTNEIADKIHNVSESASKVHADMTQSEKAFMELTGVAEQIFST
FT                   VGKFSVGNRHDEMKGAVCELRDRFLAAIDAGVAAGRITMADLSDRNYRPIPNTSPQKYN
FT                   TAFDSFFDQFISPLQEETLSKNGDIFFAICVDDRGYTASHNLRYSKPLTGDPDLDRVNN
FT                   RTKRIFDDKTGLKAAQNVEPFLLQTYMRDTGEVMNDISTPISINNRHWGAVRLGYRAE"
FT   gene            563604..565199
FT                   /gene="ato-1"
FT                   /locus_tag="Gbem_0468"
FT   CDS_pept        563604..565199
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ato-1"
FT                   /locus_tag="Gbem_0468"
FT                   /product="succinyl:acetate coenzyme A transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37497"
FT                   /db_xref="GOA:B5EBM8"
FT                   /db_xref="InterPro:IPR003702"
FT                   /db_xref="InterPro:IPR026888"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="InterPro:IPR038460"
FT                   /db_xref="UniProtKB/TrEMBL:B5EBM8"
FT                   /protein_id="ACH37497.1"
FT                   /translation="MSQYGTLQDRVKCKQLLNKVMAPEQTIEFFKNGMNLGWSGFTPAG
FT                   YPKVVPIALADHVEKNNLQGKLRFNLFIGASVGAETEDRWATLDMIDRRWPYQTGKNIA
FT                   AGINAGRIRMGDKHLSLFAQDLGYGFYTKDSESGKLDLAIIEVSAIKEDGSLVPTSSCG
FT                   VIPEILMICDKIIVEVNTGQPSFEGIHDLLTPLTPPNRQILGITHAGERIGSTSIPCDP
FT                   SKIVAVVESKLRDQGRAFAEQDDTSEAIANHIIDFFTHEVKAGRLPKNLLPIQSGVGSI
FT                   ANAVIGGLAKGPFSNLTVYTEVLQDTMLDLFDSGKLDAASSCSLSLSATPGFPRFFENM
FT                   DKYFDKITLRPLSISNAPEPIRRLGCIAMNTPVEIDIYAHANSTLVGGTRMINGLGGSG
FT                   DFLRNGFLKMMHTPSSRPSKTDPNGISCVVPHCSHIDHTEHDLDCVITEQGLADLRGMA
FT                   PKERARRIIEKCAHPDYKPQLTEYLNIAEKECLAKKVGHEPQLWDRAFKMHLNLEKNGT
FT                   MKLKNWDVKIDLCE"
FT   misc_feature    complement(565229..565258)
FT                   /note="conserved palindrome; Gbem_R0096"
FT   gene            complement(565274..567788)
FT                   /locus_tag="Gbem_0469"
FT   CDS_pept        complement(join(565274..565798,565800..567788))
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0469"
FT                   /product="sensor histidine kinase response regulator, GAF
FT                   domain-containing"
FT                   /note="domains: GAF, HisKA, HATPase_c, REC"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37498"
FT                   /db_xref="GOA:B5EBM9"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B5EBM9"
FT                   /protein_id="ACH37498.2"
FT                   /translation="MTQKQLYNSRILLTYLNLLNSRYGEVDHADILDYAGISPYQVTDA
FT                   AHWFTQSQVDRFNERLVQLTGNPGIAREGGRYAASRDSLGFIGKYVLGLIGPGNAFFTI
FT                   NQSSSNFTRSSRFACRKLATNKVEITVTPLPGVKERPFQCENRIGFFEAILASFNCESP
FT                   LIDHSECTFKGGACCRYVISWRNSLPRRLRTTRNLFTAGMVALALVFHHPFPWTALSLG
FT                   PLFLAFFCALSHLASHLEKREPHAALVNLKESTDELLEQTATNYQNALMVNEVGQAVSK
FT                   QTNKDQLLDNIVAALEMRLGYDRGMILLADANRATLKFRVGFGYDESQLKTLQDACFSL
FT                   DNPDSQGVFATCFTQHKPYLINDFSRVASLHSPQSVLFAQHMGAQSFICCPIVCEGESL
FT                   GVLAMDNVRTKRPLVGSDMSLLMGVAPVIGISIRNAIYIDNERSMTEQLRQSQKREAIG
FT                   ELASGVAHDFNNLLTAIIGFASLAQANLDPGTIPFQYLDEVLNASERATYLTRGLLAFG
FT                   RNQAANPQPVDLNRIVGQMEKLLGRLISRQIELKVSLCHESPTVLADAGQLDQVVMNLA
FT                   TNARDAMNNAGVLTIETAVVTFPPDSDRAHGVKRGGRYARLSVRDTGRGMDEATRGRLF
FT                   EPFFTTKETGQGTGLGLAIVQGIVQQNGGFIEVESTPGEGACFLIHLPLLQEISAPAQA
FT                   PLAAPLPCAGCETILVAEDALEVRRVTTELLQQHGYRVIEAADGREALEKFLAHQDQIK
FT                   LVIMDLVMPRMNGRDAFDAIAKCNPDLKVLFTSAYPPEEVDAGRAVLPEGSFLAKPCQP
FT                   RPLLLAVRRLLGTGRGMRQEMLTRG"
FT                   /artificial_location="low-quality sequence region"
FT   gene            complement(567960..568841)
FT                   /gene="xerC"
FT                   /locus_tag="Gbem_0470"
FT   CDS_pept        complement(567960..568841)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="xerC"
FT                   /locus_tag="Gbem_0470"
FT                   /product="site-specific recombinase XerC"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37499"
FT                   /db_xref="GOA:B5EBN0"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR011931"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR023009"
FT                   /db_xref="UniProtKB/TrEMBL:B5EBN0"
FT                   /protein_id="ACH37499.1"
FT                   /translation="MKAELEQFYSYLETERNVSPHTLAAYRSDLEQFLSFLAREREAPR
FT                   AEEVDHLAIRRYLAQLHKGCAKSSIGRKLSAIRALFRYLMREGKLEKNPAELVSTPKKE
FT                   KRLPFHLNIDQVSALVTAPAGSSGLPLRDRAVLETLYSCGIRVSELTGMNVGDMDLAAG
FT                   LARVMGKGGKERLVPVGSCARSALAAYLAERADPGPAEPLILNARGGRLTRRSVARIVD
FT                   AHMLLIAAMRKVSPHTLRHTFATHLLEGGADLRAIQELLGHASLSTTQKYTHVSIDKLM
FT                   EVYDKAHPKARE"
FT   gene            568897..570033
FT                   /locus_tag="Gbem_0471"
FT   CDS_pept        568897..570033
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0471"
FT                   /product="DUF362 iron-sulfur cluster-binding domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37500"
FT                   /db_xref="InterPro:IPR007160"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:B5EBN1"
FT                   /protein_id="ACH37500.1"
FT                   /translation="MYQVAVEKVGDYRRELVQEGLARLLARLGGMERFVKPGERVLIKP
FT                   NLLSAKPPEAAVTTHPELLRAVILQVQQAGGIALVGDSPGIGSAVKVARRSGMLAVIEE
FT                   TGAEFVPFVESREVQGSGVYRRFELAAPYLEAQRLINLPKLKTHEMMTMTCCVKNLFGA
FT                   IVGTQKAAWHLKAGADKDLFARMLLEVYRLREPDLNIVDAIVGMEGNGPGSGDPCQVGL
FT                   LLAGDNALAVDQVAAEIAGIPKKLLYVENAARQMKLPGAERAEVECLGLDSNEVPFRSF
FT                   RLPHLSDVQFGLPAFLKHRLRNQLTSRPEVVEGACRLCEVCVKTCPPGAIRVEGGRLRF
FT                   DYRRCIRCFCCRELCPHAALRLKDGWLLSLIKKSGTPL"
FT   misc_feature    570124..570270
FT                   /note="conserved nucleotide sequence; Gbem_R0097"
FT   gene            570523..571977
FT                   /locus_tag="Gbem_0472"
FT   CDS_pept        570523..571977
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0472"
FT                   /product="lytic transglycosylase, SLT, LysM and LysM
FT                   domain-containing"
FT                   /note="domains: SLT, LysM, LysM"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37501"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/TrEMBL:B5EBN2"
FT                   /protein_id="ACH37501.1"
FT                   /translation="MIKTTLIILSLLFSTTAFAAPASTAAEQRDLARAMQVASNSSDVA
FT                   LSKGLGLTPSDFSDDEDFSDDSQDYDLKLPEMELPDSDIPLTFNTKVDYFVRYFQGPAR
FT                   PVFAKWLSRSERYIPMMKTVLKKEGLPEDLVYLAMIESGFMTHAVSVASAVGPWQFMPA
FT                   TGKRYALRIDPWVDERRDPLKATIAAALYLKELYALFNNDWYLAAAGYNAGENKILRAI
FT                   NMYNTRDFWEISKGSYLARETKDYVPKLLAAAIIAKEPAKHGFADVAYLPPIEFDVVKI
FT                   PSRTDLEVVAKACGVSVQTIRDLNPALRRGSTPPDYPGYQLKVPRGAAASFETEYAKVP
FT                   ESERYTEKVKHVRYRAKKKDTLVSIARRFKTTPQAIAELNDLGHKKAAKLHGKVLTVPV
FT                   LVAAQGEQTSTPALAEAKAEAKEFHKYYTVKKGDTLASLAKRFNVTARVLSAWNNLKTR
FT                   VALKPGKRIIVAKYQEKKGAGARDSG"
FT   gene            572047..572778
FT                   /locus_tag="Gbem_0473"
FT   CDS_pept        572047..572778
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0473"
FT                   /product="TPR domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37502"
FT                   /db_xref="GOA:B5EBN3"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:B5EBN3"
FT                   /protein_id="ACH37502.1"
FT                   /translation="MYNLLISAGAAVAVFLIVSLSAGFQQYWWAGALAALVVFLGSFLV
FT                   ISRIVTKKLEAIMEPAMKDIQAQRFEKGIRDLKSALRFGKWQIYVESQINSAIGMVYFV
FT                   RRDFSTAFPYLEKGFFKNWVTMGMLAVTYMKRNKQDKMKETFDKALMGTPKESLLYALY
FT                   AYCLNEIGETVKGCEVLAKGVSKLPGDENLKQNLELLREGKKMKMKGYGEMWLQFHLES
FT                   LGTIQKQQMAAMGGRRRIIRK"
FT   gene            572881..574686
FT                   /gene="typA"
FT                   /locus_tag="Gbem_0474"
FT   CDS_pept        572881..574686
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="typA"
FT                   /locus_tag="Gbem_0474"
FT                   /product="translation-regulating membrane GTPase TypA"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37503"
FT                   /db_xref="GOA:B5EBN4"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006298"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035651"
FT                   /db_xref="InterPro:IPR042116"
FT                   /db_xref="UniProtKB/TrEMBL:B5EBN4"
FT                   /protein_id="ACH37503.1"
FT                   /translation="MQEKIRNIAIIAHVDHGKTTLVDAMLKQSGVFRENEAITERVMDS
FT                   NDLEKERGITILAKNLSIHHGGYKINIVDTPGHADFGGEVERVLKMVDSVLLLVDALDG
FT                   PMPQTRFVLKKSLDLGLKPIVVINKVDRPGARPAEVVDMVFDLFCELQASDAQLDFAIC
FT                   YTSAKMGYAMREMEHPSENMEPLFELIKENVHPPEGDAAAPFQLLVTNIDYNDYIGRIA
FT                   TGKIFNGKVSSGETVALIKRDGTISKARVTKLLGYEGLKQVEIAEAFTGDIVTIAGFTE
FT                   VGIGESLAAADNPIPLPYVAIDEPTLSMNFIVNSSPFAGREGKLVTSRNIRERLDRELR
FT                   TNVSLRVSDTSNADTFQVSGRGELHLSILIENMRREGFEMAVSKPEVIMRMVNGVRHEP
FT                   MEYLVVDVPAEYQGAIIERMGPRKGEMAAMTPMGDTIRLEFIVPARGLIGLRGEFLTET
FT                   RGTAVITHTFHEYAPYKGEIPGRKNGVLIAMEQGETTAYSLDALQPRGILFLGAGVEVY
FT                   GGMIVGQHAKDNDLEVNPCKGKKLTNVRASGSDDAIKLTPPRLLTLEQALEFIDEDELV
FT                   EVTPMSIRLRKKFLDPNMRKRANRS"
FT   gene            574767..575537
FT                   /gene="yfiO"
FT                   /locus_tag="Gbem_0475"
FT   CDS_pept        574767..575537
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yfiO"
FT                   /locus_tag="Gbem_0475"
FT                   /product="outer membrane protein assembly lipoprotein YfiO,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37504"
FT                   /db_xref="GOA:B5EBN5"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR017689"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR039565"
FT                   /db_xref="UniProtKB/TrEMBL:B5EBN5"
FT                   /protein_id="ACH37504.1"
FT                   /translation="MQLRPLRHLALCSALCLISACASTPAPVKSADAHFKEGEAAYASR
FT                   NYAEAIESWKKVKESDTAPGLTSQAELKIADAHFENKAYIEAAAAYEDFRKLHPTHPQA
FT                   PYALYRLALSHYQQITGTDTDQTPVKNAVATLEAFLGQYPRSEYAPELSGKLADCRDKQ
FT                   LAYENYVGNFYLRTEKYQSAIKRLNEALVRFPGLTRLDDTLFYLGKAYLKAGDVKQGKV
FT                   VLQRLAAEHPGSPRNKEAAALLQKGFADYSSHGV"
FT   gene            complement(575582..576877)
FT                   /locus_tag="Gbem_0476"
FT   CDS_pept        complement(575582..576877)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0476"
FT                   /product="response receiver sensor diguanylate cyclase, PAS
FT                   domain-containing"
FT                   /note="domains: REC, PAS, GGDEF"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37505"
FT                   /db_xref="GOA:B5EBN6"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:B5EBN6"
FT                   /protein_id="ACH37505.1"
FT                   /translation="MGRLLRVLMVEDAPDDAQLIVIRLEQGGFDVQFQRVDSAQAMCDA
FT                   LEGSPWDIIICDYVMPGFSGLQALKILKEKGTDTPFLMISGKVGEEAAAEAIRCGADGF
FT                   LLKGNLTGLVPAVQRGLADAALREQNRRHEQELKDKLSFIQILIDTLPTPIFYNDPNGL
FT                   YLGCNKAFEEQIGMKRGESINKSIYDILPPDLAALYTRGEEVAESGSGPRSFEGTITCA
FT                   DGEERDVIFYSASFSNSGSTDGGVVGALLDISERKRAETKLRYLSTHDMLTGIYNRAYF
FT                   DEELERLKKGRKFPVSIVMADVDCLKEANDRYGHAAGDELLKQAAEVLKSAFRREDVAA
FT                   RIGGDEFAALLPNTDEAALVEAMERLQQQLLLSNKEHHGFPLTLSLSTGAATALNGEEL
FT                   SAAWRVADQRMYREKKGRSAGTPHFRQRHISV"
FT   gene            577189..578319
FT                   /gene="rlmL"
FT                   /locus_tag="Gbem_0477"
FT   CDS_pept        577189..578319
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rlmL"
FT                   /locus_tag="Gbem_0477"
FT                   /product="23S rRNA (2-N-methyl-G2445)-methyltransferase,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37506"
FT                   /db_xref="GOA:B5EBN7"
FT                   /db_xref="InterPro:IPR000241"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR004114"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B5EBN7"
FT                   /protein_id="ACH37506.1"
FT                   /translation="MDQERFFATTAKGVEEVLAAELTRLGASDVAVDSGGVRFGGGMEA
FT                   VYRANLWLRSASRVLMPLGEFPCETPEQLYQGVRGLSWVNYLTPAMTLAVDCSLRDSAL
FT                   THSGFVALKAKDAIVDVLRDHFGSRPNVDTKDPDLRVNLRLFRNRCTVSLDCSGTPLDR
FT                   RGYRLDRHEAPLKENLAAALVELSGWDATTPLIDPMCGTGTIVIEAAMKALRIPPGLSR
FT                   QGFGFQRWRGFDRALWERVVSEARSGMLTSLPAPVQGTDISHSAVGMAAQNAKRAGVLE
FT                   QISLGRQQLSELAPPPGPGVIIMNPPYGKRLGEEEALRPLYKEIGDVLKKRCKGYTAYL
FT                   FTGNLELAKGVGLKATRRIVLYNGPIECRLLKYEMY"
FT   gene            578396..578472
FT                   /locus_tag="Gbem_R0011"
FT   tRNA            578396..578472
FT                   /locus_tag="Gbem_R0011"
FT                   /product="tRNA-Ile"
FT   misc_feature    578482..578584
FT                   /note="conserved nucleotide sequence; Gbem_R0098"
FT   gene            578592..579710
FT                   /gene="yqfO"
FT                   /locus_tag="Gbem_0478"
FT   CDS_pept        578592..579710
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yqfO"
FT                   /locus_tag="Gbem_0478"
FT                   /product="dimetal-binding protein YqfO"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37507"
FT                   /db_xref="GOA:B5EBN8"
FT                   /db_xref="InterPro:IPR002678"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="InterPro:IPR017221"
FT                   /db_xref="InterPro:IPR036069"
FT                   /db_xref="UniProtKB/TrEMBL:B5EBN8"
FT                   /protein_id="ACH37507.1"
FT                   /translation="MITPRVSDISGITGKIAPTHLAESWDNVGLQLGDPSSQVSRIMVA
FT                   LDPGRPAVEAAVEIGCQLLITHHPFIFTPLKKISTADETGRLAILALKNDLSIISLHTN
FT                   FDIAPGGVNDLLAGLLGIQGAQPLRITGGDEYVKMVLFAPSGCEEKLLGALSPFMPHIG
FT                   NYRDCSYQGEGTGRFTPLPGARPFVGEVGASHAEPESRLEILLVKERIAAAVAALKGAH
FT                   PYEEPAYDLYPVLNRGEAYGLGRIGKLAEPVTAGAYALQVKERLAATGVRLVGDPARQV
FT                   KKVALCGGSGASLIHEAQRKGADLLVTADVKYHEAREAEALGLALLDAGHFSTEYPMVQ
FT                   GLAGQLRAALQAKRFEAEVLEYQGEREPFSFW"
FT   gene            579757..580473
FT                   /locus_tag="Gbem_0479"
FT   CDS_pept        579757..580473
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0479"
FT                   /product="protein of unknown function DUF164"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37508"
FT                   /db_xref="InterPro:IPR003743"
FT                   /db_xref="UniProtKB/TrEMBL:B5EBN9"
FT                   /protein_id="ACH37508.1"
FT                   /translation="MRNSLKSLYELQEIDLRIDGLDSEKEQLLNEAQALEAKLADAREK
FT                   IAARREEARTLEEEKGALEANLQAEGENIARSEAHLKEIKTQKEYQAVSKEISTAKKLI
FT                   AELEDQILQKINAIEEVNADVTKKEADLSELEGNVAAQKGEVEAKVQSLDSGIAQDAAT
FT                   REQTVKGLPASVMKRYSRLRDQRRGVAVVEAREGNCMGCNMHLPPQLYNTLFRADDVIT
FT                   CPHCQRILIMKQEVQD"
FT   misc_feature    complement(580480..580503)
FT                   /note="heptanucleotide repeats; Gbem_R7063"
FT   misc_feature    580622..580649
FT                   /note="conserved nucleotide sequence; Gbem_R0099"
FT   gene            580627..581051
FT                   /gene="rnpB"
FT                   /locus_tag="Gbem_R0012"
FT   ncRNA           580627..581051
FT                   /gene="rnpB"
FT                   /locus_tag="Gbem_R0012"
FT                   /product="RNase P, RNA component"
FT                   /ncRNA_class="RNase_P_RNA"
FT   misc_feature    complement(581067..581090)
FT                   /note="heptanucleotide repeats; Gbem_R7064"
FT   misc_feature    581170..581193
FT                   /note="heptanucleotide repeats; Gbem_R7065"
FT   gene            581239..581775
FT                   /locus_tag="Gbem_0480"
FT   CDS_pept        581239..581775
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0480"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37509"
FT                   /db_xref="UniProtKB/TrEMBL:B5EBP0"
FT                   /protein_id="ACH37509.1"
FT                   /translation="MKWEREWGKAVSAVNAGFLALPQEKAHRLHELSRAMVALKERMQH
FT                   LVAQVDAAELCAGCGGACCVCGKYHFAAVDLLVYLATQEPLFTPRFDNGLCPYLGEPNC
FT                   LVPAGYRPFNCITFNCELIEDRLAHSEVSRFYLMERELRELYAEIRSLFPCGAMDGSLL
FT                   RDAAPSPILRTTTAF"
FT   gene            581792..582133
FT                   /locus_tag="Gbem_0481"
FT   CDS_pept        581792..582133
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0481"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37510"
FT                   /db_xref="UniProtKB/TrEMBL:B5EBP1"
FT                   /protein_id="ACH37510.1"
FT                   /translation="MSTVNDLVLVHIDNKPSFYARIEDISPDVKQGWWKVQLLVLTVPL
FT                   QVYTWILDESQVNGSPFTMAGTPIMLEKVVSPEPPPRPLASVGKEGKGAGKDTPRKGGN
FT                   VVSLFDRKK"
FT   gene            582414..582896
FT                   /gene="mraZ"
FT                   /locus_tag="Gbem_0482"
FT   CDS_pept        582414..582896
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mraZ"
FT                   /locus_tag="Gbem_0482"
FT                   /product="cell division protein MraZ"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37511"
FT                   /db_xref="GOA:B5EBP2"
FT                   /db_xref="InterPro:IPR003444"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR020603"
FT                   /db_xref="InterPro:IPR035642"
FT                   /db_xref="InterPro:IPR035644"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="InterPro:IPR038619"
FT                   /db_xref="UniProtKB/TrEMBL:B5EBP2"
FT                   /protein_id="ACH37511.2"
FT                   /translation="MFRGKFDTTIDAKGRTSIPAKFREVLLDTFGDERFFLTKSSPVRL
FT                   DGDEVCYGLVIYPYHEFLALEEKLKDGTALGLTVNQLAAVRRTVLVPAVECVADKLGRV
FT                   LVPNDLRKTAQLEREIHFVGMQNKVDIYSQSVWARVCEQDEQNFPVDSAALAGLGL"
FT   gene            582897..583835
FT                   /gene="rsmH"
FT                   /locus_tag="Gbem_0483"
FT   CDS_pept        582897..583835
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rsmH"
FT                   /locus_tag="Gbem_0483"
FT                   /product="16S rRNA (N4-methyl-C1402)-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37512"
FT                   /db_xref="GOA:B5EBP3"
FT                   /db_xref="InterPro:IPR002903"
FT                   /db_xref="InterPro:IPR023397"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5EBP3"
FT                   /protein_id="ACH37512.1"
FT                   /translation="MEDFHHISVLPDEVLQALSPRSGGVYVDGTLGGAGHAGLILTASA
FT                   PDGQLIGFDRDEEAIAVARERLQVFGGRVRIIHRNFAGIAQALAEIGVDGIDGFVLDLG
FT                   VSSHQLDRDERGFSFMHDAPLDMRMDRSSGQSAADLVNTLPEGELYRIISEYGEERWAK
FT                   RVASFIVKARDERPIETTLQLVDVIKGSIPKAKWEERLHPATRTFQALRIAVNEELKSL
FT                   EEGLEGLLSLLKQGGRGAVISFHSLEDRIVKEGFRAAATGCTCPKELPICICGRVPRFK
FT                   LVTRKPITAGEAEVAANPRSRSAKLRVVEKI"
FT   gene            583848..584183
FT                   /gene="ftsL"
FT                   /locus_tag="Gbem_0484"
FT   CDS_pept        583848..584183
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsL"
FT                   /locus_tag="Gbem_0484"
FT                   /product="cell division septum formation protein FtsL,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37513"
FT                   /db_xref="GOA:B5EBP4"
FT                   /db_xref="InterPro:IPR007060"
FT                   /db_xref="InterPro:IPR011922"
FT                   /db_xref="UniProtKB/TrEMBL:B5EBP4"
FT                   /protein_id="ACH37513.1"
FT                   /translation="MSQSKVAYGKVAAPARPGAVPRESWISFPYLTGVMVLLTLVSIFH
FT                   VWSRVELIDMNLKIGEASRQLKEQQQENKRLRVEVASLKAPARIEALAKGELGMALPSD
FT                   QQVVLVK"
FT   gene            584180..586162
FT                   /gene="ftsI"
FT                   /locus_tag="Gbem_0485"
FT   CDS_pept        584180..586162
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsI"
FT                   /locus_tag="Gbem_0485"
FT                   /product="peptidoglycan transglycosylase and transpeptidase
FT                   FtsI"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37514"
FT                   /db_xref="GOA:B5EBP5"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR005311"
FT                   /db_xref="InterPro:IPR005543"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR036138"
FT                   /db_xref="UniProtKB/TrEMBL:B5EBP5"
FT                   /protein_id="ACH37514.1"
FT                   /translation="MIEKKEKWARVRMRFVALLFVVVFVATTGRAFYLQVLNNDRLVKL
FT                   AEKQHQRIVALTPARGAIYDRTNAPFAVSIEMDSCYAETRNMENIPQEAAQLAPLLGYG
FT                   AQELESKLKGAKNFVWLARRIPPEQAGKVKALGLEGVGFVKESKRFYPNSQVAAHVVGF
FT                   TGVDPGGLEGVEKKYDATILGNTGFLVTERDALGRDIALKKGSEGKSGSKGNNVVLTLD
FT                   KNVQYIAEKELTNAVVKNGAKAGIAIVMEPDTGRVLAMANYPSFNPNSFAEYGQAALRN
FT                   RAIADSFEPGSTFKIFLVASALEAGVIRPGDMFNCENGSYSVYGRTIHDTHKYGALSVP
FT                   QILKYSSNIGAAKIGSRLGPERLYAALTGFGFGEKSSIDLPGEASGMLRPQSKWYGIDL
FT                   ATISFGQGVTATALQITNAVSAVANGGNLMKPYLVDRIVDDNGVVLQQFAPQVKRRIIS
FT                   PETAKTVARMLEGVVVEGGTGTGAAVEGYRVAGKTGTAQKVEGHGYSASKRTASFVGFV
FT                   PLDKPRLAIMVVVDEPTTSSYGGVVAAPAFSAIAQQTLCYLNVAPDKNVVAKKKSGAAP
FT                   EKSAPKPEPVAEGGSVEGGSVEGTAAGAMPNFRGMSMRQVLKVMEKRGLNVKLQGSGRA
FT                   VEQNPAPGSRITTQDQVWVKFVPSA"
FT   gene            586176..587693
FT                   /gene="murE"
FT                   /locus_tag="Gbem_0486"
FT   CDS_pept        586176..587693
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murE"
FT                   /locus_tag="Gbem_0486"
FT                   /product="UDP-N-acetylmuramylalanyl-D-glutamate--2,
FT                   6-diaminopimelate ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37515"
FT                   /db_xref="GOA:B5EBP6"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005761"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR018109"
FT                   /db_xref="InterPro:IPR035911"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:B5EBP6"
FT                   /protein_id="ACH37515.1"
FT                   /translation="MKLAQLLNCLASPELSGDAGIEIESLCYDSRKVAPGALFFALRGV
FT                   KSDGTEFVEAAVKGGAVAIVADRPCACPGVTVVVVPDPRLAMSLMAAAFYGTPTRGIPV
FT                   VGITGTNGKTTTTYLVEGIMEQAGVPAAVLGTISYRFGETNIPAPNTTPESVDLQAILR
FT                   ELVDHGARGAVMEVSSHALEQHRVDGCLFDVALFSNLTRDHLDYHLDMESYFKSKLRLF
FT                   TDLLAPTAEKPLRRAVVNLDDPFGPRIAEKAAAPVLTYSMTGKADISVAEAEFSVDGIR
FT                   CRLNTPVGEISLASELLGRFNLYNILSAVGAGLALGYSKEAIRAGIEGHKRVPGRLERV
FT                   ETEEGITVLVDYAHTGDALENVLSTVSELKTDRIITIFGCGGDRDKGKRPVMGEIAARY
FT                   SDLAVITSDNPRTEDPQAILEDVRAGILPLGLREYGLEELAAGFHEKGFATIESRRAAI
FT                   RAALLAAHPGDIVLLAGKGHEDYQIVGTEKFHFDDREEAAAALKLRG"
FT   gene            587817..589226
FT                   /gene="murF"
FT                   /locus_tag="Gbem_0487"
FT   CDS_pept        587817..589226
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murF"
FT                   /locus_tag="Gbem_0487"
FT                   /product="UDP-N-acetylmuramylalanyl-D-glutamyl-2,
FT                   6-diaminopimelate--D-alanyl-D-alanine ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37516"
FT                   /db_xref="GOA:B5EBP7"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005863"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR035911"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:B5EBP7"
FT                   /protein_id="ACH37516.1"
FT                   /translation="MAMFTLNEIAEATGGRVIGEAAGEASAVSTDSRQVAPGELFVALR
FT                   GERFDGHDFIIPAVSKGVTIFLAEESWAAKHELPKGAGAVLVPDTLRALGDLAAYHRRR
FT                   FNLKTVCVTGSNGKTTTKEMLARILAQTGPGLKTEGNLNNLIGLPLTIFRLTGRERWAV
FT                   FEIGMSEFGEIDRLAEIAEPQVGIITNAFPAHLETLGSVEGVARAKGELFLRLKPGSVA
FT                   VYNVDDPLVSTCPTHLNVTRLTFGLRGAEVSSASIQSLGKRGESFTLRLPDGEQQVTLS
FT                   AYGRHNIYNALAAAAAAHALGVPGDLIRQGLEEFSPYDKRFQLEEVAGVTLIDDSYNAN
FT                   PASMAAALTTLKELQGEGRLVAVLGDMLELGLGTEEAHRELGKLAAGNVDRLYLLGKLV
FT                   EETAKGALEAGLPAADLVLGRDHDQLAQELLSFVQPGDCILFKGSRGMKMDKVAQLVRQ
FT                   GLASAAKGGND"
FT   gene            589226..590302
FT                   /gene="mraY"
FT                   /locus_tag="Gbem_0488"
FT   CDS_pept        589226..590302
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mraY"
FT                   /locus_tag="Gbem_0488"
FT                   /product="UDP-N-acetylmuramyl-(pentapeptide)--undecaprenyl-phosphate
FT                   N-acetylmuramyl-(pentapeptide)-phosphotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37517"
FT                   /db_xref="GOA:B5EBP8"
FT                   /db_xref="InterPro:IPR000715"
FT                   /db_xref="InterPro:IPR003524"
FT                   /db_xref="InterPro:IPR018480"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5EBP8"
FT                   /protein_id="ACH37517.1"
FT                   /translation="MLYHLLYPLASDYKLFNVFKYLTFRSIYAMITALLLAFIVGPWVV
FT                   RKLEALQARQVIRTDGPESHLKKQGTPTMGGVLILVCIVLPTLLWADLKNVFIWLTLLI
FT                   IVGYGVLGFVDDYKKVVEKNPKGLSPRQKMFWQMLLAAGVGIFLFYLPGFSTELYLPFF
FT                   KRVHPELGILFIPFVMLVIVGASNAVNLTDGLDGLAIGPVAINAATYLLFCYIAGNAKL
FT                   SGYLQIPYVPGAGELAVLCGAMVGAGLGFLWYNSYPAEVFMGDVGSLSLGGALGTLAVL
FT                   TKQEILLVIVGGVFVVEALSVIFQVGSYKYRGKRIFRMAPIHHHFELKGVAEPKIIVRF
FT                   WIITIILALVAISTLKMR"
FT   misc_feature    590317..590427
FT                   /note="conserved palindrome; Gbem_R2010"
FT   gene            590464..591822
FT                   /gene="murD"
FT                   /locus_tag="Gbem_0489"
FT   CDS_pept        590464..591822
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murD"
FT                   /locus_tag="Gbem_0489"
FT                   /product="UDP-N-acetylmuramylalanine--D-glutamate ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37518"
FT                   /db_xref="GOA:B5EBP9"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005762"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5EBP9"
FT                   /protein_id="ACH37518.1"
FT                   /translation="MELKDKKILVVGLAKTGVAVTRFLAQAGAFVTVTDMREEEALSDV
FT                   LAELSDLDITYELGRHVPYSFLMADLIVVSPGVPMDIKPLEMARSQKRRVVSEVELASW
FT                   FIKAPMVAITGTNGKTTTTTLTGEIFKACGFETFVGGNIGNPLIELAESGQEVSRVVVE
FT                   LSSFQLEGVESFRPDVAVLLNITEDHLDRYHSFQEYIDAKLRIFENQTADDFAVLNIDD
FT                   PLVAACASKLKAQLFPMSRLHELEEGISYRDGFITFSHKGKVLRFGTEGFKLKGVHNLD
FT                   NIMASLASTLLMRCDGDCAYEAVKNFKGLPHRMELVEEIDGVAYYEDSKGTNVGSVVKS
FT                   LESFDSGITLIAGGKDKGGSYEPLAPLVESRVSHLVLIGEAKARMNEALGSLTDTHLAE
FT                   TLEEAVEISRRLTKPGGVVLFSPACSSFDMFKNYEERAQRFKAAVRAGKKGEA"
FT   gene            591819..592925
FT                   /gene="ftsW"
FT                   /locus_tag="Gbem_0490"
FT   CDS_pept        591819..592925
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsW"
FT                   /locus_tag="Gbem_0490"
FT                   /product="cell division protein FtsW"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37519"
FT                   /db_xref="GOA:B5EBQ0"
FT                   /db_xref="InterPro:IPR001182"
FT                   /db_xref="InterPro:IPR013437"
FT                   /db_xref="InterPro:IPR018365"
FT                   /db_xref="UniProtKB/TrEMBL:B5EBQ0"
FT                   /protein_id="ACH37519.1"
FT                   /translation="MRKLEGYDMIVLLMAVILTCFGVVMVYSASSVMAAKKFHDGFFFL
FT                   KRQSLYALMGFVGMALAMHVDYHVWKKYAVPLFLGCFVLLVLVFVPGIGGTAKGASRWI
FT                   KLPFFNFQPSELAKVALIIYMAYSLEKRQDKLKQFMAGFFPYMLILGVFIAVLLAQHDM
FT                   GAALTMFAVAIMMLFAAGTRVQYILGMGLIALPGIVYLVVTKAYRMRRITAFLDPWQDP
FT                   TDTGFQIIQSWLALGTGGFFGQGLGEGKQKLFYLPEAHTDFILSVLGEEMGFIGVIVIA
FT                   CMFLVLVQRSIRVAIAAEDSFGRFLAFGIAVLLGLEAFINMAVVTGMLPTKGIALPFLS
FT                   YGGSSLIISLTAVGVLLNVSTRMRGNPA"
FT   gene            592922..593998
FT                   /gene="murG"
FT                   /locus_tag="Gbem_0491"
FT   CDS_pept        592922..593998
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murG"
FT                   /locus_tag="Gbem_0491"
FT                   /product="UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide)-pyrophosphoryl-undecaprenol
FT                   N-acetylglucosamine transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37520"
FT                   /db_xref="GOA:B5EBQ1"
FT                   /db_xref="InterPro:IPR004276"
FT                   /db_xref="InterPro:IPR006009"
FT                   /db_xref="InterPro:IPR007235"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5EBQ1"
FT                   /protein_id="ACH37520.1"
FT                   /translation="MRLIIAGGGTGGHLFPGIAVADEFLARSPENEVLFVGTERGIEAR
FT                   LLPKLGYKLALISASGMKGMGTIKKIMSAGRLLYGYSQSRKILKEFRPDLVLGVGGYAS
FT                   APIVLAARGMGIRRFIHEQNAFPGLTNKVLGRFVDGVFISMPEAESFFPKEMTQMTGNP
FT                   IRKEILWGFQERVRSIGDTFSILVFGGSAGAQRVNSALLEALPHLEGVKGKLRITHQTG
FT                   EKDAARVREGYQAQGFQAQVLSFIDDMSAAYGAADLVVCRAGATTIAEVTACGKGCIFI
FT                   PFPYAADDHQRKNAESLVHKNAGVMILEEDLTGERLAAKILELMEHPAELAEIEKNARA
FT                   LAQLDAAQAIVSAMVSKN"
FT   misc_feature    complement(594004..594030)
FT                   /note="hexanucleotide repeats; Gbem_R6007"
FT   gene            594171..595556
FT                   /gene="murC"
FT                   /locus_tag="Gbem_0492"
FT   CDS_pept        594171..595556
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murC"
FT                   /locus_tag="Gbem_0492"
FT                   /product="UDP-N-acetylmuramate--alanine ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37521"
FT                   /db_xref="GOA:B5EBQ2"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005758"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5EBQ2"
FT                   /protein_id="ACH37521.1"
FT                   /translation="MYGKIERIHFVGIGGIGMSGIAEVLLNLGYKVSGSDLRGSEITQR
FT                   LESLGGEIFFGHAAENVANADVVVISSAVHDDNPEVVEAHLRLIPVIPRAEMLAELMRM
FT                   KYGIAVAGTHGKTTTTSMVATILSKGGIDPTIVIGGRLNSLGTNARLGQGQFLVAEADE
FT                   SDGSFLLLSPTIAVVTNIDADHLDFYSGIEEIKDTFVEFINKIPFYGLAVLCLDNGNIA
FT                   DVLPRVKKRFTSYGMSAQADFRATDVKLSGFSTSFVAHHKGVRLGEITFSMPGAHNVLN
FT                   ALAAIAVAMELDIPFETIQEGFAGFGGVGRRFHLKGEANGIMVVDDYGHHPTEIKATLG
FT                   AAKAGFAENRLVVVFQPHRYSRTKELFEEFVKAFHDADVLILTDIYPAGEAPIEGVTAE
FT                   ALANRVRRHGQKDVTWISDRDKLCEHLERVLAPGDILLTLGAGNVWQVGETMLLRLKAA
FT                   KES"
FT   gene            595559..596461
FT                   /gene="murB-1"
FT                   /locus_tag="Gbem_0493"
FT   CDS_pept        595559..596461
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murB-1"
FT                   /locus_tag="Gbem_0493"
FT                   /product="UDP-N-acetylenolpyruvylglucosamine reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37522"
FT                   /db_xref="GOA:B5EBQ3"
FT                   /db_xref="InterPro:IPR003170"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR011601"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="InterPro:IPR036635"
FT                   /db_xref="UniProtKB/TrEMBL:B5EBQ3"
FT                   /protein_id="ACH37522.1"
FT                   /translation="MTRGELEQAVQGVRGTVKWDEPMWQHTSLKVGGPADLYFEPADLP
FT                   DLHETVEKLLAAKIPYLVLGGGYNLLVRDGGIRGCVISLKKLDTLEMQPGARLEVGAGV
FT                   TNSTLCRFAAEHCLGGMEFLSGIPGSFGGALTMNAGAQGGETLQRVETLITLREGKLLV
FT                   RKAAELEFGYRYLRLLPGEIVLGAKLRLEPAERRIIEERMQANIARRSGTQRVTYPNAG
FT                   SFFKNPSGRHAWELIDRAGMRGVTVGGAQVSEAHTNFLVNRGGACAADFTSLAALVKLR
FT                   VKETSGVDLEEEVRLVGEE"
FT   misc_feature    596476..596584
FT                   /note="conserved palindrome; Gbem_R2011"
FT   gene            596677..597594
FT                   /gene="ddl"
FT                   /locus_tag="Gbem_0494"
FT   CDS_pept        596677..597594
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ddl"
FT                   /locus_tag="Gbem_0494"
FT                   /product="D-alanine--D-alanine ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37523"
FT                   /db_xref="GOA:B5EBQ4"
FT                   /db_xref="InterPro:IPR000291"
FT                   /db_xref="InterPro:IPR005905"
FT                   /db_xref="InterPro:IPR011095"
FT                   /db_xref="InterPro:IPR011127"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5EBQ4"
FT                   /protein_id="ACH37523.1"
FT                   /translation="MTVEELKKKKIAVLMGGLSAEREVSLNSGKAVLASLVKQGFRAVG
FT                   IDVGRDLPQRLAEEQVELAFIALHGRFGEDGSVQGLLELMGIPYTGSGVLASALAIDKI
FT                   ASKVIFASAGLKLAPYQVLRRGEELKLANPLPVVVKPSREGSSVGVGIVRDPSRMQAAL
FT                   DEAFRYDSEILIEGFIDGREVQVGILNGKALGAIEIIPKGEFYDYEAKYTDGGAQHILP
FT                   ARLPEAVYAEVLRQGEKAHAALGCDCYSRVDFLVTETGDCFLLEVNTLPGMTDLSLLPE
FT                   IAGGAGIAFGELVLRILQAASLKI"
FT   gene            597663..598487
FT                   /gene="ftsQ"
FT                   /locus_tag="Gbem_0495"
FT   CDS_pept        597663..598487
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsQ"
FT                   /locus_tag="Gbem_0495"
FT                   /product="cell division protein FtsQ"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37524"
FT                   /db_xref="GOA:B5EBQ5"
FT                   /db_xref="InterPro:IPR005548"
FT                   /db_xref="InterPro:IPR013685"
FT                   /db_xref="InterPro:IPR026579"
FT                   /db_xref="InterPro:IPR034746"
FT                   /db_xref="UniProtKB/TrEMBL:B5EBQ5"
FT                   /protein_id="ACH37524.1"
FT                   /translation="MRDLHAKKQRVPHNRVKKPPKERKPINWGPILKYASRGFGGAALC
FT                   AGLGFGGWQIYNLVSRTTLLRLEAIEVSPLKRVSREEIITLAGVRPGDSMLKVDLKTVV
FT                   ARLSKNPWLEQVQVRRYFPHTLSITVSERAPQAVANVGCLYYLDDKGVLFKSLVEGDRL
FT                   DYPLITGFTEEELAQDPKGCQDALKNALALIDTLKKGGVFSLEDISEIHYSKGYGFTLF
FT                   TMQGGVPVKLGNGGFSEKLTRLAGIYKELQPQMQALDYIDLDYADKIIVKKV"
FT   gene            598505..599740
FT                   /gene="ftsA"
FT                   /locus_tag="Gbem_0496"
FT   CDS_pept        598505..599740
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsA"
FT                   /locus_tag="Gbem_0496"
FT                   /product="cell division protein FtsA"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37525"
FT                   /db_xref="GOA:B5EBQ6"
FT                   /db_xref="InterPro:IPR003494"
FT                   /db_xref="InterPro:IPR020823"
FT                   /db_xref="UniProtKB/TrEMBL:B5EBQ6"
FT                   /protein_id="ACH37525.1"
FT                   /translation="MSTRRDNLIVGLDIGTTKICAIVGNVTEEGIDIVGIGTSPSKGLR
FT                   KGVVINIESTVAAIKKAIEEAELMAGCEIKSVYAGIAGGHIKGFNSQGVIAIKNREVSP
FT                   EDVKRVIEAAKAIAIPMDREVIHILPQEFIIDDQDGIREPLGMSGVRLEAKVHIVTGAV
FT                   ASAQNIVKSCNRAGLEVADIVLEQLSSSEAVLSSDEKELGVALVDIGGGTTDIAIFVDG
FT                   AIKHTSVLSLGGNHLTNDIAVGLRTPMAEAERIKQKYGCCLSSLVGKDETIEVPSVGGR
FT                   KPRILSRQLLCEILEPRVEEIFTLVNREIVKSGLEDSIASGVVITGGSTILEGMPELAE
FT                   QIFNLPVRRGLPQRIGGLTDVVNSPVYATGVGLVVYGSKNVGVHEFPTQQSDETVFRRV
FT                   SRRMKDWFGEFF"
FT   gene            599853..601013
FT                   /gene="ftsZ"
FT                   /locus_tag="Gbem_0497"
FT   CDS_pept        599853..601013
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsZ"
FT                   /locus_tag="Gbem_0497"
FT                   /product="cell division protein FtsZ"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37526"
FT                   /db_xref="GOA:B5EBQ7"
FT                   /db_xref="InterPro:IPR000158"
FT                   /db_xref="InterPro:IPR003008"
FT                   /db_xref="InterPro:IPR008280"
FT                   /db_xref="InterPro:IPR018316"
FT                   /db_xref="InterPro:IPR020805"
FT                   /db_xref="InterPro:IPR024757"
FT                   /db_xref="InterPro:IPR036525"
FT                   /db_xref="InterPro:IPR037103"
FT                   /db_xref="UniProtKB/TrEMBL:B5EBQ7"
FT                   /protein_id="ACH37526.1"
FT                   /translation="MFHFDESIDQSAKIKVIGVGGSGGNAVNTMMSVGIAGVDFIVANT
FT                   DAQALRMSKAQVKIQIGTELTKGLGAGANPNVGRDAALEDRDKVHEALKGADMIFIAAG
FT                   MGGGTGTGAAPVIAEVAREHGALTVGVVTKPFSREGRQRLAKGEDGIKELKKHVDSLIV
FT                   IPNDRLLGLAGKSMSILDAFKPSDDVLRQAVQGISDLITQSGLINVDFADVKSIMSERG
FT                   MAMMGIGIGSGENRAIDAAVKAISSPLLEDIDISGAKGVLVNISGSASMTMDEFDAASK
FT                   VIHEKVHEDANIIVGLVIDETLGETIKVTAIATGFGDRFDLEKGRHEMKSVATMATMVK
FT                   PVESRLEIPTFIREKQQRETQVRQRSFLSDDEDQYDIPTFLRKSVD"
FT   gene            601353..603422
FT                   /locus_tag="Gbem_0498"
FT   CDS_pept        601353..603422
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0498"
FT                   /product="sensor histidine kinase, GAF domain-containing"
FT                   /note="domains: GAF, HisKA, HATPase_c"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37527"
FT                   /db_xref="GOA:B5EC99"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B5EC99"
FT                   /protein_id="ACH37527.1"
FT                   /translation="MSDRPLYNSKIINNFVALLKKKHADVDVRELLNYAEISPYELSDE
FT                   GHWLTQRQVDRFHDKMSYLLGGKELAREGGRYAASEEALGVMAKYTFGFIGPANTLVAI
FT                   GKCASNFTRSAVYQSRKLADNKVEITVTPHSDVEEKPFQCENRIGFFEAIVQMFDHDIP
FT                   SVEHPECIFKGGSCCRYIVSWKKTWAGKIRLVRNLQVPVVLVLYGVLHHFYRIGHLGEM
FT                   LVALAFMQLGASYLAERLEKKEILATLAGVQESTEQMVDQIGVNYNNARMVNEVGQALS
FT                   TQSGIDEVLQNVIGALEKRLGYDRCLIMLADKNKSCLKFRTGVGINDKQLKALKKASFD
FT                   LTNPGAKGAFVTCFREQRTMFVDFSEVTHIHSEQSINLSEVLEAQSFICCAIVFEGESL
FT                   GILAVDNMKTQRPLTQSDMSLLTGLAPVIGMSLRNAMHLERERRMAEQIRQSQKMEAVG
FT                   VLAGGIAHDFNNLLTGMIGYVSLALMTIKEEDPATKYLDQVVSAADRAADLTQRLLAFS
FT                   RKQINHPEPVDLNQIVNNVRKLLSRLVTAKIELKVEPSEGMLPVVADSSQIDQMVMNLV
FT                   TNARDAMPTGGTLTITTEAMELTEEWVESHGYGSIGSYAVLSVTDTGTGMDEATRAHVL
FT                   EPFFTTKEVGKGSGLGLAIVYGIVKQHEGHLEIYSKPGAGTTLNVYLPLIAPAP"
FT   gene            complement(603429..606518)
FT                   /gene="dnaE-2"
FT                   /locus_tag="Gbem_0499"
FT   CDS_pept        complement(603429..606518)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaE-2"
FT                   /locus_tag="Gbem_0499"
FT                   /product="DNA polymerase III, alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37528"
FT                   /db_xref="GOA:B5ECA0"
FT                   /db_xref="InterPro:IPR003141"
FT                   /db_xref="InterPro:IPR004013"
FT                   /db_xref="InterPro:IPR004805"
FT                   /db_xref="InterPro:IPR011708"
FT                   /db_xref="InterPro:IPR016195"
FT                   /db_xref="InterPro:IPR029460"
FT                   /db_xref="InterPro:IPR040982"
FT                   /db_xref="UniProtKB/TrEMBL:B5ECA0"
FT                   /protein_id="ACH37528.1"
FT                   /translation="MFIHLHAHSSLSPNWGVHSPETLCSHAASLGFKTLAITDRNGLYG
FT                   VPRFLDAAREAGISPIIGTEAVTPDNRAVLLACNEEGYANISRLISDLHCQKNFDLIPA
FT                   LSEYRRGIIVLSDDRKLLAALKRKSDEGLFVELSPGHSMHNALTLARDLRLPPVATSRA
FT                   VLRAPRYGGQAPPSDALTPTFSQRERGNGPNALAECRLDDFHLHRVLRAIHLNTKLSRL
FT                   TPEMTAAESDALYPPDKMAEFFPHCPEALQNTIRIASLCKTDWNFSSTIFPAFRELGTE
FT                   AAFETLLERARQGAIWRYGSISDRVQARLDKELSIIRDKGFSHYFLVVEELTKQSERTC
FT                   GRGSAAASLVAYCLGITHVDPIRHNLFFERFLNEGRSDPPDIDVDFPWDERDAILDFAF
FT                   ARYGARRAAMVANQVGFKGRSALREVAKVYGLPDYEIKEMTERISGFWRAEQSAAAMSG
FT                   HPLFKGESLSSDWQEIMSTARRLNGQLRHLSLHCGGLVIVPDEIRKYVPVEISHKGLPL
FT                   IQWEKDQTEDAGLVKIDILGNRSLAVIRDAMAAVKEQKGVEIDYATWRPLEDERTQSLL
FT                   RRGLTIGCFYLESPSVRLLLRKIWSSTAPPETFRYDLFEVLVQASSIIRPAANSFIQEY
FT                   VARLQGKPWSHLHPLLESVLGETLGIAIYQEQITQIAMELAGFSASEGDQLRKVITKKH
FT                   REKRLADFRNKFMAGGAERGVPEKVLLGIWDQILSFAGYSFCKPHSASYALLSGKAAYM
FT                   KAHHPAQFIAAVISNQGGYYSPFAYISEGRRLGLAILPPDINESEYHYTGKEKTLRVGL
FT                   MQIDGLTRDGADRLLKERRERGAFASFKEFLRRARLQRADAERLIKAGCFDALEGEEKR
FT                   PTLLWELLHFQQQATALLFEQKTELPHPPPYDAQLVLRQEVEALGFLVSRHPLALYKEQ
FT                   WQRHRPIKASELIKHTGKWVTMVGWWITTKTVEDKHGRPMEFISFEDVTAIFDATFFPD
FT                   VYARFCRKLSQRRPYLLKGIVEEEFGVATLRVKWVGFLDG"
FT   misc_feature    complement(606542..606577)
FT                   /note="nonanucleotide repeats; Gbem_R9011"
FT   misc_feature    606632..606676
FT                   /note="nonanucleotide repeats; Gbem_R9012"
FT   gene            complement(606708..607961)
FT                   /locus_tag="Gbem_0500"
FT   CDS_pept        complement(606708..607961)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0500"
FT                   /product="DNA polymerase IV"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37529"
FT                   /db_xref="GOA:B5ECA1"
FT                   /db_xref="InterPro:IPR001126"
FT                   /db_xref="InterPro:IPR017961"
FT                   /db_xref="UniProtKB/TrEMBL:B5ECA1"
FT                   /protein_id="ACH37529.1"
FT                   /translation="MDREILHITVPAFPIALARVVDSNLRGRPVAVAPLNSERALLQCI
FT                   SAEAAAEGVHAGTPIYHARKSCPALIVIAPDPHLMAKGSQALQDLSAEFTPIVEPGAGR
FT                   AFLDLTASRRLFGPARDVAARLEKAIANRMGLEAMAGAGVNKLVSRVAADVMQEAGVYD
FT                   VFHGAERSFLAPFPVSVLPGVGESRQALLFRDLNLQRVEQVASLSMPQLRLAVGPFAPL
FT                   LHDRSCGIDRSPVQPPRLSTEIVEEGLLDQEENDDAILLSELLRLVEACGLRLRRLRKG
FT                   ARKLTLSVMYADGVSQQGKKVLPVPTSLDLQLLAAVEDLFFTTCKRRQRVKGLRLSCDQ
FT                   VAEDAGQMDLFAPATAQVSQKQADLQETLDLLREKHGRDAVRWGKGLAARREATMASEP
FT                   PPEWDPEQNKYMTLTSRS"
FT   gene            complement(607937..608686)
FT                   /gene="lexA-2"
FT                   /locus_tag="Gbem_0501"
FT   CDS_pept        complement(607937..608686)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lexA-2"
FT                   /locus_tag="Gbem_0501"
FT                   /product="transcriptional repressor, LexA family"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37530"
FT                   /db_xref="GOA:B5ECA2"
FT                   /db_xref="InterPro:IPR006197"
FT                   /db_xref="InterPro:IPR006199"
FT                   /db_xref="InterPro:IPR006200"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR039418"
FT                   /db_xref="UniProtKB/TrEMBL:B5ECA2"
FT                   /protein_id="ACH37530.1"
FT                   /translation="MTPKQKRVLDFILSFAERHGFQPSQQEIASGCGFGSLGTVQHYLR
FT                   ALEKDGHLTRQWNAKRGLQLANPPCPPFAKGGTQVLAQRFVGKYSPGSPESQELHFAEG
FT                   GNPQTPAVAPIIGMELPLVGIVAAGRPVQAFQLADAIEVPSAMAGPGNVVYEVRGDSMV
FT                   EMGIMDGDYVAVHPQAVAETGQTVIAEVNGSITIKKYVRKGNSIQLQPANSAMSPIMVT
FT                   EDDEFHIRGVLVGSMRFYKKWTGKSST"
FT   misc_feature    608793..608821
FT                   /note="repeat; Gbem_R5062"
FT   misc_feature    608839..608867
FT                   /note="repeat; Gbem_R5063"
FT   gene            608857..609387
FT                   /locus_tag="Gbem_0502"
FT   CDS_pept        608857..609387
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0502"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37531"
FT                   /db_xref="UniProtKB/TrEMBL:B5ECA3"
FT                   /protein_id="ACH37531.1"
FT                   /translation="MVEDDDRGVGSRWWKWVCYVQVNATDLELLARQPAMHVCNKVMAS
FT                   NLFLQLTMTSYRVCIMKLFTANSTTKKFMLPLILAVAVFFVTQGIEVPNFSDLLEPQLS
FT                   LSQKSNGSDTAVVKTLTKCSHIKSIKNVNFSALVSNAFQINSPVVPVTVFQHQSQSFIS
FT                   SVVSILPARAPPA"
FT   gene            609686..611290
FT                   /gene="secD-1"
FT                   /locus_tag="Gbem_0503"
FT   CDS_pept        609686..611290
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secD-1"
FT                   /locus_tag="Gbem_0503"
FT                   /product="protein export membrane protein SecD"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37532"
FT                   /db_xref="GOA:B5ECA4"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR005791"
FT                   /db_xref="InterPro:IPR022645"
FT                   /db_xref="InterPro:IPR022646"
FT                   /db_xref="InterPro:IPR022813"
FT                   /db_xref="UniProtKB/TrEMBL:B5ECA4"
FT                   /protein_id="ACH37532.1"
FT                   /translation="MPKSISWRITMIVFFVLLSFLYLTPTLVSNLPNWWTGYFPKDKIH
FT                   LGLDLQGGTHLVMKVDTQKAVEGYIDLIASDLEDSLNVRRIRIHQINRVGEDAIRLAFY
FT                   DVNSAENEAQLIKKKYPELEQIQIRDSEGGMVHLEFRMEKKAVQDRKDKAVAQALETIR
FT                   NRIDQFGVLEPVIQREGIDHIVIQLPGITDPKRAIELIGKTARLEFKLVDENLSASSSS
FT                   PYAMPDDAEILMEQQSNSATGAVQGVPIVVKKKAIITGDLLTDAQVKIDSQNNEPYVAI
FT                   DFNSTGARLFDQVTAANVGKRFAIVLDGNVYSAPVIRERISGGSAQISGNFNEKEAADL
FT                   AIVLRAGSLPAPVKIVQNVTVGPSIGEDSISKGLMAGGIGILLVVLFMVFYYRMAGLVA
FT                   NFGMVLNVLFLLGALAALGATLTLPGIAAIVLLVGMSVDSNVLIFERVKEEIRLGCTPK
FT                   MSIDAGYDKAFLTVMDSHVTTLITAAVLFQFGTGPVKGFAVSLSLGVIINLFTTLVTTK
FT                   VVFDSAFSRFQIRRLSI"
FT   gene            611304..612245
FT                   /gene="secF-1"
FT                   /locus_tag="Gbem_0504"
FT   CDS_pept        611304..612245
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secF-1"
FT                   /locus_tag="Gbem_0504"
FT                   /product="protein export membrane protein SecF"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37533"
FT                   /db_xref="GOA:B5ECA5"
FT                   /db_xref="InterPro:IPR005665"
FT                   /db_xref="InterPro:IPR022645"
FT                   /db_xref="InterPro:IPR022646"
FT                   /db_xref="InterPro:IPR022813"
FT                   /db_xref="UniProtKB/TrEMBL:B5ECA5"
FT                   /protein_id="ACH37533.1"
FT                   /translation="MQLISNTNIDFIGKRKVSFVISTIIAIIGLIGILQIARNSANMGI
FT                   DFSGGTSVQLSFTHPIPQEKARELLSDHLFREVNLQEIKGGNRILVKVGKSGADVSETI
FT                   TAVFKKEFPGNAFVVESSTDVGPSIGNKLKTDTLKAVGLSMIGIILYIAWRFDFKFGVG
FT                   AIAATLHDVLAMVALFYLMNKEINLLFITAVLTIAGYSLTDTVVVFDRIRENLHKYVDD
FT                   TKEGLFNRSINEVLPRTVITSLTTFLAAISLFLFGGEVIHDFALALVAGIVIATYSSIF
FT                   IASPIVAVLEARRGGWELADGDGLSGTSEEEL"
FT   gene            612249..614003
FT                   /locus_tag="Gbem_0505"
FT   CDS_pept        612249..614003
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0505"
FT                   /product="monovalent cation/proton antiporter family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37534"
FT                   /db_xref="GOA:B5ECA6"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:B5ECA6"
FT                   /protein_id="ACH37534.1"
FT                   /translation="MHNLDLIMTITGGFTAALLFGYLTHRLGMSTIVGYLLAGIAVGSH
FT                   TPGFVADRAMAEQFAEIGVILLMFGVGLQFHLKELLEVRRVAIPGALCQSAVATLLSCL
FT                   VARWLGWGWSAGIVFGFAVSVASTVVLLRVLVDNNEMHTPTGHIAVGWLVVEDILTVFL
FT                   LVILPILFGAGTADSASLPAAIGISLAKIALLVGLTFWVGGRTIPWLLERVAATHSREL
FT                   FTLTVLVLALGIAVASTKVFGVSMALGAFLAGMVVKQSDFSFRAASEALPMRDAFAVLF
FT                   FVSVGMLFNPGHLMQEPGLVLITLVIILLGKPLAALTIVLVLRYAPRVALSVAVALAQI
FT                   GEFSFILATAGKDMGVLGESGANTIVAAAIISISLNPLLYRLIGPLERRARHTRLWQIL
FT                   EARSKPHALGGEAVPGLHSVSRDRAIVVGYGPTGKTLVRLLVDNGVDPFVVEMNIHMVR
FT                   QLQADGIGVIYGDATNRDTLCAAGIQDAVALILTSSGMQGSEETIQLAREINPRLRIIA
FT                   RTTYLRNIQTLREAGAEAVFSGEGEIALNMTEHMLRKLGATDEQISRERDRVRDELLGG
FT                   SMTGLKVT"
FT   misc_feature    complement(614201..614284)
FT                   /note="icosikaihenanucleotide repeats; Gbem_R7302"
FT   gene            614908..615861
FT                   /locus_tag="Gbem_0506"
FT   CDS_pept        614908..615861
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0506"
FT                   /product="zinc-dependent oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37535"
FT                   /db_xref="GOA:B5ECA7"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B5ECA7"
FT                   /protein_id="ACH37535.1"
FT                   /translation="MKAVTISRYGGNEVVEVADVPVPTPGEDDVLIKVHAASVNPVDWK
FT                   IRNGMLKLFTGRSFPKILGSECAGEVVETGANVRQFKKGDFVIGYPGIKRLAAFAEYVC
FT                   ADKGSTFVKPGNVSSEEASTLPIAGLTALRALRDLGKVAEGGHVLINGASGGVGTFAVQ
FT                   IAKILGARVTAVCSASNAALVQDLGADRVLDYAHEDFTKGGERFDVVFDAIAKRSFAEC
FT                   KRAMTAKGVYVSTLPSPSVLLNQYLTRFFTRKTAKAVMVKPNAADMEWMKKYIEAGKLR
FT                   VVVDKVFSLEQIKEAFIYSESGKAKGKIVVRTGESE"
FT   gene            615899..616552
FT                   /locus_tag="Gbem_0507"
FT   CDS_pept        615899..616552
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0507"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37536"
FT                   /db_xref="GOA:B5ECA8"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="UniProtKB/TrEMBL:B5ECA8"
FT                   /protein_id="ACH37536.2"
FT                   /translation="MEKNDQTIGTLSEIVRARRTIRSFSNNVPPVEEMEEILRSAIFAP
FT                   FGRATGLPPKEIRKIFVFSQGTEPMEQARELLLMEISRVARKVKIAITLFPFLKKTMGL
FT                   FAERISVLERKGIPGLLEAPYYVVIATRKGFPAMEKQTIAHAMQNMWLSATAQGLGLQP
FT                   ISQTSIMSKNKEFMQLLGLKAGDYELDGCVIGVQKAPAEPREERQLEDFVTWVR"
FT   gene            616644..617297
FT                   /locus_tag="Gbem_0508"
FT   CDS_pept        616644..617297
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0508"
FT                   /product="cysteine hydrolase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37537"
FT                   /db_xref="GOA:B5ECA9"
FT                   /db_xref="InterPro:IPR000868"
FT                   /db_xref="InterPro:IPR036380"
FT                   /db_xref="UniProtKB/TrEMBL:B5ECA9"
FT                   /protein_id="ACH37537.1"
FT                   /translation="MKRSKKIMFCSAGSVLLLVLVLFAAIYWSMRPTTGTPINKYATPR
FT                   AALLIVDIQEDYTGPQAKKRYRDGDRIVTVSNALLAQAQANGAVVVFVKNVIDNPIMSA
FT                   LMGGINAPDSPGAEMDRRLIEIPAAVTFQKSRPDAFSTPELDAYLREKQVDQIFITGLD
FT                   GAYCVSATARGALNRGYKVTLFQDGVATESSKNIEELAKSWRQAGAQVKTGSEI"
FT   gene            617353..617715
FT                   /locus_tag="Gbem_0509"
FT   CDS_pept        617353..617715
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0509"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37538"
FT                   /db_xref="UniProtKB/TrEMBL:B5ECB0"
FT                   /protein_id="ACH37538.1"
FT                   /translation="MIAITYNDRFFKAVSNSENGEVDESTIFHYRQTDDLVWGTYQGGQ
FT                   VRFGTLVAKVLPDASLEMRYSHVNLNGEMMTGECRSTPELLKDGRIKLNEKWQWTCGDC
FT                   SEGESAVEELLSGDLS"
FT   gene            618076..618816
FT                   /locus_tag="Gbem_0510"
FT   CDS_pept        618076..618816
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0510"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37539"
FT                   /db_xref="UniProtKB/TrEMBL:B5ECB1"
FT                   /protein_id="ACH37539.2"
FT                   /translation="MKASHGPENASEIMAGLIPPEQWMVYALFINEMATSGIPFAVGGG
FT                   LAVSAYSACVRNTKDMDIYLLEKDSRQVIEMSRQLGFEEYTEVPYDRTWSYRCTRGGYI
FT                   IDLLWYMLNGRSSIDETWLTLGWELLVREVPVKLLPVEELIWSKLYILRHDRADWPDIL
FT                   SLLYARGVELDWDRLLTNLGADRMVLGSVVNLLRWFCPGLACRLPESIWAPMGLLPPSC
FT                   STAETDHDRVALFNCEHLFGGGLS"
FT   gene            618813..619589
FT                   /locus_tag="Gbem_0511"
FT   CDS_pept        618813..619589
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0511"
FT                   /product="TIM barrel protein, AP endonuclease family
FT                   2/xylose isomerase-like family"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37540"
FT                   /db_xref="GOA:B5ECB2"
FT                   /db_xref="InterPro:IPR001719"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:B5ECB2"
FT                   /protein_id="ACH37540.1"
FT                   /translation="MKIGAMNHPCRNPADEIRRFADMGLDFIDLTLEPPQAGWWQCNLQ
FT                   QIKAALAETGMGVVGHTAYYLPIAHPFEEVRRGAIDGFRHCIEIFAELGAKAMNIHPDA
FT                   HAPMHDRSFVISQNLKSLTEIMKAAEGTGVSVMVENLPRNFNSAAQLAELLDPLPQLGL
FT                   HLDIGHTELMVKTSTADEILERFGSRLMHAHLHDNKGGDADLHLPLGAGVIDIPRHLAV
FT                   LKKSGYDGTITLEVFTPDTSYLKYSAKRLRAMWDEA"
FT   gene            619695..620147
FT                   /locus_tag="Gbem_0512"
FT   CDS_pept        619695..620147
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0512"
FT                   /product="lipoprotein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37541"
FT                   /db_xref="UniProtKB/TrEMBL:B5ECB3"
FT                   /protein_id="ACH37541.1"
FT                   /translation="MKKVMVIALAVSAGVLGACCTPCVSPTTNEVPMYPVTVGEKTSLY
FT                   EVVAPNALRLAPGVGFKEVPGPGGKNNGIILMRPNGATGGYMACGCIGATTSSCVTTSD
FT                   NPDHPSCSGGCSDSEGNPQPCQLFGPIIGPPRDPLMIRFLAGPLPQ"
FT   gene            620497..621723
FT                   /locus_tag="Gbem_0513"
FT   CDS_pept        620497..621723
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0513"
FT                   /product="membrane protein of unknown function DUF898"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37542"
FT                   /db_xref="GOA:B5ECB4"
FT                   /db_xref="InterPro:IPR010295"
FT                   /db_xref="UniProtKB/TrEMBL:B5ECB4"
FT                   /protein_id="ACH37542.1"
FT                   /translation="MPSITLTCPVCNFTKQMDVSAIPRPGTTVTCPVCKSLFPLQTDAQ
FT                   GVASEAGNTPALPEENQTPPSSKPVRQRPRTLTFAFTGDAREYFGIWIVNTLLRIVTLG
FT                   FYSPWAKVRKRRYFCGNTLLDGAPFDYLADPWAILKGWLVAGLFFGLYSLTSRISPLIF
FT                   AAISLLFLGIFPWVVVRSRIFNLRNSTHRNIHFGFNPEYREAYRVFLGWQLLLPLTIGI
FT                   LGPYVFYRQSRFLVENSRYGTTPFSFHATATDYFKIFLPLLVLIPVGFGAAVGIGVGAG
FT                   VGFHNEKGAAVGIVFLLFALVYLIAGIYVRTALTNLAWNSTSLGQHRFASALRVRDLLW
FT                   IYLSSAVAVICTLGLLAPWAVVRMVRYRLERTTVSGVGGFDAIRASEDQQVGAGPEELV
FT                   DMVGFDLGL"
FT   gene            621720..622751
FT                   /locus_tag="Gbem_0514"
FT   CDS_pept        621720..622751
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0514"
FT                   /product="peptidase, M48 family"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37543"
FT                   /db_xref="GOA:B5ECB5"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="UniProtKB/TrEMBL:B5ECB5"
FT                   /protein_id="ACH37543.1"
FT                   /translation="MIDSCAAFWYDGRTSQRREVTVSLVECSLIVSGPDLERAYPLAEV
FT                   RIDQRLGRVRRTLRFPDGASAETGADDFLDELLKTQGRGGFVGRLHRWEMSLGKAGAAL
FT                   LLTLAVVFCLVRYGVPLLAQRVAFALPAATEEAIGRETLQILDKVALQPSALPKERRLE
FT                   LERLFRAMVSQHPERRGWRLEFRASREIGANAFALPSGIVILTDRMVEIAENDHQLAGV
FT                   LAHETGHVTHRHALRHLLQNSATALVVAGLTGDIVSVSSFAATMPAVIINAKYSRDFER
FT                   EADAAAVEYLKGRGIPVRRYAEILARLDADHYKERDAVPRLGEMLGSHPLMLERVQNVL
FT                   AAE"
FT   gene            622832..623860
FT                   /locus_tag="Gbem_0515"
FT   CDS_pept        622832..623860
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0515"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37544"
FT                   /db_xref="GOA:B5ECB6"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B5ECB6"
FT                   /protein_id="ACH37544.2"
FT                   /translation="MKTLFRTWVLVLAIWLELSGMCFAKQVFLQDGSVLECEAFWRRNG
FT                   EVVVKVNRDVVLNFTRSEVNIGKTFKEAKRRAAAVKRSQGHRKRSETTSVAGTPGHQGV
FT                   QSAARAGEAQAAVLPAEQVPAAPKAAPVAASAPVATEAVLPEPAQGASAESGPISQTEL
FT                   EQRTRENAELMAQAIKKQDPELMKKAVEAQKSLVQQQKSAQTIVRKNGQPLKEPAWFKY
FT                   LLMMAFSGVLIIVAMWVIFRKAGESGIKSIIPFYNLYVLMVISGKPGWWFILLFVPIVG
FT                   LAIHLLTMLSLAEKFGRSAAFAVGMIFLPVFFFPMLAFGGSQYEAMPKELEFTFSEEPP
FT                   VS"
FT   gene            623938..624429
FT                   /locus_tag="Gbem_0516"
FT   CDS_pept        623938..624429
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0516"
FT                   /product="pyridoxamine-5'-phosphate oxidase-related
FT                   FMN-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37545"
FT                   /db_xref="GOA:B5ECB7"
FT                   /db_xref="InterPro:IPR011576"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:B5ECB7"
FT                   /protein_id="ACH37545.1"
FT                   /translation="MEIGKHWPMIKAVLDKAHSTNRHCAIATVSEDGTPHVTPIGSLFL
FT                   RDDCTGFYIESYCQKMADNLKRNNRVCIMGINSGIGYWLKSLFSGRFPSPPGVRLYGTV
FT                   SELRLGTKDEIEYFQNRVRPFRKLKGHDLLWKNMRHVREIQLQSFEPVHAAKMTQHLWL
FT                   "
FT   gene            624635..627628
FT                   /locus_tag="Gbem_0517"
FT   CDS_pept        624635..627628
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0517"
FT                   /product="sensor histidine kinase response regulator, HAMP
FT                   and PAS domain-containing"
FT                   /note="domains: HAMP, PAS, HisKA, HATPase_c, REC"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37546"
FT                   /db_xref="GOA:B5ECB8"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR033479"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B5ECB8"
FT                   /protein_id="ACH37546.1"
FT                   /translation="MLRLSSLSIRSLLLLITCIVALPAAVIILYSGIEFRNAMLGEARK
FT                   ETVKFAEMIVNEQRNLVVAAEQLMTALAQLPEVKAGDTAKVESVLKELLKLNPMYANIT
FT                   IADCEGKVWATAVPTAVPYNLSDRYFFKSTLETGKLSSGEYVVSRITTKPVFNLGYPVR
FT                   DDSGAIAGVIGVAFNLENYRHLLQQMRLPAGSSFTIIDHRGTILARGLTEGNFTGKAYI
FT                   ADSFRKMVEGPDEGVSTRKGLAGDTRIIAYRKLYLPGEKTPYLYVTAGIPVDAATQKAN
FT                   RALILSAVLLSSFLAIACFCAVLIGKRCIADRLQLLEDASRRVASGDLHIRVSEAVTGG
FT                   ELGSLAQTLDDMADQLRTRTEALAQSKIFMNTIIETEPECVKLLDAEGRVQMMNRTGLK
FT                   MIEADSLAQIQGQCVYPLIAPEHRDAFIQLTQRVFDGVAGNLVFEVHGLKGGHLWVDSH
FT                   AVPFRNDKGEIVSLLAITRDVTELRKSEEERRKNLLLFESLMRHSPMGIRIFEGGSGKC
FT                   ILLNQATADISGGDMKTMQEQNFRELKSWRESGLLAAAEKVLADGVVRLVEADICTSFG
FT                   KSVVMSYILSRLLIKEKQHLLVVGRDVTDEKRLTEEKKKMEAQMLHVQKLESLGVLAGG
FT                   IAHDFNNILMSVMGNAELALLTLPPESPARTNLQNIEISSQRAADLARQMLAYSGKGNF
FT                   IIEKIDVNRLINEMNHMLEVSISKKVDVRFNLDSGLPLVSVDATQIRQVIMNLVINASE
FT                   AIGDRCGVISISTGAMECDAAFLSKLWLNDTLKEGTYLYFEVADDGCGMDQATLAKIFD
FT                   PFFTTKFTGRGLGMAAVLGIIRGHKGTIEVHSEPGKGSRFTVFLPALPPGSARPVQEAE
FT                   AGPLSPGYGTILLVDDEETIRNLGNEMLQILGYRVLTAEDGLVAVELFKEHHGDITCVI
FT                   LDQTMPNLDGEQTFRILRSMDPSIKVIMSSGFTEQDIAERFIGRGLAGFIQKPYKLASL
FT                   SRKLQELG"
FT   gene            627808..627969
FT                   /locus_tag="Gbem_0518"
FT   CDS_pept        627808..627969
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0518"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37547"
FT                   /db_xref="GOA:B5ECB9"
FT                   /db_xref="UniProtKB/TrEMBL:B5ECB9"
FT                   /protein_id="ACH37547.1"
FT                   /translation="MSTPLIALAVILAVFAVVLIPLMMVKSGQAPVDEPRHDHGGQAKK
FT                   SHRKKKKR"
FT   gene            628013..628732
FT                   /locus_tag="Gbem_0519"
FT   CDS_pept        628013..628732
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0519"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37548"
FT                   /db_xref="InterPro:IPR005358"
FT                   /db_xref="UniProtKB/TrEMBL:B5ECC0"
FT                   /protein_id="ACH37548.1"
FT                   /translation="MTAEKAMGDLLDMVKQQQVFLEMFVRSWVDDYRSSGGAIFCGKGC
FT                   RNCCSLAVHTGFAEALAVARQLDETQGRAVESYAMKLRELLKGVTELPEYLRLHRQTMG
FT                   FCPLLTDAGACGVYPVRPLSCRSLISTRESVWCGADFSQLSQAEREAFVAALDRKVVAF
FT                   PSHYVAVLQESGKELEEAGAKNMRELLGFSLYGNLGVLVHLCRSHGFAEACLEGKSSAA
FT                   GCIAGAGFDHPLLLTLT"
FT   misc_feature    628749..628775
FT                   /note="conserved nucleotide sequence; Gbem_R0100"
FT   gene            complement(628964..630772)
FT                   /locus_tag="Gbem_0520"
FT   CDS_pept        complement(628964..630772)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0520"
FT                   /product="amidohydrolase, YtcJ-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37549"
FT                   /db_xref="GOA:B5ECC1"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR013108"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="InterPro:IPR033932"
FT                   /db_xref="UniProtKB/TrEMBL:B5ECC1"
FT                   /protein_id="ACH37549.1"
FT                   /translation="MKGPELVLYNGTITTLDENNPEVTALAVSGGRVIAIGGAELLQEA
FT                   DEGTKRIDLKKHRAIPGLNDSHIHVIRGGLNYNMELRWDGVPSLHDALGMLREQARRTP
FT                   PPQWVRVIGGWTEFQFAERRMPTLEEVNQAAPDTPVFILHLYDRALVNKAALRALGYNR
FT                   DTPDPPGSEIQRDKAGNPTGLLIARPNAMLLYASLAKGPKLPYQDQLNSTRHFMRELNR
FT                   LGLTSAIDAGGGFQNYPDDYRVIEELSASGRLTLRIAYNLFTQHPKSELEDFTEWVRSS
FT                   SPGSGDDFYRHNGAGEMLVFSAADFEDFLEPRPDLPPMMEQELSQVVRLLAENRWPFRL
FT                   HATYNESITRFLDVFEAVNRDVPFDGLRWFFDHAETITPENLERVRNLGGGIAIQDRMA
FT                   FQGEYFRERYGRDAAANSPPFARMLDMGIPVGAGTDATRVASYNPWVALYWLVSGRTVG
FT                   KMQLYPEQNRIDRLGALRLYTVGSSWFSGEEEKKGRLVPGQLADLAVLSADYFKVAEEE
FT                   IPGIESVLTIVGGKVVHGAGDFGSLAPPPLPVSPDWSPVGSYGGYHSRVHEANAFRSCC
FT                   RHAIEKPLRTAPGSFPWGGGCDCFAF"
FT   gene            complement(630799..631461)
FT                   /locus_tag="Gbem_0521"
FT   CDS_pept        complement(630799..631461)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0521"
FT                   /product="amidohydrolase, YcaC-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37550"
FT                   /db_xref="GOA:B5ECC2"
FT                   /db_xref="InterPro:IPR000868"
FT                   /db_xref="InterPro:IPR036380"
FT                   /db_xref="UniProtKB/TrEMBL:B5ECC2"
FT                   /protein_id="ACH37550.1"
FT                   /translation="MANSAGNGGASPRLLTPGNSMLLLIDHQPQMAFASHSIDIQLLIN
FT                   NVTGLAKSARIFNVPVVLTTVAAKSFSGPIFANLQEVYPETDPIDRTTMNSWEDPKVVE
FT                   AVRRTDRKKLVMAALWTEVCLATATLSALDDGYEVYIVTDASAGVTSEAHEMAIRRMIQ
FT                   AGAVPTTWLQVLLEWQRDWARQETYNAVMAVAKEHAGGYGLGINYAKSMLGEHASEG"
FT   gene            631686..632063
FT                   /locus_tag="Gbem_0522"
FT   CDS_pept        631686..632063
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0522"
FT                   /product="response receiver"
FT                   /note="domains: REC"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37551"
FT                   /db_xref="GOA:B5ECC3"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:B5ECC3"
FT                   /protein_id="ACH37551.1"
FT                   /translation="MRILVAEDDPTIRQMMATLLSRCGFDCRSVDNGRKAVEAWEDETF
FT                   DFIFMDVQMPVMDGFAATRMIREKEALKGGHTPIIALTAHAMEQDRQQCLDSGMDDYLS
FT                   KPIDLDELFSLLKNDYSKGVS"
FT   gene            632096..633759
FT                   /pseudo
FT                   /locus_tag="Gbem_0524"
FT                   /note="sensor histidine kinase; frameshifted; domains:
FT                   HisKA, HATPase_c"
FT   gene            complement(633782..637414)
FT                   /locus_tag="Gbem_0525"
FT   CDS_pept        complement(633782..637414)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0525"
FT                   /product="DUF748 repeat protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37554"
FT                   /db_xref="GOA:B5ECC6"
FT                   /db_xref="InterPro:IPR008023"
FT                   /db_xref="UniProtKB/TrEMBL:B5ECC6"
FT                   /protein_id="ACH37554.1"
FT                   /translation="MSKPTKYILISAAIVTSIIVFVTALLPIIVRNKTVSTLKEATGRE
FT                   VHLSSVSINPFTLTVTVNDFAIAEKTGPPLVAFRKAKASLALASVYKRALILSEIVLDT
FT                   PSVSLVRTAPNRFNFSDIIDRQPKGKAPEQGKPFLFSLNNISVKNGSIEFDDRMTAGGR
FT                   KHTVRDLQITIPFISNIPYLADRYVDPRLAAVVNGAPFNFTGKLKPLSKSLETSVHIGL
FT                   KGLNLPQYLAYAPVPPPVDLTSGRLTLDMDLAYRVSADKKPELILKGGAGLAEVRVNLL
FT                   DGKPLLRLPSLELKADRLEVLAKSFEFNSIALNGLELFIDRDSNGRWMYDRILGATEKP
FT                   KEPKEPKAAKDGEKEGKTTFAARSFVSSNGTVHFHDAIPKGGFTSTVSDLNLALKEFST
FT                   KPGGSASYDLSLLADDATIKSRGQFALTPLSLTASIQLAEAKVGRAWPYLRQYLTAPVQ
FT                   GTVGLSAEILYSELEGLRVQKGDLAIAGLSTRYGSKEGFDLATLQVKDASFRQSANRLE
FT                   VGEVRLSGGNLSLSREADGTLSPLSLLAEQPKSKPVPPRKPRREASDKSKEFAYRVQRL
FT                   QLDGFKLAFTDKTYEEPPRFTLKNTSLTLSNLQGPKFAPMPMTFASTYGKGAGLKARGT
FT                   LTPAPFRYQGMMSVARLPIRDFEPYFPDSFNFSVIGGTADLSLNLDVAARDGKTKGHFR
FT                   GSAGVRDFQSIDAVGDQDLLKWESLQFDEFQGELEPFSLNIRQVALNDVYSRVIVRKDG
FT                   SLNLQDLVKSEAPQPAAAAPVSAMQPPRVATATAPAVPAPTGATSPPKAAPPARQVSVG
FT                   SVTIQNGTLSFTDNHLPQTFNSTFYNLGGRVSGLSSEESKFADVDLRGNLENHSPMQIT
FT                   GRLNPLRDDLFVDLKISFRDIELSPVTPYSGTYLGYEIDKGKLFLDLKYLIEKKQLSSE
FT                   NRVFIDQFTFGKKVDSNQATNLPVRLAIALLKDRKGEIHLDLPVTGRTDDPQFSIWGLV
FT                   GQVLKNLLVKAATSPFALLSSLTGGGQDFSTVQFEPGSSILSQGEGQKLEKLAKVLVDR
FT                   PGVKMELKGFVDKAKDPEGYRQELLERKLRHEKYLYQAKEQKAKELKEGESGETVKLSD
FT                   EEYKTFLKAVYKKEKFPKPRNALGLVKDLPANEMRKLIIANTVVAEADLQSLARERAAT
FT                   VFNYLVAKGGLPPERLFQGTEDIYHPPAQESAVRSRVEFNAIAR"
FT   gene            complement(637608..638072)
FT                   /locus_tag="Gbem_0526"
FT   CDS_pept        complement(637608..638072)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0526"
FT                   /product="DoxX family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37555"
FT                   /db_xref="GOA:B5ECC7"
FT                   /db_xref="InterPro:IPR032808"
FT                   /db_xref="UniProtKB/TrEMBL:B5ECC7"
FT                   /protein_id="ACH37555.1"
FT                   /translation="MFNKILATRDDINLTIVRVFLGLVFFPHGAQKMLGWFGGPGFSGT
FT                   MQMFTQNMKVPMVFAFLAICAEFLGSLGLLVGLCTRIAAFGILSNMAVAIFMVHLPNGF
FT                   FMNWTGKQSGEGFEYHLLVLGMALALIVGGGGKASLDRKIAVDPTWRTPH"
FT   gene            complement(638114..638359)
FT                   /locus_tag="Gbem_0527"
FT   CDS_pept        complement(638114..638359)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0527"
FT                   /product="lipoprotein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37556"
FT                   /db_xref="UniProtKB/TrEMBL:B5ECC8"
FT                   /protein_id="ACH37556.1"
FT                   /translation="MEKTYVIGALLLVAVTCGCSSRGGSAAGGALGGAAIGAGAYEYNA
FT                   YRQMQQLDQDYKTGKMNKQEYEIRKNQIEKGSLFQK"
FT   gene            638630..639004
FT                   /locus_tag="Gbem_0528"
FT   CDS_pept        638630..639004
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0528"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37557"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:B5ECC9"
FT                   /protein_id="ACH37557.1"
FT                   /translation="MKAGTGQAEVRSFGKPDEVREFPNGKLELLQVGGTVIGRATFKPG
FT                   WRWSTSIQPLVGTKSCEAPHFQYHVAGRIHVVMDDGKEFDCGPGDVSLLPEGHDAWVIG
FT                   DEPAVVVDFQGMADYAKNNL"
FT   gene            639359..639988
FT                   /locus_tag="Gbem_0530"
FT   CDS_pept        639359..639988
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0530"
FT                   /product="protein of unknown function DUF922"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37559"
FT                   /db_xref="InterPro:IPR010321"
FT                   /db_xref="UniProtKB/TrEMBL:B5ECD1"
FT                   /protein_id="ACH37559.1"
FT                   /translation="MFRRVTTLAGLMAILILCASPLFAGTRSAPSCELTAKERYTYYEI
FT                   SGKDVDDLRREMNQRGTVGEDGRVYSALTSWDINFSYDIAQDASGYRVKSATTNVDIEY
FT                   RLPRVGASCTDPELNLVWARYSERLQQHEFGHKNLAIQAASEINELLASLPAFPTADAL
FT                   AAEITRVTDEKFRVLKEKQVGYDDETRHGETQGAILPSRGTRFAGA"
FT   gene            complement(640062..640871)
FT                   /locus_tag="Gbem_0531"
FT   CDS_pept        complement(640062..640871)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0531"
FT                   /product="glycine/threonine-rich protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37560"
FT                   /db_xref="UniProtKB/TrEMBL:B5ECD2"
FT                   /protein_id="ACH37560.1"
FT                   /translation="MRSVRRALFTVIAMAGLMGLVTGTGYAAGTKHSGTHHKAGTMSKT
FT                   SKTHHKTMTHKTGSARGTAGGGLTESSMPSGVGAHSTTRQDFSVEKVGPETGSGGAMGT
FT                   GAGGNVGTSGTMQRGTGGTYDQGTGGTMQRGTGGTYDQGTGDTMQRGTGGTYDQGTGGT
FT                   MQRGTGGTYDQGTGGTMQRGTGGTYDQGTGGTMQRGTGGTYDQGTGSMGTGGTTGTGSM
FT                   GTGGTTGTGSGGSMGTGGTTGTGSGGSMGTGGTTGTGSGGSMGTGGK"
FT   gene            complement(641167..642987)
FT                   /locus_tag="Gbem_0532"
FT   CDS_pept        complement(641167..642987)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0532"
FT                   /product="Kup system potassium transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37561"
FT                   /db_xref="GOA:B5ECD3"
FT                   /db_xref="InterPro:IPR003855"
FT                   /db_xref="InterPro:IPR023051"
FT                   /db_xref="UniProtKB/TrEMBL:B5ECD3"
FT                   /protein_id="ACH37561.1"
FT                   /translation="MKQTAAAPLWKDVVKSFGLVFGDIGTSPIYTLTVIFALTKPTYDN
FT                   VMGILSLVFWTMTILVSAEYSWLAMKLSRKGEGGTIVLKEILVRLLKPGRTVAFVAFLS
FT                   YLGVSLLLGDGVITPAISILSAVEGLELIPGLEQMPQAVLISIAAAIAVLLFVFQYKGT
FT                   DRVASLFGPVMVLWFAALTLSGLASLLQRPELIQAMNPAYALKFFQDNGFSSFFVLSEV
FT                   ILCATGGEALYADMGHLGRKPIVIAWYFAFCALAINYLGQGAFVLSHGGGKNILFSMIQ
FT                   HQAPVLYVPFLLLAVMATIIASQAMISGVFSVIYQGINTRIMPLLKVDYTSSHLKSQIY
FT                   ISSVNWCLLAAVIFIMLVFRRSENLAAAYGLAVTGTMTITGIMMVMIYRRTSMKWKVPF
FT                   AVIVTAVDLVFFTACLNKIPHGGYWSIVLASIPFATIVVWTMGQRALYRALKPLDLDTF
FT                   LVSYNQIYAKGKNIPGTGLFFTRETPVVPPYVVHSIIRSNIIYERNIFISMIRTDVPFG
FT                   LKSALTSALGPGLDAFVIKAGYMEVVEIEKLLKANGIDEKVIFYGVEDIKTANPFWKFF
FT                   ATMKKQTPNFVQFHNLPAGKLQGVVTRVEM"
FT   misc_feature    complement(643081..643215)
FT                   /note="osmotic shock-responsive RNA structure; Gbem_R0080"
FT   gene            complement(643297..644247)
FT                   /locus_tag="Gbem_0533"
FT   CDS_pept        complement(643297..644247)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0533"
FT                   /product="cyclic diguanylate phosphodiesterase"
FT                   /note="domains: HD-GYP"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37562"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR037522"
FT                   /db_xref="UniProtKB/TrEMBL:B5ECD4"
FT                   /protein_id="ACH37562.1"
FT                   /translation="MKDLYWRAISIDSIDPDYFPSVPLFMKTAGNYVLYKDAERKFSSA
FT                   DRSRMDRTGTEFMYVRSGDMSEISTYLENSLKDMLTRDDLDSERKGRILYQTSINYLVD
FT                   AFEAPEEASNLERCRQLVQHMMSYLSNEPHALKSVGSVVEHNLYIFSHSVQVAALNLLA
FT                   HEKLFQVHPDELIDVGIGSMLHDYGMIFVTNDILNKPDALSDVEYYKIKQHTQKGYEYL
FT                   KDSGRFGDMSLTIVRHHHERYDGNGYPTGMKGDQIPRSAQLSAMCDMYSALTLDRAYRK
FT                   AVSHQEAIKAMRTEAGAFNASLLGNFVELVTAQKE"
FT   gene            complement(644925..645773)
FT                   /locus_tag="Gbem_0534"
FT   CDS_pept        complement(644925..645773)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0534"
FT                   /product="protein of unknown function DUF399"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37563"
FT                   /db_xref="InterPro:IPR007314"
FT                   /db_xref="UniProtKB/TrEMBL:B5ECD5"
FT                   /protein_id="ACH37563.1"
FT                   /translation="MTRAPSSWLLLALISLFCFSAEAGAHTIITRTSDGKTVTLPQLAA
FT                   AAKDSQVIVVGESHDDEYHHELQLDLIRSLNESKLPLAIGMEMIQSDFQVQLDAWSAGK
FT                   LSEEVMQAVFELNWSDWPLYREIFLYARDNRIPMIALNVPLHIVRKVSQQGFSSLTPEE
FT                   KGDLPAGTSCDLRNPQIAFLRKSFQGVRHHGENGKMFSNFCEAQTVRNSGMALKMARYL
FT                   EKQPDRRMVVMTGIWHAVKYGIPDQLQRLGKLSYTVILPETPFVNKENAGSAEADYLVE
FT                   Q"
FT   gene            complement(645801..647465)
FT                   /locus_tag="Gbem_0535"
FT   CDS_pept        complement(645801..647465)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0535"
FT                   /product="sensor histidine kinase, PAS domain-containing"
FT                   /note="domains: PAS, HisKA, HATPase_c"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37564"
FT                   /db_xref="GOA:B5ECD6"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR025201"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR038318"
FT                   /db_xref="UniProtKB/TrEMBL:B5ECD6"
FT                   /protein_id="ACH37564.1"
FT                   /translation="MWVLASFFPLAALALQWLLWERLRPYVWLFFYPAVFLSSWAGGRV
FT                   AGLLATAFSATVVWYFFIPPEQSFSLEHPSTAIALLIFAGMGILFSLFHERLRRADRQI
FT                   RLTLAEATSGREQLERRMEERTKELVDLVDELRRKETDLRRSQELLKLFIEYAPVPLAM
FT                   FDSEMRYLYASRRWRSDYGLGNRPLVKVSHYEIFPEIPQHWKELHQRGLAGEILREEAE
FT                   EFRRADGTVQWLRWELRPWYDAGGMVGGIVIFSEDITNRKCAEDALQKLNEELELRVVQ
FT                   RTETLDQILGEREAQNAELQRAYHELEAETAQRIRMVEELRQKEQLLIHQSRLAAMGEM
FT                   LGYIAHQWRQPLNVLGLHLQVLGLSYQHGTFTRELLEQSVEKAMGIIRHLSRTIDDFRD
FT                   FLVLNKEKTLFQVDEVVVKTVGLIEENLKKAGINIEVACTNPPEVNGFPNEYSHVILNL
FT                   LTNAKDAFSERQTEHPVIRVHSGFEQGKTVVTIGDNAGGIPEEIIGKIFDAYFTTKGLG
FT                   KGSGVGLFMSKMIIEKNMGGSLTVRNVNGGAEFKIEV"
FT   gene            complement(647774..649369)
FT                   /locus_tag="Gbem_0536"
FT   CDS_pept        complement(647774..649369)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0536"
FT                   /product="sensor histidine kinase response regulator, PAS
FT                   domain-containing"
FT                   /note="domains: PAS, HisKA, HATPase_c, REC"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37565"
FT                   /db_xref="GOA:B5ECD7"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B5ECD7"
FT                   /protein_id="ACH37565.1"
FT                   /translation="MVTDENTIAIPQLIYEAVSRGKREWEQTFDSIADLIFITDTNHTI
FT                   SRANRAMAKHCGLRPEDLPGRKCYDLFHDLASPPPYCPLKSLKEGGAPRAEEVEVAKFC
FT                   GFFDISVSPLYNDEGTLAACVHVARDVTERKKAEEYRLELEQQLLQSQKLESLGVLTGG
FT                   IAHDFNNILMIILGHCLLAKENQASAPVVGHLDQIESAGNRAADLCRQMLAYAGKAPLI
FT                   QTQIDLPALVRDMVQMLQPAFNKKVTIECDLGGDLPKLTCDEAKIQQIVMNLVVNAAES
FT                   LGEQGGKVKVTLSHKTVLQAQQEVDCFGNVIPPGTYQCLEVADTGCGMDQETQKRIFEP
FT                   FFTTKFTGRGLGLSAISGIIKSHNGALQLCSAPGAGTTFSVYFPLPPCCPAGDQVAAPL
FT                   PLPLNAAARLEGTILLVDDEEELRAVGCELLTSMGFKVIAVNNGSEALAIWQERKSEID
FT                   LVLMDLTMPELDGVETYRALREDTPTLPVLFCSGYGDQDIRPCIGEDARAGFIAKPYQL
FT                   AQLQAALAALWKTA"
FT   gene            complement(649363..649566)
FT                   /locus_tag="Gbem_0537"
FT   CDS_pept        complement(649363..649566)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0537"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37566"
FT                   /db_xref="UniProtKB/TrEMBL:B5ECD8"
FT                   /protein_id="ACH37566.1"
FT                   /translation="MCCHIQRPIGIIHPLTVVRRSTSAVMTVASDKTSLAALDAGVHLH
FT                   CLPQELFFSPRHPAAATRVLAW"
FT   misc_binding    complement(649617..649733)
FT                   /bound_moiety="cyclic diguanylate"
FT                   /note="cyclic diguanylate-responsive riboswitch;
FT                   Gbem_R3002"
FT   gene            complement(649838..651733)
FT                   /locus_tag="Gbem_0538"
FT   CDS_pept        complement(649838..651733)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0538"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37567"
FT                   /db_xref="InterPro:IPR025178"
FT                   /db_xref="UniProtKB/TrEMBL:B5ECD9"
FT                   /protein_id="ACH37567.1"
FT                   /translation="MAIPRSAVFATLWLLLLFSPAAAAAPPSQPDLLTARARSMGLAAE
FT                   RNWHILLHYKKTSGGFKSRISDPNFFLSPEGRENPEAELEATIAGFFQPRSVDGEHPIC
FT                   RFPARLQWLKERLGIGPGDLQEVACPAQKELLQTVDARSAVLVFPVGHINSPASMFGHT
FT                   LLRFDGPTKSNLISFAVNYAADANDSNGLLYAYKGLFGKYKGYYSLMPYYLKVKEYGDM
FT                   EHRDMWEYRLRLSQAEVERMLLHTLELERISSDYFFLDENCAFNLLFLIEAARPTLHLT
FT                   DQTGLLVHPTDTIELTKQSGILEEGVYRPSQGARIVKMASLLDGERQKAALKLGQGESD
FT                   PAVAANAGASVEEQRGILDLAAEVVQLRYARKELEKDEYNKLYLKILAQRSRLGKGEDD
FT                   AYAVAPPSPPDAGHKTTKLGVGGGIRRDEWFGEVRLQPEFHDMLDPDQGYIRGAQIKFL
FT                   ETALRYAPEHERFWLKSMHLVDIFSTAPRDRFFTPLSWKVAAGWDTEAMKDGRDSLIFR
FT                   VNTGGGFAARSPFGGIVHALGEVDLNAGRRFAGNVAAGPGVSLGALEQLTAWWKLQLRG
FT                   EGFYYLLGDNRLALKGTVAQNFRLARNDSLSLELSYQEVQGHPVREATMLWNRYF"
FT   gene            complement(651843..652307)
FT                   /locus_tag="Gbem_0539"
FT   CDS_pept        complement(651843..652307)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0539"
FT                   /product="protein of unknown function DUF3015"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37568"
FT                   /db_xref="InterPro:IPR021383"
FT                   /db_xref="UniProtKB/TrEMBL:B5ECE0"
FT                   /protein_id="ACH37568.1"
FT                   /translation="MKKLLLGFLLSLTVSGAAYAAQAHTNTGCGLGTMLFQNKADNSIA
FT                   LQVLQATTNGSFGSQTFGISSGTSECQQPGKIAQNEKLNEFVRANMDNLAKEIAMGKGE
FT                   TLDTFVEMLGVNPAQGDAYKSSLQANFNNIFTSDKIVLAEVIDNAVAITR"
FT   gene            complement(652511..653821)
FT                   /gene="pbuG"
FT                   /locus_tag="Gbem_0540"
FT   CDS_pept        complement(652511..653821)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pbuG"
FT                   /locus_tag="Gbem_0540"
FT                   /product="hypoxanthine/guanine transport membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37569"
FT                   /db_xref="GOA:B5ECE1"
FT                   /db_xref="InterPro:IPR006043"
FT                   /db_xref="InterPro:IPR026033"
FT                   /db_xref="UniProtKB/TrEMBL:B5ECE1"
FT                   /protein_id="ACH37569.1"
FT                   /translation="MTSRIAAYFQFQRYGTDMKREVIAGLTTFLTMAYIIIVNPAILEN
FT                   AGIPRGPSTTATIIAAVFGTVLMAFFANRPFAIAPYMSENAFIAFVVVKVMGYSWQTAL
FT                   TAVFFAGILFTLLTLFKVRSWLAESIPLSLKCAFATGIGLFLTFIGLNETGIVVLGVPG
FT                   APVKLGDLSQPSVLLAVCGLLLTVVLISRKVLGAMMIGIVATTLASIALKVTPLPHSFV
FT                   SLPPDISPILFQLDFAGALSPGFFPIILTIFIMAFLDTVGTLLGLSMRADLLDEKGNLP
FT                   EIEKPMLADALATVAAPLLGTTTTGAYIESAAGIEEGGRTGFTALVTAFFFLLALFFAP
FT                   LFTVVPAHAFGIALIVIGSFMISPLAKIDFDDFTEQIPAFLTVVLMIFTYNIGVGMTAG
FT                   FIAYPLMKGATGRIKEMKGGMWVLALLSLSYFIFGAK"
FT   gene            complement(653824..654375)
FT                   /locus_tag="Gbem_0541"
FT   CDS_pept        complement(653824..654375)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0541"
FT                   /product="hypoxanthine/guanine phosphoribosyltransferase,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37570"
FT                   /db_xref="GOA:B5ECE2"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:B5ECE2"
FT                   /protein_id="ACH37570.1"
FT                   /translation="MLLKDMEDIRQKADCLKSAQEVDDALSRMAQQITERLAESNPVAI
FT                   CIMNGGLFVTGKLVDKLPFALELDYLHATRYGAELTGGNLLWKVKPERSLKGRTVLLVD
FT                   DILDEGVTLAEIERYCREEGAAAVYTAVLVDKIHDRKAPGAKADFVGLEVEDRFLFGCG
FT                   MDIAGYWRNLPALYAMKEQN"
FT   gene            complement(654527..656131)
FT                   /locus_tag="Gbem_0542"
FT   CDS_pept        complement(654527..656131)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0542"
FT                   /product="acyl-CoA synthetase, AMP-forming"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37571"
FT                   /db_xref="GOA:B5ECE3"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR010071"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:B5ECE3"
FT                   /protein_id="ACH37571.1"
FT                   /translation="MYLLQRLLTRSATSFPDKTAVSFRNEELSYAELEAASNQLSAALK
FT                   AHGVQRGDRVGILMNKSLESIVSVFGILKAGAIYVPLDPGAPASRQASIIRHCGIEIVL
FT                   AAPQLLEQLLAEAGEAPPLRAAIVTGSPAVTLPHPAGSMSCSGWDEILGESCECPADDG
FT                   LCGAAPAYILHTSGSTGSPKGVVISHLNALTFVEMAVRFFEISPQDRLANHAPLHFDLS
FT                   IFDIFCAARSAATMVLIPDALSAFPVRLADFMQSEGVTVWNSVASLLTKLADQGALDRL
FT                   TLDRLRLVHFSGDLMPVKYLKILKQCMPAAVFYNIYGQTEANSSLYFRVPDVVEEAAWK
FT                   IPIGTPFPNFEVFAIDEVGNVVTGAGEEGELHVLSSTVALGYWNDCGRTQAQFTPDPRN
FT                   PSAHARVYKTGDMARLDAAGNFVFAGRKDHMVKSKGFRVELGEIEIVLNSHPDIRQAVA
FT                   VAIPDDLAGSRIVAYVCLREGVELEPQTLVVHCSDHLPKYMVPEQIRYLPSLPVTSNSK
FT                   IDRKALVQAFLDGPAEP"
FT   gene            complement(656156..657301)
FT                   /locus_tag="Gbem_0543"
FT   CDS_pept        complement(656156..657301)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0543"
FT                   /product="short-chain acyl-CoA dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37572"
FT                   /db_xref="GOA:B5ECE4"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:B5ECE4"
FT                   /protein_id="ACH37572.1"
FT                   /translation="MEAIFNEEQRNFKQMAIEFARRELNQGAKERERKGEFSQRGWEKC
FT                   AEFGIPGITMPEKYGGLGLDTMTSIATMEGLGYACLDSGLLFSLNSHVWTCESPINRFG
FT                   SEEQKKRYLPGLIAGSLRGGHAMTEPDAGSDAFSMRCRAEKRGDRYILNGSKTFITNAP
FT                   IADLLLVFAVTCKEKGFAGVSAFIVERGFPGFSTGQPLETMGLRTCPLGEVFLEECEVP
FT                   EENRLGQEGSGAAIFNSEMEWERSCLFAAHLGAMDKILEDCVAYAKERQQFGKAIGKCQ
FT                   SISHKISDMKVRIELSRLMLHQVATLKGQGKRAPLESAMAKLFISESYVQNCTDALQIH
FT                   GAYGYSAEYDFERNLRDAIAGKIYSGTSEIQRNIIATFLGL"
FT   gene            complement(657341..657997)
FT                   /locus_tag="Gbem_0544"
FT   CDS_pept        complement(657341..657997)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0544"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37573"
FT                   /db_xref="UniProtKB/TrEMBL:B5ECE5"
FT                   /protein_id="ACH37573.1"
FT                   /translation="MRKDLHDFWHFSRRYRQFQRISALTQGILDKDHEVSEPTRGALQK
FT                   LNGNRIKCQERIAGLDLPSFAGCRSCQGACCGEPAEHYFTAIDFWLRKYSHKQVTAFSE
FT                   QPLQPLPAYYRLRIESALGLGKPRTTAQGSHLRQDSRCAHLGERGCLLPHAERPLQCLI
FT                   YACPSLKQSLDQATRLAYLESVRELLGISLATFNALKCEAGFPPYYGLTSLLLTV"
FT   gene            complement(658009..659007)
FT                   /locus_tag="Gbem_0545"
FT   CDS_pept        complement(658009..659007)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0545"
FT                   /product="arginase family hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37574"
FT                   /db_xref="GOA:B5ECE6"
FT                   /db_xref="InterPro:IPR006035"
FT                   /db_xref="InterPro:IPR023696"
FT                   /db_xref="UniProtKB/TrEMBL:B5ECE6"
FT                   /protein_id="ACH37574.1"
FT                   /translation="MNSKDIPMVPNRKASLPTVYGDTPSFLGVPVLDYRKPAAGYDVMI
FT                   AGVPWEGTVTWGSFTGCELAPRSIRHASARYGGFLPEYEIDLFDHLTLGDIGDIPVHPN
FT                   DPAETMRNVHAAMQRVYRNQSIPFVLGGDHSFTPEIIRALADGEEGKIGVIHLDAHLDN
FT                   AKSFGSDQFARCGPIHRISQIPQVRKESIVHLGIRGPRNSPTQYEYAQSMGARVITTRE
FT                   VRERGMSAVTEEAIRIAHHETRHVFVTICSDCIDAGYNPGGPADFNGLLPSELLPALHQ
FT                   IGASGISGLDYVEVYPGQDPQGYSSHLAAWAMIYALSGMAQRKRDRPGPDR"
FT   gene            complement(659034..659684)
FT                   /locus_tag="Gbem_0546"
FT   CDS_pept        complement(659034..659684)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0546"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37575"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:B5ECE7"
FT                   /protein_id="ACH37575.1"
FT                   /translation="MLQYCKMRLVQVLETVKHGSINSLLRETVYLNREAVPVEIELDNL
FT                   RPVADFARPHDEEVVELTQELLQNRQLAYPLKSRHLKTLNYLKRGYRGYALVKGNKVFG
FT                   DIWCADSKAGNDCYKHPDELWLGVRCAPKEVYTFDMFVDPANRGGNLAAALQNGALHLL
FT                   KRHGYTKAYGFFWSDNVPALWVHRTLRWRELNRVRATRLLLSRKLYVTGDPAD"
FT   gene            complement(659708..659965)
FT                   /gene="acpP-5"
FT                   /locus_tag="Gbem_0547"
FT   CDS_pept        complement(659708..659965)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="acpP-5"
FT                   /locus_tag="Gbem_0547"
FT                   /product="acyl carrier protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37576"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/TrEMBL:B5ECE8"
FT                   /protein_id="ACH37576.1"
FT                   /translation="MVDFTETVRSFIEKEMMTQAHKGTLSPSDSLIDKGIVDSLGVQRL
FT                   IAYLEQEFDLQIADTEIVPENFETIGSVVNFINYKLTAKG"
FT   gene            660264..661937
FT                   /locus_tag="Gbem_0548"
FT   CDS_pept        660264..661937
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0548"
FT                   /product="radical SAM domain iron-sulfur cluster-binding
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0548"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37577"
FT                   /db_xref="GOA:B5ECE9"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="UniProtKB/TrEMBL:B5ECE9"
FT                   /protein_id="ACH37577.1"
FT                   /translation="MSRKSIEKRRALLAGESGGEHRNSGGRLSCCLVYPNRYHSAMSNL
FT                   GFQAVQAMMNAHPEVICERAFLPERDELAELERTEGTLLSLEGQRPLSSFDLVAFSVSF
FT                   ESDYLNLPTIFRLSGMSPWAAERSALQPLVLAGGAALFLNPEPVAPFLDLVCIGEAEPI
FT                   LPDLLELLKDGRRSRAELLLQACRLPGVYVPSLYQPQYDAGRFRGVQPLPGAPARVRRV
FT                   WEKELDRRQTVTEIHTDATEFSGMHLVELSRGCPRACRFCAAGFIYLPYRSRSLEGVRE
FT                   EVLKGVAQGRKVGLVAAAVSDYTGIGELCGEIVAAGGKFSVSSFRIDHLDAGMIEALKA
FT                   SGQKSVALAPEGGSQRLRDLVKKGIDEEQILAACDKLISHDILNLKLYFIIGLPTETEK
FT                   DLEELVLLVTRIRERVLAAAKKNKRLGELQLSVNPFIPKPFTPFQWCGMEPVKSLESKW
FT                   KYLQKALGKLSNLKLQMESPREAYQQALLSRGDRRLAQLLVLADRTGSWKQALREAGLD
FT                   ADAEVHRQVGLDEPLPWDFIDGGDCERLKREYRRAFEEGN"
FT   gene            complement(662003..662593)
FT                   /locus_tag="Gbem_0549"
FT   CDS_pept        complement(662003..662593)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0549"
FT                   /product="outer membrane protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37578"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="InterPro:IPR027385"
FT                   /db_xref="UniProtKB/TrEMBL:B5ECF0"
FT                   /protein_id="ACH37578.1"
FT                   /translation="MRKLFMLSAGALLLATTLTANAGAEELRGRLALTGKIGVINPAKS
FT                   ELDTPQGTMVVSTDAGLTGGLGLMFGVDENVAVELEVSRASFHTSNFGTAQITDVSVGA
FT                   QYRFPERQRLVPYLGAGMDVLVNDLSNRYTNTTVGAHLSAGVDCILNRQASLMLEAKGI
FT                   ESFSANVDTPSGQHGEFDPTNLSVTVGARFFFN"
FT   gene            complement(662805..663461)
FT                   /gene="elbB"
FT                   /locus_tag="Gbem_0550"
FT   CDS_pept        complement(662805..663461)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="elbB"
FT                   /locus_tag="Gbem_0550"
FT                   /product="isoprenoid biosynthesis amidotransferase-like
FT                   protein ElbB"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37579"
FT                   /db_xref="GOA:B5ECF1"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR026041"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:B5ECF1"
FT                   /protein_id="ACH37579.1"
FT                   /translation="MKRIGVVLSGCGVRDGSEIHEAVLALLAIDRSGAKAVCLAPDIDC
FT                   DEVNHLTMQETGAKRKVLVESARIARGEVSDVKNAKASDLDAVVFPGGFGAAKNLCNFG
FT                   QKGADGMVQPDVLRLVREMSAAKKPICAICIAPSVVALALGKELSPRLTIGNDPGTAGA
FT                   ISATGSKHVDCPADEIVVDRENLIVSTPAYMLAGSISEAARGIEKAVQATLELIK"
FT   gene            663605..663817
FT                   /locus_tag="Gbem_4067"
FT   CDS_pept        663605..663817
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_4067"
FT                   /product="iron-sulfur cluster-binding oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_4067"
FT                   /db_xref="EnsemblGenomes-Tr:ADO00764"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:E1P669"
FT                   /protein_id="ADO00764.1"
FT                   /translation="MNDNLQCEIPPVVDKLRCTGCGRCVAACSSRLITLEVDGFRKHAR
FT                   LSAPERCSCCLACIDACPVGALRCD"
FT   gene            663894..664055
FT                   /locus_tag="Gbem_0551"
FT   CDS_pept        663894..664055
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0551"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37580"
FT                   /db_xref="UniProtKB/TrEMBL:B5ECF2"
FT                   /protein_id="ACH37580.1"
FT                   /translation="MLYFIKQNTIHTYPVKNRCGAIYELEQLRDTIPRDVQQCPYCMKL
FT                   WPGRNAED"
FT   gene            complement(664136..664209)
FT                   /locus_tag="Gbem_R0013"
FT   tRNA            complement(664136..664209)
FT                   /locus_tag="Gbem_R0013"
FT                   /product="tRNA-Glu"
FT   gene            complement(664280..664355)
FT                   /locus_tag="Gbem_R0014"
FT   tRNA            complement(664280..664355)
FT                   /locus_tag="Gbem_R0014"
FT                   /product="tRNA-Lys"
FT   gene            complement(664396..664473)
FT                   /locus_tag="Gbem_R0015"
FT   tRNA            complement(664396..664473)
FT                   /locus_tag="Gbem_R0015"
FT                   /product="tRNA-Glu"
FT   gene            complement(664477..664552)
FT                   /locus_tag="Gbem_R0016"
FT   tRNA            complement(664477..664552)
FT                   /locus_tag="Gbem_R0016"
FT                   /product="tRNA-Lys"
FT   gene            complement(664625..665923)
FT                   /gene="purA"
FT                   /locus_tag="Gbem_0552"
FT   CDS_pept        complement(664625..665923)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purA"
FT                   /locus_tag="Gbem_0552"
FT                   /product="adenylosuccinate synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37581"
FT                   /db_xref="GOA:B5ECF3"
FT                   /db_xref="InterPro:IPR001114"
FT                   /db_xref="InterPro:IPR018220"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033128"
FT                   /db_xref="InterPro:IPR042109"
FT                   /db_xref="InterPro:IPR042110"
FT                   /db_xref="InterPro:IPR042111"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5ECF3"
FT                   /protein_id="ACH37581.1"
FT                   /translation="MANVVVIGAQWGDEGKGKVVDIYTEFADNVVRYQGGNNAGHTLVV
FT                   GDEKVILHLIPSGILHEGKRCVIGNGVVLDPEVFIMEITKLKANGYLKDDKMLLLSEAL
FT                   HIIMPYHKRIDIAREKKSGSKKIGTTGRGIGPAYEDKIGRRGIRLMDLLDEKAFTRKVK
FT                   EVLEEKNLILTQLLGDQPFTFEEIYEEYMKYAETLRKYAADTSLILHQETKAGKSLLFE
FT                   GAQGTLLDVDHGTYPYVTSSSTCSGGACTGSGVSPREIHEVIGISKAYATRVGSGPFPT
FT                   ELEDETGEQLRQAGREFGSTTGRPRRTGWYDALVARYAVRVNGLSGIAITKLDVLSGQE
FT                   TVKVCTAYNYKGQVLTEVPASLEIMEQCTPIYEELPGWNDDITGAKSMAELPKNARDYV
FT                   ARIEKLSGAPVVLVSVGPRRDETIVLRNPFELN"
FT   gene            complement(665916..667238)
FT                   /gene="hisZ"
FT                   /locus_tag="Gbem_0553"
FT   CDS_pept        complement(665916..667238)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisZ"
FT                   /locus_tag="Gbem_0553"
FT                   /product="regulatory subunit of short ATP
FT                   phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37582"
FT                   /db_xref="GOA:B5ECF4"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR004516"
FT                   /db_xref="InterPro:IPR004517"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="InterPro:IPR041715"
FT                   /db_xref="UniProtKB/TrEMBL:B5ECF4"
FT                   /protein_id="ACH37582.1"
FT                   /translation="MTNPSCIEAPLPKGVSDFLPETADKITFIADSIHRVFELWGFRRM
FT                   ITPLLEFEHVLALGMGDELRSKTFRFDDRQTGRLLAIPPDITPQVARIVATRMHALPLP
FT                   HRIYYSGRVLRQAQMQSGKSREIFQFGVELIGLDSPEADAEMVAMAVEVLKNLGFTGFK
FT                   IDLGQVEFYRGIMDASGLSAEVQKQLQEAISKKEVSAVRSILESAGAPDRVKQEIALLP
FT                   RLYGGREVLQEARSIAGNERSLRALDNLAQVVDILDIYGVAEHLTIDLGEIRGLDYHSG
FT                   ITFEGFVPGVGEAICSGGRYDDLTAKYGYPAHATGFAFNILALLASMSKRPEVEASSSR
FT                   DFLIFNRKDERREALEVAQKLRSLGYTCARDIIKRDFDSSLEYAKKMNIRLLLVIGAED
FT                   CAAGQLYLVRVADRQSITVSEEELFDKDLDLKFDLQGENHG"
FT   gene            complement(667345..668775)
FT                   /locus_tag="Gbem_0554"
FT   CDS_pept        complement(667345..668775)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0554"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37583"
FT                   /db_xref="UniProtKB/TrEMBL:B5ECF5"
FT                   /protein_id="ACH37583.1"
FT                   /translation="MKRTLALTLILLSSLFFPLLASAENIRAYVSDFTVSGGDSADLKT
FT                   TLKRLMSSRLSGDGLVTVETAAEADVVISGSYTMLGKMFSLDATAKNAQGKQLAAAYEQ
FT                   GESIDALIPAVGKISSKLKGEIVKQYPQAAAPAAAPLQSPAFVTKAPASEIVRSEAGAG
FT                   WASQRIAGAKSAIASWGTEEMIIADADALYLYKKGDKLALLGQAALPQHQKLLGIDAIG
FT                   PDQEGKVLAFVTLMDREAPSSRVYSIQNGTLKAVAQDLPYMFRALAPYGGKKQLFAQEM
FT                   GRSDDYYGDVFEASFVDGKVKLANPIKMPRFANIFNFNLFRDRSGKSFLTCFNDSGYLL
FT                   VYADGDEIWRSSEKFGGTETYFQRRDIENERTTGTPFRTRFIDQRITVTDKGEVIVPQN
FT                   AGFFVLGNARSYSRYSMVDFAWNGSTLEELWRTKPSQNYLADYDFNQKSREMVLMEVTQ
FT                   KTGLGGKGGSLVRILRAE"
FT   gene            complement(668947..669222)
FT                   /locus_tag="Gbem_0555"
FT   CDS_pept        complement(668947..669222)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0555"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0555"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37584"
FT                   /db_xref="UniProtKB/TrEMBL:B5ECF6"
FT                   /protein_id="ACH37584.1"
FT                   /translation="MRKTIATLTAVLFIGSATTVFAQASETQKNECLLASKNCTNQVDD
FT                   IYKRMQRLDREIKKGKRVYSPEELKQLQQKLTETQELLRDMERPGK"
FT   gene            complement(669254..669529)
FT                   /locus_tag="Gbem_0556"
FT   CDS_pept        complement(669254..669529)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0556"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0556"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37585"
FT                   /db_xref="UniProtKB/TrEMBL:B5ECF7"
FT                   /protein_id="ACH37585.1"
FT                   /translation="MRKMAMILAATLCTLSSVPAFAQTTSTQKDECLLASKNCMNQVDD
FT                   IRKRIYKLDKEIRKGTRVYTPQELKRLQDKLNETSEILRTLEKPDS"
FT   gene            complement(669861..671219)
FT                   /locus_tag="Gbem_0557"
FT   CDS_pept        complement(669861..671219)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0557"
FT                   /product="outer membrane channel, OmpJ-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0557"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37586"
FT                   /db_xref="UniProtKB/TrEMBL:B5ECF8"
FT                   /protein_id="ACH37586.1"
FT                   /translation="MSFQKKMLAFAAASALTAATAVPAMALENEFHGMFKFMGYQSNSL
FT                   TGGNSGTVNFNSDAHSGFFAEQRARLMYIAKANDNLKLVTHFELDTRFGGVTGGYKGTT
FT                   GNDSGNLDADQLTLETKNIYLDFNEPNTATNFKVGMQPWNDAYGSLFLSADMTGVYATK
FT                   KFDPATVSLGWFRFDDNTLATGTNTGAGKLTADLIVLDGKFALNKDMTVGASYYNIQND
FT                   TGATFSSATVGNYELLHMLGLNADLKFGDVAVKPFAAYQFGDINGTDSISGYLLGATGK
FT                   AKVGSGAINFAGYYLSGDKKTTGDRDSFQTVTAGTTYFNPANMWLLVRPNQATNTSTSV
FT                   VNNDMTVGGRGSYGVFAGYEGTDNKLFYNANIGYMAAAENRTNAGVKENGSLGTEINAQ
FT                   VGYKIYDNLSASVAAAYVFLGDGLSGTTKKINGFGAANADDPYLFNVQLSYLF"
FT   gene            complement(671567..671980)
FT                   /gene="mceE"
FT                   /locus_tag="Gbem_0558"
FT   CDS_pept        complement(671567..671980)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mceE"
FT                   /locus_tag="Gbem_0558"
FT                   /product="methylmalonyl-CoA epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0558"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37587"
FT                   /db_xref="InterPro:IPR017515"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:B5ECF9"
FT                   /protein_id="ACH37587.1"
FT                   /translation="MLSKINHVGVAVASLEEALPFYRDSLGMTFSGTEEVPSQLVRVAF
FT                   LSVGESKIELLEPTSPESPVTKFLEKNGPGVHHVAYGVDDIEAAIAALVAKGTRMIDAV
FT                   PRNGAHGARIAFIHPKSSGGVLTELCEVHDHSH"
FT   gene            complement(672288..673941)
FT                   /locus_tag="Gbem_0559"
FT   CDS_pept        complement(join(672288..673328,673330..673941))
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0559"
FT                   /product="(R)-methylmalonyl-CoA mutase, isobutyryl-CoA
FT                   mutase-like catalytic subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0559"
FT                   /db_xref="EnsemblGenomes-Tr:ADO00765"
FT                   /db_xref="GOA:E1P670"
FT                   /db_xref="InterPro:IPR006098"
FT                   /db_xref="InterPro:IPR006099"
FT                   /db_xref="InterPro:IPR016176"
FT                   /db_xref="UniProtKB/TrEMBL:E1P670"
FT                   /protein_id="ADO00765.1"
FT                   /translation="MSIEEKKKAWQAAAEKSIAKAPERKSSFRNSSDIELDRCFAPGFD
FT                   YPGYEENLGFPGQYPFTRGVQPTMYRGRFWTMRQYAGFGNAAESNERYKYLLSAGQTGL
FT                   SIAFDLPTQMGYDSDASMSRGEVGKVGVAIDSLADMEILFDGIPLDKVSTSMTINSTAS
FT                   ILLAMYIAVAEKQGVSADKISGTIQNDILKEYMARGTYIYPPKESMRIITDIFAYCKDN
FT                   VPKWNTISISGYHIREAGSSAVQEVAFTLADGIAYVEAAVKAGLDVDEFAPRLAFFFNA
FT                   HNDLLEEVAKFRAARRMWSRIMRDRFKAKDPRSQMLRFHTQTAGCTLTAQQPDNNIMRV
FT                   TLQALAAVLGGTQSLHTNSRDEALALPTEESVRIALRTQQVIAYESGVADSIDPLAGSF
FT                   MVEALTDKIEAQALAYIEKIDALGGAVEAISRGFQQKEIQDSAYAYQRAIEKNETIIVG
FT                   VNKFTVQEGAPQGLLKVTGEVEVKQKASLGKMKEGRDNAKVEASLKALEQAARGTQNLM
FT                   PFILDAVKTYATLGEIANVMRGVFGIHRETVVL"
FT                   /artificial_location="low-quality sequence region"
FT   gene            674356..674556
FT                   /locus_tag="Gbem_0560"
FT   CDS_pept        674356..674556
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0560"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0560"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37588"
FT                   /db_xref="UniProtKB/TrEMBL:B5ECG0"
FT                   /protein_id="ACH37588.1"
FT                   /translation="MQCPVCKNDEHIGMDLRSGSFTEDIVECPSCGTMWSVNHGQMAIV
FT                   KDPLQDSFLEALSGDNICFAA"
FT   gene            complement(674676..677576)
FT                   /locus_tag="Gbem_0561"
FT   CDS_pept        complement(674676..677576)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0561"
FT                   /product="biotin-dependent acyl-CoA carboxylase, biotin
FT                   carboxylase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0561"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37589"
FT                   /db_xref="GOA:B5ECG1"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001882"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005481"
FT                   /db_xref="InterPro:IPR005482"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011764"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:B5ECG1"
FT                   /protein_id="ACH37589.1"
FT                   /translation="MAYTSEKYTKNPLIHRDRRLSLSPSAWVRSFSCEDLKPLIVCRGP
FT                   IRKEAMDVYQEMGITHYGILLSEKDSIVYPNALAPELRTLTDSKRVHRVPDYSGASKEE
FT                   RVERIHQIIRIALDNGYDSIFAGYGFMAEDDEFVGAIEQAGLNFIGPCAATQSGAGKKD
FT                   EAKRTALSVNVSVTPGIDNVTARTLIKKHSTREKLLALVKSDGLECDPQVLKNDKLSLE
FT                   ELADHILYASYNKGVDLFSIEELCAQVQTECIAMLKKYPQSRVRLKAIGGGGGKGQRLL
FT                   GAGLLNLKNADDKTIAKEAAEAPGLVREILNEVKANGIGDNKNILVELNIEQTRHNEIQ
FT                   LIGNGDWCLALGGRDCSLQMHEQKLLEVSVTQEGLLAAIEQAKAAGKKAEVKALESDLK
FT                   VLKRMEEESERFGKAVGLDSASTFECIVDRDRHYFMEVNTRIQVEHRVTELCYALKFVN
FT                   PDDPKDFFVVESLVEAMALLARHRKRVPKPERFVRFNAAVEARLNATDASLSPHAGGMI
FT                   RYWSKPIEGEIRDDQGISMLNPDTGVFMKYKVAGAYDSNIALLLTNGDDRLASYEKMSE
FT                   VLRATTLRGSDLATNLEFHYGLVNWFLGRNVMAKPTTRFVVPYLTLVGTLKEISNKIDP
FT                   VYAFLQMKKHYAKMVTDSLAGQPERQAKELKNMSTLLDRKGTLIIRPIERLLGDPHLLS
FT                   GWLSMNTKNFRIDNGKVVWLRNPVGVLNETYEYLHMNHRPHKPAAEIIWGHDNDLLQQA
FT                   LHFSRTLRENFGLARDEYFTLHEILKNDSPQGGFDQETWDQIRSAHFGYEAGLELLGML
FT                   FMIGQTTKFWDLRVEEDLEITIPEYLNDPELQARMKKVLVPPPATKADEIVSVCGGMYY
FT                   GQEAPGMPCFVTEGMHFEKGQPLYIIEVMKMFNKVYAPFAGTIDKILVTSGDGTIVSKG
FT                   QPLFKVTPDEKFVEVDVNALEKEKRGITSDYLKAVL"
FT   gene            complement(677732..679456)
FT                   /locus_tag="Gbem_0562"
FT   CDS_pept        complement(677732..679456)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0562"
FT                   /product="biotin-dependent acyl-CoA carboxylase,
FT                   carboxyltransferase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37590"
FT                   /db_xref="GOA:B5ECG2"
FT                   /db_xref="InterPro:IPR011762"
FT                   /db_xref="InterPro:IPR011763"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR034733"
FT                   /db_xref="UniProtKB/TrEMBL:B5ECG2"
FT                   /protein_id="ACH37590.1"
FT                   /translation="MSNTFIQPSLKNPFDAGEKVEFNIPGEISRATGGYEEAMQAGYDL
FT                   IQRPIKSVSIDQIEKQHFKKRMTVWERIRVLTEAEPNILFQNWGKNLDGASLVTGILNI
FT                   HGRDVAVYGHDFTVRAGSMDATNGNKLARLFYMAGEKGIPVIGMNDSAGAYVPAGVGGL
FT                   DGYAEAFTALRKISGVVPSIMCMFGFNAGGGSYLPRQGSFVIQPKDTFFGLTGPGVVKS
FT                   VLGEDVTPEDLGGPKVHGQSGVADLTVEDEVGALRTALQLLNYIPDNNSVMARHQETSD
FT                   PLDRKTWEINTLLKKAFNSPTGFNTPFDVSIIIQQICDHGDYFEMQRDRARNVVTAFGR
FT                   LGGNVIGFVANNSAVDSGQIDCDAAYKIARFNRFCNIYNIPIIFMEDTTGFLPGREQEA
FT                   RGIVQAGRAMLDSIVDIRTPRILLILRNAYGGAYASYNNYPTGADLVLALPTTRLAVMG
FT                   PAGKEFVYKDELRKIRNAVIERVKRGTQERVEAGVKPDLAKLDAEKEAADWLRAEEALL
FT                   NTRYEKELMNPKEALSLGSISSLVMPTDLRKVLGENMNFFLRHYKPGPMQSVQREFH"
FT   gene            complement(680082..681362)
FT                   /gene="larF"
FT                   /locus_tag="Gbem_0563"
FT   CDS_pept        complement(680082..681362)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="larF"
FT                   /locus_tag="Gbem_0563"
FT                   /product="D-lactate dehydrogenase, CCG domain
FT                   pair-containing subunit, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0563"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37591"
FT                   /db_xref="GOA:B5ECG3"
FT                   /db_xref="InterPro:IPR004017"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:B5ECG3"
FT                   /protein_id="ACH37591.1"
FT                   /translation="MTKKQIDPLERVAAEMKKCVKCGACRAHCPAFSTFQREPATARGK
FT                   VALAQHLCKGDITLDDGTYSAMSKCLLCGSCVEKCPNQVPTDEIVIAAREALAQRRGLT
FT                   TFHKAVGQVIKNRKVMNFGALAAAILGPLFFRKVPATSGLRLRFPMPFIGGSRHIPQIA
FT                   KKPFMKRHPEVIQGEPGKPRIVFFVGCMTNFVYTEIGEATLALFRHLGCTVIIPKGQQC
FT                   CGLPGMSGGDLNTVRELAEMNLAAIEAHQADYVMTACATCGGALHKLYPLVVGKRNPEL
FT                   KQRLQALADKTVDAAVLLQKLGLTPEETGTGSGMRITYHDPCHHRTAGITKEPRALLKR
FT                   TPGLELVEMEGADRCCGLGGTFNVYHYENSLDINASKSAAIIATGADAVVTGCPGCIMQ
FT                   LSDGLKQAGDKTRVLHTVELLARKIRR"
FT   misc_feature    681382..681412
FT                   /note="heptanucleotide repeats; Gbem_R7017"
FT   misc_feature    complement(681529..681559)
FT                   /note="heptanucleotide repeats; Gbem_R7018"
FT   gene            complement(681562..682941)
FT                   /gene="larD"
FT                   /locus_tag="Gbem_0564"
FT   CDS_pept        complement(681562..682941)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="larD"
FT                   /locus_tag="Gbem_0564"
FT                   /product="D-lactate dehydrogenase, flavoprotein subunit,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0564"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37592"
FT                   /db_xref="GOA:B5ECG4"
FT                   /db_xref="InterPro:IPR004113"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016171"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:B5ECG4"
FT                   /protein_id="ACH37592.1"
FT                   /translation="MLDARILQQLTDIVGSENIAATPQDLICYGYDATQMEFLPDCVVH
FT                   PDGSEEVARILKLANSEGFPVFPRGAGSGFTGGALPKGGGVVLVTTRMNRILRIDTDNL
FT                   VAEVEPGVVTETFQMAVEKLGLFYPPDPASLKFSTLGGNVAECAGGPRAVKYGVTKDFV
FT                   MGLEVVLPTGEVIRTGGETVKGVVGYDLTKLICGSEGTLGVITKIIFKLLPYPDAKKTM
FT                   LTVFDSIDGAARAVSTIIKNKIIPTTLEFMDHATLVCVERRFNLGLPDSGRAVLLIEVD
FT                   GDRDLIEKQAGEIHKLIEPLGLVQFRVAKDAAESEELWRVRRLVSPSLRDVNPDKFNED
FT                   IVVPRSKVPDVIRRIEVIQKRYDIPIVNFGHAGDGNIHVNIMIDKQVPGQLEKAHEAIK
FT                   EVFQAALDLGGTMSGEHGVGLAKQPYIPMELTADQVAAMKAIKRALDPNNILNPGKMLP
FT                   V"
FT   gene            complement(682995..684278)
FT                   /gene="larA"
FT                   /locus_tag="Gbem_0565"
FT   CDS_pept        complement(682995..684278)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="larA"
FT                   /locus_tag="Gbem_0565"
FT                   /product="lactate racemase"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0565"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37593"
FT                   /db_xref="GOA:B5ECG5"
FT                   /db_xref="InterPro:IPR018657"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B5ECG5"
FT                   /protein_id="ACH37593.2"
FT                   /translation="MYHNAMLDLKCGDQTYPLQISPDRILSVLRPRPFVPQGSPSQLIE
FT                   KAMAGCEQALSAFGPGEKVVVVTSDVTRPTGSEVYLPMLVSRLNQAGIRDRDIEIVIAL
FT                   GIHRKQTEAEQRKILGEVYGRVRVSDHDCDAPGALVYLGDTSRGVPVEINRRVAEADRL
FT                   ILTGAITFHYFAGFGGGRKSLLPGVSSRRSCMASHFALLNPEEGSGRHPKAVTGNLAGN
FT                   PVHEAMLEACGKRPPEFILNTVLGPDKKIVAAFAGDWRDAHLAGCRFYADAFSAPIDEL
FT                   ADLVLVSCGGFPKDINLIQAHKSMEYASRALKPGGVMVLLAECRDGYGNATFFNWFGYP
FT                   TCFELESALRKRYEINGQTAWSVKEKAERFKVVLVSQLPGEEVRTMGMTPAQTLEEAMR
FT                   LALPMLTEEFRAYVIPEGGNVLPVHSPA"
FT   gene            684661..686703
FT                   /gene="hppA"
FT                   /locus_tag="Gbem_0566"
FT   CDS_pept        684661..686703
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hppA"
FT                   /locus_tag="Gbem_0566"
FT                   /product="V-type proton-translocating pyrophosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0566"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37594"
FT                   /db_xref="GOA:B5ECG6"
FT                   /db_xref="InterPro:IPR004131"
FT                   /db_xref="UniProtKB/TrEMBL:B5ECG6"
FT                   /protein_id="ACH37594.1"
FT                   /translation="MEQYAVVFALACAAAAVAYGLISAQWILGLPQGNERMRQIAAAIQ
FT                   EGAGAYMKRQYTIIAVVGVAMFVALFATLGWKTAVGFLVGAVFSGLTGFIGMFVSVRAN
FT                   VRTTEAAKSGIHKALNVAFKGGAITGMLVVGLGLLGVAGYYMVLQQIMPGAPVKEIVSQ
FT                   LVGLGFGGSLISIFARLGGGIFTKGADVGADLVGKVEAGIPEDDPRNPAVIADNVGDNV
FT                   GDCAGMAADLFETYAVTLIAAMLLGAITFTNSAAVNYPLILGGISIIASIIGTYFVKLG
FT                   GSGKIMGALYKGLIASAVIACIAFYFVTVQMFPQGLTTATGATISALNIFISAIVGLVV
FT                   TGAIFWITEYYTATEYAPVKHIAEASKTGHATNIIAGLGVSMKSTALPVIVIAAGIVVA
FT                   SNCAGVYGIAIAAVSMLSLTGIVVAMDAYGPITDNAGGIAEMAELDDSVRAVTDPLDAV
FT                   GNTTKAVTKGYAIGSAGLAAIILFTSYVQELTIADKSFSLSDPYIIVGLFIGGMLPYYF
FT                   AAMCMEAVGKAGGAVVDEVRRQFRTIKGIMEGTGKPDYAACVDIVTKTALKEMVIPGLI
FT                   PILAPIVVGFTLGPKALGGVIVGSIVTGIFVAISMTTGGGAWDNAKKYIEDGYHGGKGS
FT                   EAHKAAVTGDTVGDPYKDTAGPAVNPMIKIINIVSLLIVPLLNKM"
FT   gene            complement(687261..688817)
FT                   /gene="glgA-1"
FT                   /locus_tag="Gbem_0567"
FT   CDS_pept        complement(687261..688817)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glgA-1"
FT                   /locus_tag="Gbem_0567"
FT                   /product="glycogen synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0567"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37595"
FT                   /db_xref="GOA:B5ECG7"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR011835"
FT                   /db_xref="InterPro:IPR013534"
FT                   /db_xref="UniProtKB/TrEMBL:B5ECG7"
FT                   /protein_id="ACH37595.1"
FT                   /translation="MRLNILITASEAVPFAKEGGLADVVGALPKYLEARGHDVRVVMPR
FT                   YYNVDRDRYRLRQLPGALVVPMGIIGEMYCGVLEGRIPGSDVPIYFLEHEEFYGRDSLY
FT                   ERDNKGYLDNDNRFIFLSKASLELCKMIRFTPDLVHAHDWHTAAVPVLMNSWYRHDQYL
FT                   SQSASLLTIHNMQHQGSFYEGAMDVLGIGWEHFTYLELEKENQVNLLKGGIYHATLLNT
FT                   VSQGYAREIQTSEYGWGLEGVVRERAGELSGILNGVDYEEWNPEGDPLLPANYSARDLA
FT                   GKGICKRELQRALGLPEREDVPLIGMVSRLVKQKGIDVLAQALPRILELDVQLVLLGAG
FT                   EPWAHFYFGGMAAGRPDRFACRIGYDNALAHRIEGGCDFFLMPSAFEPCGLNQMYSMRY
FT                   GTIPIVRATGGLDDSVQNYDAQNRSGDGFKFWDLNAGALFDTVGWAVHTWYQDKEGIHS
FT                   LRQNAMAKRFTWEDAAAKYERLYLEAMRRKLGEERYGQATSRVTPRKFRNRPTIPGCNT
FT                   P"
FT   gene            complement(688901..690160)
FT                   /locus_tag="Gbem_0568"
FT   CDS_pept        complement(688901..690160)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0568"
FT                   /product="peptidase, M48 family"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0568"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37596"
FT                   /db_xref="GOA:B5ECG8"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="InterPro:IPR027057"
FT                   /db_xref="InterPro:IPR032456"
FT                   /db_xref="UniProtKB/TrEMBL:B5ECG8"
FT                   /protein_id="ACH37596.1"
FT                   /translation="MKTLLISLFLVRFAVAYLLRYLNLRHLKRYGTTVPEGFAGAIDQE
FT                   ALAKSARYTLEQHRVGLVESIYDSALLLVFLFTPLLPLYDHWIASLSGSYLVRGLTFML
FT                   LIFLSQSVLEIPFSLYSTFRLERRYGFNTTTPGLWLSDFFKSMLISALLAGILVSAALL
FT                   LVRHSPELWWLWVWGFFALFSITMIYLSPYVIEPLFSKFEPLSDPELEAEIRVMLDRAG
FT                   IEVKGVLQMDASRRSLHSNAYFTGIGHVKRIVLYDTLLKQMDHQELLTILAHETGHWKK
FT                   GHIWKQLLLMESVALAAFFLVHQLIGWGGLPGLFGHQEASFPAQVLLVSFILSIASFPF
FT                   TPVGSWLSRRNEREADRFAVELSGAPHALASALVKLSCENLSNLHPHPLYAGFYYSHPP
FT                   VVERVAALRAMASTGERRNN"
FT   gene            complement(690307..691140)
FT                   /locus_tag="Gbem_0569"
FT   CDS_pept        complement(690307..691140)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0569"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0569"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37597"
FT                   /db_xref="UniProtKB/TrEMBL:B5ECG9"
FT                   /protein_id="ACH37597.1"
FT                   /translation="MKRYSTIMSVLLTLALPVAGTCADAPQAPEKAEASKVEASKVEAI
FT                   KESVSKSGHMMMGGGAAPAAEGAAPAPPPNLNPAGKVVETMDGGGYTYANIDSAGTKTW
FT                   VAYPVLPTKVGDTLSFKGCMSMGGFQSKALNRKFDDILFCGSPEIAGAKTASAKPAASE
FT                   KKAPAGPVKVAKATGANAYTVEEIFSKRGSLNGKQVVVKGQVVKVASGIMSKNWIHLQD
FT                   GTGNAKKKTNDLVITTTDQAEEGDIITVSGTLAKDKDFGGGYKYTAIIEKGSVKK"
FT   gene            complement(691256..693850)
FT                   /gene="clpB"
FT                   /locus_tag="Gbem_0570"
FT   CDS_pept        complement(691256..693850)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="clpB"
FT                   /locus_tag="Gbem_0570"
FT                   /product="ATP-dependent chaperone ClpB"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0570"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37598"
FT                   /db_xref="GOA:B5ECH0"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004176"
FT                   /db_xref="InterPro:IPR017730"
FT                   /db_xref="InterPro:IPR018368"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028299"
FT                   /db_xref="InterPro:IPR036628"
FT                   /db_xref="InterPro:IPR041546"
FT                   /db_xref="UniProtKB/TrEMBL:B5ECH0"
FT                   /protein_id="ACH37598.1"
FT                   /translation="MIRPEKMTVKTQEALVTAQEKAAEMSAGSIEAEHLLLALIDQEGG
FT                   FVPDLLKKIGAPLAKLRESVDETLKRLPKVTGAAQVSLSATLNRVLDQAQKEADSMHDA
FT                   FVSTEHLLLALVAAKDAPSSRLLSQNGVTRDGILSALKELRGGEAVNEQDPEGKYQALA
FT                   KYCRDLTDLARQGKLDPVIGRDDEVRRVLQVLSRRTKNNPVLIGEPGVGKTAIVEGLAQ
FT                   RIVSGDVPESLKDKVIMALDMGALIAGAKYRGEFEERLKAVIKEVARSEGKIILFIDEM
FT                   HTLVGAGAAEGAMDASNMLKPALARGELHCIGATTLNEYRKHIEKDAALERRFQQVFAG
FT                   EPSVEETISILRGLKEKYENYHKIRIKDGAIIAAATLSDRYITDRFLPDKAIDLIDEAA
FT                   SRLRIEIDSKPTEIDEIDRRIIQLEIERQAMLREQDTKVLDRLKKLEEELDGLKAQSAK
FT                   LNEHWKRETNLLKDLGELKQRKEEKAEEAKRAERDGLLARTAEIRYGEIPAIEKEMEEK
FT                   RLTLESVQKEEKMLPEEVDAEMVAEVVAKWTGIPVNRMLETESDKLVKMEERLKSRVVG
FT                   QDEALTLVANAVRRARSGLSDPNRPIGSFIFLGPTGVGKTETARALASFLFDDDQAIVR
FT                   IDMSEYQEKHTVARLIGAPPGYVGYEEGGQLTEAVRRRPYCIVLFDEIEKAHPEVFNVF
FT                   LQILDDGRLTDGQGRTVDFKNSVIIMTSNLGSQWIQQYGAADYGKMQSEVMETLREAFK
FT                   PEFLNRVDEIVIYHSLPLERIKEIVSIQLQSLTKRLEEKGLGLEVTEQAREFLAREGYD
FT                   PAYGARPLKRALQRKIQDPLALMLLENKFAPGDIVVVDLPAQGDSLTIGKKA"
FT   gene            694102..694665
FT                   /locus_tag="Gbem_0571"
FT   CDS_pept        694102..694665
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0571"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0571"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37599"
FT                   /db_xref="UniProtKB/TrEMBL:B5ECH1"
FT                   /protein_id="ACH37599.1"
FT                   /translation="MAKLTLNEKEHGVAEDLELDAGDEVAAAIEEDWDDPIPDDDLYYG
FT                   DEPEELLDDEQDDAEELVWDGDDLARPVVPTPGCAVSFFADNKRHHAICLAIIGDEVLL
FT                   EHKDATRCFLFIGKVTEIVPRIRRGVVSATITVGALKKCRYHSVPKKWLQEMIRTGQSW
FT                   KGMEGGGKVAPPPGDLLKGQMDLF"
FT   gene            complement(694786..695856)
FT                   /gene="ilvE"
FT                   /locus_tag="Gbem_0572"
FT   CDS_pept        complement(694786..695856)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ilvE"
FT                   /locus_tag="Gbem_0572"
FT                   /product="branched-chain amino acid aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0572"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37600"
FT                   /db_xref="GOA:B5ECH2"
FT                   /db_xref="InterPro:IPR001544"
FT                   /db_xref="InterPro:IPR005786"
FT                   /db_xref="InterPro:IPR018300"
FT                   /db_xref="InterPro:IPR033939"
FT                   /db_xref="InterPro:IPR036038"
FT                   /db_xref="UniProtKB/TrEMBL:B5ECH2"
FT                   /protein_id="ACH37600.1"
FT                   /translation="MEIRIVPLSEGEKKAKFKDESQLGFGKIFTDRMLLIEWKVGQGWV
FT                   DARIKKYEPFQLDPAALVLHYAQEIFEGLKAYRWKDGTIALFRPEMNARRFNHSADRLC
FT                   MPEIPEELFVSGIEQLVAAEREWVPGAEGTSLYIRPAMIAVEPHVGIKPSDHYYFYVIL
FT                   SPVGAYYANGFNPVKIMVEDHYVRATPGGTGEAKTGGNYASSLKAGLEAKKKGFDQVLW
FT                   LDGVHKRYIEEVGSMNMFFAYGDTIVTAPLEGSILNGITRDSVLTLAKSLNLKVEERRI
FT                   DVNDLMADLKSGKITEAFGSGTAAVVTPVGTLSYAGDTVQVGNGGVGKYTQVLYDTLTG
FT                   IQTGKIEDRFGWIRKI"
FT   misc_feature    695860..695911
FT                   /note="conserved nucleotide sequence; Gbem_R0101"
FT   gene            696093..696950
FT                   /gene="rpoH"
FT                   /locus_tag="Gbem_0573"
FT   CDS_pept        696093..696950
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoH"
FT                   /locus_tag="Gbem_0573"
FT                   /product="RNA polymerase sigma-32 factor RpoH"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0573"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37601"
FT                   /db_xref="GOA:B5ECH3"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR009042"
FT                   /db_xref="InterPro:IPR012759"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="UniProtKB/TrEMBL:B5ECH3"
FT                   /protein_id="ACH37601.1"
FT                   /translation="MTHSMPVPIDNLTLYLAEINRFPLLTADEEMDLAGRFRREGDLEA
FT                   AHRLITANLRFVVKIAGEYRSYGMKMLDLIQEGNIGLMMAVRKFDPDKGVRLISYAVWW
FT                   IRAYIQNHIISAWSLLKIGTTQAQRKLFFKLNQAKQAIVNMTGEGDLHAAAISLDVKDN
FT                   EAREMEQRLRGELSLDVEMFEGEGGGTFLESLPDLRQNQEEMLAERQETTILERNVASA
FT                   LENLNEKEKFVIEQRVAAEDPMTLQEIADHFSISRERVRQIEEGALKKMKRFLAPLVME
FT                   AEAA"
FT   misc_feature    complement(697045..697070)
FT                   /note="conserved nucleotide sequence; Gbem_R2107"
FT   gene            complement(697150..697731)
FT                   /gene="plsY"
FT                   /locus_tag="Gbem_0574"
FT   CDS_pept        complement(697150..697731)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="plsY"
FT                   /locus_tag="Gbem_0574"
FT                   /product="acyl-phosphate--glycerol-3-phosphate
FT                   acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0574"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37602"
FT                   /db_xref="GOA:B5ECH4"
FT                   /db_xref="InterPro:IPR003811"
FT                   /db_xref="UniProtKB/TrEMBL:B5ECH4"
FT                   /protein_id="ACH37602.1"
FT                   /translation="MNETLLLVGAYLLGSVPTGLLLAKSMGVDIREAGSGNIGATNVYR
FT                   TIGRKLGILTLLGDCLKGLVPVLVARWLGLPDLWIAAAGLCAFLGHVYTIFLGFKGGKG
FT                   VATALGVFLGTSPLSVLFGIVIFGSVLYKWRYVSLASITAAALIPVLVWATGGSVKLVL
FT                   MAVVIACIVIFKHRENIARLTAGTENKFKA"
FT   gene            complement(697893..698330)
FT                   /locus_tag="Gbem_0575"
FT   CDS_pept        complement(697893..698330)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0575"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0575"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37603"
FT                   /db_xref="GOA:B5ECH5"
FT                   /db_xref="InterPro:IPR009908"
FT                   /db_xref="UniProtKB/TrEMBL:B5ECH5"
FT                   /protein_id="ACH37603.1"
FT                   /translation="MSAVKRYLPVAVRIALGGIFIYAALPKIADPVTFAGSVASYQILP
FT                   YFWSYFTAAVLPFLELICGVLLVSGYRVRACALIVAALNVVFMAALASLIVRGLDIDCG
FT                   CFGGGKTSPWLALSRDAVFLAMAGAVLWFEEKRTPPPVVRS"
FT   gene            complement(698327..698821)
FT                   /locus_tag="Gbem_0576"
FT   CDS_pept        complement(698327..698821)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0576"
FT                   /product="rhodanese homology domain superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0576"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37604"
FT                   /db_xref="GOA:B5ECH6"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:B5ECH6"
FT                   /protein_id="ACH37604.1"
FT                   /translation="MAKTTVSIIEISLIVLVAAALGVFWNRTLLADAWRGAPTRQAAPA
FT                   QAGEQLPMPVGLAQVKEMLDAGQAVVVDARSAASFREEHIAGALPLPLEEAKKRTGKSP
FT                   LLEKVGKDSVVIAYCNGFSCHDSMELAKLLIGSGYGSVYVFEGGLPEWRDAGYPLAKGE
FT                   R"
FT   gene            complement(698953..699393)
FT                   /locus_tag="Gbem_0577"
FT   CDS_pept        complement(698953..699393)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0577"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0577"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37605"
FT                   /db_xref="InterPro:IPR005361"
FT                   /db_xref="UniProtKB/TrEMBL:B5ECH7"
FT                   /protein_id="ACH37605.1"
FT                   /translation="MHAMRNLEIVWEDLMEAFENGDTEMIYFLDRETGEVFSVPAEYDD
FT                   ESFWEEVGENQERYLEIPPFDYGQERQMVHAFIQGIGNDGLKAMLVRAFTGRHSHGKLN
FT                   EILSFYPEEMERFQALREELLTTRAAHWLEEHDIYPPEHESD"
FT   gene            699517..700236
FT                   /gene="lpxH"
FT                   /locus_tag="Gbem_0578"
FT   CDS_pept        699517..700236
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lpxH"
FT                   /locus_tag="Gbem_0578"
FT                   /product="UDP-N-2,
FT                   O-3-di-(3-hydroxyacyl)glucosamine/UDP-N-2,
FT                   N-3-di-(3-hydroxyacyl)glucosediamine pyrophosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0578"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37606"
FT                   /db_xref="GOA:B5ECH8"
FT                   /db_xref="InterPro:IPR010138"
FT                   /db_xref="InterPro:IPR024654"
FT                   /db_xref="UniProtKB/TrEMBL:B5ECH8"
FT                   /protein_id="ACH37606.1"
FT                   /translation="MRKIFIADAHLKRPEDANYRTLVRFLENLPADTETLYLLGDIFEF
FT                   WIGNPEPVYGHYREIVDCLKQVRGRGVRIVYFEGNHDFHLDRFFGEKLQAEVHRAGALL
FT                   EIGGQKVYVCHGDEINREDYRYRAFRLLLHNPVVKALVPIFSRRIADHAAAVLSRRSSS
FT                   KHSLREKRWDYRVILDSFARNRFASGCDAVITGHYHLPMIKREPGRLFISLGDWITHYS
FT                   YAQWLDGEFTLESYREN"
FT   gene            complement(700233..700463)
FT                   /locus_tag="Gbem_0579"
FT   CDS_pept        complement(700233..700463)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0579"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0579"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37607"
FT                   /db_xref="UniProtKB/TrEMBL:B5ECH9"
FT                   /protein_id="ACH37607.1"
FT                   /translation="MECSGCGTCCVAPDISTLGKKAGERCPHLMESLVCGIYEERPKVC
FT                   RGYRPDDICRAIAAPTLEKRVANYQRLFGVG"
FT   gene            complement(700473..701810)
FT                   /locus_tag="Gbem_0580"
FT   CDS_pept        complement(700473..701810)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0580"
FT                   /product="transpeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0580"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37608"
FT                   /db_xref="GOA:B5ECI0"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:B5ECI0"
FT                   /protein_id="ACH37608.1"
FT                   /translation="MQDFKDIDKQNRSKRSIRAKRLEGRNAFKTIQEDDEKPRKTRYGI
FT                   VLGVIAALLASYPIISVLNSSPAKTAMPTAAAETVSLKNLDQGSAFRLAAEAYPKAQPQ
FT                   GGSLVAPLPQGGQVVYAINEDVQKRVEKVLSDYKVPYGLFVAMEPRTGRILAMVSHSSV
FT                   EPAWEKDGSYHLYPLASLFKIVTATAALESKKVTPETPFAFNGRLTSESPKYWRVHPGR
FT                   GNQQMPLAVAMGKSVNPVYGRLAGEVVGRDPLLLYAGRYGFNQALLPGAPIMSSTAPAP
FT                   STDNELMRMGAGLNREVKASPFHAAAMMAAVANGGVMMAPGFAKEIRDAKGNLVFTHKP
FT                   QALRTVMTPETAASMARMLSTTVQTGTSRRAFHDRRGRRMLASVSIAAKTGSIDGTDPA
FT                   GHYSWFAAYAPMEDPQIALAALVVNGNKWRIKATSVGEQALEAFFR"
FT   gene            complement(701844..703184)
FT                   /locus_tag="Gbem_0581"
FT   CDS_pept        complement(701844..703184)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0581"
FT                   /product="membrane-bound transcriptional regulator,
FT                   ribonuclease BN-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0581"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37609"
FT                   /db_xref="GOA:B5ECI1"
FT                   /db_xref="InterPro:IPR017039"
FT                   /db_xref="UniProtKB/TrEMBL:B5ECI1"
FT                   /protein_id="ACH37609.1"
FT                   /translation="MKNSSDKRPFSTGLIWEYDPSAVGGFKGRMVRLLQFLSFTFSNFM
FT                   ANNSLLRATALSFTTVLSLVPLLALAFSVLKGLGAQNRLAPLILKEVTAGSEEVVNRVV
FT                   SYIGNTNMGSVGAIGLAALLFTAISMLGSIEEAFNVVWGVQETRSLYRKFSDYLSVLIS
FT                   APLLLLAATSITTTLQSKWLIGWLMERTYLGDLFLFMLGLTPYLSVWVAIFLLYTFIPN
FT                   TRVRYTSALIGAVLAGTLWQFAQWAYIHFQVGAGNYNAIYGTLAALPILMVWIYVSWII
FT                   VLFGMEVVAAHQNRAFFHRDIRGRSISPTLQELIALAALRHIGEAFYGGSPGWGEQHLA
FT                   AKLNIPLRIVRDTLEHLREEGFLVCAGEGECYYPARDLNRVTIAEVLLSLRNRGVYASI
FT                   SGEEQAEQIVETVDAALAKALEGRTLMDLAAPEKSPAGVDKEGAVDI"
FT   gene            complement(703290..703604)
FT                   /locus_tag="Gbem_0582"
FT   CDS_pept        complement(703290..703604)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0582"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0582"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37610"
FT                   /db_xref="GOA:B5ECI2"
FT                   /db_xref="InterPro:IPR024623"
FT                   /db_xref="UniProtKB/TrEMBL:B5ECI2"
FT                   /protein_id="ACH37610.1"
FT                   /translation="MSKDNDIGTGTMLLSFLAGAAVGIGAALLLAPKTGEEMRGKIKDL
FT                   ADDAVDKIKEYANEAQDKIRASYEDGKELVLEKKGIITSAIEAGKEAMEREKEKQKAEL
FT                   "
FT   gene            complement(703609..704004)
FT                   /locus_tag="Gbem_0583"
FT   CDS_pept        complement(703609..704004)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0583"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0583"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37611"
FT                   /db_xref="GOA:B5ECI3"
FT                   /db_xref="InterPro:IPR009293"
FT                   /db_xref="UniProtKB/TrEMBL:B5ECI3"
FT                   /protein_id="ACH37611.1"
FT                   /translation="MLLLQITSTVTAVTLVVLALCLIPVLAELRKAAVLMQEATDSLQQ
FT                   ELKPLIKDLRDTVADIQVVTSSAAANADGVNMLLSELGHAGHNIRMINKVLGIASNVAS
FT                   NYTVWLTGAKVAGQFIADRLVKTKTRG"
FT   gene            complement(704120..704977)
FT                   /gene="omcX"
FT                   /locus_tag="Gbem_0584"
FT   CDS_pept        complement(704120..704977)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="omcX"
FT                   /locus_tag="Gbem_0584"
FT                   /product="cytochrome c"
FT                   /note="12 heme-binding sites"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0584"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37612"
FT                   /db_xref="InterPro:IPR011031"
FT                   /db_xref="InterPro:IPR012286"
FT                   /db_xref="InterPro:IPR036280"
FT                   /db_xref="UniProtKB/TrEMBL:B5ECI4"
FT                   /protein_id="ACH37612.1"
FT                   /translation="MRVAKILNLISALALFAFVGTATAADIAPAAATLTNGDCVKCHDA
FT                   APKAIAQAGGKHKTEVTCQDCHVGHPPKVKKPIPLCSQCHEGKPHYKLQGCLGCHSNPH
FT                   TPKNIKFGNNITDPCLTCHTTQIELLRQFKSKHTALNCSFCHNVHGRIPDCTQCHKSHS
FT                   ADIVQKDCKVCHQAHKPTDVTYKSDTPSKMCAACHKKAYTLLVSSPAKHSKLACVYCHQ
FT                   NKHKTVPQCTQCHVKPHPAAIMAKFPKCGECHNIAHDLNRWSEPAAAPAAGKPAAKPAK
FT                   PAKK"
FT   gene            complement(705332..706168)
FT                   /gene="gspN"
FT                   /locus_tag="Gbem_0585"
FT   CDS_pept        complement(705332..706168)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gspN"
FT                   /locus_tag="Gbem_0585"
FT                   /product="type II secretion system protein GspN, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0585"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37613"
FT                   /db_xref="InterPro:IPR030925"
FT                   /db_xref="InterPro:IPR032712"
FT                   /db_xref="UniProtKB/TrEMBL:B5ECI5"
FT                   /protein_id="ACH37613.1"
FT                   /translation="MKRRTLYLACGIPAAVACFLFLTILFVPSRSVEGLLMRICGNAGY
FT                   TLRCTGFGKILPIGFSARTLEIGSEKGALLQLRDAKVRLELLPLLAGKAAVACSGGIGA
FT                   GEVNGEIFLGKNPAWDLKCRGVRLEEIPFFKNVAEASIKGELRLTGKLAPGKDGGQGDM
FT                   QLEVKGAEVAGLKVGSMPLPDAAYREVRGALKIDKGRAAVKSFTLNGDGIYVRISGDTQ
FT                   LANPLGTSPLNLTMEMMPKPAFLERQKFVFLLLTKYQSSPGAFSIPIRGTLAHPSI"
FT   gene            complement(706165..706710)
FT                   /gene="gspM"
FT                   /locus_tag="Gbem_0586"
FT   CDS_pept        complement(706165..706710)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gspM"
FT                   /locus_tag="Gbem_0586"
FT                   /product="type II secretion system protein GspM, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0586"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37614"
FT                   /db_xref="GOA:B5ECI6"
FT                   /db_xref="UniProtKB/TrEMBL:B5ECI6"
FT                   /protein_id="ACH37614.1"
FT                   /translation="MSREDIVSALQGLDSRSRQRLGIAVAVVLAVIVAVTVINGNISKL
FT                   ARKRAAREADIAEMMQLKLRYQSASAGAQRLANRLMATRADDSPAKIVEEIGIKGRASQ
FT                   IKPVKGEEIPGYVEDAAELRMEGLTANEAVNLIYRLEKGARPVTVKKASIKQRFDDPSK
FT                   LDLALTIALIKPAPAGSK"
FT   gene            complement(706707..707993)
FT                   /gene="gspL"
FT                   /locus_tag="Gbem_0587"
FT   CDS_pept        complement(706707..707993)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gspL"
FT                   /locus_tag="Gbem_0587"
FT                   /product="type II secretion system protein GspL, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0587"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37615"
FT                   /db_xref="GOA:B5ECI7"
FT                   /db_xref="InterPro:IPR025691"
FT                   /db_xref="UniProtKB/TrEMBL:B5ECI7"
FT                   /protein_id="ACH37615.1"
FT                   /translation="MDMLIVQLKRTELVLASFKARKGGVNFLSAERHALSGEEGELSRI
FT                   LKTSNMAAGEHRVILAVPPSQLFMRELELPITDRSKVRDLLPLELKGETALDTEDLVFD
FT                   ALPLAEGKVLAIWGHAGELSGMIETLKDAGLEPEMVTASLFHWNRLAPEHGTVAVSDGD
FT                   AFAAYKDGAAIFFRALPANCGESEIARTVAAVEMGRNVKVDKVISHAADTQGGGGLSAV
FT                   PGLFEAFGDDNHAAHDLAGAYAVAVAAADGSAINLRRGALAYTAGSEKLYQRLRLTMML
FT                   AAALVLLIIAESGVRYYLVRKDLASLDRSITAIYKEIFPTRKKAVDEVSEIRSEIKRLE
FT                   GAKTSSNVLQLLKDVALAKGDDVGGIYEAEVTGTEVRLKGDAKSFQAANDFKTRTAPLL
FT                   NQAEVSETKSRPDGSVTFTLSGTMKGVTR"
FT   gene            complement(707993..708934)
FT                   /gene="gspK"
FT                   /locus_tag="Gbem_0588"
FT   CDS_pept        complement(707993..708934)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gspK"
FT                   /locus_tag="Gbem_0588"
FT                   /product="type II secretion system minor pseudopilin GspK"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0588"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37616"
FT                   /db_xref="GOA:B5ECI8"
FT                   /db_xref="InterPro:IPR005628"
FT                   /db_xref="InterPro:IPR038072"
FT                   /db_xref="UniProtKB/TrEMBL:B5ECI8"
FT                   /protein_id="ACH37616.1"
FT                   /translation="MRGEKGFALVITLIVTALLVALLVEFVNEVYVDTSHSHNFVASQQ
FT                   AGILAESGVAGGIKLLQLSSAMRLNEPYSSLLEPWAKPQSFQADDGTVTITIEEETGKL
FT                   NINTATSANGTAAPYYTPMLLRLLTRLKLSTDLADSLMDWVDENDNPLPGGAESNYYGT
FT                   LKLPYAAKNKRLETVDELALVKGFTPETLTTLKSLVTVYGNSNELEPATLINVNTAPKE
FT                   VLAALDERMSDDLVQRILDFRKTRPIKGMADFNSIPGMDSMLPKFSDKITFGGSVYRIR
FT                   SEGKVGESVAVAEAVVRTSGSATPAVLYWREY"
FT   gene            complement(708931..709557)
FT                   /gene="gspJ"
FT                   /locus_tag="Gbem_0589"
FT   CDS_pept        complement(708931..709557)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gspJ"
FT                   /locus_tag="Gbem_0589"
FT                   /product="type II secretion system minor pseudopilin GspJ"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0589"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37617"
FT                   /db_xref="GOA:B5ED31"
FT                   /db_xref="InterPro:IPR010055"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:B5ED31"
FT                   /protein_id="ACH37617.2"
FT                   /translation="MCNTHRKMHNNRGFTLIELLIALALLVILAGALYGTYFSVVAARE
FT                   KGGRRMEQRRELSTTLGKLHDELSSCFFNTKNARLHFVVEDRDSFGKPASLLQFTAIAP
FT                   PRIDPAPASDIVAVRYSVQEKNEQQTLSLQREARDPYLDVKVKSVPYPVVDEIEGFLVE
FT                   CWDGNKWVKSWDTALNGGLPKQVRITLTLKGGEEFSTIASQRLTR"
FT   gene            complement(709526..709870)
FT                   /gene="gspI"
FT                   /locus_tag="Gbem_0590"
FT   CDS_pept        complement(709526..709870)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gspI"
FT                   /locus_tag="Gbem_0590"
FT                   /product="type II secretion system minor pseudopilin GspI"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0590"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37618"
FT                   /db_xref="GOA:B5ED32"
FT                   /db_xref="InterPro:IPR010052"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:B5ED32"
FT                   /protein_id="ACH37618.1"
FT                   /translation="MKGFTLLEVMIALAITAGVLLTVITSLNHHLSLVGSDAEETTAVL
FT                   LGRAKLEDPEFGKLADNKGDFAPNHPGHKWVREITKTEIPGLNQIRLTVTWNDDAKRLT
FT                   LVQYAPQNAQ"
FT   gene            complement(709867..710397)
FT                   /gene="gspH"
FT                   /locus_tag="Gbem_0591"
FT   CDS_pept        complement(709867..710397)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gspH"
FT                   /locus_tag="Gbem_0591"
FT                   /product="type II secretion system minor pseudopilin GspH"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0591"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37619"
FT                   /db_xref="GOA:B5ED33"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:B5ED33"
FT                   /protein_id="ACH37619.2"
FT                   /translation="MADKSTDKIPSRCTAGFTLLELLVVIFIVTLAAGIVFPRLPDTEA
FT                   TKLKNSARNLGSGIRFLNDQAIVTKKVYRLHLNLNDNSTRITQLSPSGEELQPGDQFMN
FT                   RRLIEEGIDIEDVNVPSLGLVTEGEVTVPFGPGGIGDGMTIHLKGGEKEFTVIAYPSGG
FT                   KVKVLEGRQEVDS"
FT   misc_feature    complement(710420..710454)
FT                   /note="conserved nucleotide sequence; Gbem_R4012"
FT   gene            complement(710480..710923)
FT                   /gene="gspG"
FT                   /locus_tag="Gbem_0592"
FT   CDS_pept        complement(710480..710923)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gspG"
FT                   /locus_tag="Gbem_0592"
FT                   /product="type II secretion system major pseudopilin GspG"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0592"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37620"
FT                   /db_xref="GOA:B5ED34"
FT                   /db_xref="InterPro:IPR000983"
FT                   /db_xref="InterPro:IPR010054"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="InterPro:IPR013545"
FT                   /db_xref="UniProtKB/TrEMBL:B5ED34"
FT                   /protein_id="ACH37620.1"
FT                   /translation="MFKTLKDSRGFTLIELMVVIVILSILAVMVGPKIIGRSDDAKIAD
FT                   AKVQIRNIETALKLYKLDSGSYPTTEQGLQALVTKPTTGKIPNNYKAEGYLENKNVPKD
FT                   PWGGDYVYLSPGEHGDYDLSSFGADGARGGEGNNADIQSWNMK"
FT   gene            complement(710981..712183)
FT                   /gene="gspF"
FT                   /locus_tag="Gbem_0593"
FT   CDS_pept        complement(710981..712183)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gspF"
FT                   /locus_tag="Gbem_0593"
FT                   /product="type II secretion system inner membrane protein
FT                   GspF"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0593"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37621"
FT                   /db_xref="GOA:B5ED35"
FT                   /db_xref="InterPro:IPR001992"
FT                   /db_xref="InterPro:IPR003004"
FT                   /db_xref="InterPro:IPR011850"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="InterPro:IPR042094"
FT                   /db_xref="UniProtKB/TrEMBL:B5ED35"
FT                   /protein_id="ACH37621.1"
FT                   /translation="MPTFRYSAFNQKGTEVSGTVDAAGETEARLQLKQKGLYAKEIAPA
FT                   VEGGKRKLFSSGVSVPDLSLATRRLATLLGSAVPVYEAVATLWEQEAPGELKKVLGRVR
FT                   DRLAEGQGLAQSMAAEPAVFSESYIGMVAAGEASGALEVVLERLAEFQEDQAEVRSRVI
FT                   TALIYPAIMVVVGTAVMLVLLGFVVPKISAVFETNKATLPMVTIILIKASALVRKGWWL
FT                   LLAAAFALWTGYKRLIKSEELVRKRDRLILKLPVAGQLWQRLVLSRFAKVLGLLLQSGV
FT                   PIIKAMDITGEAVVNREYKAFLAEARESLMQGGSLSASLKASPLFPPLLTHMTAVGEKS
FT                   GELDGMLIKAGDAFQKEFNATVTRSMAMLEPLLILGMGLTIGFMVIAVLLPIMQLNQLV
FT                   K"
FT   gene            complement(712164..713726)
FT                   /gene="gspE"
FT                   /locus_tag="Gbem_0594"
FT   CDS_pept        complement(712164..713726)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gspE"
FT                   /locus_tag="Gbem_0594"
FT                   /product="type II secretion system ATPase GspE"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0594"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37622"
FT                   /db_xref="GOA:B5ED36"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR007831"
FT                   /db_xref="InterPro:IPR013369"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037257"
FT                   /db_xref="InterPro:IPR042181"
FT                   /db_xref="UniProtKB/TrEMBL:B5ED36"
FT                   /protein_id="ACH37622.1"
FT                   /translation="MAESLDIEEIATRLGLPYQAEIDDSKVDGALVNRVPLNFARNNLL
FT                   LPLHEEDGSIVAASADPANLLALDEMAGLFSQPVSVVAVPRPALLDAVNRLYSRLSGSA
FT                   QEVVEELEGEELSTLATTFNEPRDLMELTDEAPVIRLLNSILFQAVKERASDIHIEPFE
FT                   RELEVRFRIDGLLYKMLSPPKVIQEALTSRVKIMSGLNIAEKRLPQDGRIRVKVAGRDV
FT                   DIRVSLIPTFFGERVVLRLLDKQRGVLSLKEIGLSDGNDRLMDRLLSRTSGIILVTGPT
FT                   GSGKTTTLYAALSQINSPEKNIITVEDPIEYQLKGVGQIQVNPKIELTFAAGLRSILRQ
FT                   DPDIVMIGEIRDAETAEIAMQASLTGHLVLSTLHTNDAATAVTRLIDMGIEPFMVASSL
FT                   SAVLAQRLVRVICPHCKESYVPDRSYPGVELPPLLYRGRGCEKCFNLGTIGRVGIYELL
FT                   PIDAELCSMIIRQASSGAIKEYAVSKGMRTLREDGLAKAAQGITTIEEVLRVTQDDYAD
FT                   LSL"
FT   gene            complement(713793..715715)
FT                   /gene="gspD"
FT                   /locus_tag="Gbem_0595"
FT   CDS_pept        complement(713793..715715)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gspD"
FT                   /locus_tag="Gbem_0595"
FT                   /product="type II secretion system protein GspD, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0595"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37623"
FT                   /db_xref="GOA:B5ED37"
FT                   /db_xref="InterPro:IPR001775"
FT                   /db_xref="InterPro:IPR004846"
FT                   /db_xref="InterPro:IPR005644"
FT                   /db_xref="InterPro:IPR013356"
FT                   /db_xref="InterPro:IPR038591"
FT                   /db_xref="UniProtKB/TrEMBL:B5ED37"
FT                   /protein_id="ACH37623.2"
FT                   /translation="MKRRCARIIAMLMFLLAAPPLVFAKGVVLNFTDVDIATMVKFVSD
FT                   LTGKNFIMDDRVKGKISVFSPAKLSNEEAYNVFTSVLELKGFTVVPAGKVLKIVPTSSA
FT                   RQSGMRILSDGERSVVNDSYQARVIQLEHVAPQDAVTFLQPLVSKDGQISAFGAANMIL
FT                   VVDSAFNIQKVLGILKHIDTDQVREGAELVFLKNAAAESVATLVKDWMSGKSSKGGAPG
FT                   AAATNTASSTVVPDNRLNALIIFGSDKDKTDVKKLIALVDVVPPTTSSKVNVYYLENAE
FT                   AAEVAKVLDGLLKGTAATPAPAAGAAATAPQQAIFEGGKITITPDKSTNSLVIMASPTD
FT                   YQNLLQVIQKLDRRSRQVFVQAMIAEVSANKAKELGLQWGVVTGASNGTLSTVGTFDPF
FT                   GAVAGLTGTLTLAGQLGITPPDAGVALFPATLKALQSNGALNVLSTPNIMTSDNKEAEI
FT                   FVGENVPFLSGTNLTSTGLSQQSIERKDTGIILKIKPQISEGEYIKLDIYQEISAVKDF
FT                   GTATNPNLGSTKRSAKTSVVVKNTDTVIIGGLIQDTDQVTESKIPLLGDIPLLGWLFKT
FT                   KKTTRDKTNLLIMLTPRIIKDARDMAEVSVNQRNAFSDAVKTSEPINLEQALKEKPKSV
FT                   TEDKP"
FT   gene            complement(715767..716135)
FT                   /locus_tag="Gbem_0596"
FT   CDS_pept        complement(715767..716135)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0596"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0596"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37624"
FT                   /db_xref="InterPro:IPR012657"
FT                   /db_xref="InterPro:IPR036583"
FT                   /db_xref="UniProtKB/TrEMBL:B5ED38"
FT                   /protein_id="ACH37624.1"
FT                   /translation="MYRSFKDMPVWQHAMAVAEQVYSATEHLPKKEDYGLTSQIRRSAL
FT                   SISANIAEAYGRKHLLDKVNFYYHARGSLTETQSHLEYSKRVGYLKSEEADSLDDRLSQ
FT                   LYQEINKIVLALKEMHSD"
FT   misc_feature    716195..716221
FT                   /note="hexanucleotide repeats; Gbem_R6008"
FT   gene            complement(716236..717126)
FT                   /gene="gspC"
FT                   /locus_tag="Gbem_0597"
FT   CDS_pept        complement(716236..717126)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gspC"
FT                   /locus_tag="Gbem_0597"
FT                   /product="type II secretion system protein GspC, putative
FT                   serine protease"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0597"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37625"
FT                   /db_xref="GOA:B5ED39"
FT                   /db_xref="InterPro:IPR024961"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:B5ED39"
FT                   /protein_id="ACH37625.1"
FT                   /translation="MPRWILPLNISLGLALIAVSALIAADLLSFKISGLYPRTAQKQAQ
FT                   AAAQAPGDVQDLLAFAPILERALFGKATQGKLSAILQPTAAPGQAAAPVAPSVGDLTLL
FT                   GTAVGSFRESFALVQKGSTHEERVFRLGETVFSAGPLVSVKKDVAEILIGGKRVKILTP
FT                   TAAAAAAAQPAPALPSAASGGLAAPTGSGNYVVDQRALNAALDNIGQAMTDARLLPSMK
FT                   DGKVEGFRASEVKPQGIFGTIGIRNGDVLLRMNDFPIDSPEKAIQSFASLKGQSRIKLD
FT                   LIRDGQPTTFNYDIR"
FT   gene            717561..718292
FT                   /gene="mqnB"
FT                   /locus_tag="Gbem_0598"
FT   CDS_pept        717561..718292
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mqnB"
FT                   /locus_tag="Gbem_0598"
FT                   /product="futalosine hydrolase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0598"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37626"
FT                   /db_xref="GOA:B5ED40"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR019963"
FT                   /db_xref="InterPro:IPR035994"
FT                   /db_xref="UniProtKB/TrEMBL:B5ED40"
FT                   /protein_id="ACH37626.1"
FT                   /translation="MKPVIVTASTTLELSELIAGTSAIAVTGVGHLRVYRASYRGVELV
FT                   IAVTGIGKVNAAAATTLLLERFGAELLINTGCGGAFPGCGLGVGDLAIAQSETLADEGV
FT                   QTPDGWRGLELIGIPVFQGDGKRIFNTVPLDLDLARGAEAHARELGYAVAGGPFLTVST
FT                   CSGSALQGQELLRRFPGVCENMEGGAVAQVALPYAVPLLEVRGISNLVEDRDLARWDLK
FT                   LAVSQAQKFLLDYLEHLPLSV"
FT   gene            718482..719348
FT                   /gene="mqnD"
FT                   /locus_tag="Gbem_0599"
FT   CDS_pept        718482..719348
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mqnD"
FT                   /locus_tag="Gbem_0599"
FT                   /product="1,4-dihydroxy-6-naphthoate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0599"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37627"
FT                   /db_xref="GOA:B5ED41"
FT                   /db_xref="InterPro:IPR003773"
FT                   /db_xref="InterPro:IPR030869"
FT                   /db_xref="UniProtKB/TrEMBL:B5ED41"
FT                   /protein_id="ACH37627.1"
FT                   /translation="MNTVDTKQIEKKSSPILSLGFSPCPNDTFIFDALVHGRVECGYAF
FT                   KERLEDVETLNRMALSATLDVSKVSYHLLGHILGDYLLLRSGGALGRGCGPLLVAREKL
FT                   DAASLAGKRIALPGRYTTAALLLRLFNPSLSDFVYLPFDKIMAAVADGSVAAGVIIHES
FT                   RFTYQGHGLQKILDLGQWWEEETGHPIPLGGIAARRDLGRETLLALEQAIAASVERAFK
FT                   YPAEARPYIRAHSQEMSDEVCDAHIGLYVNDFSRGLGSEGEAAVRLLLGRAEAAGIIPP
FT                   LREPLLI"
FT   gene            719436..721619
FT                   /locus_tag="Gbem_0600"
FT   CDS_pept        719436..721619
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0600"
FT                   /product="sensor protein, PAS, PAS, PAS, PAS and PAS
FT                   domain-containing"
FT                   /note="domains: PAS, PAS, PAS, PAS, PAS"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0600"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37628"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:B5ED42"
FT                   /protein_id="ACH37628.1"
FT                   /translation="MLKTLKLKKGHALLAAGLSLLFWLGDTFVDAYVFGRRSFVDQLLA
FT                   PEPFEISMRIFYATLAGIFFTGLFQLWEKGRKVETALRHSDDLSKIFFGSSRDAICVIK
FT                   TDTLSVSDANSVFVQKYALKDAQSAGSFPELLARNGLTDQVLGQLAACAGGAAPVSFEI
FT                   NYRGADGGTCYEEVSIHPVGEMQQDVETVLYVARDITVRRRSQEMLVASEARYRAIFEN
FT                   TGTAMAIIEPGGMLQTVNRGFEAASGYSRSEIEGKKVWTDFVKSPEGGVLDRGAGAQRR
FT                   TFEALLEDKTGTQRSMAGNWAPVDGTEQAVLSLLDISANKEAEEELRKSRATLAVAQRI
FT                   ARLGNWDWDLCTNSLNWSEEMYRIFGLDPAGFTPTYDWFLQVVHPQDLERVVRSTNDAI
FT                   YNSKPYQIDYRILLPSGAARTISASAEVTYDAQGNPLHMVGTNQDITWRIEAEEALRSS
FT                   EEKFSKAFHASPDSIVITRAADGTYIDVNEAFQVITGYSRDEVIGKSSTEVGLWADPDA
FT                   RMVMLKLLNQHEHVRNLDVRFRVKSGEVREMIWSADVIEYDGEACLIAISRDVTDQRQM
FT                   EKELLESDARLYMKHEELKNVFHQMEVIRREWEEIMDCISDMFILADQFGKIRRFNRAV
FT                   ETFTGKAHRDIVGRDCEAFLKEHGLGAHLASPDLELLHKETGKWFVVKRHAFPNAEVDG
FT                   SSREVVIINETTSIRRRTGHEAPQAATEVSAAN"
FT   misc_feature    721701..721724
FT                   /note="conserved nucleotide sequence; Gbem_R0102"
FT   gene            721725..722189
FT                   /locus_tag="Gbem_0601"
FT   CDS_pept        721725..722189
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0601"
FT                   /product="rare lipoprotein A-like double-psi beta-barrel
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0601"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37629"
FT                   /db_xref="GOA:B5ED43"
FT                   /db_xref="InterPro:IPR009009"
FT                   /db_xref="InterPro:IPR012997"
FT                   /db_xref="InterPro:IPR034718"
FT                   /db_xref="InterPro:IPR036908"
FT                   /db_xref="UniProtKB/TrEMBL:B5ED43"
FT                   /protein_id="ACH37629.1"
FT                   /translation="MASPEQSGRMVRICAFVLMLFPIHTLPLLAAEQVEKTAVEASVGK
FT                   VEPQQKSVVNKLVGIASYYASKFHGRRTTSGERYHPEKMTAAHHSLPLGTRVRVRNLAN
FT                   DKEVTVVINDRCRKKSVPFIDLSRAAARKLGFLGSGVTKVAIIPLPAEES"
FT   gene            complement(722304..724241)
FT                   /locus_tag="Gbem_0602"
FT   CDS_pept        complement(722304..724241)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0602"
FT                   /product="TPR domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0602"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37630"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:B5ED44"
FT                   /protein_id="ACH37630.1"
FT                   /translation="MKRYAALSSLLAVTLFSTGFNWPFPSGNACRDAKRIIMELSPQAG
FT                   EQKRKEAEKRVAELCPTGPAGHYLKGLTFERSGNVDAAISEYRETLSLDPEFYPASGNL
FT                   GLLHLQKGAGEEAAVELAAGLKAGDPRYHAGLARVMADKQMHLLAIFHYNEAIAAFPDD
FT                   AALYTGIAASYNAAGQKQKAEDAYRRALVLQPDNAQARFGLGALLLERGEADKAVSELK
FT                   LAAIAQPANKETHRLLAEAYARKGDAKSADYERGLAGIGSKPKELPKVDHMALAEKHRL
FT                   AKEYEMAISEYRLRLADEPDDAVAQQRLGDTLLAVGREDEAMSYYRDALRNKAENPELH
FT                   FNLAGIYERKALLDEAVVEYRQVLASSPDNQQARQRLADIYTLRGSFNQALEQYQALIK
FT                   TNPADPALRLKLARAYVNSKELDAAAEAYHAAIKLDGESVDAHRELANLQRKRNMIDEA
FT                   AAEYQEVLRLKKDDQEVRTALTAIYVKNKNYDALAKLLKDGVDLSPSDPNAHYKLGLVY
FT                   EFQKDYDAATAQYKEAVTLKPDHAKALNAMGRVQMKDGHIAEAKESLEAARKADPELEE
FT                   AQVLLSNIKDEFNPEPRSYRKHKSSNGSKAKKGKKGKKGKEAKKSKKDSDDKPAKKSKK
FT                   KKSKKKSKED"
FT   gene            724615..725058
FT                   /locus_tag="Gbem_0603"
FT   CDS_pept        724615..725058
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0603"
FT                   /product="ATP-independent chaperone, alpha-crystallin/Hsp20
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0603"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37631"
FT                   /db_xref="InterPro:IPR002068"
FT                   /db_xref="InterPro:IPR008978"
FT                   /db_xref="UniProtKB/TrEMBL:B5ED45"
FT                   /protein_id="ACH37631.1"
FT                   /translation="MAVIPKEPLEWLGLFRQQMDEIFRYLSTLEGREGFGEKEHSPLVD
FT                   IYETDSSFVVEAELPGCDVQDISLSICCSTLVVEGSTREGALSGVNYSCLERSAGRFCR
FT                   AIELPPGADLERVSARYRRGLLTVVIPWCKGEKPHIREIQIEE"
FT   gene            725069..727519
FT                   /gene="lon-3"
FT                   /locus_tag="Gbem_0604"
FT   CDS_pept        725069..727519
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lon-3"
FT                   /locus_tag="Gbem_0604"
FT                   /product="ATP-dependent Lon protease (La)"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0604"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37632"
FT                   /db_xref="GOA:B5ED46"
FT                   /db_xref="InterPro:IPR003111"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004815"
FT                   /db_xref="InterPro:IPR008268"
FT                   /db_xref="InterPro:IPR008269"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027065"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR027543"
FT                   /db_xref="UniProtKB/TrEMBL:B5ED46"
FT                   /protein_id="ACH37632.1"
FT                   /translation="MENRQETEELNIPDVLPLLPVRDVVVYPYMILPLFVGREISISAV
FT                   DYALSKDRMIFLATQRDVGDEDPAPEAIYEVGTVAMIMRMLKLPDGRVKILVQGLTKAR
FT                   ITEYLAEKPFYSVRIDRIVEPALQENTLEAEALIRTVKEELGKIVALGKAVSPEVMVIV
FT                   ENMQEPGSLADLVASNIGLKVEEAQGLLEVIDPLERLKRVNDLLNKESELLNMQARIQS
FT                   AAKEEMGKSQREYYLREQLRAIQQELGETDARSEEIAELRKSIESAKMPQPVEKEALKQ
FT                   LGRLEQMHPDAAEAGMLRTFLDWMVDIPWGKSTKDSLEINRASEILNEDHYFLEKVKER
FT                   ILEFLAVRKLKKKMKGPILCFVGPPGVGKTSLGKSIARAMGRKFVRISLGGVRDEAEIR
FT                   GHRRTYVGALPGRIIQGLKQAGSNNPVFMLDELDKLGSDFRGDPSSALLEVLDPEQNNS
FT                   FSDHYINLPFNLSNVMFIATANQMDTIPGPLRDRMEVINLSGYTEEEKLGIAKRYLVPR
FT                   QVKENGITDDIVAFSDEALRTVISKYTREAGLRNLEREVGSICRKVARKVAEGKGEHFA
FT                   ISAGTVAKYLGPPKFLREEEMEKNEVGVVTGLAWTPVGGEVLFVEATVMKGKGALTLTG
FT                   QLGDVMKESVQAALSYIRSKTADFDIPEDFNSTTDIHVHVPAGAIPKDGPSAGVTMATA
FT                   LVSALTKIPVRKEVAMTGEITLRGKVLPIGGLKEKILAAARLGVTTVVIPVQNQKDLED
FT                   VPKTILKKLKIVPASNIDEVLAVALEIYPPRAASKPKPSKTEPPKSKVARRVTVPPTGV
FT                   RGKA"
FT   gene            727516..728490
FT                   /gene="thiL"
FT                   /locus_tag="Gbem_0605"
FT   CDS_pept        727516..728490
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiL"
FT                   /locus_tag="Gbem_0605"
FT                   /product="thiamin monophosphate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0605"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37633"
FT                   /db_xref="GOA:B5ED47"
FT                   /db_xref="InterPro:IPR006283"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="UniProtKB/TrEMBL:B5ED47"
FT                   /protein_id="ACH37633.1"
FT                   /translation="MRLAELGEFGLIDRIKKNVAASPSVLLGIGDDAAALVPAPECVTL
FT                   ITCDMLLESVHFDLSFCDPESLGRKSLSVNLSDLAAMGAHPRQFLLGIALGKEVPIEFM
FT                   DRFMAGVLEQAERFGATLVGGDTCASKGGIAISITALGEQRPELVLKRSGARPGDLICL
FT                   SGTVGDAAAGLVALRQGVREGFLVSRQLDPTPRVAAGVALAEGGLATAMIDVSDGVLGD
FT                   LGHIREMSGVGARLELAKLPLSDEYRAACGDDPYALALSGGEDYELLFCIAPGKRGEVE
FT                   ALFAKLALRLSVIGEITATPEVKLVTPGGGVYAPGHGGFDHFG"
FT   gene            complement(728503..728901)
FT                   /locus_tag="Gbem_0606"
FT   CDS_pept        complement(728503..728901)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0606"
FT                   /product="protein of unknown function UPF0047"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0606"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37634"
FT                   /db_xref="InterPro:IPR001602"
FT                   /db_xref="InterPro:IPR035917"
FT                   /db_xref="UniProtKB/TrEMBL:B5ED48"
FT                   /protein_id="ACH37634.1"
FT                   /translation="MIHYLTLKSRERTELIDITARVEDLIAASSIGSGCCEIFVLHTTA
FT                   AVTVNEGADPAVKRDISNCLDRLVPDAHYFTHAEGNSAAHVKASMIGSSERLLVDRGKL
FT                   LLGTWQVLYFCEFDGPRERRVAVKICGE"
FT   misc_feature    complement(728938..728965)
FT                   /note="heptanucleotide repeats; Gbem_R7104"
FT   gene            complement(728969..729463)
FT                   /locus_tag="Gbem_0607"
FT   CDS_pept        complement(728969..729463)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0607"
FT                   /product="TPR domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0607"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37635"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="UniProtKB/TrEMBL:B5ED49"
FT                   /protein_id="ACH37635.1"
FT                   /translation="MSRSENYLQAGTGGKVGETDAEELYRQGSEALQTRNFAVAFRLLR
FT                   AALDQKRSPEHLSQFALALTHYTGNDKAGVALCQEAIRSEPRNPNHFLRLGTIYLISGR
FT                   KKEAVRIFNLGLRVGRHAGITRILQALGQRDKPVLPFLARTNPLNKYLGKMRNNFFKKD
FT                   R"
FT   gene            729656..730144
FT                   /gene="folK"
FT                   /locus_tag="Gbem_0608"
FT   CDS_pept        729656..730144
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folK"
FT                   /locus_tag="Gbem_0608"
FT                   /product="2-amino-4-hydroxy-6-hydroxymethyldihydropteridine
FT                   pyrophosphokinase"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0608"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37636"
FT                   /db_xref="GOA:B5ED50"
FT                   /db_xref="InterPro:IPR000550"
FT                   /db_xref="InterPro:IPR035907"
FT                   /db_xref="UniProtKB/TrEMBL:B5ED50"
FT                   /protein_id="ACH37636.1"
FT                   /translation="MEERAYIGLGSNLGDRELKLLMAVAELGKLPGTRVTGVSQFYETE
FT                   PVGGVPQDNFYNAVARIETTLSPFLLLDELKRVETEVFQRKPSERWGARSMDLDILLYG
FT                   ELVLDSDRLTIPHPRLAERRFALQPLADLAPDLVYPVTGKTVSQLLAALTATEKVVKL"
FT   gene            730154..730390
FT                   /locus_tag="Gbem_0609"
FT   CDS_pept        730154..730390
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0609"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0609"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37637"
FT                   /db_xref="InterPro:IPR007029"
FT                   /db_xref="InterPro:IPR011017"
FT                   /db_xref="UniProtKB/TrEMBL:B5ED51"
FT                   /protein_id="ACH37637.1"
FT                   /translation="MKILIWVLLGYLAYRMLKGKSEAKIAKKEPAAAETFQDPVCGVYI
FT                   SEADAVVGNLAGRRYHFCSMDCLRRFEQIQQQR"
FT   gene            730413..731057
FT                   /locus_tag="Gbem_0610"
FT   CDS_pept        730413..731057
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0610"
FT                   /product="transaldolase"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0610"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37638"
FT                   /db_xref="GOA:B5ED52"
FT                   /db_xref="InterPro:IPR001585"
FT                   /db_xref="InterPro:IPR004731"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018225"
FT                   /db_xref="InterPro:IPR022999"
FT                   /db_xref="InterPro:IPR033919"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5ED52"
FT                   /protein_id="ACH37638.1"
FT                   /translation="MKFFIDTADVKEIREANELGLVDGVTTNPSLIAKSGRRFEEVIKE
FT                   ITGIVDGPISAEVISLEHDGMIAEATELAKIHPNIVIKLPMTPEGLKATKTLYKRGIKT
FT                   NVTLIFTPMQALLAAKAGATYVSPFVGRLDDISQNGMGIIQEIRTIFDNYGMDAEIIVA
FT                   SIRNPIHVLDSALIGADVCTIPYSVMLQLAKHPLTDAGIKKFLEDWEKVPK"
FT   misc_feature    731066..731118
FT                   /note="conserved palindrome; Gbem_R1015"
FT   gene            complement(731173..731799)
FT                   /locus_tag="Gbem_0611"
FT   CDS_pept        complement(731173..731799)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0611"
FT                   /product="membrane protein DedA"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0611"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37639"
FT                   /db_xref="GOA:B5ED53"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="UniProtKB/TrEMBL:B5ED53"
FT                   /protein_id="ACH37639.1"
FT                   /translation="MHAVVDWLLQTIGALGYPGIFLLMAMESSIIPIPSELVMPPAGYL
FT                   AQQGQMNMALAILCGTAGSLIGAYANYYAAHYLGRPLVLKYGKYVFITEEKFAKVEKFF
FT                   LKHGEISTFIGRLLPVVRHLISLPAGLSGMNHLRFSLYTLLGAGIWCTVLTVIGYVIGS
FT                   NQELIMKYSHQAVLGVVVVSALLIAVYVWWQRRNGNCGAGEAQPK"
FT   gene            731918..733564
FT                   /locus_tag="Gbem_0612"
FT   CDS_pept        731918..733564
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0612"
FT                   /product="CBS domain pair protein of unknown function,
FT                   DRTGG and DHHA2 domain-containing"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0612"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37640"
FT                   /db_xref="GOA:B5ED54"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR001667"
FT                   /db_xref="InterPro:IPR004097"
FT                   /db_xref="InterPro:IPR010766"
FT                   /db_xref="InterPro:IPR028979"
FT                   /db_xref="InterPro:IPR038222"
FT                   /db_xref="InterPro:IPR038763"
FT                   /db_xref="UniProtKB/TrEMBL:B5ED54"
FT                   /protein_id="ACH37640.1"
FT                   /translation="MEKEIYVIGHKNPDTDSVASAIAYARLKRELGEERVTAAMAGGLN
FT                   PQTTWLLSRLGIKAPLYLADVHPKVRDVIQRTPVTVQEAAPLLTALELFHHHGIRILPV
FT                   LDQRGAPTGVIPLLKIAERSLATGPASLRLVTASLDSLAACLEASFLAGSGEAAVETLH
FT                   LFVGAMAEESFNAKIAGFDPVNLVVVTGDRRSIQLSAIERGVRLLVVTGGLAVDEEVVR
FT                   LAAENGVALLSTPLDTAATVSRARLATPAGHLAEPGFESVTVGAPLGRLREKLLHSGET
FT                   AVLVLEEDGTLAGVATKSSLFAPLPYALILVDHNELSQSVPGAEDLEILEVVDHHKLGN
FT                   PPTSNPIPFITAPVGSTCTIVASLYEEHRVTPPSDIAALLLAGILSDTVILKSPTTTGR
FT                   DRDAVSRLAALAGLDWQAFGAEIFAASGALSGYGSPDRVVVSDFKLFNQGEIRFGVGQV
FT                   EVFGFAEFEEMKADLRGALASLREKEGLEVAGLMVTDISSESTMFLMEGGQGYSRFMGY
FT                   PQPEPQVFEMKGVMSRKKQLVPHLIKVLGGR"
FT   gene            733566..735398
FT                   /gene="metF-2"
FT                   /locus_tag="Gbem_0613"
FT   CDS_pept        733566..735398
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metF-2"
FT                   /locus_tag="Gbem_0613"
FT                   /product="5-methyltetrahydrofolate--homocysteine
FT                   S-methyltransferase and 5,10-methylenetetrahydrofolate
FT                   reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0613"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37641"
FT                   /db_xref="GOA:B5ED55"
FT                   /db_xref="InterPro:IPR003171"
FT                   /db_xref="InterPro:IPR003726"
FT                   /db_xref="InterPro:IPR029041"
FT                   /db_xref="InterPro:IPR036589"
FT                   /db_xref="UniProtKB/TrEMBL:B5ED55"
FT                   /protein_id="ACH37641.1"
FT                   /translation="MGGSFLERVAHEVLIGDGAIGTMLYAKGVALDANFEHLNLVRPQL
FT                   VLDLHAEYLAAGAQVIETNTFGANYAKLSAIGIGGKVADINRQGAILARRAAKVRDVFV
FT                   AGSMGPMGRGKQEMSADQVRDSFRLQAAALAEGGVDLLILETFSELDELETALSAARET
FT                   GLPVVANLAFGEGSRLAGGIEAEDAALRLAAAGASLVGANCGAGPLELLATLKRIAAVT
FT                   DLPLAAYPNSGFPEYVDGRYIYRTTPDYFAARAEEMVAAGAVLVGGCCGTTPEHIRVMA
FT                   QRLKGARPAARVAVGAVSRTPASEKAKTAASGFLDLWGKEMVVTVELDPPKGLDCSRIL
FT                   AGSRALKEAGADAINLAENPLARVRMGNLALASLIRRDVGIEVIAHITCRDRNLIGLQS
FT                   DLMGASLLGVSSILAVTGDPASLGEEAGASSVFDLNSFTLIKLLSDLNRGVNALGNPIG
FT                   AGTGFTIGAAFNPNTQKMEVQVARLAKKVANGACFAQTQPIYDLERFEQMMEQTAHLGI
FT                   PILPGVLPLVSGRNAEFLHNEVPGITIPDGIRARMAGKTGEEGVREGLAIAREFIEATM
FT                   GRVGGFYLIPPFGKYEIAVELVKFIKSRAEHRGH"
FT   misc_feature    735457..735492
FT                   /note="nonanucleotide repeats; Gbem_R9013"
FT   gene            735554..736258
FT                   /locus_tag="Gbem_0614"
FT   CDS_pept        735554..736258
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0614"
FT                   /product="sulfite reductase, assimilatory"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0614"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37642"
FT                   /db_xref="GOA:B5ED56"
FT                   /db_xref="InterPro:IPR005117"
FT                   /db_xref="InterPro:IPR006066"
FT                   /db_xref="InterPro:IPR006067"
FT                   /db_xref="InterPro:IPR017220"
FT                   /db_xref="InterPro:IPR036136"
FT                   /db_xref="UniProtKB/TrEMBL:B5ED56"
FT                   /protein_id="ACH37642.1"
FT                   /translation="MTEAMTKKDIPTKGAILQRDRETYAIAPHIPGGFTDTATLRKICD
FT                   VADKYNLALKITSAQRIAMIGAKEEELDAIWSDLAQNPGAAIGLCVRSVKVCPGTQHCK
FT                   RAVLDSASLGLKLDRIYHAMELPNKMKMGVSGCLLSCSESGVKDIGIVGHNKGWRIFVG
FT                   GNAGPRPRLGEMLVDNVQSEEEVLEIVAKVVDFYKNDPQQGRIGKLVEEMGIEAFRAKV
FT                   LGTAAAAAGSAK"
FT   gene            736306..737073
FT                   /gene="ttcA"
FT                   /locus_tag="Gbem_0615"
FT   CDS_pept        736306..737073
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ttcA"
FT                   /locus_tag="Gbem_0615"
FT                   /product="tRNA (2-thio-C32)-thioltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0615"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37643"
FT                   /db_xref="GOA:B5ED57"
FT                   /db_xref="InterPro:IPR011063"
FT                   /db_xref="InterPro:IPR012089"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR035107"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5ED57"
FT                   /protein_id="ACH37643.1"
FT                   /translation="MALIEDAAFTRIKNRVGKAIAEFDLISEGDRVAVAVSGGKDSYTM
FT                   LHMLETLRRRAPVRYELVAINIDSGYRGYRADIIEEHLREHGFTYHMEKTDHYDIISEK
FT                   RRPNSSYCSICARLKRGTLYTLAQQYGCNKLALGHHMDDFIETLLLNQFFVGSLKAMAP
FT                   SMLADNGVTTVIRPLVYVPEKEIIPFSRNNRFPVVCCCCPVCGTADLQRKKMKELLETL
FT                   ERDNPLVKKSLLTALSNVHPRHLLDKGLTRKPS"
FT   gene            737313..738308
FT                   /gene="yccM"
FT                   /locus_tag="Gbem_0616"
FT   CDS_pept        737313..738308
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yccM"
FT                   /locus_tag="Gbem_0616"
FT                   /product="iron-sulfur cluster-binding oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0616"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37644"
FT                   /db_xref="GOA:B5ED58"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:B5ED58"
FT                   /protein_id="ACH37644.1"
FT                   /translation="MAEKKVQQVRIAVQWGFLLFSLYLGVTFYRFVQHFRSGGATPFVE
FT                   RPDGVEAFLPISGLVSLKGWLTSGSINPVHPAALVVLLAVIAVSVLLKRSFCSWICPVS
FT                   TITELCWKVGHKIFGRNYRVWLWLDWLLRPIKYLLVLFFLFSILVLMAPDSVASFILSD
FT                   YNKTADVKMLDFFLNLSGLPLAFISGFLLLSFFFRNPFCRFFCPYGALLAVLSRLAPAK
FT                   VERMQSACISCGNCNKACPSHLDVMNAKRVCSEECIGCLRCVSSCPKPEALQVRLKGGK
FT                   VVPGMVFAALVVVIFVGGTLVGRVAGHWHSEIPKSDYQRLINNGPPIEHP"
FT   misc_feature    738416..738451
FT                   /note="nonanucleotide repeats; Gbem_R9014"
FT   gene            complement(738467..738886)
FT                   /locus_tag="Gbem_0617"
FT   CDS_pept        complement(738467..738886)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0617"
FT                   /product="zinc finger transcriptional regulator, TraR/DksA
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0617"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37645"
FT                   /db_xref="GOA:B5ED59"
FT                   /db_xref="InterPro:IPR000962"
FT                   /db_xref="InterPro:IPR020458"
FT                   /db_xref="InterPro:IPR037187"
FT                   /db_xref="UniProtKB/TrEMBL:B5ED59"
FT                   /protein_id="ACH37645.1"
FT                   /translation="MTEKPEEMKAMLLKMKEETLKEINKTVKSGSDVPVNEPSGDIYDQ
FT                   ASSERDRELGLLLGDREREKLRHIDEALLRLEEGEYGICEECEEEIPIGRLKIVPFARH
FT                   CVKCKADLEKQQAQTKRFEEDRAYREIALGEEEEG"
FT   gene            complement(738968..740314)
FT                   /gene="rimO"
FT                   /locus_tag="Gbem_0618"
FT   CDS_pept        complement(738968..740314)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rimO"
FT                   /locus_tag="Gbem_0618"
FT                   /product="ribosomal protein S12 methylthiotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0618"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37646"
FT                   /db_xref="GOA:B5ED60"
FT                   /db_xref="InterPro:IPR002792"
FT                   /db_xref="InterPro:IPR005839"
FT                   /db_xref="InterPro:IPR005840"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013848"
FT                   /db_xref="InterPro:IPR020612"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR038135"
FT                   /db_xref="InterPro:IPR041582"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5ED60"
FT                   /protein_id="ACH37646.1"
FT                   /translation="MSEKTKEKVSLVSLGCPKNLVDAEVMLGYLSQDEYEVTTDETQAD
FT                   IIVVNTCSFIKEAKQESIDTILDLADRKHDARCKLLIVTGCLPQRYQQELAKELPEVDI
FT                   FIGTGDYPRIAEIIAEKKQTEEQLCYTGDPNFVYNDEVPRLQSSPHYTAYLKIAEGCSN
FT                   NCSYCVIPSLRGGHRSRPLATLLAEAKALVEGGVKELNLIAQDITAYGRDLEGKPSLEL
FT                   LIKELVKMEKLKWIRLLYAYPDGVTDSLIQLIKEEPKVCKYLDLPIQHISDPVLSNMKR
FT                   RSGEAEIRTLISKLRREIPDIAIRTSLIVGFPGETTDDFKKLLQFVEQTRFDRLGVFCY
FT                   SREDGTPAAEMPDQVSERIKRERHKKLMRTQARVSFKHNRTLVDSEEDVLVEGYSEETE
FT                   LLLKGRSSRQAPDVDGLVYITAGNANVGDIVRLKITDSSDYDLIGEIVD"
FT   gene            complement(740335..740820)
FT                   /gene="yajQ"
FT                   /locus_tag="Gbem_0619"
FT   CDS_pept        complement(740335..740820)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yajQ"
FT                   /locus_tag="Gbem_0619"
FT                   /product="protein of unknown function DUF520"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0619"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37647"
FT                   /db_xref="InterPro:IPR007551"
FT                   /db_xref="InterPro:IPR035570"
FT                   /db_xref="InterPro:IPR035571"
FT                   /db_xref="InterPro:IPR036183"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5ED61"
FT                   /protein_id="ACH37647.1"
FT                   /translation="MPSFDIVSKVDMQEVDNAINQTVKEIAQRYDFKGSKCEVTLEKEN
FT                   IKVLADDDFKLKAVIDILQSKFIKRNISPKSLQYGKAEQASGSMVRQIITLQVGISKEK
FT                   AKEIGQVIKETKLKVQSQIQDDQLRVTGKNIDDLQEVIRVLKGKDLDIDMQFVNFRS"
FT   misc_feature    complement(740837..740863)
FT                   /note="hexanucleotide repeats; Gbem_R6009"
FT   misc_feature    740991..741017
FT                   /note="hexanucleotide repeats; Gbem_R6010"
FT   gene            complement(741031..741741)
FT                   /locus_tag="Gbem_0620"
FT   CDS_pept        complement(741031..741741)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0620"
FT                   /product="outer membrane lipoprotein carrier/sorting
FT                   protein LolA"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0620"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37648"
FT                   /db_xref="GOA:B5ED62"
FT                   /db_xref="InterPro:IPR004564"
FT                   /db_xref="InterPro:IPR029046"
FT                   /db_xref="UniProtKB/TrEMBL:B5ED62"
FT                   /protein_id="ACH37648.1"
FT                   /translation="MKLIRVSMLVMALVALSATMSFAAELSQVVRTLEQGYAGLNDLQA
FT                   DFSQRSLIRAMRREEKGGGELLIKKGGGKDSMFRFNYTKPKQQIVSNGKTVWYYIPDQK
FT                   QVMIMDLAHLFEAGNGIAMNYLAGLGQVSRDFKISFADQQRDKNGNYQLELIPNRKSPA
FT                   MAKLILVIDGKAVETFISKGRPGTPFPVVSSTVVDQAGNSTRMDFSGIKTNRGISDSKF
FT                   SFKVPAGVEIVKNR"
FT   gene            complement(741867..742460)
FT                   /gene="cheC44H"
FT                   /locus_tag="Gbem_0621"
FT   CDS_pept        complement(741867..742460)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cheC44H"
FT                   /locus_tag="Gbem_0621"
FT                   /product="protein phosphoaspartate phosphatase CheC
FT                   associated with MCPs of class 44H"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0621"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37649"
FT                   /db_xref="GOA:B5ED63"
FT                   /db_xref="InterPro:IPR007597"
FT                   /db_xref="InterPro:IPR028976"
FT                   /db_xref="UniProtKB/TrEMBL:B5ED63"
FT                   /protein_id="ACH37649.1"
FT                   /translation="MPNPVLQQADLAALTEVCKLGMEHAATALSQLMGKGVSIEVPRLK
FT                   FVDSEKLAELIEQEQEATTLQLQILGNVRGSIVILLPQQNALRVVELLLGKAPNPEAPL
FT                   SELERATLMEVGNILASACLNALGNTLKMTLLPSVPTLVSGSDEFFARIQEQGGESESI
FT                   VMIDAMFSVDDACCGGSIFLVPAASSLEAMLAAL"
FT   gene            complement(742520..744151)
FT                   /gene="cheA44H"
FT                   /locus_tag="Gbem_0622"
FT   CDS_pept        complement(742520..744151)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cheA44H"
FT                   /locus_tag="Gbem_0622"
FT                   /product="sensor histidine kinase CheA associated with MCPs
FT                   of class 44H"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0622"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37650"
FT                   /db_xref="GOA:B5ED64"
FT                   /db_xref="InterPro:IPR002545"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004105"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR008207"
FT                   /db_xref="InterPro:IPR036061"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036641"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR037006"
FT                   /db_xref="UniProtKB/TrEMBL:B5ED64"
FT                   /protein_id="ACH37650.1"
FT                   /translation="MDMSQYKSLFLSESREYLKTISDQVVALEQAPAERSAVDALFRGA
FT                   HSLKGMAASMEYGDVVVVAHSMEDLMARVRDGALCFEAGVADLLLEGVDLIDVMLADVE
FT                   ADRECTRPPDDFAERLRGYTPALPKKQAPAGEPPAEHPAPQAAQPGGEPEKAKEPAGEA
FT                   SGTVRVKTELLDHLINLTGELVTNKHRLLNVAQEVASPALNDAVSETGKLLRALHDEVM
FT                   KVRLMPFEAICDRFQRSVRSLAKKSGKEINFELSGREIGMDRGMLEQLVDPLNHILRNA
FT                   VDHGMEESAERAAQGKPPRGTVKLSVSRDRDRISIQVSDDGRGMEPQKMIEAAVAKGVI
FT                   TPEEGALLSPRQALMLSCIPGFSTAKVVTDISGRGVGMDAVNAAIQKLGGTLVIESEPG
FT                   QGSTFTLRLPMTIAIIHALVVQCGNVKGAVPVTGVLRTVELARHQIETMGKRQMFQLDG
FT                   EAIPLLSLNRILGLPLGRFPNGILPLFVTEAKGRRVGIVVDRFLGQHELFVKPFGRPLC
FT                   KMAGLAGGATLGDGEIVTILDLAGLL"
FT   gene            complement(744155..744520)
FT                   /gene="cheY44H"
FT                   /locus_tag="Gbem_0623"
FT   CDS_pept        complement(744155..744520)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cheY44H"
FT                   /locus_tag="Gbem_0623"
FT                   /product="response receiver CheY associated with MCPs of
FT                   class 44H"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0623"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37651"
FT                   /db_xref="GOA:B5ED65"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:B5ED65"
FT                   /protein_id="ACH37651.1"
FT                   /translation="MATTVMIVDDSLFMRKMLRDILTEEGYEITAEASDGNEAIEKYQE
FT                   CRPDLVTLDIVMPNKTGIEALQIIMVLDPQARVVMCSAIGQESMTEAAAKAGAKAFILK
FT                   PFNPELVARTLREVAEG"
FT   gene            complement(744561..744995)
FT                   /gene="cheW44H"
FT                   /locus_tag="Gbem_0624"
FT   CDS_pept        complement(744561..744995)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cheW44H"
FT                   /locus_tag="Gbem_0624"
FT                   /product="scaffold protein CheW associated with MCPs of
FT                   class 44H"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0624"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37652"
FT                   /db_xref="GOA:B5ED66"
FT                   /db_xref="InterPro:IPR002545"
FT                   /db_xref="InterPro:IPR036061"
FT                   /db_xref="UniProtKB/TrEMBL:B5ED66"
FT                   /protein_id="ACH37652.1"
FT                   /translation="MIPERLILFTLGGEEFACSLQQIGEVMEPLQSYPFAGAPAHYLGL
FT                   INFHGNLTALVDLALYLGLKSRPIPGKLLVLDPRLAHLALKVDGVSAIIASDLVTGEEP
FT                   GEDPLTEAYLETPSGRVRLLQLEALIDELENGLKQAPARI"
FT   gene            complement(744992..746266)
FT                   /gene="mcp44H"
FT                   /locus_tag="Gbem_0625"
FT   CDS_pept        complement(744992..746266)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mcp44H"
FT                   /locus_tag="Gbem_0625"
FT                   /product="methyl-accepting chemotaxis sensory transducer,
FT                   class 44H"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0625"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37653"
FT                   /db_xref="GOA:B5ED67"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="UniProtKB/TrEMBL:B5ED67"
FT                   /protein_id="ACH37653.1"
FT                   /translation="MYIQIGYKFILGFLTVVAAVAFVPSWVAALDYSPELTSILSYVVA
FT                   LTIGLILGSFFSKSFTKNIALLRGATESISEGDLSSDLVFPATRFPDETHSMAVSINAM
FT                   LVSLRTLVRQIRETAERVSESTRTLNSSALEINASTEEVAQAIEQISGGAETQAEMLVR
FT                   SSKVIHEMAISVDLVARRARETAKAARETSITAQRGGELANDSLERMKSFFDSVELIGM
FT                   QFMDLNGKLQQVGKIADFIVDMARQTNLLALNASIEAARAGEYGKGFGVVAEEVRKLAD
FT                   GSAKSATDIVEMIDLVKMESRKLQETITDSSRGIIAGKKNVDTTAESFKEILATVIDTE
FT                   RKANSIADLSQMQNTGAEKMVSMVDEIAKVAEDNAASTEEVSAATEQQHSAMQEMVFQT
FT                   VELSKLAEELLRSVEKFQVQGEPGQ"
FT   gene            complement(746292..747125)
FT                   /gene="cheR44H-1"
FT                   /locus_tag="Gbem_0626"
FT   CDS_pept        complement(746292..747125)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cheR44H-1"
FT                   /locus_tag="Gbem_0626"
FT                   /product="protein glutamate methyltransferase CheR
FT                   associated with MCPs of class 44H"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0626"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37654"
FT                   /db_xref="GOA:B5ED68"
FT                   /db_xref="InterPro:IPR000780"
FT                   /db_xref="InterPro:IPR022641"
FT                   /db_xref="InterPro:IPR022642"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B5ED68"
FT                   /protein_id="ACH37654.1"
FT                   /translation="MIDGFKGGTEPDIAPETFDVIGRILKARSGFTLDGYKDKCVKRRI
FT                   HIRVRATQSPSPEAYGMLLTESPAEQERLLRVLTIHVSHFFRNPPVFERLAVDILPQLI
FT                   SERRELNILSVGCAGGEEPYTVALILKERFPQALEEGRISLRAVDVDVSTLEHAREGVY
FT                   HPDRLAEVPPELLSRWFTPQDGRFRLSQEIRSLVSFSQADLNQPQQWPRCDLVLCRNVL
FT                   IYFERERQETILNGFADALFPGGCLVLGKSETLFGAPRNRFKTFCPVERIYRAIA"
FT   misc_feature    complement(747390..747415)
FT                   /note="conserved nucleotide sequence; Gbem_R2108"
FT   gene            complement(747558..748862)
FT                   /locus_tag="Gbem_0627"
FT   CDS_pept        complement(747558..748862)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0627"
FT                   /product="amino acid aminotransferase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0627"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37655"
FT                   /db_xref="GOA:B5ED69"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:B5ED69"
FT                   /protein_id="ACH37655.1"
FT                   /translation="MRNEIVAPGAGELTYEIRNIVTVAEKVQRLGVKINWENIGDPIVK
FT                   GENIPLWMKEIVAAEAMNDDSYAYCPTRGVLETREFICEITNKRGGAQITPDDIIFFNG
FT                   LGDAIAKVYGNLRPESRVLMPSPTYTTHSIGEAAHANAVPVCYRLKPEDNWYPDMDDLE
FT                   CHVKYNPQIAGIMMINPDNPTGMVYPVEVLKQIVEIARKYDLFIIADEVYSNIVYNGEK
FT                   TVPISDVIGQVPAIAMKGISKELPWPGSRCGWIEVYNADRDPRFNKFVNSILSSKMNEV
FT                   CSTTLPQRCLPAVMKHPEYHNYLNERITRYEKMSNITYEALSKVPELAVNRTNGAFYMA
FT                   VPFKPGVLNNTQTLPIKNPEIRQLVEGIVNQPGVAPDKRFVYYILAHTGICVVPLSSFN
FT                   TELLGFRVTLLERDEAECRRIYRTLTENIATYLAS"
FT   misc_feature    complement(748920..748950)
FT                   /note="conserved nucleotide sequence; Gbem_R0103"
FT   gene            749020..749430
FT                   /locus_tag="Gbem_4068"
FT   CDS_pept        749020..749430
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_4068"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_4068"
FT                   /db_xref="EnsemblGenomes-Tr:ADO00766"
FT                   /db_xref="UniProtKB/TrEMBL:E1P671"
FT                   /protein_id="ADO00766.1"
FT                   /translation="MPRDVTLLVYMTPQIACSAVDVNVFHEWGRTSARGKVTFPAQSIT
FT                   SFEKTTFFEAKCYFPDKKCHFFDSSGTFFSKKYRLEEKNITWAEKNITWAQKTSLGPKK
FT                   YHLDEKNVTWEKKMITWKKNTALGAGIGKCPR"
FT   gene            complement(749450..750019)
FT                   /locus_tag="Gbem_0628"
FT   CDS_pept        complement(749450..750019)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0628"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0628"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37656"
FT                   /db_xref="UniProtKB/TrEMBL:B5ED70"
FT                   /protein_id="ACH37656.1"
FT                   /translation="MRLPAALLIVALAAGAAYSAPAAPRPYSGCGILTLRQWGALQSAP
FT                   LPLYREPGVQRIAEKSAAALPRLAGDGVEPLVAASERRGNWTRLSLDEAGRQGWLEQQR
FT                   GWEYASWEEFLPGRTVRVLPGLKKGWYQLKGAPTEEAAGLASLSRDQLVQVLEVEEDWV
FT                   KLERPSGWFRWRDPDGRLTVSLKTSR"
FT   gene            complement(750016..750369)
FT                   /locus_tag="Gbem_0629"
FT   CDS_pept        complement(750016..750369)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0629"
FT                   /product="glyoxalase/bleomycin resistance
FT                   protein/dioxygenase superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0629"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37657"
FT                   /db_xref="GOA:B5ED71"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:B5ED71"
FT                   /protein_id="ACH37657.1"
FT                   /translation="MVEKIKNIVVFVNDFPAARRFYREQLALAPGQETEYMMEFLPAEG
FT                   TALGVALAMHDDAKKLVGRHTGITFNVKGLEDLCAKLTAGGARFTEPLMVTPYGKMAVV
FT                   ADPDGNEFALVEM"
FT   gene            750487..752091
FT                   /locus_tag="Gbem_0630"
FT   CDS_pept        750487..752091
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0630"
FT                   /product="thiolase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0630"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37658"
FT                   /db_xref="GOA:B5ED72"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="UniProtKB/TrEMBL:B5ED72"
FT                   /protein_id="ACH37658.1"
FT                   /translation="MTQQFKPREVYVASSFMAPVGRYNGREREALSFLEMAEKAGEVFA
FT                   GSRLKRSDINAVVVGCQNPVAFSGVDNTAAKIAGVLGISGAKSVLIDTASSSGASALEY
FT                   AYLQIASGRCDHVLAIGIQKMSDVPTGQATRIVAGVIDKDEAEFGLSMPACGALVARSL
FT                   IERLKLSIDEWTAFSALLTQRAHRYAARNPEAHLGFEIPLEEYYRQIVTGKNYRYWWPL
FT                   RYHDFCPMSDGVAAVLLSATPHEVIVSGVGSATDIPTIADRPYFHSFPATVRAAAEAYA
FT                   MAGIKKIADFAGKIHVNMHDPFNGFGPINMVDLGFVHRRRIVEALLNDELTGEQGAFPT
FT                   NITGGLKGRGHPLGATGMIQIVENHRLITSGRFQMGLAHSIGGPINNNVVTLLERSSHY
FT                   RQRSRPVLTPWGLPPLGRMKPKQMNVGELLKASGEVQGRFVAATTRFDFKTGDPEGIII
FT                   IVSCLVNGTRYSFLFGVGGEHYRQVVQLRSGDQVRLEQGEEGILVNRIPVRKFYQRSMS
FT                   GVLEFAGSGWKKLTGGS"
FT   gene            752211..752372
FT                   /locus_tag="Gbem_0631"
FT   CDS_pept        752211..752372
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0631"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0631"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37659"
FT                   /db_xref="GOA:B5ED73"
FT                   /db_xref="UniProtKB/TrEMBL:B5ED73"
FT                   /protein_id="ACH37659.1"
FT                   /translation="MTLLFKILGVIFALFVVLFIAIVIEESFFGGRRRRKLEQKAREEQ
FT                   KAREGQGR"
FT   misc_feature    complement(752387..752420)
FT                   /note="conserved palindrome; Gbem_R1106"
FT   gene            752455..753060
FT                   /locus_tag="Gbem_0632"
FT   CDS_pept        752455..753060
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0632"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0632"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37660"
FT                   /db_xref="GOA:B5ED74"
FT                   /db_xref="InterPro:IPR005025"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:B5ED74"
FT                   /protein_id="ACH37660.1"
FT                   /translation="MTRKAKVVAIVGSYRKGGMIDQVVDEILAAAAREGGEVEKLYLLD
FT                   TQIEFCTNCRLCTQEREGARGICPIADQMARVLELVEGADAVVLASPMNFGTVTALMKR
FT                   FIERLACYVYWPWGTAAPKPRSKERPRRAVLVASSAAPAFMARFLTPIVKVLRRAAELL
FT                   GGRTVGVLLVGLAALEERQGPGSRTLARARLLGKKLVS"
FT   gene            complement(753527..754156)
FT                   /locus_tag="Gbem_0633"
FT   CDS_pept        complement(753527..754156)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0633"
FT                   /product="helix-turn-helix transcriptional regulator,
FT                   LexA-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0633"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37661"
FT                   /db_xref="GOA:B5ED75"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="InterPro:IPR039418"
FT                   /db_xref="UniProtKB/TrEMBL:B5ED75"
FT                   /protein_id="ACH37661.1"
FT                   /translation="MPSTEYHAETGVRIKKARLALGLTQKEFAASLGIVQGFLSGIETG
FT                   RKRPSDTLLIALSHTFGINAQWLSDGSGESFKNQPGAEQPNVSRAPLLEMIPDSFPDDP
FT                   GAISRYISVPDLPEGCYAIVCYGDFMSPTIRDGDVVIFRPESEQKKSGDIIIVHNRWGE
FT                   PILRRYRVKDDEIYLAPDNPAYAPFQPDDGTRTIGIVVDVWRKVII"
FT   gene            754441..754959
FT                   /gene="def-1"
FT                   /locus_tag="Gbem_0634"
FT   CDS_pept        754441..754959
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="def-1"
FT                   /locus_tag="Gbem_0634"
FT                   /product="polypeptide formylmethionine deformylase"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0634"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37662"
FT                   /db_xref="GOA:B5ED76"
FT                   /db_xref="InterPro:IPR023635"
FT                   /db_xref="InterPro:IPR036821"
FT                   /db_xref="UniProtKB/TrEMBL:B5ED76"
FT                   /protein_id="ACH37662.1"
FT                   /translation="MIRTILTYPDPELKKRSLPVTVITDKTRELARDMAETMYDAPGVG
FT                   LAAPQIGVHQRIIVIDVSGKDETPELIVAINPEIVHAEGEAFEEEGCLSVPKFSANVRR
FT                   HARIVVKALNLEGEEVTFRADDLLSIAFQHEIDHLDGVLFIDHLSPLKKGIFRKRYQRA
FT                   LDEAKELNR"
FT   gene            754956..755912
FT                   /gene="fmt"
FT                   /locus_tag="Gbem_0635"
FT   CDS_pept        754956..755912
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fmt"
FT                   /locus_tag="Gbem_0635"
FT                   /product="methionyl-tRNA formyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0635"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37663"
FT                   /db_xref="GOA:B5ED77"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR005793"
FT                   /db_xref="InterPro:IPR005794"
FT                   /db_xref="InterPro:IPR011034"
FT                   /db_xref="InterPro:IPR036477"
FT                   /db_xref="InterPro:IPR037022"
FT                   /db_xref="InterPro:IPR041711"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5ED77"
FT                   /protein_id="ACH37663.1"
FT                   /translation="MTGMRIVFMGTPEFACPTLRTLIERGEKVVAVVTQPDRPKGRGQQ
FT                   TLPPPVKVVAEQHGIPVLQPVKVRLPESIEEIRGLNPDLIVVIAFGQILPKALLDIPKY
FT                   GCINVHASLLPRYRGAAPLNWCIINGENETGVTTMMMDVGLDTGDMLLKRSTPIGADED
FT                   TQSLHDRMSQLGAELLAETLDRLARGELVPEKQDDALTCYAPMMKKEDGLIDWSRDAQA
FT                   IKNQVRGMTPWPGAYSFLDDKLLKVFRVQTASGSGAPGEILSCGRDGIEVACGTGSLVI
FT                   AELQLEGKKRLPAGDFLAGYKLQPGGLLGKKDASVGV"
FT   gene            755902..756672
FT                   /locus_tag="Gbem_0636"
FT   CDS_pept        755902..756672
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0636"
FT                   /product="protein of unknown function DUF116"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0636"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37664"
FT                   /db_xref="GOA:B5ED78"
FT                   /db_xref="InterPro:IPR002829"
FT                   /db_xref="UniProtKB/TrEMBL:B5ED78"
FT                   /protein_id="ACH37664.2"
FT                   /translation="MGYKGPYQGPPRKRLFVALMGVTCLLVVGLIYLGWWIPTMGLTNI
FT                   HPGLPRIVGMVFAVLSGMAVLGTLLLVLTTALGKDILGTKFMRGVVIKFLLPLIEQIGS
FT                   LCGISKDTIRQSFVAMNNSLVISQRLKVKPDRILILLPHCLQLSQCEIKVTGDITKCLR
FT                   CGRCDIMGLAELAQKYQVEISVATGGTLARKVIIEKRPKLVLAVACERDLTSGIKDCYP
FT                   LPVIGVLNDRPYGPCIDTRVDVNKIEAALRSVLV"
FT   gene            756680..757705
FT                   /locus_tag="Gbem_0637"
FT   CDS_pept        756680..757705
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0637"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0637"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37665"
FT                   /db_xref="GOA:B5ED79"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:B5ED79"
FT                   /protein_id="ACH37665.1"
FT                   /translation="MSRSPLAKIPAFSLFLALFLFFCAAQAQAAQITEYRVIREPVSDR
FT                   SGKRLLAVRSFKCDGVPRLLAVDPETLASYDLPADSPKRSGDAGADAFRATRLARALNK
FT                   YNSPPYRLQNGGAVHAETQVQGLFLTVDLCPSKRPFERELFEATAALGHGRAVPVAVMI
FT                   SGVWLSTHPQELSYLKEAIASGKLAVTWVNHSYHHHYDPKVPLAENFLLAPGTDPMQEV
FT                   LQAEELLLSQGLVPSPFFRFPGLVSDGAWMQRLKELSLIPIGSDAWLAKGEAPRPGSFI
FT                   LVHGNGNEPKGVKLLLPILKEKAPRLLPLAAAFGAKAEPISPPPLTGGGRGVGELATQR
FT                   K"
FT   misc_feature    757643..757751
FT                   /note="conserved palindrome; Gbem_R2012"
FT   gene            757778..758620
FT                   /locus_tag="Gbem_0638"
FT   CDS_pept        757778..758620
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0638"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0638"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37666"
FT                   /db_xref="InterPro:IPR000064"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:B5ED80"
FT                   /protein_id="ACH37666.1"
FT                   /translation="MKTMFLALLALPIFSPAAHAADSPRYAVAVAATPVLNTPDFARTF
FT                   SGKVKLDPCKGVRPVEFVAFPGTLFRIEGEQEKDGVKVYRVTSNDYPYPTKTGLFVDAR
FT                   FVETVEGTPRERQRTLPETAEIRKRLLSAVGRPYVWGGNFKEGVPLLRTLYPQGDPLYG
FT                   VDCTGLLYEATDGYTPRNSSYLTRYGKGVKVAGLSAAEIAKKLEPLDLVVYKGHVMMVV
FT                   DEDSIIQSVMGCGGGKKGVVLSSREETLKKLMRTREPADRYPKGAAGVKSFVVRRWLR"
FT   gene            complement(758637..759674)
FT                   /locus_tag="Gbem_0639"
FT   CDS_pept        complement(758637..759674)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gbem_0639"
FT                   /product="response receiver-modulated cyclic diguanylate
FT                   phosphodiesterase"
FT                   /note="domains: REC, HD-GYP"
FT                   /db_xref="EnsemblGenomes-Gn:Gbem_0639"
FT                   /db_xref="EnsemblGenomes-Tr:ACH37667"
FT                   /db_xref="GOA:B5ED81"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006675"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR037522"
FT                   /db_xref="UniProtKB/TrEMBL:B5ED81"
FT                   /protein_id="