(data stored in SCRATCH zone)

EMBL: CP001125

ID   CP001125; SV 1; circular; genomic DNA; STD; PRO; 110227 BP.
XX
AC   CP001125; ABAL01000000-ABAL01000160;
XX
PR   Project:PRJNA19459;
XX
DT   31-JUL-2008 (Rel. 96, Created)
DT   15-MAY-2014 (Rel. 120, Last updated, Version 5)
XX
DE   Salmonella enterica subsp. enterica serovar Schwarzengrund str. CVM19633
DE   plasmid pCVM19633_110, complete sequence.
XX
KW   .
XX
OS   Salmonella enterica subsp. enterica serovar Schwarzengrund str. CVM19633
OC   Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales;
OC   Enterobacteriaceae; Salmonella.
OG   Plasmid pCVM19633_110
XX
RN   [1]
RP   1-110227
RX   DOI; 10.1128/JB.00297-11.
RX   PUBMED; 21602358.
RA   Fricke W.F., Mammel M.K., McDermott P.F., Tartera C., White D.G.,
RA   Leclerc J.E., Ravel J., Cebula T.A.;
RT   "Comparative genomics of 28 Salmonella enterica isolates: evidence for
RT   CRISPR-mediated adaptive sublineage evolution";
RL   J. Bacteriol. 193(14):3556-3568(2011).
XX
RN   [2]
RP   1-110227
RA   Ravel J., Fricke W.F., White D., McDermott P., Mammel M., Rosovitz M.,
RA   Leclerc J., Cebula T., Sebastian Y.;
RT   ;
RL   Submitted (24-JUL-2008) to the INSDC.
RL   J. Craig Venter Institute, 9704 Medical Center Drive, Rockville, MD 20850,
RL   USA
XX
DR   MD5; aebe9298fa76c3f8c70296db12742922.
DR   BioSample; SAMN02604064.
DR   EuropePMC; PMC2945939; 20831800.
DR   EuropePMC; PMC3133335; 21602358.
DR   EuropePMC; PMC3587935; 23469341.
DR   EuropePMC; PMC6105805; 29760137.
DR   RFAM; RF00383; IS1222_FSE.
XX
CC   The sequenced strain has been deposited at the Salmonella Genetic
CC   Stock Center at the University of Calgary under the care of Dr.
CC   K.E. Sanderson.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..110227
FT                   /organism="Salmonella enterica subsp. enterica serovar
FT                   Schwarzengrund str. CVM19633"
FT                   /plasmid="pCVM19633_110"
FT                   /sub_species="enterica"
FT                   /strain="CVM19633"
FT                   /mol_type="genomic DNA"
FT                   /serovar="Schwarzengrund"
FT                   /db_xref="taxon:439843"
FT   gene            34..459
FT                   /locus_tag="SeSA_B0001"
FT   CDS_pept        34..459
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeSA_B0001"
FT                   /product="protein SamA"
FT                   /EC_number="3.4.21.-"
FT                   /note="identified by match to protein family HMM PF00717"
FT                   /db_xref="EnsemblGenomes-Gn:SeSA_B0001"
FT                   /db_xref="EnsemblGenomes-Tr:ACF88510"
FT                   /db_xref="GOA:A0A0U1RF89"
FT                   /db_xref="InterPro:IPR006197"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="InterPro:IPR039418"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RF89"
FT                   /protein_id="ACF88510.1"
FT                   /translation="MKFIPAVSEASIVKIPLFTERCPAGFPSPAANYTESELDLNEYCI
FT                   HRRHSTYFVRAIGNSMTDIGLYSGDLMVVDKAEQPRHGDIVIAEIEGEFTVKRLLLTPR
FT                   PALQAMNPDFPSLYPDPETLQIFGVVTAFIHKTRRAD"
FT   gene            459..1730
FT                   /locus_tag="SeSA_B0002"
FT   CDS_pept        459..1730
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeSA_B0002"
FT                   /product="protein UmuC"
FT                   /note="identified by match to protein family HMM PF00817"
FT                   /db_xref="EnsemblGenomes-Gn:SeSA_B0002"
FT                   /db_xref="EnsemblGenomes-Tr:ACF88605"
FT                   /db_xref="GOA:A0A0N1QRY5"
FT                   /db_xref="InterPro:IPR001126"
FT                   /db_xref="InterPro:IPR017961"
FT                   /db_xref="InterPro:IPR025188"
FT                   /db_xref="InterPro:IPR036775"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0N1QRY5"
FT                   /protein_id="ACF88605.1"
FT                   /translation="MFALADVNSFYASCEKVFRPDLRGKPVVVLSNNDGCVIARSAEAK
FT                   RLGIKMGTPWFQLKEAQFPEKLYVFSSNYELYASLSNRVVALLEELSPRVEQYSIDECF
FT                   LDARGISHCMDLEDFGRQLRGHVLSGTGLTIGVGFGATKTLAKSAQWASKEWPQFSGVL
FT                   ALSPENPRRTAKLLSLQPVEEIWGVGNRIAKKLHVMGITTALQLSLTNPTFIRKNFNVV
FT                   LERTVRELNGESCISLEEAPPPKQQIVCSRSFGQRITTYGEMRQAVCQYAERAAEKLRG
FT                   ERQYCRHISTFIKTSPFAVNEPYYGNVATEKLNTPTRDTRDIIAAAVRSLDRIWLDGHR
FT                   YAKAGIMLNDFSPNGVAQLNLFDDVQPRPHSDALMKVLDGINHSGLGKVWFAGRGIAPD
FT                   WQMKREMLSPAYTTRWKELPVARF"
FT   gene            1809..2060
FT                   /locus_tag="SeSA_B0003"
FT   CDS_pept        1809..2060
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeSA_B0003"
FT                   /product="antitoxin of toxin-antitoxin stability system,
FT                   StbD family"
FT                   /note="identified by match to protein family HMM TIGR01552"
FT                   /db_xref="EnsemblGenomes-Gn:SeSA_B0003"
FT                   /db_xref="EnsemblGenomes-Tr:ACF88583"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RFE3"
FT                   /protein_id="ACF88583.1"
FT                   /translation="MTNIILCDVTASVSELKNDPVATASARGGYPVEIIDRNRPVFYCV
FT                   PAALYEQMLDELDEKDLVQTITERQNQPLREVDLNQYL"
FT   gene            2114..2419
FT                   /locus_tag="SeSA_B0004"
FT   CDS_pept        2114..2419
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeSA_B0004"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SeSA_B0004"
FT                   /db_xref="EnsemblGenomes-Tr:ACF88547"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0N1QRV6"
FT                   /protein_id="ACF88547.1"
FT                   /translation="MGSKIAGVVFLYFAVWGMASVIELQYWRNADTYPVWLTKHLRISP
FT                   ENNDKSLIRIEMETFDKVCGDKRGLLAVTQKQNGMFMRCDDSPGFFSWFSGVYKVN"
FT   gene            2598..2798
FT                   /locus_tag="SeSA_B0005"
FT   CDS_pept        2598..2798
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeSA_B0005"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SeSA_B0005"
FT                   /db_xref="EnsemblGenomes-Tr:ACF88614"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0N1TUI1"
FT                   /protein_id="ACF88614.1"
FT                   /translation="MMFIQGRKIGRYWLPAGRRAGQRAASVAGFKNAGGNLKMKPHTLR
FT                   NFANFTQHASFRSQQSFHHRL"
FT   gene            complement(3496..4467)
FT                   /gene="sopB"
FT                   /locus_tag="SeSA_B0006"
FT   CDS_pept        complement(3496..4467)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sopB"
FT                   /locus_tag="SeSA_B0006"
FT                   /product="plasmid partition protein SopB"
FT                   /note="identified by match to protein family HMM PF02195;
FT                   match to protein family HMM TIGR00180"
FT                   /db_xref="EnsemblGenomes-Gn:SeSA_B0006"
FT                   /db_xref="EnsemblGenomes-Tr:ACF88575"
FT                   /db_xref="GOA:A0A0U1RFD7"
FT                   /db_xref="InterPro:IPR003115"
FT                   /db_xref="InterPro:IPR004437"
FT                   /db_xref="InterPro:IPR036086"
FT                   /db_xref="InterPro:IPR040873"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RFD7"
FT                   /protein_id="ACF88575.1"
FT                   /translation="MKRAPVIPRHTTHSQSTEDTSSPAPAAPMVDSLIARVGAMARGNA
FT                   ISLPVCGREVKFTLEVLRGDSVESASRVWSGNERDQELLTEDALDDLIPSFLLTGQQTP
FT                   AFGRRVSDVIEIADGSRRRKAAILTESDYRVLVGELDDEQMAALSRLGNDYRPTSAYER
FT                   GLRYTSRLQNEFAGNISALADAENISRKIITRCINTAKLPKSVVALFAHPGELSARSGE
FT                   ALQKAFADKEELLKQQAETLHDQKKAGLIFEAEEVISLLTSVLKQSPASRVNLSSRHQF
FT                   APGATALYKGDKMVLNLDRSRIPAECIEKIEAILKELEKPGV"
FT   gene            complement(4467..5642)
FT                   /gene="sopA"
FT                   /locus_tag="SeSA_B0007"
FT   CDS_pept        complement(4467..5642)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sopA"
FT                   /locus_tag="SeSA_B0007"
FT                   /product="plasmid partition protein SopA"
FT                   /note="identified by match to protein family HMM PF00376;
FT                   match to protein family HMM PF01656"
FT                   /db_xref="EnsemblGenomes-Gn:SeSA_B0007"
FT                   /db_xref="EnsemblGenomes-Tr:ACF88511"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RF90"
FT                   /protein_id="ACF88511.1"
FT                   /translation="MFSMGLMDTLNQCISAGHEMTKAIAIAQFNDDSPEARKITRRWRI
FT                   GEAADLVGVSSQAIRDAEKAGRLPHPDMETRGRVEQRVGYTIEQINHMRDVFGTRLRRA
FT                   EDAFPPVIGVAAHKGGVYKTSVSVHLAQDLALKGLRVLLVEGNDPQGTASMYHGWVPDL
FT                   HIHAEDTLLPFYLGEKDDASYAIKPTCWPGLDIIPSCLALHRIETELMGKFDEGKLPAD
FT                   PHLMLRLAIETVAHDYDVIVIDSAPNLGIGTINVVCAADVLIVPTPAELFDYTSALQFF
FT                   DMLRDLLKNVDLKGFEPDVRILLTKYSNNNGSQSPWMEEQIRDAWGSMVLKNVVRETDE
FT                   VGKGQIRMRTVFEQAIDQRSSTGAWRNALSIWEPVCNEIFDRLIKPRWEIR"
FT   gene            6374..7384
FT                   /locus_tag="SeSA_B0008"
FT   CDS_pept        6374..7384
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeSA_B0008"
FT                   /product="DNA replication protein"
FT                   /note="identified by match to protein family HMM PF01051"
FT                   /db_xref="EnsemblGenomes-Gn:SeSA_B0008"
FT                   /db_xref="EnsemblGenomes-Tr:ACF88619"
FT                   /db_xref="GOA:A0A0N1QRZ5"
FT                   /db_xref="InterPro:IPR000525"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0N1QRZ5"
FT                   /protein_id="ACF88619.1"
FT                   /translation="MTSENNSLLLNLQEVDKTTGEVVKLDVNSTSTVQPVALMRLGLFV
FT                   PTLKSTGKSKANRKNVTDATEELVQLAIAKSEGYTDVKITGSRLDMDTDFKVWLGIIRS
FT                   MSEYGVKSDTLELSFVEFVKMCGFDSRRSNKKMRDRISNSLFKLASVTLKFQSETKGWT
FT                   THLVQSAYYDINEDIVEIKAEPKLFELYHMDRRVLLRLKAIDALQRKESAQALYTYIES
FT                   LPQNPAPISMKRMRDRLNLTSNVYTQNHTVRKAMEQLRDIGYLDYTEFKRGRATYFSVH
FT                   YRNPKLISSPVKVPRKEEEEKAPEQNYDEVIKALKAAGIDPLKLAEALSAMKPEN"
FT   gene            complement(8174..8518)
FT                   /locus_tag="SeSA_B0009"
FT   CDS_pept        complement(8174..8518)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeSA_B0009"
FT                   /product="outer membrane lipoprotein blc"
FT                   /note="identified by match to protein family HMM PF08212"
FT                   /db_xref="EnsemblGenomes-Gn:SeSA_B0009"
FT                   /db_xref="EnsemblGenomes-Tr:ACF88556"
FT                   /db_xref="InterPro:IPR000566"
FT                   /db_xref="InterPro:IPR002446"
FT                   /db_xref="InterPro:IPR012674"
FT                   /db_xref="InterPro:IPR022272"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RFC4"
FT                   /protein_id="ACF88556.1"
FT                   /translation="MKLWPVVTGVAIALTLVACKSPTPPKGVQPISGFDASRYLGKWYE
FT                   VARLENRFERGLEQVTATYGKRSDGGISVLNRGYDPVKNKWNESEGKAYFTGEPTTAAL
FT                   KVSFLGSVWI"
FT   gene            8636..9361
FT                   /locus_tag="SeSA_B0010"
FT   CDS_pept        8636..9361
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeSA_B0010"
FT                   /product="transcriptional regulator, MerR family protein"
FT                   /note="identified by match to protein family HMM PF00376"
FT                   /db_xref="EnsemblGenomes-Gn:SeSA_B0010"
FT                   /db_xref="EnsemblGenomes-Tr:ACF88534"
FT                   /db_xref="GOA:A0A0U1RFA7"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RFA7"
FT                   /protein_id="ACF88534.1"
FT                   /translation="MAYSIGEFARLSGITATTLRAWQRRYGLLKPQRTEGGHRQYSDED
FT                   VQQALKILDWVKKGVPIGQVKPLLERPTSRLTNNWLTLQQSMLQRLQDGKIESLRQMIY
FT                   DAGREYPRPELVANVLRPLRSQVSANVAAAMTLREILDGIIIAYTSFCLEGDKKAPGDN
FT                   ILLSGWNLNDPCEVWLEALTRTGQGHRIDILPTPPATLAPEIFPDRHWLLVTRGKLTAA
FT                   RKKQIEQWQQQVSLEVIIL"
FT   gene            9461..9871
FT                   /gene="uraH"
FT                   /locus_tag="SeSA_B0011"
FT   CDS_pept        9461..9871
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="uraH"
FT                   /locus_tag="SeSA_B0011"
FT                   /product="hydroxyisourate hydrolase"
FT                   /EC_number="3.5.2.17"
FT                   /note="identified by match to protein family HMM PF00576;
FT                   match to protein family HMM TIGR02962"
FT                   /db_xref="EnsemblGenomes-Gn:SeSA_B0011"
FT                   /db_xref="EnsemblGenomes-Tr:ACF88609"
FT                   /db_xref="GOA:A0A0N1QRY6"
FT                   /db_xref="InterPro:IPR000895"
FT                   /db_xref="InterPro:IPR014306"
FT                   /db_xref="InterPro:IPR023416"
FT                   /db_xref="InterPro:IPR036817"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0N1QRY6"
FT                   /protein_id="ACF88609.1"
FT                   /translation="MKKTASLLMLTTLAFAPAAFSAPAGTLSVHILDQQTGMPPSYVTV
FT                   TLEKQQQDKWTPIASGKTDHDGRIKSLYPEDQDMQPGVYKVAFKTADYFHGKKLDSFFP
FT                   EIPVLFTVTRTNEKLHIPLLLSQYGYSTYKGS"
FT   gene            9974..10933
FT                   /locus_tag="SeSA_B0012"
FT   CDS_pept        9974..10933
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeSA_B0012"
FT                   /product="putative pathogenicity island protein"
FT                   /note="identified by match to protein family HMM PF04463;
FT                   match to protein family HMM PF08349"
FT                   /db_xref="EnsemblGenomes-Gn:SeSA_B0012"
FT                   /db_xref="EnsemblGenomes-Tr:ACF88563"
FT                   /db_xref="InterPro:IPR007553"
FT                   /db_xref="InterPro:IPR013560"
FT                   /db_xref="InterPro:IPR017087"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RFC9"
FT                   /protein_id="ACF88563.1"
FT                   /translation="MTTKPVLGISGCLTGSAVRFDGGHKRMGFVMDELAQWVSFRPVCP
FT                   EMAIGLPTPRPAIRLTLTDSGETQLRFSKPPHDDITQKMADFTADYLPKIGDLSGFIVC
FT                   AKSPSCGMERVRLYDENGNRGRKEGVGLFTAALLETYPWLPVEEDGRLHAPVLRENFIE
FT                   RVFALHELNTLRAKGLTRRALLDFHSRYKLQLLAHHQAGYREIGPFVASLHEWEDLDAF
FT                   FVAYREKLMTILKKPASRKNHTNVLMHIQGYFRNQLNSRQRVELRDVILHYRDGLLPIL
FT                   APLTLLKHYMAEYPDRYLMTQNYFDPYPDDLGLRLAVT"
FT   gene            11079..12167
FT                   /locus_tag="SeSA_B0013"
FT   CDS_pept        11079..12167
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeSA_B0013"
FT                   /product="RecF/RecN/SMC domain protein"
FT                   /note="identified by match to protein family HMM PF02463"
FT                   /db_xref="EnsemblGenomes-Gn:SeSA_B0013"
FT                   /db_xref="EnsemblGenomes-Tr:ACF88506"
FT                   /db_xref="GOA:A0A0U1RF87"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR014555"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041685"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RF87"
FT                   /protein_id="ACF88506.1"
FT                   /translation="MITTLHIQNYRSIREMSLELEQLNIVFGPNGTGKSNIYKAIHLMH
FT                   SAAQGQFSQALANEGGILKVFWAGKTRSDQLRRMNLAVETETYEYELQVGFVEKLPYPS
FT                   QFQLDPVIKEESIWLSGQYRRPSSQLMKRKNQAVFLNNVHHEKVTHSGTLYENESVFGQ
FT                   LGEPHLYPEVSQMRESLRNWRFYQEFSVSIGSAMRAPQVGFRSPVLASDGANLAAAFQT
FT                   IVEIGDELLLMRILDQAFPGCVFYSDNTGGRFRMMMQREGLSRPLEPAEFSDGTLRFLC
FT                   LAVALLSPRPPAFIALNEPENSLHPQMLPALASLIAEASRYSQIWLTSHSPELANLIEK
FT                   QRSFSLYQLSMVEGETKVERLG"
FT   gene            complement(12230..12934)
FT                   /locus_tag="SeSA_B0014"
FT   CDS_pept        complement(12230..12934)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeSA_B0014"
FT                   /product="IS26 transposase"
FT                   /note="identified by match to protein family HMM PF00665"
FT                   /db_xref="EnsemblGenomes-Gn:SeSA_B0014"
FT                   /db_xref="EnsemblGenomes-Tr:ACF88616"
FT                   /db_xref="GOA:A0A0N1QRZ3"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR032874"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0N1QRZ3"
FT                   /protein_id="ACF88616.1"
FT                   /translation="MNPFKGRHFQRDIILWAVRWYCKYGISYRELQEMLAERGVNVDHS
FT                   TIYRWVQRYAPEMEKRLRWYWRNPSDLCPWHMDETYVKVNGRWAYLYRAVDSRGRTVDF
FT                   YLSSRRNSKAAYRFLGKILNNVKKWQIPRFINTDKAPAYGRALALLKREGRCPSDVEHR
FT                   QIKYRNNVIECDHGKLKRIIGATLGFKSMKTAYATIKGIEVMRALRKGQASAFYYGDPL
FT                   GEIRLVSRVFEM"
FT   gene            complement(13198..14271)
FT                   /locus_tag="SeSA_B0015"
FT   CDS_pept        complement(13198..14271)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeSA_B0015"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SeSA_B0015"
FT                   /db_xref="EnsemblGenomes-Tr:ACF88561"
FT                   /db_xref="InterPro:IPR024064"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RFC7"
FT                   /protein_id="ACF88561.1"
FT                   /translation="MHTRTKLPAPLAADVAALIKNGMDFLDKAREEFEAKQYKHSVVSF
FT                   WIAVEILLKVPLASEHWTLVCSGKKVSRKSYLAGDFQSVSFDDVCTRLRDILEKPLPKE
FT                   TEAVFNTIRNHRNRVVHFFHTAFSDSEVETILAEQARAWFALNRLMREDWQQHFASPHN
FT                   WALALGETQLLRGNEFYAEARLKHIQPELEQLATEGAEFHPCTICHKPAAIMEILAVGK
FT                   NGPTVYEQTCRVCFHSERHVKFTCPECDTDQVLPVEEEDDDTFICRTCNAELSRYNLLD
FT                   EENFRHVDEMMYPDGLANCAHCEGHETVCVFGENFLCTRCLEIHTGYDTCEICGTPCEA
FT                   MGETMRYTGCPHCADED"
FT   gene            complement(14315..14464)
FT                   /locus_tag="SeSA_B0016"
FT   CDS_pept        complement(14315..14464)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeSA_B0016"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SeSA_B0016"
FT                   /db_xref="EnsemblGenomes-Tr:ACF88541"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RFB2"
FT                   /protein_id="ACF88541.1"
FT                   /translation="MHLLYGLVHPKILQWLMVHEKFECNEVNTKVFALDVVASQQLRFI
FT                   LYTH"
FT   gene            14806..15045
FT                   /locus_tag="SeSA_B0017"
FT   CDS_pept        14806..15045
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeSA_B0017"
FT                   /product="conserved domain protein"
FT                   /note="identified by match to protein family HMM PF04221;
FT                   match to protein family HMM TIGR02384"
FT                   /db_xref="EnsemblGenomes-Gn:SeSA_B0017"
FT                   /db_xref="EnsemblGenomes-Tr:ACF88608"
FT                   /db_xref="GOA:A0A0N1QRY3"
FT                   /db_xref="InterPro:IPR007337"
FT                   /db_xref="InterPro:IPR013321"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0N1QRY3"
FT                   /protein_id="ACF88608.1"
FT                   /translation="MGSINLRIDDELKARSYAALEKMGVTPSEALRLMLEYIADNERLP
FT                   FKQTLLSDEDAELVEIVKERLRKPKPVRVTLDEL"
FT   gene            15045..15332
FT                   /locus_tag="SeSA_B0018"
FT   CDS_pept        15045..15332
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeSA_B0018"
FT                   /product="toxin RelE"
FT                   /note="identified by match to protein family HMM PF05016;
FT                   match to protein family HMM TIGR02385"
FT                   /db_xref="EnsemblGenomes-Gn:SeSA_B0018"
FT                   /db_xref="EnsemblGenomes-Tr:ACF88602"
FT                   /db_xref="InterPro:IPR007712"
FT                   /db_xref="InterPro:IPR035093"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0N1QRY7"
FT                   /protein_id="ACF88602.1"
FT                   /translation="MAYFLDFDERALKEWRKLGSTVREQLKKKLVEVLESPRIEANKLR
FT                   GMPDCYKIKLRSSGYRLVYQVIDEKVVVFVISVGKRERSEVYSEAVKRIL"
FT   gene            complement(15636..16418)
FT                   /locus_tag="SeSA_B0019"
FT   CDS_pept        complement(15636..16418)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeSA_B0019"
FT                   /product="IS100 transposase orfB"
FT                   /note="identified by match to protein family HMM PF01695"
FT                   /db_xref="EnsemblGenomes-Gn:SeSA_B0019"
FT                   /db_xref="EnsemblGenomes-Tr:ACF88582"
FT                   /db_xref="GOA:A0A0U1RFE2"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR002611"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028350"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RFE2"
FT                   /protein_id="ACF88582.1"
FT                   /translation="MMVELQHQRLMVLAEQLQLDSLIGAAPALSQQAVDQEWSYMDFLE
FT                   HLLHEEKLARHQRKQAMYTRMAAFPAVKTFEEYDFTFATGAPQKQIQSLRSLSFIERNE
FT                   NIVLLGPSGVGKTHLAIAMGYEAVRAGIKVRFTTAADLLLQLSTSQRQGRYKTTLNRGV
FT                   MAPKLLIIDEIGYLPFSQEEAKLFFQVIAKRYEKSAMILTSNLPFGQWDQTFAGDAALT
FT                   SAMLDRILHHSHVVQIKGESYRLKQKRKAGVIAEANPE"
FT   gene            complement(16415..17437)
FT                   /locus_tag="SeSA_B0020"
FT   CDS_pept        complement(16415..17437)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeSA_B0020"
FT                   /product="transposase for insertion sequence"
FT                   /note="identified by match to protein family HMM PF00665"
FT                   /db_xref="EnsemblGenomes-Gn:SeSA_B0020"
FT                   /db_xref="EnsemblGenomes-Tr:ACF88515"
FT                   /db_xref="GOA:A0A0U1RF94"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR017894"
FT                   /db_xref="InterPro:IPR025246"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RF94"
FT                   /protein_id="ACF88515.1"
FT                   /translation="MITFEIRMEIKVLHKRGMSIRAIARELGISRNTVRSHLKAKSEKP
FT                   QYSPRPAPSSLLDEYRDYISKRISDAHPYKIPATVIAREIMELGYRGGLTILREFIRKQ
FT                   TLPAQAEPVVRFETEPGRQMQVDWGTMRNGKSPLHVFVAVLGYSRMLYIEFTDNMRYDT
FT                   LEACHRNAFSFFGGVPQEVLYDNMKTVVLQRDAYQTGQHRFHPSLWQFGKEMGFSPRLC
FT                   RPFRAQTKGKVERMVQYARNSFYIPLMTRLRPMGITVDVETANRYGLRWLYDVANQRKH
FT                   ETIQTRPCDRWVEEQQSMLALPPEKKQYDVQVDESLMTFDRQPLHHPLSIYDTFCRGAA
FT                   "
FT   gene            18237..20444
FT                   /locus_tag="SeSA_B0021"
FT   CDS_pept        18237..20444
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeSA_B0021"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SeSA_B0021"
FT                   /db_xref="EnsemblGenomes-Tr:ACF88559"
FT                   /db_xref="GOA:A0A0U1RFC5"
FT                   /db_xref="InterPro:IPR011704"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RFC5"
FT                   /protein_id="ACF88559.1"
FT                   /translation="MALEQVIYNLEEVKGLSDEELYQRLYDSWGLENHKIDVWGELSIN
FT                   VAGNWAGIRNAKTLSGNQSIEYPLADSHELQSGVFLTPSVAKIVLGNDTKGMVACELML
FT                   ASIPQRAKKNNPFLLAVNDKTVERLTYLPDALPNLDRQALIQNEDETLLRKVIYDAEVK
FT                   RVKHKIASETEALEAALQEKQQDMTDKLAELSDAFKSTQDKITASTTELESSIKRNEEL
FT                   NNDNHRLNLKIQESKAELDVIIEKSRKVEESMARKVEKLTDFIKEKAIFLKSFEFLDEE
FT                   DFDFFVGSPLSNKERGEHISFSQALYSNYSDAVSYIQAYLKERDILYPRHIIENFLTLI
FT                   RTNDLIILAGDSGSGKTNLVQSFAKAIGGVSKIIPVKPNWTSSEDLLGYYNPLEKKYLA
FT                   TPFLEALIEAKQNPDIPYFICLDEMNLARVEYYFADFLSKLEERNEQPTIQLYSDDEAA
FT                   HVLAELKGVVSVISNAQEKFSKNGIVDFVALMQDEEINAEMKRAFGFSDKDSLIKYHGD
FT                   IRRMLAGVLGTPSSITIPANVRIIGAINIDETTHYLSPKILDRAHVMKFKSPLLTDWDA
FT                   IFDEIDSYGLDDVTLPLVFDIEELGERTPYPKFERLNEFCELFTTLNRDVFDPLGVEFG
FT                   MRTIRQGLNYVSLFSDVNDNKSLAINNFIVHKVLPKFTFDGDKQVGDYSKAELVSRVFL
FT                   PRLESLLDNQVEIAAEFSCTKSIERLVKTAESNDGVVNYWA"
FT   gene            20447..23029
FT                   /locus_tag="SeSA_B0022"
FT   CDS_pept        20447..23029
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeSA_B0022"
FT                   /product="EstP"
FT                   /db_xref="EnsemblGenomes-Gn:SeSA_B0022"
FT                   /db_xref="EnsemblGenomes-Tr:ACF88551"
FT                   /db_xref="InterPro:IPR007505"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RFB9"
FT                   /protein_id="ACF88551.1"
FT                   /translation="METPFVIKFIETKWHDKQTLVSVSESEYSLKLEQTGNNAFSAHTT
FT                   IYPKVDELRFAQLAIKTKQGDQSPPYIVMPNGDRKQLESITDPASNAVWWVEPAHWDAK
FT                   QRVWRSEARRTAGQITFVIGNSTLKLDIDISEQTKSDLSRYLSDFKADLWELILDENSH
FT                   ITGDAKNSQVAAIDQEALSLVASILSNAQTILKKPKVELKEIQALKPAKEVRPVPRTFM
FT                   EICTKGSRKHLTSRASEPSYNVPENQYVLYVVLSTLSIVKQLVKVAESKKSRFSGAIEK
FT                   LNERLDSLKDYRIINRDLVVKDLERLKKRFDTEVINAELASQLGEINANKYFSQNHAAK
FT                   GYLRLEKTTGSENEWWAKIKPSQHDDWQQFELDGYTIFSSGEYYASLFQPYSDYDMVAI
FT                   MPPPSRRGTASILYPEYISKLTILADSRSLLRDKEKFSKLREQGIALNENGWKTKLTPE
FT                   ELSEQEKERETIRKRLSYFASEHEKVGIVHQVLAPKIKPFQQVEKEWRQCKVKSKSTFP
FT                   NSMTFVQNPAYQAVHSGFKKLKEQIGLADEDILLSLEKIEAIGLVNMPLIYERWCLLQI
FT                   IKVLTQAFRYLPEDNWKRKLIANIQGNEEQISIQFFNPNVSRKVTLQYEPFLANGKRPD
FT                   FVLDVEAITKSGNQISKRLVVDAKYYSAAYLKLRGGIGGVIHELYNGKDYSECQENSVF
FT                   VLHPVLDAVEKVVSPQEWAKDSYLGELSMFDWEPAYHQRQATNYGAVCANPMKSQRYLD
FT                   EIQRMLGMFLQYGIEDNTSFRGASDDTHAVNFCVSCGSEKVVDVTKSMSSNNQKRWYRC
FT                   NECTHFTVYTHCGTCNTRLIKNGEYWTYLSLMPMSSINIKCPNCESPV"
FT   gene            complement(23075..23287)
FT                   /locus_tag="SeSA_B0023"
FT   CDS_pept        complement(23075..23287)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeSA_B0023"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:SeSA_B0023"
FT                   /db_xref="EnsemblGenomes-Tr:ACF88603"
FT                   /db_xref="GOA:A0A0N1QRX9"
FT                   /db_xref="InterPro:IPR002513"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0N1QRX9"
FT                   /protein_id="ACF88603.1"
FT                   /translation="MLWNTMYMQAALDHLRAQGETLNDEDIARLSPLCHGHINMLGHYS
FT                   FTLAELVTKGHLRPLKEASEVENVA"
FT   gene            complement(23450..24280)
FT                   /locus_tag="SeSA_B0024"
FT   CDS_pept        complement(23450..24280)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeSA_B0024"
FT                   /product="integrase core domain protein"
FT                   /note="identified by match to protein family HMM PF00665"
FT                   /db_xref="EnsemblGenomes-Gn:SeSA_B0024"
FT                   /db_xref="EnsemblGenomes-Tr:ACF88546"
FT                   /db_xref="GOA:A0A0U1RFB6"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RFB6"
FT                   /protein_id="ACF88546.1"
FT                   /translation="MLMCDATGLSQRRACRLTGLSLSTCRYEAHRPAADAHLSGRITEL
FT                   ALERRRFGYRRIWQLLRREGLHVNHKRVYRLYHLSGLGVKRRRRRKGLATERLPLLRPA
FT                   APNLTWSMDFVMDALSTGRRIKCLTCVDDFTKECLTVTVAFGISGVQVTRILDSIALFR
FT                   GYPATIRTDQGPEFTCRALDQWAFEHGVELRLIQPGKPTQNGFIESFNGRFRDECLNEH
FT                   WFSDIVHARKIINDWRQDYNECRPHSTLNYQTPSEFAAGWRKGHSENEDSDVTN"
FT   misc_feature    complement(24223..24340)
FT                   /note="Insertion sequence IS1222 ribosomal frameshifting
FT                   element"
FT   gene            complement(24307..24570)
FT                   /locus_tag="SeSA_B0026"
FT   CDS_pept        complement(24307..24570)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeSA_B0026"
FT                   /product="transposase subfamily"
FT                   /note="identified by match to protein family HMM PF01527"
FT                   /db_xref="EnsemblGenomes-Gn:SeSA_B0026"
FT                   /db_xref="EnsemblGenomes-Tr:ACF88553"
FT                   /db_xref="GOA:A0A0U1RFC1"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RFC1"
FT                   /protein_id="ACF88553.1"
FT                   /translation="MKKRFSDEQIISILREAEAGVPARELCRKHAISDATFYTWRKKYG
FT                   GMEVPEVKRLKSLEEENTRLKKLLAEAMLDKEALQVALGRKY"
FT   gene            complement(24999..25976)
FT                   /locus_tag="SeSA_B0027"
FT   CDS_pept        complement(24999..25976)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeSA_B0027"
FT                   /product="integrase/recombinase"
FT                   /note="identified by match to protein family HMM PF00589"
FT                   /db_xref="EnsemblGenomes-Gn:SeSA_B0027"
FT                   /db_xref="EnsemblGenomes-Tr:ACF88555"
FT                   /db_xref="GOA:A0A0U1RFC3"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RFC3"
FT                   /protein_id="ACF88555.1"
FT                   /translation="MILIPDDEPELSLPAASEEFLPALSGENAPVSPARAYLLSLNSHR
FT                   SRQTMASFLNIVAVMLGAASLESCSWGSLRRHHVMAVTELLRDTGRATATVNTYLSALK
FT                   GVAKEAWMLRLMDVESFQHIRAVRNLRGSRLPSGRALPQGEIRALFAVCEADRSCLGAR
FT                   DAAMLAVILGCGLRRSEVVSLDLRDVVTQDRALRVLGKGNKERLAYVPAGAWQRLQIWI
FT                   DEIRGETPGPLFTRIRRFGDVTLNRLTDQAVYHILQVRQGQAGITKCSPHDLRRTFATA
FT                   MLDNGEDLITVKDAMGHASVTTTQQYDRRGEQRLQDARDRLNLI"
FT   gene            26216..26353
FT                   /pseudo
FT                   /locus_tag="SeSA_B0028"
FT                   /note="IS1 OrfA; this gene contains a frame shift which may
FT                   be the result of sequencing error; identified by match to
FT                   protein family HMM PF03811"
FT   gene            26373..26537
FT                   /locus_tag="SeSA_B0029"
FT   CDS_pept        26373..26537
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeSA_B0029"
FT                   /product="IS1 protein InsB"
FT                   /note="identified by match to protein family HMM PF03400"
FT                   /db_xref="EnsemblGenomes-Gn:SeSA_B0029"
FT                   /db_xref="EnsemblGenomes-Tr:ACF88505"
FT                   /db_xref="GOA:A0A0U1RF86"
FT                   /db_xref="InterPro:IPR005063"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RF86"
FT                   /protein_id="ACF88505.1"
FT                   /translation="MDEQWGYVGAKSRQRWLFYAYDRIRRTVVAHVFGERTMATLEHLL
FT                   SLPSVFQGA"
FT   gene            complement(27048..28868)
FT                   /locus_tag="SeSA_B0030"
FT   CDS_pept        complement(27048..28868)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeSA_B0030"
FT                   /product="transposase"
FT                   /note="identified by match to protein family HMM PF01526"
FT                   /db_xref="EnsemblGenomes-Gn:SeSA_B0030"
FT                   /db_xref="EnsemblGenomes-Tr:ACF88611"
FT                   /db_xref="GOA:A0A0N1QRZ1"
FT                   /db_xref="InterPro:IPR002513"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0N1QRZ1"
FT                   /protein_id="ACF88611.1"
FT                   /translation="MAIRRRRRMFILFAERKVGEQHAPAAQGVLAAVQTLREMNADNLR
FT                   KVPADAPTAFIKPRWKPLVITPEGLDRKFYEICALSELKNALRSGDIWVKGSRQFRDFD
FT                   DYLLPAEKFAALKREQALPLAINPNSDQYLEERLQLLDEQLATVTRLAKDNELPDAILT
FT                   ESGLKITPLDAAVPDRAQALIDQTSQLLPRIKITELLMDVDDWTGFSRHFTHLKDGAEA
FT                   KDRTLLLSAILGDAINLGLTKMAESSPGLTYAKLSWLQAWHIRDETYSAALAELVNHQY
FT                   RHAFAAHWGDGTTSSSDGQRFRAGGRGESTGHVNPKYGSEPGRLFYTHISDQYAPFSTR
FT                   VVNVGVRDSTYVLDGLLYHESDLRIEEHYTDTAGFTDHVFALMHLLGFRFAPRIRDLGE
FT                   TKLYVPQGVQAYPTLRPLIGGTLNIKHVRAHWDDILRLASSIKQGTVTASLMLRKLGSY
FT                   PRQNGLAVALRELGRIERTLFILDWLQSVELRRRVHAGLNKGEARNSLARAVFFNRLGE
FT                   IRDRSFEQQRYRASGLNLVTAAIVLWNTVYLERATQGLVEAGKPVDGELLQFLSPLGWE
FT                   HINLTGDYVWRQSRRLEDGKFRPLRMPGKP"
FT   gene            29333..30217
FT                   /locus_tag="SeSA_B0031"
FT   CDS_pept        29333..30217
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeSA_B0031"
FT                   /product="drug/metabolite transporter"
FT                   /note="identified by match to protein family HMM PF00892"
FT                   /db_xref="EnsemblGenomes-Gn:SeSA_B0031"
FT                   /db_xref="EnsemblGenomes-Tr:ACF88501"
FT                   /db_xref="GOA:A0A0U1RF83"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RF83"
FT                   /protein_id="ACF88501.1"
FT                   /translation="MSLRTPDLLFTAIAPAIWGSTYIVTTQYLPNFSPMTVAMLRALPA
FT                   GLLLVMIVRQIPTGIWWMRIFILGALNISLFWSLLFISVYRLPGGVAATVGAVQPLMVV
FT                   FISAALLGSPIRLMAVLGAICGTAGVALLVLTPNAALDPVGVAAGLAGAVSMAFGTVLT
FT                   RKWQPPVPLLTFTAWQLAAGGLLLVPVALVFDPPIPMPTGTNVLGLAWLGLIGAGLTYF
FT                   LWFRGISRLEPTVVSLLGFLSPGTAVLLGWLFLDQTLSALQIIGVLLVIGSIWLGQRSN
FT                   RTPRARIACRKSP"
FT   gene            complement(30249..31448)
FT                   /gene="tetA"
FT                   /locus_tag="SeSA_B0032"
FT   CDS_pept        complement(30249..31448)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tetA"
FT                   /locus_tag="SeSA_B0032"
FT                   /product="tetracycline resistance protein, class A"
FT                   /note="identified by match to protein family HMM PF07690;
FT                   match to protein family HMM TIGR00880"
FT                   /db_xref="EnsemblGenomes-Gn:SeSA_B0032"
FT                   /db_xref="EnsemblGenomes-Tr:ACF88573"
FT                   /db_xref="GOA:A0A0U1RFD5"
FT                   /db_xref="InterPro:IPR001958"
FT                   /db_xref="InterPro:IPR004734"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RFD5"
FT                   /protein_id="ACF88573.1"
FT                   /translation="MKPNRPLIVILSTVALDAVGIGLIMPVLPGLLRDLVHSNDVTAHY
FT                   GILLALYALMQFACAPVLGALSDRFGRRPVLLVSLAGAAVDYAIMATAPFLWVLYIGRI
FT                   VAGITGATGAVAGAYIADITDGDERARHFGFMSACFGFGMVAGPVLGGLMGGFSPHAPF
FT                   FAAAALNGLNFLTGCFLLPESHKGERRPLRREALNPLASFRWARGMTVVAALMAVFFIM
FT                   QLVGQVPAALWVIFGEDRFHWDATTIGISLAAFGILHSLAQAMITGPVAARLGERRALM
FT                   LGMIADGTGYILLAFATRGWMAFPIMVLLASGGIGMPALQAMLSRQVDEERQGQLQGSL
FT                   AALTSLTSIVGPLLFTAIYAASITTWNGWAWIAGAALYLLCLPALRRGLWSGAGQRADR
FT                   "
FT   gene            31527..32204
FT                   /gene="tetR"
FT                   /locus_tag="SeSA_B0033"
FT   CDS_pept        31527..32204
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tetR"
FT                   /locus_tag="SeSA_B0033"
FT                   /product="tetracycline repressor protein, class A"
FT                   /note="identified by match to protein family HMM PF00440;
FT                   match to protein family HMM PF02909"
FT                   /db_xref="EnsemblGenomes-Gn:SeSA_B0033"
FT                   /db_xref="EnsemblGenomes-Tr:ACF88544"
FT                   /db_xref="GOA:A0A0U1RFB4"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR003012"
FT                   /db_xref="InterPro:IPR004111"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RFB4"
FT                   /protein_id="ACF88544.1"
FT                   /translation="MFISDKVSSMTKLQPNTVIRAALDLLNEVGVDGLTTRKLAERLGV
FT                   QQPALYWHFRNKRALLDALAEAMLAENHTHSVPRADDDWRSFLIGNARSFRQALLAYRD
FT                   GARIHAGTRPGAPQMETADAQLRFLCEAGFSAGDAVNALMTISYFTVGAVLEEQAGDSD
FT                   AGERGGTVEQAPLSPLLRAAIDAFDEAGPDAAFEQGLAVIVDGLAKRRLVVRNVEGPRK
FT                   GDD"
FT   gene            complement(32236..32478)
FT                   /locus_tag="SeSA_B0034"
FT   CDS_pept        complement(32236..32478)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeSA_B0034"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SeSA_B0034"
FT                   /db_xref="EnsemblGenomes-Tr:ACF88607"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0N1QRY0"
FT                   /protein_id="ACF88607.1"
FT                   /translation="MKTAALDLARERQAHEAGARTRATAHERTPQQERQKAAREAERGR
FT                   EAWTLGQGMKKPVAGCYGRLTRWKGGGDVVYMALL"
FT   gene            complement(32536..33303)
FT                   /locus_tag="SeSA_B0035"
FT   CDS_pept        complement(32536..33303)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeSA_B0035"
FT                   /product="transposase"
FT                   /note="identified by match to protein family HMM PF01526"
FT                   /db_xref="EnsemblGenomes-Gn:SeSA_B0035"
FT                   /db_xref="EnsemblGenomes-Tr:ACF88526"
FT                   /db_xref="GOA:A0A0U1RFA2"
FT                   /db_xref="InterPro:IPR002513"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RFA2"
FT                   /protein_id="ACF88526.1"
FT                   /translation="MLDGLLYHESDLRIEEHYTDTAGFTDHVFALMHLLGFRFAPRIRD
FT                   LGETKLYVPQGVQAYPTLRPLIGGTLNIKHVRAHWDDILRLASSIKQGTVTASLMLRKL
FT                   GSYPRQNGLAVALRELGRIERTLFILDWLQSVELRRRVHAGLNKGEARNSLARAVFFNR
FT                   LGEIRDRSFEQQRYRASGLNLVTAAIVLWNTVYLERATQGLVEAGKPVDGELLQFLSPL
FT                   GWEHINLTGDYVWRQSRRLEDGKFRPLRMPGKP"
FT   gene            complement(33549..36521)
FT                   /locus_tag="SeSA_B0036"
FT   CDS_pept        complement(33549..36521)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeSA_B0036"
FT                   /product="Tn3 family transposase"
FT                   /note="identified by match to protein family HMM PF01526"
FT                   /db_xref="EnsemblGenomes-Gn:SeSA_B0036"
FT                   /db_xref="EnsemblGenomes-Tr:ACF88581"
FT                   /db_xref="GOA:A0A0U1RFE1"
FT                   /db_xref="InterPro:IPR002513"
FT                   /db_xref="InterPro:IPR025296"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RFE1"
FT                   /protein_id="ACF88581.1"
FT                   /translation="MPRRSILSATERESLLALPDAKDELIRHYTFNETDLSVIRQRRGA
FT                   ANRLGFAVQLCYLRFPGTFLGVDEPPFPPLLRMVAAQLKMPVESWSEYGQREQTRREHL
FT                   VELQTVFGFKPFTMSHYRQAVHTLTELALQTDKGIVLASALVENLRRQSIILPAMNAIE
FT                   RASAEAITRANRRIYAALTDSLLSPHRQRLDELLKRKDGSKVTWLAWLRQSPAKPNSRH
FT                   MLEHIERLKSWQALDLPAGIERQVHQNRLLKIAREGGQMTPADLAKFEVQRRYATLVAL
FT                   AIEGMATVTDEIIDLHDRIIGKLFNAAKNKHQQQFQASGKAINDKVRMYGRIGQALIEA
FT                   KQSGSDPFAAIEAVMPWDTFAASVTEAQTLARPADFDFLHHIGESYATLRRYAPQFLGV
FT                   LKLRAAPAAKGVLDAIDMLRGMNSDSARKVPADAPTAFIKPRWAKLVLTDDGIDRRYYE
FT                   LCALSELKNALRSGDVWVQGSRQFKDFDEYLVPVEKFATLKLASELPLAVATDCDQYLH
FT                   DRLELLEAQLATVNRMAAANDLPDAIITTASGLKITPLDAAVPDAAQAMIDQTAMLLPH
FT                   LKITELLMEVDEWTGFTRHFTHLKTSDTAKDKTLLLTTILADAINLGLTKMAESCPGTT
FT                   YAKLSWLQAWHIRDETYSTALAELVNAQFRQPFAGNWGDGTTSSSDGQNFRTGSKAEST
FT                   GHINPKYGSSPGRTFYTHISDQYAPFSAKVVNVGIRDSTYVLDGLLYHESDLRIEEHYT
FT                   DTAGFTDHVFGLMHLLGFRFAPRIRDLGETKLFIPKGDAAYDALKPMISSDRLNIKQIR
FT                   AHWDEILRLATSIKQGTVTASLMLRKLGSYPRQNGLAVALRELGRIERTLFILDWLQSV
FT                   ELRRRVHAGLNKGEARNALARAVFFYRLGEIRDRSFEQQRYRASGLNLVTAAIVLWNTV
FT                   YLERATSALRGNGTALDDTLLQYLSPLGWEHINLTGDYLWRSSAKVGAGKFRPLRPLPP
FT                   A"
FT   gene            complement(36524..37141)
FT                   /locus_tag="SeSA_B0037"
FT   CDS_pept        complement(36524..37141)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeSA_B0037"
FT                   /product="transposon Tn21 resolvase"
FT                   /note="identified by match to protein family HMM PF00239;
FT                   match to protein family HMM PF02796"
FT                   /db_xref="EnsemblGenomes-Gn:SeSA_B0037"
FT                   /db_xref="EnsemblGenomes-Tr:ACF88613"
FT                   /db_xref="GOA:A0A0N1QRZ0"
FT                   /db_xref="InterPro:IPR006118"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR006120"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036162"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0N1QRZ0"
FT                   /protein_id="ACF88613.1"
FT                   /translation="MTYSVKGNRFHPDTFAFGGILQGQRIGYVRVSSFDQNPERQLEGV
FT                   QVARVFTDKASGKDTQRPELERLLAFVREGDTVVVHSMDRLARNLDDLRRIVQGLTQRG
FT                   VRMEFVKEGLKFTGEDSPMANLMLSVMGAFAEFERALIRERQREGIVLAKQRGAYRGRK
FT                   KSLNSEQIAELKRRVAAGDQKTLVARDFGISRETLYQYLRED"
FT   gene            37249..37428
FT                   /locus_tag="SeSA_B0038"
FT   CDS_pept        37249..37428
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeSA_B0038"
FT                   /product="putative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:SeSA_B0038"
FT                   /db_xref="EnsemblGenomes-Tr:ACF88592"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0N1QI80"
FT                   /protein_id="ACF88592.1"
FT                   /translation="MDPSGNDGLLPAISGRREDFPQPAVRCGTDGLRAGVVNPPGLTCA
FT                   ALPLTSEGRQRIKR"
FT   gene            complement(37387..37866)
FT                   /locus_tag="SeSA_B0039"
FT   CDS_pept        complement(37387..37866)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeSA_B0039"
FT                   /product="integrase/recombinase"
FT                   /note="identified by match to protein family HMM PF00589;
FT                   match to protein family HMM TIGR02249"
FT                   /db_xref="EnsemblGenomes-Gn:SeSA_B0039"
FT                   /db_xref="EnsemblGenomes-Tr:ACF88529"
FT                   /db_xref="GOA:A0A0U1RFA3"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RFA3"
FT                   /protein_id="ACF88529.1"
FT                   /translation="MLPESLAPSLREQLSRARAWWLKDQAEGRSGVALPDALERKYPRA
FT                   GHSWPWFWVFAQHTHSTDPRSGVVRRHHMYDQTFQRAFKRAVEQAGITKPATPHTLRHS
FT                   FATALLRSGYDIRTVQDLLGHSDVSTTMIYTHVLKVGGAGVRSPLDALPPLTSER"
FT   gene            complement(37923..38627)
FT                   /locus_tag="SeSA_B0040"
FT   CDS_pept        complement(37923..38627)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeSA_B0040"
FT                   /product="IS26 transposase"
FT                   /note="identified by match to protein family HMM PF00665"
FT                   /db_xref="EnsemblGenomes-Gn:SeSA_B0040"
FT                   /db_xref="EnsemblGenomes-Tr:ACF88522"
FT                   /db_xref="GOA:A0A0N1QLE1"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR032874"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0N1QLE1"
FT                   /protein_id="ACF88522.1"
FT                   /translation="MNPFKGRHFQRDIILWAVRWYCKYGISYRELQEMLAERGVNVDHS
FT                   TIYRWVQRYAPEMEKRLRWYWRNPSDLCPWHMDETYVKVNGRWAYLYRAVDSRGRTVDF
FT                   YLSSRRNSKAAYRFLGKILNNVKKWQIPRFINTDKAPAYGRALALLKREGRCPSDVEHR
FT                   QIKYRNNVIECDHGKLKRIIGATLGFKSMKTAYATIKGIEVMRALRKGQASAFYYGDPL
FT                   GEMRLVSRVFEM"
FT   gene            complement(38674..39942)
FT                   /locus_tag="SeSA_B0041"
FT   CDS_pept        complement(38674..39942)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeSA_B0041"
FT                   /product="TniAdelta1"
FT                   /note="identified by match to protein family HMM PF00665"
FT                   /db_xref="EnsemblGenomes-Gn:SeSA_B0041"
FT                   /db_xref="EnsemblGenomes-Tr:ACF88610"
FT                   /db_xref="GOA:A0A0N1QRY4"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0N1QRY4"
FT                   /protein_id="ACF88610.1"
FT                   /translation="MATDTPRIPEQGVATLPDEAWERARRRAEIISPLAQSEMVGHEAA
FT                   DMAAQALGLSRRQVYVLIRRARQGSGLVTDLVPGQSGGGKGKGRLPEPVERVIHELLQK
FT                   RFLTKQKRSLAAFHREVTQVCKAQKLRVPARNTVALRIASLDPRKVIRRREGQDAARDL
FT                   QGVGGEPPAVTAPLEQVQIDHTVIDLIVVDDRDRQPIGRPYLTLAIDVFTRCVLGMVVT
FT                   LEAPSAVSVGLCLVHVACDKRPWLEGLNVEMDWQMSGKPLLLYLDNAAEFKSEALRRGC
FT                   EQHGIRLDYRPLGQPHYGGIVERIIGTAMQMIHDELPGTTFSNPDQRGDYDSENKAALT
FT                   LRELERWLTLAVGTYHGSVHNGLLQPPAARWAEAVARVGVPAVVTRATSFLVDFLPILR
FT                   RTLTRTGFVIDHIHYYADGHCCK"
FT   gene            complement(40017..40724)
FT                   /locus_tag="SeSA_B0042"
FT   CDS_pept        complement(40017..40724)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeSA_B0042"
FT                   /product="Urf2"
FT                   /note="identified by match to protein family HMM PF00563"
FT                   /db_xref="EnsemblGenomes-Gn:SeSA_B0042"
FT                   /db_xref="EnsemblGenomes-Tr:ACF88548"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0N1QRV7"
FT                   /protein_id="ACF88548.1"
FT                   /translation="MTSSQPAGWTAAELAQAAARGQLDLHYQPLVDLRDHRIAGAEALM
FT                   RWRHPRLGLLPPGQFLPLAESFGLMPEIGAWVLGEACRQMHKWQGPAWQPFRLAINVSA
FT                   SQVGPTFDDEVKRVLADMALPAELLEIELTESVAFGNPALFASFDALRAIGVRFAADDF
FT                   GTGYSCLQHLKCCPITTLKIDQSFVARLPDDARDQTIVRAVIQLAHGLGMDVIFRRRLH
FT                   QLIGRNGCCAASS"
FT   gene            complement(40721..40957)
FT                   /locus_tag="SeSA_B0043"
FT   CDS_pept        complement(40721..40957)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeSA_B0043"
FT                   /product="conserved domain protein"
FT                   /note="identified by match to protein family HMM PF05052"
FT                   /db_xref="EnsemblGenomes-Gn:SeSA_B0043"
FT                   /db_xref="EnsemblGenomes-Tr:ACF88531"
FT                   /db_xref="GOA:A0A0U1RFA4"
FT                   /db_xref="InterPro:IPR007746"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RFA4"
FT                   /protein_id="ACF88531.1"
FT                   /translation="MNAPDKLPPETRQPVSGYLWGALAVLTCPCHLPILAAVLAGTTAG
FT                   AFLGEHWGVAALALTGLFVLAVTRLLRAFRGGS"
FT   gene            complement(40954..41316)
FT                   /gene="merD"
FT                   /locus_tag="SeSA_B0044"
FT   CDS_pept        complement(40954..41316)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="merD"
FT                   /locus_tag="SeSA_B0044"
FT                   /product="mercuric resistence transcriptional repressor
FT                   protein MerD"
FT                   /note="identified by match to protein family HMM PF00376;
FT                   match to protein family HMM TIGR02054"
FT                   /db_xref="EnsemblGenomes-Gn:SeSA_B0044"
FT                   /db_xref="EnsemblGenomes-Tr:ACF88593"
FT                   /db_xref="GOA:A0A0N1QRX2"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR011797"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0N1QRX2"
FT                   /protein_id="ACF88593.1"
FT                   /translation="MSAYTVSQLAHNAGVSVHIVRDYLVRGLLRPVACTTGGYGVFDDA
FT                   ALQRLCFVRAAFEAGIGLDALARLCRALDAADGAQAAAQLAVLRQLVERRRAALAHLDA
FT                   QLASMPAERAHEEALP"
FT   gene            complement(41334..43028)
FT                   /gene="merA"
FT                   /locus_tag="SeSA_B0045"
FT   CDS_pept        complement(41334..43028)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="merA"
FT                   /locus_tag="SeSA_B0045"
FT                   /product="mercuric reductase"
FT                   /EC_number="1.16.1.1"
FT                   /note="identified by match to protein family HMM PF00070;
FT                   match to protein family HMM PF00403; match to protein
FT                   family HMM PF01266; match to protein family HMM PF02852;
FT                   match to protein family HMM PF07992; match to protein
FT                   family HMM TIGR02053"
FT                   /db_xref="EnsemblGenomes-Gn:SeSA_B0045"
FT                   /db_xref="EnsemblGenomes-Tr:ACF88604"
FT                   /db_xref="GOA:A0A0N1TUI5"
FT                   /db_xref="InterPro:IPR001100"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR012999"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR017969"
FT                   /db_xref="InterPro:IPR021179"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0N1TUI5"
FT                   /protein_id="ACF88604.1"
FT                   /translation="MSTLKITGMTCDSCAVHVKDALEKVPGVQSADVSYAKGSAKLAIE
FT                   VGTSPDALTAAVAGLGYRATLADAPSVSTPGGLLDKMRDLLGRNDKTGSSGALHIAVIG
FT                   SGGAAMAAALKAVEQGARVTLIERGTIGGTCVNVGCVPSKIMIRAAHIAHLRRESPFDG
FT                   GIAATTPTIQRTALLAQQQARVDELRHAKYEGILEGNPAITVLHGSARFKDNRNLIVQL
FT                   NDGGERVVAFDRCLIATGASPAVPPIPGLKDTPYWTSTEALVSETIPKRLAVIGSSVVA
FT                   LELAQAFARLGAKVTILARSTLFFREDPAIGEAVTAAFRMEGIEVREHTQASQVAYING
FT                   EGDGEFVLTTAHGELRADKLLVATGRAPNTRKLALDATGVTLTPQGAIVIDPGMRTSVE
FT                   HIYAAGDCTDQPQFVYVAAAAGTRAAINMTGGDAALNLTAMPAVVFTDPQVATVGYSEA
FT                   EAHHDGIKTDSRTLTLDNVPRALANFDTRGFIKLVVEEGSGRLIGVQAVAPEAGELIQT
FT                   AALAIRNRMTVQELADQLFPYLTMVEGLKLAAQTFNKDVKQLSCCAG"
FT   gene            complement(43192..44052)
FT                   /gene="blaT"
FT                   /locus_tag="SeSA_B0046"
FT   CDS_pept        complement(43192..44052)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blaT"
FT                   /locus_tag="SeSA_B0046"
FT                   /product="beta-lactamase TEM"
FT                   /EC_number="3.5.2.6"
FT                   /note="identified by match to protein family HMM PF00144"
FT                   /db_xref="EnsemblGenomes-Gn:SeSA_B0046"
FT                   /db_xref="EnsemblGenomes-Tr:ACF88509"
FT                   /db_xref="GOA:A0A0U1RF88"
FT                   /db_xref="InterPro:IPR000871"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR023650"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RF88"
FT                   /protein_id="ACF88509.1"
FT                   /translation="[TEM beta-lactamase fragment, 45 aa]
FT                   ELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYS
FT                   PVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRW
FT                   EPELNEAIPNDERDTTMPAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSA
FT                   LPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGAS
FT                   LIKHW"
FT   gene            complement(44235..44387)
FT                   /pseudo
FT                   /locus_tag="SeSA_B0047"
FT                   /note="transposon Tn3 resolvase; this gene contains a frame
FT                   shift which may be the result of sequencing error;
FT                   identified by match to protein family HMM PF02796"
FT   gene            44446..45150
FT                   /locus_tag="SeSA_B0048"
FT   CDS_pept        44446..45150
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeSA_B0048"
FT                   /product="IS26 transposase"
FT                   /note="identified by match to protein family HMM PF00665"
FT                   /db_xref="EnsemblGenomes-Gn:SeSA_B0048"
FT                   /db_xref="EnsemblGenomes-Tr:ACF88542"
FT                   /db_xref="GOA:A0A0N1QKX5"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR032874"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0N1QKX5"
FT                   /protein_id="ACF88542.1"
FT                   /translation="MNPFKGRHFQRDIILWAVRWYCKYGISYRELQEMLAERGVNVDHS
FT                   TIYRWVQRYAPEMEKRLRWYWRNPSDLCPWHMDETYVKVNGRWAYLYRAVDSRGRTVDF
FT                   YLSSRRNSKAAYRFLGKILNNVKKWQIPRFINTDKAPAYGRALALLKREGRCPSDVEHR
FT                   QIKYRNNVIECDHGKLKRIINATLGFKSMKTAYATIKGIEVMRALRKGQASAFYYGDPL
FT                   GEMRLVSRVFEM"
FT   gene            45214..45330
FT                   /locus_tag="SeSA_B0049"
FT   CDS_pept        45214..45330
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeSA_B0049"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SeSA_B0049"
FT                   /db_xref="EnsemblGenomes-Tr:ACF88597"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0N1QRX4"
FT                   /protein_id="ACF88597.1"
FT                   /translation="MKNVWYNKDIILKIECCSVDNLQGLISIFTQKLQSIIY"
FT   gene            45485..45877
FT                   /locus_tag="SeSA_B0050"
FT   CDS_pept        45485..45877
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeSA_B0050"
FT                   /product="NimC/NimA family protein"
FT                   /note="identified by match to protein family HMM PF01243"
FT                   /db_xref="EnsemblGenomes-Gn:SeSA_B0050"
FT                   /db_xref="EnsemblGenomes-Tr:ACF88521"
FT                   /db_xref="GOA:A0A0U1RF98"
FT                   /db_xref="InterPro:IPR011576"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RF98"
FT                   /protein_id="ACF88521.1"
FT                   /translation="MSQVVDFLNEAKTFYFATVEGDQPRVRPFNAAMERNGKVYLGTTN
FT                   QKKVYQQLLANSKVEVSGMAKGKWIRLTGEAVIDDTVEAREAMLEANPPLRDMYSADDG
FT                   KFTVFYLKNMQAVLYSFTGDPEILDN"
FT   gene            complement(46197..46313)
FT                   /locus_tag="SeSA_B0051"
FT   CDS_pept        complement(46197..46313)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeSA_B0051"
FT                   /product="bleomycin resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:SeSA_B0051"
FT                   /db_xref="EnsemblGenomes-Tr:ACF88577"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0N1QRW3"
FT                   /protein_id="ACF88577.1"
FT                   /translation="MGILHPNTSLKDQWWDERDFAVIDPDNNLISFFQQIKS"
FT   gene            complement(46715..49681)
FT                   /locus_tag="SeSA_B0052"
FT   CDS_pept        complement(46715..49681)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeSA_B0052"
FT                   /product="Tn3 family transposase"
FT                   /note="identified by match to protein family HMM PF01526"
FT                   /db_xref="EnsemblGenomes-Gn:SeSA_B0052"
FT                   /db_xref="EnsemblGenomes-Tr:ACF88599"
FT                   /db_xref="GOA:A0A0N1QRX8"
FT                   /db_xref="InterPro:IPR002513"
FT                   /db_xref="InterPro:IPR025296"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0N1QRX8"
FT                   /protein_id="ACF88599.1"
FT                   /translation="MPRRSILSAAERESLLALPDSKDDLIRHYTFNDTDLSIIRQRRGP
FT                   ANRLGFAVQLCYLRFPGVILGVDELPFPPLLKLVADQLKVGVESWNEYGQREQTRREHL
FT                   SELQTVFGFRPFTMSHYRQAVQMLTELAMQTDKGIVLASALIGHLRRQSVILPALNAVE
FT                   RASAEAITRANRRIYDALAEPLADAHRRRLDDLLKRRDNGKTTWLAWLRQSPAKPNSRH
FT                   MLEHIERLKAWQALDLPTGIERLVHQNRLLKIAREGGQMTPADLAKFEPQRRYATLVAL
FT                   ATEGMATVTDEIIDLHDRILGKLFNAAKNKHQQQFQASGKAINAKVRLYGRIGQALIDA
FT                   KQSGRDAFAAIEAVMSWDSFAESVTEAQKLAQPDDFDFLHRIGESYATLRRYAPEFLAV
FT                   LKLRAAPAAKNVLDAIEVLRGMNTDNARKLPADAPTGFIKPRWQKLVMTDAGIDRRYYE
FT                   LCALSELKNSLRSGDIWVQGSRQFKDFEDYLVPPEKFTSLKQSSELPLAVATDCEQYLH
FT                   ERLTLLEAQLATVNRMAAANDLPDAIITESGLKITPLDAAVPDTAQALIDQTAMVLPHV
FT                   KITELLLEVDEWTGFTRHFTHLKSGDLAKDKNLLLTTILADAINLGLTKMAESCPGTTY
FT                   AKLAWLQAWHTRDETYSTALAELVNAQFRHPFAGHWGDGTTSSSDGQNFRTASKAKSTG
FT                   HINPKYGSSPGRTFYTHISDQYAPFHTKVVNVGLRDSTYVLDGLLYHESDLRIEEHYTD
FT                   TAGFTDHVFALMHLLGFRFAPRIRDLGDTKLYIPKGDAAYDALKPMIGGMLNIKHVRAH
FT                   WDEILRLATSIKQGTVTASLMLRKLGSYPRQNGLAVALRELGRIERTLFILDWLQSVEL
FT                   RRRVHAGLNKGEARNALACAVFFNRLGEIRDRSFEQQRYRASGLNLVTAAIVLWNTVYL
FT                   ERAAHALRGNGHAVDDSLLQYLSPLGWEHINLTGDYLWRSSVKIGAGKFRPLRPLQPA"
FT   gene            complement(49684..50244)
FT                   /locus_tag="SeSA_B0053"
FT   CDS_pept        complement(49684..50244)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeSA_B0053"
FT                   /product="transposon Tn21 resolvase"
FT                   /note="identified by match to protein family HMM PF00239;
FT                   match to protein family HMM PF02796"
FT                   /db_xref="EnsemblGenomes-Gn:SeSA_B0053"
FT                   /db_xref="EnsemblGenomes-Tr:ACF88589"
FT                   /db_xref="GOA:A0A0N1QRW5"
FT                   /db_xref="InterPro:IPR006118"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR006120"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036162"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0N1QRW5"
FT                   /protein_id="ACF88589.1"
FT                   /translation="MTGQRIGYIRVSTFDQNPERQLEGVKVDRAFSDKASGKDVKRPQL
FT                   EALISFARTGDTVVVHSMDRLARNLDDLRRIVQTLTQRGVHIEFVKEHLSFTGEDSPMA
FT                   NLMLSVMGAFAEFERALIRERQREGIALAKQRGAYRGRKKSLSSERIAELRQRVEAGEQ
FT                   KTKLAREFGISRETLYQYLRTDQ"
FT   gene            complement(50306..50554)
FT                   /locus_tag="SeSA_B0054"
FT   CDS_pept        complement(50306..50554)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeSA_B0054"
FT                   /product="insertion sequence"
FT                   /db_xref="EnsemblGenomes-Gn:SeSA_B0054"
FT                   /db_xref="EnsemblGenomes-Tr:ACF88518"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0N1TUH1"
FT                   /protein_id="ACF88518.1"
FT                   /translation="MQLHQQKGMISLSPPTICNSAGPSTWSISAGWSAISASRRGPALR
FT                   PKPASNRTLVIRRRQVEAYPNLMSDAMCKLRQDRIEF"
FT   gene            50555..51259
FT                   /locus_tag="SeSA_B0055"
FT   CDS_pept        50555..51259
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeSA_B0055"
FT                   /product="IS26 transposase"
FT                   /note="identified by match to protein family HMM PF00665"
FT                   /db_xref="EnsemblGenomes-Gn:SeSA_B0055"
FT                   /db_xref="EnsemblGenomes-Tr:ACF88568"
FT                   /db_xref="GOA:A0A0N1QKX5"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR032874"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0N1QKX5"
FT                   /protein_id="ACF88568.1"
FT                   /translation="MNPFKGRHFQRDIILWAVRWYCKYGISYRELQEMLAERGVNVDHS
FT                   TIYRWVQRYAPEMEKRLRWYWRNPSDLCPWHMDETYVKVNGRWAYLYRAVDSRGRTVDF
FT                   YLSSRRNSKAAYRFLGKILNNVKKWQIPRFINTDKAPAYGRALALLKREGRCPSDVEHR
FT                   QIKYRNNVIECDHGKLKRIINATLGFKSMKTAYATIKGIEVMRALRKGQASAFYYGDPL
FT                   GEMRLVSRVFEM"
FT   gene            51299..51571
FT                   /locus_tag="SeSA_B0056"
FT   CDS_pept        51299..51571
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeSA_B0056"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:SeSA_B0056"
FT                   /db_xref="EnsemblGenomes-Tr:ACF88549"
FT                   /db_xref="GOA:A0A0U1RFB7"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RFB7"
FT                   /protein_id="ACF88549.1"
FT                   /translation="MQQCPFMNVPVMAYVQESIAPEMMGKVFSLLMTAMTLSMPIGLLV
FT                   AGPVVEVIGVNTWFFWSGVALIVNAVLCRILTRRYDKVTMKPQVD"
FT   gene            51717..52580
FT                   /locus_tag="SeSA_B0057"
FT   CDS_pept        51717..52580
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeSA_B0057"
FT                   /product="short chain dehydrogenase"
FT                   /note="identified by match to protein family HMM PF00106;
FT                   match to protein family HMM PF08659"
FT                   /db_xref="EnsemblGenomes-Gn:SeSA_B0057"
FT                   /db_xref="EnsemblGenomes-Tr:ACF88540"
FT                   /db_xref="GOA:A0A0U1RFB1"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RFB1"
FT                   /protein_id="ACF88540.1"
FT                   /translation="MIPNSENKRVWFITGASKGLGYAFTCAALKAGDKVVAVARTIDNL
FT                   AKLEETYQESLLPLNLDVTDREAVFSTVETAVKHFGRLDIVVNNAGIMTMGMIEELNES
FT                   DARKLMDTNFFGALWVCQAVMPYLRSQRSGHIIQITSIGAIISGPMSGIYSASKFALEG
FT                   MSEALAKEAEHFGVKLTMVEPGGYWTDLYTSMSYSNPLDSYGTLRDELAKQYSEDSVDS
FT                   DPSLAAEALMKLVASNNPPLRLILGSMVYDLAMDTLKARMATWEEWEAVSRASEKAIPA
FT                   PERYGV"
FT   gene            complement(52549..52725)
FT                   /locus_tag="SeSA_B0058"
FT   CDS_pept        complement(52549..52725)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeSA_B0058"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SeSA_B0058"
FT                   /db_xref="EnsemblGenomes-Tr:ACF88572"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RFD4"
FT                   /protein_id="ACF88572.1"
FT                   /translation="MFNGYGMRTEKMEQFYFLFFKILCPIRVIFHNFNFHDSFVLASKT
FT                   MFGIILHISPVQE"
FT   gene            53014..53241
FT                   /locus_tag="SeSA_B0059"
FT   CDS_pept        53014..53241
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeSA_B0059"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SeSA_B0059"
FT                   /db_xref="EnsemblGenomes-Tr:ACF88565"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RFD1"
FT                   /protein_id="ACF88565.1"
FT                   /translation="MFELCRINANQGLTAEIDWNYTSWSRRCRKILIGLVVRGAKTVVV
FT                   RGKNRILTQNREKLEMTVPISFHNELKQKN"
FT   gene            53332..54123
FT                   /gene="folP"
FT                   /locus_tag="SeSA_B0060"
FT   CDS_pept        53332..54123
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folP"
FT                   /locus_tag="SeSA_B0060"
FT                   /product="dihydropteroate synthase"
FT                   /EC_number="2.5.1.15"
FT                   /note="identified by match to protein family HMM PF00809;
FT                   match to protein family HMM TIGR01496"
FT                   /db_xref="EnsemblGenomes-Gn:SeSA_B0060"
FT                   /db_xref="EnsemblGenomes-Tr:ACF88502"
FT                   /db_xref="GOA:A0A0U1RF84"
FT                   /db_xref="InterPro:IPR000489"
FT                   /db_xref="InterPro:IPR006390"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RF84"
FT                   /protein_id="ACF88502.1"
FT                   /translation="MSKIFGIVNITTDSFSDGGLYLDTDKAIEHALHLVEDGADVIDLG
FT                   AASSNPDTTEVGVVEEIKRLKPVIKALKEKGISISVDTFKPEVQSFCIEQKVDFINDIQ
FT                   GFPYPEIYSGLAKSDCKLVLMHSVQRIGAATKVETNPEEVFTSMMEFFKERIAALVEAG
FT                   VKRERIILDPGMGFFLGSNPETSILVLKRFPEIQEAFNLQVMIAVSRKSFLGKITGTDV
FT                   KSRLAPTLAAEMYAYKKGADYLRTHDVKSLSDALKISKALG"
FT   gene            54373..55056
FT                   /locus_tag="SeSA_B0061"
FT   CDS_pept        54373..55056
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeSA_B0061"
FT                   /product="transposase, Mutator family"
FT                   /note="identified by match to protein family HMM PF00872"
FT                   /db_xref="EnsemblGenomes-Gn:SeSA_B0061"
FT                   /db_xref="EnsemblGenomes-Tr:ACF88570"
FT                   /db_xref="GOA:A0A0U1RFD3"
FT                   /db_xref="InterPro:IPR001207"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RFD3"
FT                   /protein_id="ACF88570.1"
FT                   /translation="MVNPNNPIFNLATGKVLLKVPQVRGMEFYPSCIEKGMRSERALKL
FT                   AIAEMYVKGVSTRRVSDIVEILCGTEVSSSQVSRLAKELDEEITSWKAQPVGQIQYLVL
FT                   DATYESVRVGSHVVKQALLVAIGVDYSGNRHILDAEVANSEAEVNWRSFLEGLVRRGMH
FT                   GLRMITSDDHSGLRAAIDAVFPGILWQRCQFHLQQNAHSYVTKKDEIPLIAADIRKVFN
FT                   RNMSR"
FT   gene            complement(55303..55635)
FT                   /locus_tag="SeSA_B0062"
FT   CDS_pept        complement(55303..55635)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeSA_B0062"
FT                   /product="quaternary ammonium compound-resistance protein
FT                   QacE"
FT                   /note="identified by match to protein family HMM PF00893"
FT                   /db_xref="EnsemblGenomes-Gn:SeSA_B0062"
FT                   /db_xref="EnsemblGenomes-Tr:ACF88532"
FT                   /db_xref="GOA:A0A0U1RFA5"
FT                   /db_xref="InterPro:IPR000390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RFA5"
FT                   /protein_id="ACF88532.1"
FT                   /translation="MKNWLFLAIAIFGEVVATSALKSSHGFTKLVPSVVVVAGYGLAFY
FT                   FLSLALKSIPVGIAYAVWAGLGIVLVAAIAWIFHGQKLDLWAFVGMGLIVSGVAVLNLL
FT                   SKVSAH"
FT   gene            complement(55805..56596)
FT                   /locus_tag="SeSA_B0063"
FT   CDS_pept        complement(55805..56596)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeSA_B0063"
FT                   /product="streptomycin 3''-adenylyltransferase"
FT                   /EC_number="2.7.7.47"
FT                   /note="identified by match to protein family HMM PF01909"
FT                   /db_xref="EnsemblGenomes-Gn:SeSA_B0063"
FT                   /db_xref="EnsemblGenomes-Tr:ACF88584"
FT                   /db_xref="GOA:A0A0U1RFE4"
FT                   /db_xref="InterPro:IPR002934"
FT                   /db_xref="InterPro:IPR024172"
FT                   /db_xref="InterPro:IPR025184"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RFE4"
FT                   /protein_id="ACF88584.1"
FT                   /translation="MREAVIAEVSTQLSEVVGVIERHLEPTLLAVHLYGSAVDGGLKPH
FT                   SDIDLLVTVTVRLDETTRRALINDLLETSASPGESEILRAVEVTIVVHDDIIPWRYPAK
FT                   RELQFGEWQRNDILAGIFEPATIDIDLAILLTKAREHSVALVGPAAEELFDPVPEQDLF
FT                   EALNETLTLWNSPPDWAGDERNVVLTLSRIWYSAVTGKIAPKDVAADWAMERLPAQYQP
FT                   VILEARQAYLGQEEDRLASRADQLEEFVHYVKGEITKVVGK"
FT   gene            complement(56689..57948)
FT                   /locus_tag="SeSA_B0064"
FT   CDS_pept        complement(56689..57948)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeSA_B0064"
FT                   /product="chloramphenicol resistance protein"
FT                   /note="identified by match to protein family HMM PF07690;
FT                   match to protein family HMM TIGR00710; match to protein
FT                   family HMM TIGR00880"
FT                   /db_xref="EnsemblGenomes-Gn:SeSA_B0064"
FT                   /db_xref="EnsemblGenomes-Tr:ACF88516"
FT                   /db_xref="GOA:A0A0U1RF95"
FT                   /db_xref="InterPro:IPR004812"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RF95"
FT                   /protein_id="ACF88516.1"
FT                   /translation="MSSKNFSWRYSLAATVLLLSPFDLLASLGMDMYLPAVPFMPNALG
FT                   TTASTIQLTLTTYLVMIGAGQLLFGPLSDRLGRRPVLLGGGLAYVVASMGLALTSSAEV
FT                   FLGLRILQACGASACLVSTFATVRDIYAGREESNVIYGILGSMLAMVPAVGPLLGALVD
FT                   MWLGWRAIFAFLGLGMIAASAAAWRFWPETRVQRVAGLQWSQLLLPVKCLNFWLYTLCY
FT                   AAGMGSFFVFFSIAPGLMMGRQGVSQLGFSLLFATVAIAMVFTARFMGRVIPKWGSPSV
FT                   LRMGMGCLIAGAVLLAITEIWALQSVLGFIAPMWLVGIGVATAVSVAPNGALRGFDHVA
FT                   GTVTAVYFCLGGVLLGSIGTLIISLLPRNTAWPVVVYCLTLATVVLGLSCVSRVKGSRG
FT                   QGEHDVVALQSAESTSNPNR"
FT   gene            complement(58210..59001)
FT                   /gene="aadA"
FT                   /locus_tag="SeSA_B0065"
FT   CDS_pept        complement(58210..59001)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aadA"
FT                   /locus_tag="SeSA_B0065"
FT                   /product="aminoglycoside adenylyltransferase"
FT                   /note="identified by match to protein family HMM PF01909"
FT                   /db_xref="EnsemblGenomes-Gn:SeSA_B0065"
FT                   /db_xref="EnsemblGenomes-Tr:ACF88590"
FT                   /db_xref="GOA:A0A0N1QRW6"
FT                   /db_xref="InterPro:IPR002934"
FT                   /db_xref="InterPro:IPR024172"
FT                   /db_xref="InterPro:IPR025184"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0N1QRW6"
FT                   /protein_id="ACF88590.1"
FT                   /translation="MRVAVTIEISNQLSEVLSVIERHLESTLLAVHLYGSAVDGGLKPY
FT                   SDIDLLVTVAVKLDETTRRALLNDLMEASAFPGESETLRAIEVTLVVHDDIIPWRYPAK
FT                   RELQFGEWQRNDILAGIFEPAMIDIDLAILLTKAREHSVALVGPAAEEFFDPVPEQDLF
FT                   EALRETLKLWNSQPDWAGDERNVVLTLSRIWYSAITGKIAPKDVAADWAIKRLPAQYQP
FT                   VLLEAKQAYLGQKEDHLASRADHLEEFIRFVKGEIIKSVGK"
FT   gene            complement(59059..59667)
FT                   /locus_tag="SeSA_B0066"
FT   CDS_pept        complement(59059..59667)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeSA_B0066"
FT                   /product="HAD-superfamily, subfamily IB hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:SeSA_B0066"
FT                   /db_xref="EnsemblGenomes-Tr:ACF88617"
FT                   /db_xref="GOA:A0A0N1QRY8"
FT                   /db_xref="InterPro:IPR006385"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0N1QRY8"
FT                   /protein_id="ACF88617.1"
FT                   /translation="MSLALFDFDGTITTRETMPDFVRRSVSRRRLLVGQLLLAPLVLGY
FT                   KIGILSGTLIRRVIVRFAYSGIPASVLEAQGRDFAQSYLPNTLRGEAMQRIAWHKAQGH
FT                   KVVVVSGGLEAYLEPWCDSHGVELICSSLQQSDGILTGRYEGRQCVLTEKARLVRERYD
FT                   LATYPTIYAYGDTPEDLDMLAIATKQYYQWQEVGVAGGR"
FT   gene            complement(59763..60773)
FT                   /gene="sat"
FT                   /locus_tag="SeSA_B0068"
FT   CDS_pept        complement(59763..60773)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sat"
FT                   /locus_tag="SeSA_B0068"
FT                   /product="streptothricin acetyltransferase Sat-1"
FT                   /note="identified by match to protein family HMM PF00561"
FT                   /db_xref="EnsemblGenomes-Gn:SeSA_B0068"
FT                   /db_xref="EnsemblGenomes-Tr:ACF88528"
FT                   /db_xref="GOA:A0A0N1QRV8"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0N1QRV8"
FT                   /protein_id="ACF88528.1"
FT                   /translation="MACYDCFFVQSMPRASKQQARYAVGRCLMLWSSNDVTQQGSRPKT
FT                   KLYVELEGNLSMKEKVVVDKAISLYTESFGDPAHEPIILIMGAMSSAVWWPDEFCSQLA
FT                   KMGRYVIRYDHRDTGKSTSYEPGQAPYSVEELADDVVRVIDGYGLEAAHLVGMSLGGFL
FT                   SQLVALKYPKRVKSLTLIASERLADADPDMPAFDPAIIEYHQRAESLDWSDRDAVVAYQ
FT                   VGAWRINSGTAHAFDAEKIQNIAELNFDRTPNILTTFNHTTLGGGERWLGRLNEIAVPT
FT                   LIIHGTEDPVLPYVHGLALKDAIRGSKMLTLEGTGHELHHEDWPRIIQAIKGQTS"
FT   gene            60772..61785
FT                   /locus_tag="SeSA_B0067"
FT   CDS_pept        60772..61785
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeSA_B0067"
FT                   /product="integrase/recombinase"
FT                   /note="identified by match to protein family HMM PF00589;
FT                   match to protein family HMM PF02899; match to protein
FT                   family HMM TIGR02249"
FT                   /db_xref="EnsemblGenomes-Gn:SeSA_B0067"
FT                   /db_xref="EnsemblGenomes-Tr:ACF88579"
FT                   /db_xref="GOA:A0A0U1RFD9"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR011946"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RFD9"
FT                   /protein_id="ACF88579.1"
FT                   /translation="MKTATAPLPPLRSVKVLDQLRERIRYLHYSLRTEQAYVHWVRAFI
FT                   RFHGVRHPATLGSSEVEAFLSWLANERKVSVSTHRQALAALLFFYGKVLCTDLPWLQEI
FT                   GRPRPSRRLPVVLTPDEVVRILGFLEGEHRLFAQLLYGTGMRISEGLQLRVKDLDFDHG
FT                   TIIVREGKGSKDRALMLPESLAPSLREQLSRARAWWLKDQAEGRSGVALPDALERKYPR
FT                   AGHSWPWFWVFAQHTHSTDPRSGVVRRHHMYDQTFQRAFKRAVEQAGITKPATPHTLRH
FT                   SFATALLRSGYDIRTVQDLLGHSDVSTTMIYTHVLKVGGAGVRSPLDALPPLTSER"
FT   gene            complement(61744..61923)
FT                   /locus_tag="SeSA_B0069"
FT   CDS_pept        complement(61744..61923)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeSA_B0069"
FT                   /product="putative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:SeSA_B0069"
FT                   /db_xref="EnsemblGenomes-Tr:ACF88571"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0N1QI80"
FT                   /protein_id="ACF88571.1"
FT                   /translation="MDPSGNDGLLPAISGRREDFPQPAVRCGTDGLRAGVVNPPGLTCA
FT                   ALPLTSEGRQRIKR"
FT   gene            complement(62277..62981)
FT                   /locus_tag="SeSA_B0070"
FT   CDS_pept        complement(62277..62981)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeSA_B0070"
FT                   /product="IS26 transposase"
FT                   /note="identified by match to protein family HMM PF00665"
FT                   /db_xref="EnsemblGenomes-Gn:SeSA_B0070"
FT                   /db_xref="EnsemblGenomes-Tr:ACF88530"
FT                   /db_xref="GOA:A0A0N1QKX5"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR032874"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0N1QKX5"
FT                   /protein_id="ACF88530.1"
FT                   /translation="MNPFKGRHFQRDIILWAVRWYCKYGISYRELQEMLAERGVNVDHS
FT                   TIYRWVQRYAPEMEKRLRWYWRNPSDLCPWHMDETYVKVNGRWAYLYRAVDSRGRTVDF
FT                   YLSSRRNSKAAYRFLGKILNNVKKWQIPRFINTDKAPAYGRALALLKREGRCPSDVEHR
FT                   QIKYRNNVIECDHGKLKRIINATLGFKSMKTAYATIKGIEVMRALRKGQASAFYYGDPL
FT                   GEMRLVSRVFEM"
FT   gene            complement(62993..63667)
FT                   /locus_tag="SeSA_B0071"
FT   CDS_pept        complement(62993..63667)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeSA_B0071"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:SeSA_B0071"
FT                   /db_xref="EnsemblGenomes-Tr:ACF88576"
FT                   /db_xref="InterPro:IPR032874"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RFD8"
FT                   /protein_id="ACF88576.1"
FT                   /translation="MILNTIAEKLKRQSKDDFKGRHFEAWLIVQAVAWYLRYPLSYRDL
FT                   EEMFRERGFEVDHSTINRWVLAYAPVIEKRLRQFRRPHCGSVRIDETYVKIRGKWRYLY
FT                   RAIDKHGNPVDFLLTAKRDLDAAKRFFRKMLKDEPLLSPNRIGTDGANTFPSTIKTSVD
FT                   DGLLHPDPVHYVTKHLQQGIESDHFRVKKNMPKIGGFQSFNTARRALLQIVGGDKLIIP
FT                   FC"
FT   gene            63612..65252
FT                   /locus_tag="SeSA_B0072"
FT   CDS_pept        63612..65252
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeSA_B0072"
FT                   /product="transposase"
FT                   /note="identified by match to protein family HMM PF01526"
FT                   /db_xref="EnsemblGenomes-Gn:SeSA_B0072"
FT                   /db_xref="EnsemblGenomes-Tr:ACF88517"
FT                   /db_xref="GOA:A0A0N1QRW0"
FT                   /db_xref="InterPro:IPR002513"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0N1QRW0"
FT                   /protein_id="ACF88517.1"
FT                   /translation="MKSSFDWRFSFSAMVFKIIGSLRNIRSGNFSPHGQHRVNLKNLRQ
FT                   GHAFRSGDVWLTRSRRYGDLKHALVPAQSIAEGGRLAVPLRPEEWLADRQARLDMRLRE
FT                   LGRAARAGTIPGGSIENGVLHIEKLEAAAPTGAEDLVLDLYKQIPPTRITDLLLEVDAA
FT                   TGFTEAFTHLRTGAPCADRIGLMNVILAEGINLGLRKMADATNTHTFWELIRIGRWHVE
FT                   GEAYDRALAMVVEAQAALPMARFWGMGTSASSDGQFFVATEQGEAMNLVNAKYGNTPGL
FT                   KAYSHVSDQYAPFATQVIPATASEAPYILDGLLMNDAGRHIREQFTDTGGFTDHVFAAC
FT                   AILGYRFAPRIRDLPSKRLYAFNPSAAPAHLRALIGGKVNQAMIERNWPDILRIAATIA
FT                   AGTVAPSQILRKLASYPRQNELATALREVGRVERTLFMIDWILDAELQRRAQIGLNKGE
FT                   AHHALKRAISFHRRGEIRDRSAEGQHYRIAGMNLLAAIIIFWNTMKLGEVVANQKRDGK
FT                   LLSPDLLAHVSPLGWEHINLTGEYRWPKP"
FT   gene            complement(65318..65737)
FT                   /locus_tag="SeSA_B0074"
FT   CDS_pept        complement(65318..65737)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeSA_B0074"
FT                   /product="TraB protein"
FT                   /db_xref="EnsemblGenomes-Gn:SeSA_B0074"
FT                   /db_xref="EnsemblGenomes-Tr:ACF88600"
FT                   /db_xref="InterPro:IPR040782"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0N1QRX7"
FT                   /protein_id="ACF88600.1"
FT                   /translation="MPEGSRKVCVLNGSRQLDQVVKGEWMTIKVLPENGLPKGIYQLAE
FT                   ATKPDTGKDGKESAYTGQVLHVDSKAVYQLSGKGIVEHSRSAFADLEAKGDQIVAGRTY
FT                   TVGYVNGKGTARPGQAASLAQQQQRSASKGGGISL"
FT   gene            65718..65846
FT                   /locus_tag="SeSA_B0073"
FT   CDS_pept        65718..65846
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeSA_B0073"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SeSA_B0073"
FT                   /db_xref="EnsemblGenomes-Tr:ACF88539"
FT                   /db_xref="GOA:A0A0U1RFB0"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RFB0"
FT                   /protein_id="ACF88539.1"
FT                   /translation="MREPSGIIFGAGPVGFRLLGVLAIRFVLLSIAVKKAAANGRR"
FT   gene            complement(65850..66422)
FT                   /locus_tag="SeSA_B0075"
FT   CDS_pept        complement(65850..66422)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeSA_B0075"
FT                   /product="conjugal transfer protein TrbI"
FT                   /note="identified by match to protein family HMM PF03743"
FT                   /db_xref="EnsemblGenomes-Gn:SeSA_B0075"
FT                   /db_xref="EnsemblGenomes-Tr:ACF88598"
FT                   /db_xref="InterPro:IPR005498"
FT                   /db_xref="InterPro:IPR042217"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0N1QRX3"
FT                   /protein_id="ACF88598.1"
FT                   /translation="MMISGINSDLPGQIIGQVREAVYDSATSTQCLIPPGSRLVGTYDS
FT                   GVTLGQQRALAVWRRIIYPDGSSISIDNMPGADVGGYAGFNDKVNNHYLRIFGSGLLLS
FT                   VFSAGIQLSQPQASNGENYSSSQIIAGSLGQQMGQIGMQMAQRNMNIQPTLEIRPGYEF
FT                   NIMVTKDIILPTWEGHPMAGSTGKGCN"
FT   gene            complement(66574..67278)
FT                   /locus_tag="SeSA_B0076"
FT   CDS_pept        complement(66574..67278)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeSA_B0076"
FT                   /product="IS26 transposase"
FT                   /note="identified by match to protein family HMM PF00665"
FT                   /db_xref="EnsemblGenomes-Gn:SeSA_B0076"
FT                   /db_xref="EnsemblGenomes-Tr:ACF88585"
FT                   /db_xref="GOA:A0A0N1QLE1"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR032874"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0N1QLE1"
FT                   /protein_id="ACF88585.1"
FT                   /translation="MNPFKGRHFQRDIILWAVRWYCKYGISYRELQEMLAERGVNVDHS
FT                   TIYRWVQRYAPEMEKRLRWYWRNPSDLCPWHMDETYVKVNGRWAYLYRAVDSRGRTVDF
FT                   YLSSRRNSKAAYRFLGKILNNVKKWQIPRFINTDKAPAYGRALALLKREGRCPSDVEHR
FT                   QIKYRNNVIECDHGKLKRIIGATLGFKSMKTAYATIKGIEVMRALRKGQASAFYYGDPL
FT                   GEMRLVSRVFEM"
FT   gene            67375..67554
FT                   /locus_tag="SeSA_B0077"
FT   CDS_pept        67375..67554
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeSA_B0077"
FT                   /product="replication initiator protein"
FT                   /db_xref="EnsemblGenomes-Gn:SeSA_B0077"
FT                   /db_xref="EnsemblGenomes-Tr:ACF88527"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0N1QRV5"
FT                   /protein_id="ACF88527.1"
FT                   /translation="MGSCAAPSAKGDDKFITTDYLQQCQISCQLKLIRFTGESAIAFSL
FT                   LSGQKVNGHIGLPA"
FT   gene            complement(68170..68874)
FT                   /locus_tag="SeSA_B0078"
FT   CDS_pept        complement(68170..68874)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeSA_B0078"
FT                   /product="IS26 transposase"
FT                   /note="identified by match to protein family HMM PF00665"
FT                   /db_xref="EnsemblGenomes-Gn:SeSA_B0078"
FT                   /db_xref="EnsemblGenomes-Tr:ACF88504"
FT                   /db_xref="GOA:A0A0N1QKX5"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR032874"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0N1QKX5"
FT                   /protein_id="ACF88504.1"
FT                   /translation="MNPFKGRHFQRDIILWAVRWYCKYGISYRELQEMLAERGVNVDHS
FT                   TIYRWVQRYAPEMEKRLRWYWRNPSDLCPWHMDETYVKVNGRWAYLYRAVDSRGRTVDF
FT                   YLSSRRNSKAAYRFLGKILNNVKKWQIPRFINTDKAPAYGRALALLKREGRCPSDVEHR
FT                   QIKYRNNVIECDHGKLKRIINATLGFKSMKTAYATIKGIEVMRALRKGQASAFYYGDPL
FT                   GEMRLVSRVFEM"
FT   gene            68933..70240
FT                   /locus_tag="SeSA_B0079"
FT   CDS_pept        68933..70240
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeSA_B0079"
FT                   /product="transposase"
FT                   /note="identified by match to protein family HMM PF01526"
FT                   /db_xref="EnsemblGenomes-Gn:SeSA_B0079"
FT                   /db_xref="EnsemblGenomes-Tr:ACF88550"
FT                   /db_xref="GOA:A0A0U1RFB8"
FT                   /db_xref="InterPro:IPR002513"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RFB8"
FT                   /protein_id="ACF88550.1"
FT                   /translation="MPKRLSKMISDLLPPVDLTELLLEINAHTGFADEFFHASEASARV
FT                   DDLPVSISAVLMAEACNIGLEPLIRSNVPALTRHRLNWTKANYLRAETITSANARLVDF
FT                   QATLPLAQIWGGGEVASADGMRFVTPVRTINAGPNRKYFGNNRGITWYNFVSDQYSGFH
FT                   GIVIPGTLRDSIFVLEGLLEQETGLNPTEIMTDTAGASELVFGLFWLLGYQFSPRLADA
FT                   GASVFWRMDHDADYGVLNDIARGQSDPRKIVLQWDEMIRTAGSLKLGKVQVSVLVRSLL
FT                   KSERPSGLTQAIIEVGRINKTLYLLNYIDDEDYRRRILTQLNRGESRHAVARAICHGQK
FT                   GEIRKRYTDGQEDQLGTLGLVTNAVVLWNTIYMQAALDHLRAQGETLNDEDIARLSPLC
FT                   HGHINMLGHYSFTLAELVTKGHLRPLKEASEAENVA"
FT   gene            complement(70314..70775)
FT                   /locus_tag="SeSA_B0080"
FT   CDS_pept        complement(70314..70775)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeSA_B0080"
FT                   /product="mercuric resistance protein MerC"
FT                   /note="identified by match to protein family HMM PF03203"
FT                   /db_xref="EnsemblGenomes-Gn:SeSA_B0080"
FT                   /db_xref="EnsemblGenomes-Tr:ACF88507"
FT                   /db_xref="GOA:A0A0N1QRU8"
FT                   /db_xref="InterPro:IPR004891"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0N1QRU8"
FT                   /protein_id="ACF88507.1"
FT                   /translation="MSQQANDNSESRFMGLMTRIADKTGALGSVVSAMGCAACFPALAS
FT                   FGAAIGLGFLSQYEGLFISRLLPLFAALAFLANALGWFSHRQWLRSLLGMIGPAIVFAA
FT                   TVWLLGNWWTANLMYVGLALMIGVSIWDFVSPAHRRCGPDGCELPAKRL"
FT   gene            complement(70772..71047)
FT                   /gene="merP"
FT                   /locus_tag="SeSA_B0081"
FT   CDS_pept        complement(70772..71047)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="merP"
FT                   /locus_tag="SeSA_B0081"
FT                   /product="mercuric transport protein periplasmic component"
FT                   /note="identified by match to protein family HMM PF00403;
FT                   match to protein family HMM TIGR02052"
FT                   /db_xref="EnsemblGenomes-Gn:SeSA_B0081"
FT                   /db_xref="EnsemblGenomes-Tr:ACF88580"
FT                   /db_xref="GOA:A0A0U1RFE0"
FT                   /db_xref="InterPro:IPR001802"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR011795"
FT                   /db_xref="InterPro:IPR017969"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RFE0"
FT                   /protein_id="ACF88580.1"
FT                   /translation="MKKLFASLALAAAVAPVWAATQTVTLAVPGMTCAACPITVKKALS
FT                   KVEGVSKVDVGFEKREAVVTFDDTKASVQKLTKATADAGYPSSVKQ"
FT   gene            complement(71061..71411)
FT                   /locus_tag="SeSA_B0082"
FT   CDS_pept        complement(71061..71411)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeSA_B0082"
FT                   /product="mercuric transport protein"
FT                   /note="identified by match to protein family HMM PF02411"
FT                   /db_xref="EnsemblGenomes-Gn:SeSA_B0082"
FT                   /db_xref="EnsemblGenomes-Tr:ACF88520"
FT                   /db_xref="GOA:A0A0U1RF97"
FT                   /db_xref="InterPro:IPR003457"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RF97"
FT                   /protein_id="ACF88520.1"
FT                   /translation="MSEPQNGRGALFAGGLAAILASTCCLGPLVLVALGFSGAWIGNLT
FT                   VLEPYRPLFIGAALVALFFAWKRIYRPVQACKPGEVCAIPQVRATYKLIFWIVAVLVLV
FT                   ALGFPYVVPFFY"
FT   gene            71483..71917
FT                   /gene="merR"
FT                   /locus_tag="SeSA_B0083"
FT   CDS_pept        71483..71917
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="merR"
FT                   /locus_tag="SeSA_B0083"
FT                   /product="Hg(II)-responsive transcriptional regulator"
FT                   /note="identified by match to protein family HMM PF00376;
FT                   match to protein family HMM PF09278; match to protein
FT                   family HMM TIGR02051"
FT                   /db_xref="EnsemblGenomes-Gn:SeSA_B0083"
FT                   /db_xref="EnsemblGenomes-Tr:ACF88533"
FT                   /db_xref="GOA:A0A0U1RFA6"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR011794"
FT                   /db_xref="InterPro:IPR015358"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RFA6"
FT                   /protein_id="ACF88533.1"
FT                   /translation="MENNLENLTIGVFAKAAGVNVETIRFYQRKGLLREPDKPYGSIRR
FT                   YGEADVVRVKFVKSAQRLGFSLDEIAELLRLDDGTHCEEASSLAEHKLKDVREKMADLA
FT                   RMETVLSELVCACHARKGNVSCPLIASLQGEAGLARSAMP"
FT   gene            complement(71907..72689)
FT                   /locus_tag="SeSA_B0084"
FT   CDS_pept        complement(71907..72689)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeSA_B0084"
FT                   /product="streptomycin phosphotransferase B"
FT                   /note="identified by match to protein family HMM PF04655"
FT                   /db_xref="EnsemblGenomes-Gn:SeSA_B0084"
FT                   /db_xref="EnsemblGenomes-Tr:ACF88601"
FT                   /db_xref="GOA:A0A0N1QRY1"
FT                   /db_xref="InterPro:IPR006748"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0N1QRY1"
FT                   /protein_id="ACF88601.1"
FT                   /translation="MFMPPVFPAHWHVSQPVLIADTFSSLVWKVSLPDGTPAIVKGLKP
FT                   IEDIADELRGADYLVWRNGRGAVRLLGRENNLMLLEYAGERMLSHIVAEHGDYQATEIA
FT                   AELMAKLYAASEEPLPSALLPIRDRFAALFQRARDDQNAGCQTDYVHAAIIADQMMSNA
FT                   SELRGLHGDLHHENIMFSSRGWLVIDPVGLVGEVGFGAANMFYDPADRDDLCLDPRRIA
FT                   QMADAFSRALDVDPRRLLDQAYAYGGHLRKRKIKHAKA"
FT   gene            complement(72689..73678)
FT                   /gene="strA"
FT                   /locus_tag="SeSA_B0085"
FT   CDS_pept        complement(72689..73678)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="strA"
FT                   /locus_tag="SeSA_B0085"
FT                   /product="aminoglycoside resistance protein A"
FT                   /note="identified by match to protein family HMM PF01636"
FT                   /db_xref="EnsemblGenomes-Gn:SeSA_B0085"
FT                   /db_xref="EnsemblGenomes-Tr:ACF88500"
FT                   /db_xref="GOA:A0A0U1RF82"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR024165"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RF82"
FT                   /protein_id="ACF88500.1"
FT                   /translation="MAFIIHAEDIQHSAGNRRWHLRKKPLKMRDRPEHNRCKSIATRFF
FT                   SQVEPPPRFIRKLKEPPLNRTNIFFGESHSDWLPVRGGESGDFVFRRGDGHAFAKIAPA
FT                   SRRGELAGERDRLIWLKGRGVACPEVINWQEEQEGACLVITAIPGVPAADLSGADLLKA
FT                   WPSMGQQLGAVHSLSVDQCPFERRLSRMFGRAVDVVSRNAVNPDFLPDEDKSTPQLDLL
FT                   ARVERELPVRLDQERTDMVVCHGDPCMPNFMVDPKTLQCTGLIDLGRLGTADRYADLAL
FT                   MIANAEENWAAPDEAERAFAVLFNVLGIEAPDRERLAFYLRLDPLTWG"
FT   gene            complement(73906..74547)
FT                   /locus_tag="SeSA_B0086"
FT   CDS_pept        complement(73906..74547)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeSA_B0086"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SeSA_B0086"
FT                   /db_xref="EnsemblGenomes-Tr:ACF88557"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0N1QRW9"
FT                   /protein_id="ACF88557.1"
FT                   /translation="MTEIIKDLYQFTEVMEPIKLSMHQYLLMTNEPVLIQTGAVSQAQT
FT                   TIPKLQELLGERKIKYILISHFESDECGGLALVLKEHPEAVAVCSETTARQLMGFGITN
FT                   NVLIKKPNEIFAGDDFEFQTISYPSEMHMWEGLLFFEKKRGIFFSSDLMFGMGENHGQV
FT                   IESSWDAAVKSSGADTLPNQESGQKLSSDLSEIEPKFVASGHGFCITIVG"
FT   gene            complement(74760..75005)
FT                   /pseudo
FT                   /locus_tag="SeSA_B0087"
FT                   /note="IS1 transposase orfB; this gene contains a frame
FT                   shift which may be the result of sequencing error;
FT                   identified by match to protein family HMM PF03400"
FT   gene            complement(75182..75457)
FT                   /pseudo
FT                   /locus_tag="SeSA_B0088"
FT                   /note="IS1, transposase orfA; this gene contains a frame
FT                   shift which may be the result of sequencing error;
FT                   identified by match to protein family HMM PF03811"
FT   gene            complement(75588..75764)
FT                   /locus_tag="SeSA_B0089"
FT   CDS_pept        complement(75588..75764)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeSA_B0089"
FT                   /product="phage integrase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SeSA_B0089"
FT                   /db_xref="EnsemblGenomes-Tr:ACF88560"
FT                   /db_xref="InterPro:IPR038488"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RFC6"
FT                   /protein_id="ACF88560.1"
FT                   /translation="MLTDTKLRNLKPRDKLYKVNDREGLYVGVASENGIYGHSRFCNTD
FT                   FDDKLACLNLSGV"
FT   gene            76091..76906
FT                   /gene="sul2"
FT                   /locus_tag="SeSA_B0090"
FT   CDS_pept        76091..76906
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sul2"
FT                   /locus_tag="SeSA_B0090"
FT                   /product="dihydropteroate synthase type-2"
FT                   /EC_number="2.5.1.15"
FT                   /note="identified by match to protein family HMM PF00809;
FT                   match to protein family HMM TIGR01496"
FT                   /db_xref="EnsemblGenomes-Gn:SeSA_B0090"
FT                   /db_xref="EnsemblGenomes-Tr:ACF88618"
FT                   /db_xref="GOA:A0A0N1QRY9"
FT                   /db_xref="InterPro:IPR000489"
FT                   /db_xref="InterPro:IPR006390"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0N1QRY9"
FT                   /protein_id="ACF88618.1"
FT                   /translation="MNKSLIIFGIVNITSDSFSDGGRYLAPDAAIAQARKLMAEGADVI
FT                   DLGPASSNPDAAPVSSDTEIARIAPVLDALKADGIPVSLDSYQPATQAYALSRGVAYLN
FT                   DIRGFPDAAFYPQLAKSSAKLVVMHSVQDGQADRREAPAGDIMDHIAAFFDARIAALTG
FT                   AGIKRNRLVLDPGMGFFLGAAPETSLSVLARFDELRLRFDLPVLLSVSRKSFLRALTGR
FT                   GPGDVGAATLAAELAAAAGGADFIRTHEPRPLRDGLAVLAALKETARIR"
FT   gene            76993..77295
FT                   /locus_tag="SeSA_B0091"
FT   CDS_pept        76993..77295
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeSA_B0091"
FT                   /product="phosphoglucosamine mutase"
FT                   /EC_number="5.4.2.10"
FT                   /note="identified by match to protein family HMM PF02878"
FT                   /db_xref="EnsemblGenomes-Gn:SeSA_B0091"
FT                   /db_xref="EnsemblGenomes-Tr:ACF88538"
FT                   /db_xref="GOA:A0A0N1QRV4"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0N1QRV4"
FT                   /protein_id="ACF88538.1"
FT                   /translation="MVRKYFGTDGIRGKANEGAMTAETALRVGMAAGRVFRRGDHRHRV
FT                   VIGKDTRLSGYMLEPALTAGFTSMGMDVFLFGPLPTTYRKNKRPFHPSPTALDRS"
FT   gene            complement(77471..78964)
FT                   /locus_tag="SeSA_B0092"
FT   CDS_pept        complement(77471..78964)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeSA_B0092"
FT                   /product="iscr2 transposase"
FT                   /note="identified by match to protein family HMM PF04986"
FT                   /db_xref="EnsemblGenomes-Gn:SeSA_B0092"
FT                   /db_xref="EnsemblGenomes-Tr:ACF88578"
FT                   /db_xref="GOA:A0A0N1QRW2"
FT                   /db_xref="InterPro:IPR007069"
FT                   /db_xref="InterPro:IPR026889"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0N1QRW2"
FT                   /protein_id="ACF88578.1"
FT                   /translation="MPHVAARTASRDRDTGRYQSHRPEQTLLYQIVDEYYPAFAALMAE
FT                   QGKELPGYVQREFEEFLQCGRLEHGFLRVRCESCHAEHLVAFSCKRRGFCPSCGARRMA
FT                   ESAALLVDEVLPEQPMRQWVLSFPFQLRFLFASRPEIMGWVLGIVYRVIATHLVKKAGH
FT                   THQVAKTGAVTLIQRFGSALNLNVHFHMLFLDGVYVEQSHGSARFRWVKAPTSPELTQL
FT                   THTIAHRVGRYLERQGLLERDVENSYLASDAVDDDPMTPLLGHSITYRIAVGSQAGRKV
FT                   FTLQTLPTSGDPFGDGIGKVAGSSLHAGVAARADERKKLERLCRYISRPAVSEKRLSLT
FT                   RGGNVRYQLKTPYRDGTTHVIFEPLDFIARLAALVPKPRVNLTRFHGVFAPNSRHRALV
FT                   TPAKRGRGNKVRVADEPATPAQRRASMTWAQRLKRVFNIDIETCSGCGGAMKVIACIED
FT                   PIVIKQILDHLKHKAETSGTRALPESRAPPAELLLGLFD"
FT   gene            complement(79175..79399)
FT                   /pseudo
FT                   /locus_tag="SeSA_B0093"
FT                   /note="conserved hypothetical protein; this gene contains a
FT                   frame shift which may be the result of sequencing error"
FT   gene            complement(79396..80133)
FT                   /locus_tag="SeSA_B0094"
FT   CDS_pept        complement(79396..80133)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeSA_B0094"
FT                   /product="resolvase"
FT                   /note="identified by match to protein family HMM PF00239;
FT                   match to protein family HMM PF02796"
FT                   /db_xref="EnsemblGenomes-Gn:SeSA_B0094"
FT                   /db_xref="EnsemblGenomes-Tr:ACF88588"
FT                   /db_xref="GOA:A0A0N1QRW1"
FT                   /db_xref="InterPro:IPR006118"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR006120"
FT                   /db_xref="InterPro:IPR036162"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0N1QRW1"
FT                   /protein_id="ACF88588.1"
FT                   /translation="MRRTKPVAAPMVARVYLRVSTDAQDLERQEAITTAAKAAGYYVAG
FT                   IYREKASGARADRPELLRMIGDLQPGEVVIAEKIDRISRLPLPEAERLVASIQAKGASL
FT                   AVPGVVDLSDLAAEAQGVAKIVLEAVQIMLFRLALQMARDDYEDRRERQRQGIELARQA
FT                   GRYKGRRADPKRRAQVVALRKSGYSINKTAELAGYSAAQVKRIWAEVSQAEAKQHGAFV
FT                   EDALTEADALAAVGQDERQEERA"
FT   gene            complement(80619..80759)
FT                   /locus_tag="SeSA_B0095"
FT   CDS_pept        complement(80619..80759)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeSA_B0095"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SeSA_B0095"
FT                   /db_xref="EnsemblGenomes-Tr:ACF88552"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RFC0"
FT                   /protein_id="ACF88552.1"
FT                   /translation="MNKTKGCLIANFATVPRDEQQHQEQKHVEKKQQQIEQRPRRAARI
FT                   G"
FT   gene            complement(80765..81469)
FT                   /locus_tag="SeSA_B0096"
FT   CDS_pept        complement(80765..81469)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeSA_B0096"
FT                   /product="IS26 transposase"
FT                   /note="identified by match to protein family HMM PF00665"
FT                   /db_xref="EnsemblGenomes-Gn:SeSA_B0096"
FT                   /db_xref="EnsemblGenomes-Tr:ACF88566"
FT                   /db_xref="GOA:A0A0N1QLE1"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR032874"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0N1QLE1"
FT                   /protein_id="ACF88566.1"
FT                   /translation="MNPFKGRHFQRDIILWAVRWYCKYGISYRELQEMLAERGVNVDHS
FT                   TIYRWVQRYAPEMEKRLRWYWRNPSDLCPWHMDETYVKVNGRWAYLYRAVDSRGRTVDF
FT                   YLSSRRNSKAAYRFLGKILNNVKKWQIPRFINTDKAPAYGRALALLKREGRCPSDVEHR
FT                   QIKYRNNVIECDHGKLKRIIGATLGFKSMKTAYATIKGIEVMRALRKGQASAFYYGDPL
FT                   GEMRLVSRVFEM"
FT   gene            81549..82049
FT                   /locus_tag="SeSA_B0097"
FT   CDS_pept        81549..82049
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeSA_B0097"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SeSA_B0097"
FT                   /db_xref="EnsemblGenomes-Tr:ACF88537"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0N1QRV9"
FT                   /protein_id="ACF88537.1"
FT                   /translation="MRLQQWATENIKKLLYLAGDDAVINYGKMRLEFLQKALAQDTSGD
FT                   FCFRVLHPEVSGPPDMKKASAGYRDFIIGNRALLDLVNSAGEGAPVAHYSADEIQSLFS
FT                   AQIQGSVDKYGDSFLTDDPYVLAEDKLQTCQMEIDLMADVLRAPPRESAELIRYVFADE
FT                   WPE"
FT   gene            82199..82840
FT                   /gene="cmlA"
FT                   /locus_tag="SeSA_B0098"
FT   CDS_pept        82199..82840
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cmlA"
FT                   /locus_tag="SeSA_B0098"
FT                   /product="chloramphenicol acetyltransferase 2"
FT                   /EC_number="2.3.1.28"
FT                   /note="identified by match to protein family HMM PF00302"
FT                   /db_xref="EnsemblGenomes-Gn:SeSA_B0098"
FT                   /db_xref="EnsemblGenomes-Tr:ACF88519"
FT                   /db_xref="GOA:A0A0U1RF96"
FT                   /db_xref="InterPro:IPR001707"
FT                   /db_xref="InterPro:IPR018372"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RF96"
FT                   /protein_id="ACF88519.1"
FT                   /translation="MNFTRIDLNTWNRREHFALYRQQIKCGFSLTTKLDITALRTALAK
FT                   TGYKFYPLMIYLISRAVNQFPEFRMAMKDNELIYWEQSDPVFTVFHKETETFSALSCRY
FT                   FPDLSEFMAGYNAVTAEYQHDTRLFPQGNLPENHLNISSLPWVSFDGFNLNITGNDDYF
FT                   SPVFTMAKFQQEGDRVLLPVSVQVHHAVCDGFHAARFINTLQLMCDNILK"
FT   gene            complement(82984..83688)
FT                   /locus_tag="SeSA_B0099"
FT   CDS_pept        complement(82984..83688)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeSA_B0099"
FT                   /product="IS26 transposase"
FT                   /note="identified by match to protein family HMM PF00665"
FT                   /db_xref="EnsemblGenomes-Gn:SeSA_B0099"
FT                   /db_xref="EnsemblGenomes-Tr:ACF88615"
FT                   /db_xref="GOA:A0A0N1QLE1"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR032874"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0N1QLE1"
FT                   /protein_id="ACF88615.1"
FT                   /translation="MNPFKGRHFQRDIILWAVRWYCKYGISYRELQEMLAERGVNVDHS
FT                   TIYRWVQRYAPEMEKRLRWYWRNPSDLCPWHMDETYVKVNGRWAYLYRAVDSRGRTVDF
FT                   YLSSRRNSKAAYRFLGKILNNVKKWQIPRFINTDKAPAYGRALALLKREGRCPSDVEHR
FT                   QIKYRNNVIECDHGKLKRIIGATLGFKSMKTAYATIKGIEVMRALRKGQASAFYYGDPL
FT                   GEMRLVSRVFEM"
FT   gene            complement(83905..85623)
FT                   /locus_tag="SeSA_B0100"
FT   CDS_pept        complement(83905..85623)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeSA_B0100"
FT                   /product="histidine kinase"
FT                   /note="identified by match to protein family HMM PF00072;
FT                   match to protein family HMM PF00512; match to protein
FT                   family HMM PF02518"
FT                   /db_xref="EnsemblGenomes-Gn:SeSA_B0100"
FT                   /db_xref="EnsemblGenomes-Tr:ACF88514"
FT                   /db_xref="GOA:A0A0U1RF93"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RF93"
FT                   /protein_id="ACF88514.1"
FT                   /translation="MKKNFFIILVALLLLIAFTVSSVVKYTSLLSEKNLYTVAGTQENY
FT                   GFSVAKFIIQLNELYTLINSDNTIDDVRLKFDILYSRLNVIYVKSEATAPLYKQQGYEE
FT                   TIDSINKKLEDIDGLLSHNHPDYKKISTIIADIKPLTKTVTNLADMAEIAQRNDALKDF
FT                   RSKRQQLWTLLFITGGLISLLLFVLFIYISKINRLLLSERAAFASKNAFLGMVGHELRT
FT                   SLQAIVSIIDVVTNNLSGGIKSGQIERLETAVSKMERQLNDLAEFAKIDNGSVEIKNTY
FT                   NSLQAIVTNAVQDCIAIYEKKDVTVKIKNNNDAVIFTDALRLNQVIENLTSNAIKYTER
FT                   GEVNVDYFIEKGKVLNIVISDTGKGIPKDKLKFIFKPFTRVVDSKSTVPGFGMGLAIVA
FT                   GIIRLLKGTIHISSEVNVGTTVTVRIPIKLGDSSLATAEVSASAPGDVFGVLSLLVIDD
FT                   NEMACSSLSSLLTNAGYIVEATTSPERALEKLLRKPYDVVLSDLQMPGMTGDELYATVS
FT                   SSQNPNRSTPFIFISAYSDAHSIGQAPLLTKPVRLKDINLKIHEVMSNQGRVKSE"
FT   gene            complement(85620..86108)
FT                   /locus_tag="SeSA_B0101"
FT   CDS_pept        complement(85620..86108)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeSA_B0101"
FT                   /product="oxidoreductase molybdopterin binding"
FT                   /db_xref="EnsemblGenomes-Gn:SeSA_B0101"
FT                   /db_xref="EnsemblGenomes-Tr:ACF88574"
FT                   /db_xref="GOA:A0A0U1RFD6"
FT                   /db_xref="InterPro:IPR000572"
FT                   /db_xref="InterPro:IPR036374"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RFD6"
FT                   /protein_id="ACF88574.1"
FT                   /translation="MVKIISFLSLMLLSISAYSNIGDIVIDGSIANANSDKGYVITEKQ
FT                   FDSFPRDTIVTTTPWTPTGKKVKFKGVDLSYVLKLAGANGAKLKFHALNDYEIIVDMND
FT                   VEKYNILLATEMDGKRLQIRDFGPYFLVYPLDEHYIELNTPHYLARFIWQIDKITVLK"
FT   gene            complement(86101..87054)
FT                   /locus_tag="SeSA_B0102"
FT   CDS_pept        complement(86101..87054)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeSA_B0102"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SeSA_B0102"
FT                   /db_xref="EnsemblGenomes-Tr:ACF88558"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0N1QRW4"
FT                   /protein_id="ACF88558.1"
FT                   /translation="MISNDSLIVAPYDYQKLSYENILPLNNGLIKNWNIQKFSSDYSEI
FT                   EHLNVINGMGVTLGDSIVGISVLSAIKKKNPKIKIKLIRPETAPSYVEELYELASSVID
FT                   ELHYMPFHIQKLPCTALNIDVGNQLYSPDFHIMEMHDYFIQGLGVKLDDVNHNELSNKW
FT                   LGNIDLGAPVFENYTLFAPIASTKIRSIPSKFYYDIVDMLSRREGKTVLGFVDVNHKNY
FT                   INISKYSPHTKDFIALIKYASNVYTCDSSALHIAAGFGVPTECVFNTIPPELRTKYYSK
FT                   CKSIYVGNKRLEKIQSSEDFQLVKMVENNYREYLYG"
FT   gene            complement(87088..88002)
FT                   /locus_tag="SeSA_B0103"
FT   CDS_pept        complement(87088..88002)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeSA_B0103"
FT                   /product="response regulator receiver protein"
FT                   /note="identified by match to protein family HMM PF00072;
FT                   match to protein family HMM PF08667"
FT                   /db_xref="EnsemblGenomes-Gn:SeSA_B0103"
FT                   /db_xref="EnsemblGenomes-Tr:ACF88586"
FT                   /db_xref="GOA:A0A0U1RFE5"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR013975"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RFE5"
FT                   /protein_id="ACF88586.1"
FT                   /translation="MLEMFEKIEKKYWQDKIKKISKFRVIKMQDLDDAKVIEVLAKVLT
FT                   KKGISKVKHNSYISKVLQITTSAGYKKLNGATKWEVQQLIKVVQSVGMDMIEFFRIYYE
FT                   DNKEIQDAIWNDGRSEHSCKVCLYPEGSEVNTEYSALKVADQWNIFPTNDLKDELLYES
FT                   KRSIESIVINPKVISSTKYRIALLDDDANITESLKEILSNDYYQVDTYDNLKKLTQAVA
FT                   TNPYDAYVLDWIIGDETSFKLVKAIRSSKNKNAMIIVLTGQLSGIKDDEIVKSIHDYDI
FT                   VGPYEKPIKSGIIKSNIEKYFAR"
FT   gene            88316..88624
FT                   /locus_tag="SeSA_B0104"
FT   CDS_pept        88316..88624
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeSA_B0104"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SeSA_B0104"
FT                   /db_xref="EnsemblGenomes-Tr:ACF88512"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RF91"
FT                   /protein_id="ACF88512.1"
FT                   /translation="MSMQTVRRKALRQNPYSTLGKPPLRSSRDRITRAINGTWSLRELP
FT                   DNVRELLIERAALRAEITTLTVKAQGLKKSDVSVLIADRLRRIDAITSLLENRKCNA"
FT   gene            88617..88832
FT                   /locus_tag="SeSA_B0105"
FT   CDS_pept        88617..88832
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeSA_B0105"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SeSA_B0105"
FT                   /db_xref="EnsemblGenomes-Tr:ACF88524"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RFA0"
FT                   /protein_id="ACF88524.1"
FT                   /translation="MPDITPAPASLLEAVFTPMTEYTHNVYSVKGDRLAMTLTKIGVAQ
FT                   ANSQGDIQLFINPDCATGKVLLYRKD"
FT   gene            88835..89497
FT                   /locus_tag="SeSA_B0106"
FT   CDS_pept        88835..89497
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeSA_B0106"
FT                   /product="type IV secretory pathway VirB1 component"
FT                   /note="identified by match to protein family HMM PF01464"
FT                   /db_xref="EnsemblGenomes-Gn:SeSA_B0106"
FT                   /db_xref="EnsemblGenomes-Tr:ACF88562"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RFC8"
FT                   /protein_id="ACF88562.1"
FT                   /translation="MLTTAALFQLAMQCAPAVHPDTIHDITRTESGLNPYAIAEIVPVK
FT                   GGRSRVISHLPSSKDEALKIVEAIKQKKHRYSVGLMQITSTNFPQFGVSAESMFNPCDN
FT                   MTVAAKIITDCYQRGGTLQRALSCYYSGNFETGQRPESAFGNTSYVQRIGYVVPSTRAE
FT                   QQTASPSSGEAPAVPSDNTVYPDSVIRGVIPAPDTTPTSIAAYPPHVVRGGLAVSSD"
FT   gene            89508..89807
FT                   /locus_tag="SeSA_B0107"
FT   CDS_pept        89508..89807
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeSA_B0107"
FT                   /product="conjugal transfer protein TrbC"
FT                   /note="identified by match to protein family HMM PF04956"
FT                   /db_xref="EnsemblGenomes-Gn:SeSA_B0107"
FT                   /db_xref="EnsemblGenomes-Tr:ACF88606"
FT                   /db_xref="GOA:A0A0N1QRY2"
FT                   /db_xref="InterPro:IPR007039"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0N1QRY2"
FT                   /protein_id="ACF88606.1"
FT                   /translation="MTLRTIKTAATRLIAAFSALSAVPAMAASADQAFQKGSDAINWVF
FT                   LGLTGMSVVTISCAVAFIAYKMLVDGKAWHDLQRVFWAGVLLAGASGFGAYFAA"
FT   gene            89817..92567
FT                   /locus_tag="SeSA_B0108"
FT   CDS_pept        89817..92567
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeSA_B0108"
FT                   /product="TriC protein"
FT                   /note="identified by match to protein family HMM PF03135;
FT                   match to protein family HMM PF05101"
FT                   /db_xref="EnsemblGenomes-Gn:SeSA_B0108"
FT                   /db_xref="EnsemblGenomes-Tr:ACF88543"
FT                   /db_xref="GOA:A0A0U1RFB3"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR007792"
FT                   /db_xref="InterPro:IPR018145"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RFB3"
FT                   /protein_id="ACF88543.1"
FT                   /translation="MTILNKALTRPAALWGVPLVPLLFTLCILTLAAVWSRFYWLLLLL
FT                   IPAFIELRRLAKEDIHFFDLKLLAFKTRGNRAATRHFGTKALVANQYDAIDVTEFIKHM
FT                   RLNESIPLSRYLPWSSHLHEQVVKNKKGDFVSTWEIGGIIFECEDEHYLATLDMQLNNV
FT                   IRSFEGLPVTFYTHLVSDEFTDTLECESGIPFSDEIARLFYASREGKPFYQRRLFFTVC
FT                   FNPHTGIERATMKQKSLGERKTLLDNALQVMQEHRQAIGTALSRYAARPLGTYEENGHV
FT                   FSSQLAFYNFLITGRWQKVRVTRTPFYDVLGGTDIFPSTDIGQVSHTDGQSYFRGLEIK
FT                   DYSTETITGLYDSLLYARCRYLFTQSYTCMGKDEARGCIRTIEKRLKSAEDDAISQQED
FT                   LKVARDMLQSGIISFGKYHQTLIVSAPTSEQVIRDTNTLADTLKDLGFIMTLSRESLSA
FT                   AYLAQLPGVYHLRPRLVPVSSLNYAEMVSFHNFHPHKRDGNAWGEAIAVVPTPSGGCQY
FT                   VNLHNSQADVDEFSEKPPGNTMLLGSTGTGKSTLLMMFQHLMQKYRRPESFAPGATKKR
FT                   FTSVVFDKDRSAEMSIRLQGGSYFRFRSGEKTGLNPFALAPTKRNRNFLKKLMRMMCTR
FT                   DGKPLDPRDEERLSEAVDTIMLDYPPELRRNGITRMLEVLHEAPTKDARMNGLRIRLQQ
FT                   WAQGGEFGWVFDNDVDTFDIDNIDNFGIDGTEFLNDKDVRSPLTFYLLYRVTSLLDGRR
FT                   LVIFMDEFWKWLQDPEFSKFALDMLKVIRKLNGIFFPATQSPEEMCKHEISAAIIEQCS
FT                   TRIFMANQQAKEYDYVDMLRVPKAVYDIVTTLDPYARQMVIMKSPLRRGDVRPYIAQIT
FT                   LDLSGLGRYTKLLSASADNLKIFDEIWQEGMKPEDWKDEMLRRAV"
FT   gene            92586..93302
FT                   /locus_tag="SeSA_B0109"
FT   CDS_pept        92586..93302
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeSA_B0109"
FT                   /product="TriD protein"
FT                   /note="identified by match to protein family HMM PF07996"
FT                   /db_xref="EnsemblGenomes-Gn:SeSA_B0109"
FT                   /db_xref="EnsemblGenomes-Tr:ACF88587"
FT                   /db_xref="InterPro:IPR014158"
FT                   /db_xref="InterPro:IPR023220"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0N1QRW7"
FT                   /protein_id="ACF88587.1"
FT                   /translation="MKLKTTLTALTVALCLFHVPAQAGIPVFDEVANASNIQQWAEKLQ
FT                   QWQQTVQHYQSQMNAYKQQLATATGIRDVQAFLNQAKNLTADIKNLKNRGISLNDLLTG
FT                   SGGSYAGELNRLYDKYKLFDNCPENASEAYRDSCKQMLLNQAVSVEDTSDIQEKISDTL
FT                   SDISNLASRIENAKDSKESQDLANVVSARSIQLNALTTQWEMSVKQSEMRNQLLAEQRR
FT                   KAQAEQMRTAPIADLN"
FT   gene            93314..93598
FT                   /locus_tag="SeSA_B0110"
FT   CDS_pept        93314..93598
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeSA_B0110"
FT                   /product="putative entry exclusion protein"
FT                   /db_xref="EnsemblGenomes-Gn:SeSA_B0110"
FT                   /db_xref="EnsemblGenomes-Tr:ACF88523"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RF99"
FT                   /protein_id="ACF88523.1"
FT                   /translation="MKLKTLTFIVLASVAALTGCEDKTSVDWYMAHHDDMLAKYRECIF
FT                   NHNFVPTDCQNARSALHREKAKPDVAEGYKQILKDLDKARVQEPIADLN"
FT   gene            93616..94623
FT                   /locus_tag="SeSA_B0111"
FT   CDS_pept        93616..94623
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeSA_B0111"
FT                   /product="TriE protein"
FT                   /note="identified by match to protein family HMM PF04610"
FT                   /db_xref="EnsemblGenomes-Gn:SeSA_B0111"
FT                   /db_xref="EnsemblGenomes-Tr:ACF88595"
FT                   /db_xref="GOA:A0A0N1QRX5"
FT                   /db_xref="InterPro:IPR007688"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0N1QRX5"
FT                   /protein_id="ACF88595.1"
FT                   /translation="MSGIFVGLNSHIMEGFDSVLTSVAADTGGWMAHLFSVAVLSLYIT
FT                   WRAYQTMAGKLVRPFEEIVWDVSRMLIIMIFVTNAGGYLDLVSDAITGLRDGFSGDASI
FT                   WARLDTVWEKAQALGEKLYSYDDSTYVALKGTLAQFLVWAGVMLLVGITAIINLIAELV
FT                   MLLMLATAPIFIYCLMWSWFRDMFSNWLRIILGCILTSLFSGIALTVVMDYLDYILAGA
FT                   TKASDANYLTLAVQVFLGTAGAAAVMVLTYKLAEALAGASAQGAAQALAASGVGSARQS
FT                   ASSAAGAVGDKASQNLNSTGSATASSASTASRATGDARSRSRAAVQRMQERYQR"
FT   gene            94700..94840
FT                   /locus_tag="SeSA_B0112"
FT   CDS_pept        94700..94840
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeSA_B0112"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:SeSA_B0112"
FT                   /db_xref="EnsemblGenomes-Tr:ACF88535"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RFA8"
FT                   /protein_id="ACF88535.1"
FT                   /translation="MKYGITLLMLCLLAGCAQRNTQLPPVSGNPEPVNSPAIIQELTPH
FT                   V"
FT   gene            94833..95519
FT                   /locus_tag="SeSA_B0113"
FT   CDS_pept        94833..95519
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeSA_B0113"
FT                   /product="TriG protein"
FT                   /note="identified by match to protein family HMM PF04335"
FT                   /db_xref="EnsemblGenomes-Gn:SeSA_B0113"
FT                   /db_xref="EnsemblGenomes-Tr:ACF88620"
FT                   /db_xref="GOA:A0A0N1QRZ2"
FT                   /db_xref="InterPro:IPR007430"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0N1QRZ2"
FT                   /protein_id="ACF88620.1"
FT                   /translation="MSELTAKALSDSRSFENAILERDMRMKKAGWIVAALAGLLLVFAL
FT                   AALILLLPLKTTTVELYTLDRQTGRIERVTTVGEDKLDTSEVLNLSQTASYVKRREGYN
FT                   YFALQQDYRETQMFNSDEVNKEYLDWFNSPDAPDAVFQQAAYVVTVEVLSNVPSEGTGS
FT                   SMVEMLRIKRTIRKVKDNTETYDYWTVRMTYRYFPQKKMTASEREVNPFGFIVTSYQRF
FT                   KEKSDE"
FT   gene            95512..96405
FT                   /gene="virB9"
FT                   /locus_tag="SeSA_B0114"
FT   CDS_pept        95512..96405
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="virB9"
FT                   /locus_tag="SeSA_B0114"
FT                   /product="P-type conjugative transfer protein VirB9"
FT                   /note="identified by match to protein family HMM PF03524;
FT                   match to protein family HMM TIGR02781"
FT                   /db_xref="EnsemblGenomes-Gn:SeSA_B0114"
FT                   /db_xref="EnsemblGenomes-Tr:ACF88554"
FT                   /db_xref="InterPro:IPR010258"
FT                   /db_xref="InterPro:IPR014148"
FT                   /db_xref="InterPro:IPR033645"
FT                   /db_xref="InterPro:IPR038161"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RFC2"
FT                   /protein_id="ACF88554.1"
FT                   /translation="MNKVLMCALLLTAASAWGAATPRGSAYDSRMQNIPYNSQNTTVIN
FT                   TRAGYITTLVFDADEEVITATAGFPQGWTITPDRNRVGISPAPVKQPVTDADGKTVQKI
FT                   FTPTQQDWQTNLFVTTTKRDYSLMLNVIDNDREAGNLAFVVRFSYPDDTRRQNDAARLA
FT                   RQQELQAAQEKERIQFALKKSTAPRNWNYTRRVAAGSESITPDFAYDDGRFTYLGFSPQ
FT                   KLIPSPTVIVGGSEQVITPTFSTEGNYRVMVLRSLSPRFVLRYGSQVVGIENGSYGKVT
FT                   VANGSTVSPDVKLESK"
FT   gene            96402..97598
FT                   /locus_tag="SeSA_B0115"
FT   CDS_pept        96402..97598
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeSA_B0115"
FT                   /product="TriI protein"
FT                   /note="identified by match to protein family HMM PF03743"
FT                   /db_xref="EnsemblGenomes-Gn:SeSA_B0115"
FT                   /db_xref="EnsemblGenomes-Tr:ACF88612"
FT                   /db_xref="GOA:A0A0N1QRZ6"
FT                   /db_xref="InterPro:IPR005498"
FT                   /db_xref="InterPro:IPR042217"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0N1QRZ6"
FT                   /protein_id="ACF88612.1"
FT                   /translation="MMNEQEDIKTAAELEAEARERARAEIDGDKPAAGAVPPGQPQVVQ
FT                   HAKRRSRRSLVLAAISLVLLVIIATGGDYLMAKLKGDGSGKSASHEPESHATSPARERN
FT                   NLGRDLNPLGQLADTTGQEKTTPTDTAAPPQASPPPLTFDKVSALADSAPTTASSAPKS
FT                   TSSSNVSPAGSASAPGSATPAGQSQDNGLARITGVKRLGLDPDLYIPADRHIPCAMMQR
FT                   FVSDVGGRFNCLISEDIYSASNAVRLIPAGTEARGLYRTGTLKNGQGRLFLAITELRTP
FT                   EPGRLVIPMVDSQAVGALGENGVAGWIDNHWLERIGNTLLLGTVQDFAAAASGSSPGKD
FT                   RNTDYTENTRAATAEMAKTLLENSINIPPTMYLNQGDVIGLVTGADIDFSDVYRLRMR"
FT   gene            97602..98651
FT                   /gene="virB1"
FT                   /locus_tag="SeSA_B0116"
FT   CDS_pept        97602..98651
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="virB1"
FT                   /locus_tag="SeSA_B0116"
FT                   /product="P-type DNA transfer ATPase VirB11"
FT                   /note="identified by match to protein family HMM PF00437;
FT                   match to protein family HMM TIGR02788"
FT                   /db_xref="EnsemblGenomes-Gn:SeSA_B0116"
FT                   /db_xref="EnsemblGenomes-Tr:ACF88525"
FT                   /db_xref="GOA:A0A0U1RFA1"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR014155"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RFA1"
FT                   /protein_id="ACF88525.1"
FT                   /translation="MDDKLTDTPSEGNVALSHLRDLLFGDYLSREGLTEIAINRPGELH
FT                   TKINGAWEMHASPVTLRQCSSFARALAVWNNDTIDETSPILSATLPTGERCQIVVPPAC
FT                   ERNTISITLRKPDYFQRTHQSYIDAGFYDRVQGTEKVESKDGELSRIYLSGNIPLFMEK
FT                   CVEYGKTLFVVGETGSGKTTYMKMLLHYIPETLRLITIEDNPELKFYSQKNYVHLFYPA
FT                   DAGEGAIVTSDRLVRAIYRMNPDRPLLAEVRGREAWDALKLIESGHEGFMSSLHAGSPR
FT                   ECISGLIDRCYEHPACRGMPVDVLLRKVLHCVDVIVSVDVHGNVRRMSDVYFKPLHMQA
FT                   MKESFNDAA"
FT   gene            98638..99039
FT                   /locus_tag="SeSA_B0117"
FT   CDS_pept        98638..99039
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeSA_B0117"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SeSA_B0117"
FT                   /db_xref="EnsemblGenomes-Tr:ACF88536"
FT                   /db_xref="InterPro:IPR025264"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RFA9"
FT                   /protein_id="ACF88536.1"
FT                   /translation="MMLPKLTGLTAIVVLLAGCSSPPEPAAVDWSQPAQPVTTTRPVWE
FT                   PNRLIVASPVTEGHWSQVLTRFEPGGIYPAAQWYAVAHASRAVVNAPDGQRFFAAKTWL
FT                   REGGYKGVVEFRPRSGCLTCDTSEIVFYR"
FT   gene            99130..99447
FT                   /locus_tag="SeSA_B0118"
FT   CDS_pept        99130..99447
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeSA_B0118"
FT                   /product="killer protein"
FT                   /db_xref="EnsemblGenomes-Gn:SeSA_B0118"
FT                   /db_xref="EnsemblGenomes-Tr:ACF88591"
FT                   /db_xref="InterPro:IPR009989"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0N1QRX0"
FT                   /protein_id="ACF88591.1"
FT                   /translation="MKHTVITAALLCALTSPAFAADGQNADPNDPCAMVLCLAGKLDGS
FT                   SPAECDPMYKNFMSIKKKKKGSFLPDHTAAARQKKLSACPSADSAIVGKIISKFGRMNG
FT                   W"
FT   gene            99474..99809
FT                   /locus_tag="SeSA_B0119"
FT   CDS_pept        99474..99809
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeSA_B0119"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SeSA_B0119"
FT                   /db_xref="EnsemblGenomes-Tr:ACF88594"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0N1U6T2"
FT                   /protein_id="ACF88594.1"
FT                   /translation="MINQTVSINNFSGLLKDEELPAGDLQTVLLVLSEISQKQDHFQAN
FT                   TSELVQLAAQHSPTFQALPAERQSFFRSVLSMPVFFYTVPLSDDEAAEWEKLNDKDALQ
FT                   WQQKPDL"
FT   gene            99827..100093
FT                   /locus_tag="SeSA_B0120"
FT   CDS_pept        99827..100093
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeSA_B0120"
FT                   /product="hypothetical plasmid protein"
FT                   /db_xref="EnsemblGenomes-Gn:SeSA_B0120"
FT                   /db_xref="EnsemblGenomes-Tr:ACF88513"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RF92"
FT                   /protein_id="ACF88513.1"
FT                   /translation="MRGDSVSAASLISRIEKEAHRGCGLHYEIYQYRALCELHDVLTSL
FT                   SVRDAETFMTVAADHGFSLSDNDFQESRMMYFETMDEIRRDQE"
FT   gene            100090..102291
FT                   /locus_tag="SeSA_B0121"
FT   CDS_pept        100090..102291
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeSA_B0121"
FT                   /product="DNA topoisomerase 3"
FT                   /EC_number="5.99.1.2"
FT                   /note="identified by match to protein family HMM PF01131;
FT                   match to protein family HMM PF01751"
FT                   /db_xref="EnsemblGenomes-Gn:SeSA_B0121"
FT                   /db_xref="EnsemblGenomes-Tr:ACF88569"
FT                   /db_xref="GOA:A0A0U1RFD2"
FT                   /db_xref="InterPro:IPR000380"
FT                   /db_xref="InterPro:IPR003601"
FT                   /db_xref="InterPro:IPR003602"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR013497"
FT                   /db_xref="InterPro:IPR013824"
FT                   /db_xref="InterPro:IPR013825"
FT                   /db_xref="InterPro:IPR013826"
FT                   /db_xref="InterPro:IPR023405"
FT                   /db_xref="InterPro:IPR025589"
FT                   /db_xref="InterPro:IPR034144"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RFD2"
FT                   /protein_id="ACF88569.1"
FT                   /translation="MRLWIAEKPAVASDIAKALGGNFTRHDGYAESATDIVSYCVGHVL
FT                   EMVPPETINPAYATWSLDTLPLKLYPVQLQPKASVAKQANTLVKLIRRPDIKMVVHCGD
FT                   PDDEGQLLVDEVLEFAGNTAPVKRALINDNTAPAVKKAINSLRDNSDFRGMYLKALMRS
FT                   AGDAIFGFSMSRCYTLKARDKGYKGTISVGRVQTPVLGMIVRRWRDNQAHSEAFYYQLA
FT                   GQFISGTDVVCARWQTSEYAPVDDKKRLTDKAWGEGLARALAGKPASVLAAATDRGKTT
FT                   AAPLPFNLLRLQVYMNRRHKLTAQQTLDITQKLKDSKYITYNRSDCSYLSDEQFNDAPQ
FT                   VVAALKTLDVFNGLTTDTAQKSAAFDSKKVTAHTAIIPTTNMPDLSRLTDKEKAVYLTI
FT                   AQFYLAQFVAKKRYDESIAEIKCGDEMFKVSARKITDAGFTTFLNDAEEDDEEDENSTS
FT                   FEAISRLQTGATLTCREVVISEKKTKPLPLFTEATLLAALVRVADFVADPRIKKLLKEK
FT                   DKDKKDEHGGIGTPATRAAIIETLKTRDYITVEKGKFIPTAAGLALIDALPDSVTQPDM
FT                   TAVWAEKQAAVETGEMTIERFIDGLYAEVSRLVESADIAISATEKHPVKTALNRLAVKC
FT                   PSCGSELVMTPKTCACTGCQFKIWLEVRGKKLTEKQAEKLIGKGKTDVIKGFKSKKNDD
FT                   TYSMIVTLKNAQTGELGFEYPPRDPLKGLNVSMPKELKL"
FT   gene            102288..102680
FT                   /locus_tag="SeSA_B0122"
FT   CDS_pept        102288..102680
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeSA_B0122"
FT                   /product="DNA binding protein"
FT                   /note="identified by match to protein family HMM PF00816"
FT                   /db_xref="EnsemblGenomes-Gn:SeSA_B0122"
FT                   /db_xref="EnsemblGenomes-Tr:ACF88499"
FT                   /db_xref="GOA:A0A0U1RF81"
FT                   /db_xref="InterPro:IPR001801"
FT                   /db_xref="InterPro:IPR027444"
FT                   /db_xref="InterPro:IPR027454"
FT                   /db_xref="InterPro:IPR037150"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RF81"
FT                   /protein_id="ACF88499.1"
FT                   /translation="MNRIQDELTSERALKKFLRESDFAFLEMLSARISAALDEKRAEHI
FT                   EQEKLRRQREEKRNELLALIESEGFSPTELVSTTPAKKSAKRKAKYQYFENGVHKKWSG
FT                   VGRVPVVIQQELDAGKPLESFLITTD"
FT   gene            102750..102875
FT                   /locus_tag="SeSA_B0123"
FT   CDS_pept        102750..102875
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeSA_B0123"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SeSA_B0123"
FT                   /db_xref="EnsemblGenomes-Tr:ACF88567"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0N1QRW8"
FT                   /protein_id="ACF88567.1"
FT                   /translation="MKKLLIDRPPESAKWQEASKFNFEEIANLRRRFHFLSAHPK"
FT   gene            103389..105296
FT                   /locus_tag="SeSA_B0124"
FT   CDS_pept        103389..105296
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeSA_B0124"
FT                   /product="mobilization protein"
FT                   /db_xref="EnsemblGenomes-Gn:SeSA_B0124"
FT                   /db_xref="EnsemblGenomes-Tr:ACF88503"
FT                   /db_xref="GOA:A0A0U1RF85"
FT                   /db_xref="InterPro:IPR016387"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032689"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RF85"
FT                   /protein_id="ACF88503.1"
FT                   /translation="MIFDKLNHLLSPIANAVLAFIAFLQAHQLALALLSGVMLPFIFSA
FT                   KHGGQEKPTFLQRILILLSMICFVFGSIAPVAVWFLQRIYGREDIASPPLLTWTMALLF
FT                   TVAGFILHVVLRRLISPEFDKVKCGMVKKTSMERDRRTDVRRVKEILPVTTEYDPMDYI
FT                   DLNKGIFIGLSREGEPQYIPLKEWQTQHADIIGTTGAGKGVVTGILLYQSILADEGVFV
FT                   LDPKNDEWAPHLYKKACADAGKPFVLIDLNKQEYQMNLIDGITADHLEELFVAGFSLAE
FT                   KGEAADFYRIDDRKAARTAAQFVKDNPGATVRDIYNGDYVQGIGETIKAFHGKTEELAM
FT                   LNSINAPGGFALKEIFDKGGCCYIIGSMRNSKIITAQRMILVRLFQLAELRDRVAGNIR
FT                   PIAIFKDEVKYHLSKPALEGLGAARDKGVHILMAHQSIADLRDCPADLNGDAVVGAVVE
FT                   NCKFKLVYKLQDPDTAEWIARMSGTILVDDESRKVTTTAVLTEKVDNERMLRQAESYYI
FT                   DSNMLQNLPKFVSYIFSQNALAFPSLISPLKVKKAPLELFTLPPVAVATVAEVKPVLDL
FT                   DFDKTAPAVPAPDIIPVSATTTKKPSATPIPTPPVQPDEEWLMASQPAPNDEIHSLLDL
FT                   "
FT   gene            105311..106057
FT                   /locus_tag="SeSA_B0125"
FT   CDS_pept        105311..106057
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeSA_B0125"
FT                   /product="mobilization protein"
FT                   /db_xref="EnsemblGenomes-Gn:SeSA_B0125"
FT                   /db_xref="EnsemblGenomes-Tr:ACF88564"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RFD0"
FT                   /protein_id="ACF88564.1"
FT                   /translation="MLISSYQERYARSTEKIRVLLNFLKEETYSDFQIIKLLFDFKSDR
FT                   PLYRLLEKVEKMGLIQKHVHESRASRISLWGITTDGLAVILTADDNIMPARFEPYRLTG
FT                   WSLDHHLDNQLVRLTLEKNGATGWINGDRSTFLSQYSVKHRPDGLISLPDGRLIAVETE
FT                   RRIKTKARYQSIMASHLLAISDKKWRYAFYVAPDEAKKRALKIIFDSIASVIVKNQHVQ
FT                   LEAKHRDVFRFYTLDELKNLELDNYA"
FT   gene            106050..106577
FT                   /locus_tag="SeSA_B0126"
FT   CDS_pept        106050..106577
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeSA_B0126"
FT                   /product="phospholipase D (PLD) family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SeSA_B0126"
FT                   /db_xref="EnsemblGenomes-Tr:ACF88508"
FT                   /db_xref="GOA:A0A0N1QRU7"
FT                   /db_xref="InterPro:IPR001736"
FT                   /db_xref="InterPro:IPR025202"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0N1QRU7"
FT                   /protein_id="ACF88508.1"
FT                   /translation="MRKTTLLVLAAALCVPAFATAAPVLTAGFSPSDGRPALEIVLGAI
FT                   NNARQSIDVAAYSFTSKPVATALAGANRRGVAVRVVADEKANSDRYTAVTYLINQGVPV
FT                   HLNGRYAIMHNKFMVIDGKNVQTGSFNYTASAVSRNAENVLLIEDAPQLAEAYQREFNR
FT                   LWDEGIPLNALY"
FT   gene            complement(106609..107040)
FT                   /locus_tag="SeSA_B0127"
FT   CDS_pept        complement(106609..107040)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeSA_B0127"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SeSA_B0127"
FT                   /db_xref="EnsemblGenomes-Tr:ACF88545"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RFB5"
FT                   /protein_id="ACF88545.1"
FT                   /translation="MTMNLHTPTTAPKAAPATSVSPLEQSGSPKTKFPEIKTVKTAVVK
FT                   LISDIEGNLDQRLVYREAVEGLCQEAANRITQCMHSRSTGQTLRDLRELLSVTLDTIIV
FT                   VEFEGEQTRLNYGGRSAEDVIAMLKALHLEGRKAWLEVE"
FT   gene            complement(107520..108485)
FT                   /locus_tag="SeSA_B0128"
FT   CDS_pept        complement(107520..108485)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeSA_B0128"
FT                   /product="antirestriction protein"
FT                   /note="identified by match to protein family HMM PF08401"
FT                   /db_xref="EnsemblGenomes-Gn:SeSA_B0128"
FT                   /db_xref="EnsemblGenomes-Tr:ACF88596"
FT                   /db_xref="InterPro:IPR013610"
FT                   /db_xref="InterPro:IPR017113"
FT                   /db_xref="InterPro:IPR041459"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0N1QRX1"
FT                   /protein_id="ACF88596.1"
FT                   /translation="MTMNLHTQTTAPKASQATSVSPLEQSGSSKTKFSRGKSKARAGAV
FT                   KTDLYQTVTDSIIAALESGVKPWVCPWVRNGAAVGLPANFSTGTTYSGINIMLLWCSAA
FT                   KQGFQDERWLTYKQAQELGGQVRKGEHGTTAIFYKTLEKEDEDGEIEKIPMLKAFTVFN
FT                   VEQIDGLSIESVPQPVAGFDPLPQAEALMTRSGAKITEQGVKAFYRPATDEIVLPERFR
FT                   FADAANFYATGLHELVHWTGAASRLNREKGNKFGSEAYAFEELIAELGSAFLLADLGIT
FT                   GEVQHESYIASWLKALKGDKRYIFKAAAAASKAHRWLMDC"
FT   gene            complement(108940..109086)
FT                   /pseudo
FT                   /locus_tag="SeSA_B0129"
FT                   /note="ISL3 family transposase; this gene contains a
FT                   premature stop which may be the result of sequencing error"
FT   gene            complement(109102..110160)
FT                   /pseudo
FT                   /locus_tag="SeSA_B0130"
FT                   /note="putative ISL3 family transposase; this gene contains
FT                   a premature stop which may be the result of sequencing
FT                   error; identified by match to protein family HMM PF01610"
XX
SQ   Sequence 110227 BP; 25541 A; 29835 C; 29670 G; 25181 T; 0 other;
     atgcatatac agttttaagc gagggaaaaa acgatgaagt tcattcctgc agtatcagaa        60
     gccagcatag taaaaattcc tttgttcaca gagcgatgcc ctgcgggttt tccgtcaccg       120
     gcagcaaact atactgagtc tgaactggat ctgaatgagt actgcattca ccggcgccac       180
     tccacctatt ttgtcagagc gattggcaac tcaatgactg atattggcct ctattccggc       240
     gatctgatgg tcgtggataa agcagaacag ccgcggcacg gggatattgt tatcgcggaa       300
     attgagggtg aatttacggt aaaacgcctg cttctgacgc cgcggccagc cctgcaggcg       360
     atgaacccgg acttcccttc cctgtacccg gatccggaaa ctctgcaaat tttcggcgtg       420
     gtgacggcct tcattcataa aacccggagg gcagactgat gttcgccctg gcagacgtca       480
     actccttcta cgccagttgc gagaaggttt tcaggccgga tttgcgcggc aaacctgtcg       540
     tcgttctcag taacaacgat ggctgcgtta ttgcccggag tgctgaagcc aaacggctgg       600
     gtataaagat gggaaccccc tggttccagc tcaaagaggc gcagtttcct gaaaaactgt       660
     acgttttttc cagcaactac gagctctacg cgagcctgag taaccgtgtg gtcgccctgc       720
     tggaagagct gtcgccccgc gtcgaacaat actcaattga cgaatgtttc ctggatgccc       780
     ggggaattag ccactgtatg gatctggagg attttggcag gcagctgcgt gggcatgttc       840
     tcagtggaac cggactgacg atcggtgtcg gcttcggcgc cacaaaaaca ctggccaaat       900
     cggcgcagtg ggcgtcaaag gaatggccac aattcagtgg ggtgctggcg ctgtcgcccg       960
     aaaatccacg cagaacggca aaattactca gcctgcagcc ggtggaagaa atctggggcg      1020
     tggggaaccg gatagcgaaa aagctgcacg ttatggggat caccaccgcc ctgcagctgt      1080
     cgctgacgaa ccctacattt atccggaaaa acttcaacgt agtgctggag cgcacggtac      1140
     gtgagctgaa cggcgagagt tgcatttcgc tggaggaagc gccgccgccg aaacagcaga      1200
     ttgtctgcag tcgcagcttc gggcagcgga tcaccaccta cggagaaatg cgccaggccg      1260
     tctgccagta tgccgagcgc gcggcggaaa agttgcgcgg tgagcgacag tactgccggc      1320
     atatcagcac cttcatcaag acatcccctt ttgcggttaa tgagccgtat tacggtaacg      1380
     tggccacgga aaaactgaac acccctaccc gtgacacccg ggacattatc gcggcagcgg      1440
     tcaggtctct ggacaggata tggctcgatg gccaccgcta cgcaaaagcg gggataatgc      1500
     tcaatgattt cagtccgaac ggcgtcgcgc agctgaatct gttcgatgac gtgcagccac      1560
     ggccgcacag cgatgcgctg atgaaggtac tcgacggcat taatcattcc ggactcggga      1620
     aagtctggtt tgccggacgg ggtattgcgc cggactggca gatgaaacgg gagatgctgt      1680
     caccggcata taccacacgc tggaaggagc tgccggttgc ccgtttctga ccgttgaaat      1740
     gacagaaggg acttgccgcc agagcttact ttaccgatca tacaggtgac ttgtctcagg      1800
     ggggaaccat gacaaatatc attctgtgtg atgtgactgc cagcgtcagc gaacttaaaa      1860
     acgatccggt ggccaccgcc agtgcccgcg gcggctaccc ggtcgagata attgaccgta      1920
     accgccctgt tttttattgt gtgcccgcgg ctttgtatga acaaatgctc gatgagctgg      1980
     acgaaaaaga cctggtgcaa acgataacag aacgtcaaaa ccagccgctg cgtgaagtgg      2040
     atctcaatca gtatctgtga tgtgctccgg tgcgaggagc aaggaatgta ttaagccaat      2100
     gttaaggaac aatatgggta gcaaaatcgc aggtgtggtt ttcttatact tcgctgtctg      2160
     gggaatggct tcagtgattg aattgcagta ctggcgtaac gctgatacct atcctgtctg      2220
     gctgacaaaa catctccgga tctctcctga aaataacgac aagagcctga taaggataga      2280
     aatggaaacc tttgacaagg tatgtggtga taaaaggggc ctccttgccg tcacccaaaa      2340
     acaaaacggt atgtttatgc gctgtgatga ttcccccggt tttttttcat ggttcagcgg      2400
     cgtttacaaa gtcaattaat cagataacgt gttgcacttt caatatgtta cccacatggt      2460
     tatcccccgt tactgtgggt aatcaatata ttgtgtctct ggcagctgct tttcctacca      2520
     tatgttgtcc ctgcccgttc tattttgtga tcggacagtg tgaaaaacga catcacagtg      2580
     gagacgctgc tgacgggatg atgttcatcc agggtcgtaa gatcggccgg tactggttac      2640
     ccgccggacg aagggccggc caacgcgcag cgtcggtagc tggctttaaa aatgctggcg      2700
     gaaatttaaa gatgaagccg catactctgc gaaattttgc aaatttcact caacatgctt      2760
     cgttcagatc ccaacagagc tttcaccatc gcctgtaaca gccgtcctgc tgcgtgatta      2820
     ctccgctcaa cgggttgctg gcgacaagcc aatacctgtt cgtgacaggc attgattgaa      2880
     ccgttgtccc taactaataa tgtgccgacg atgcaggtgg gaccgtggtc ccaggcagat      2940
     aacctgaccg gcgatacagg tggcaccgtg gtcccagaca gataacctga ccggcgatac      3000
     aggtgggacc gtggtcccag gcagataagc tgaccgacga agcaggtggg accgtggtcc      3060
     caggcagata agctgacaga cgatgcaggt gggaccgtgg tcccaggcag ataacctgac      3120
     cggcgataca ggtgggaccg tggtcccagg cagataagct gacagacgat gcaggtggga      3180
     ccgtggtccc aggcagataa cctgaccggc gatacaggtg ggaccgtggt cccaggcaga      3240
     taagctgacc ggcgatgcag gtgggaccgt ggtcccaggc agataacctg accggcgata      3300
     caggtgggac cgtggtccca ggcagataag ctgaccgacg acgcaggtgg gaccgtggtc      3360
     ccagggagat aacctgagcg gcgatacagg tgggaccgtg gtcccagaga gaatattcag      3420
     gccagttatg ttttctggcc tgtgagaaag gaaatgaagt aaagggagat caccgtagac      3480
     taaagcgtgt ccgcatcaga ctcctggttt ctcaagctcc ttaagaatgg cttctatttt      3540
     ctctatacac tccgcaggaa tgcgggacct atccaggtta agcaccattt tatcgccctt      3600
     atacaatgct gttgcccctg gagcaaactg atgacgtgag ctcagattaa ctcttgatgc      3660
     gggagattgt ttcagtacgg atgttaaaag actaatgacc tcttcagctt caaagattag      3720
     tcccgctttc ttctgatcgt ggagagtctc agcctgctgc ttcagtaatt cttctttatc      3780
     tgcaaaagcc ttctgaaggg cttcacctga ccgggcagac agttctccag gatgtgcaaa      3840
     cagggcaaca acggatttag gcaatttggc cgtattgata cagcgggtaa tgatcttacg      3900
     agagatgttt tccgcatcgg caagcgcaga aatatttcct gcaaactcat tctgcagccg      3960
     gcttgtataa cgcaggccac gttcataagc actcgtcggc cgataatcgt tacccagtcg      4020
     ggacaatgca gccatctgct catcgtccag ttcaccaacc agaacgcgat aatcactttc      4080
     cgtcaggatt gcggctttac ggcgacggct gccgtcggca atttctatga catcagaaac      4140
     ccggcggccg aaagctggag tctgctgacc ggtcagtaaa aatgaaggaa tgagatcatc      4200
     cagagcatct tcggtaagta gttcctgatc gcgctcattg cctgaccata cgcgtgaagc      4260
     gctctcaaca gagtctcccc ggagcacctc aagggtaaat ttcacttccc gtccacatac      4320
     cggaagagag attgcattac cgcgggccat agcacccacg cgcgcaatta atgaatccac      4380
     catcggcgcg gccggcgccg gtgatgaagt atcttcagtc gattgactat gtgtggtatg      4440
     tcttggaatg acaggagcac gcttcattat ctaatctccc agcgtggttt aatcagacga      4500
     tcaaaaatct cattgcaaac aggctcccag atagagaggg cattacgcca ggcaccggtt      4560
     gaagaacgtt gatcaatagc ctgttcaaaa acggttctca tacggatctg acctttaccg      4620
     acttcatccg tttcgcgcac aacattttta aggaccatgc ttccccaggc atcccgaatt      4680
     tgttcttcca tccacgggga ctgtgagcca ttattattac tgtatttggt aagcagaata      4740
     cggacatctg gctcgaagcc tttaagatcc acgttcttaa gcaggtcacg aagcatatcg      4800
     aaaaactgca gtgcggaggt gtagtcgaac agctctgccg gagtagggac aatcagaaca      4860
     tcagcagcgc atacaacatt tatcgtaccg ataccaaggt tgggtgcact gtcgataact      4920
     atcacgtcat aatcatgagc gacagtttca atggccagac ggagcatcag gtgcgggtca      4980
     gcaggtaatt tgccttcgtc aaatttcccc atcagctcgg tttcaatgcg gtgcagtgcc      5040
     agacaggacg ggatgatatc aaggccaggc cagcaggtgg gctttatagc gtagctggcg      5100
     tcatcctttt ccccaagata aaagggcagg agagtgtcct cagcatgaat atgaagatcg      5160
     ggcacccatc cgtgatacat agaagcagtt ccctgtgggt cattgccttc aacaagcaga      5220
     acacggagtc ctttcagagc aagatcctga gccaggtgaa cggatactga ggttttgtaa      5280
     acaccacctt tgtgagctgc aacgccaatc accggcggaa acgcatcttc agcacggcgc      5340
     agtcgtgtac caaatacatc ccgcatgtga ttgatttgtt cgatggtata accaacgcgt      5400
     tgctcaactc tcccacgggt ttccatatca gggtgcggca gccggccagc tttctcggca      5460
     tccctgatag cctgagatga cacgccaact aaatctgccg cttcaccaat cctccagcgc      5520
     cgggttattt tccgggcttc cggactgtca tcattaaact gtgcaatggc gattgctttc      5580
     gtcatttcat gaccagcact tatgcactgg ttgagtgtat ccatgagtcc catactgaac      5640
     atcctttaat catcactttg cattatttta ttaaatcttg gaatttattg caaagcaaca      5700
     ataaaatcgc aaagcacacg aaaaagtgca aagtgaacca cattgggtaa tgaaagaacg      5760
     caggggatta caaaagagta cataccgcag tcaatattaa tcactgccgc tcgccgcagt      5820
     aagcgatctc acacagtgag aaagcggcga ggaagcggaa aatcacagaa ctcacagatt      5880
     gcacgtacgt cgggttgcta aagatgactc gggatcagcc agttataatg aaattgactg      5940
     cggtatgtaa tatattgact atggtatgat gcttaccgca tctgtaggaa agacgactca      6000
     gcataccgca gtcaatgttt cattgttgta cctgtagatc tcaatcttcc agagcgtatt      6060
     caggaaaatc aggccagggg tctggatatc tggtgtggcg cttccggcct tgtatctggg      6120
     ttattcatgg tctcgatcca ataattgatc ccaaggagat catagtgaga tccaaaagag      6180
     atccccggat cgctccagca tgcgctgtaa ctggctttaa cgtctgtctg gatcgactgc      6240
     ggaatgtaaa atgttgactg ttatatgcat aatctaatac tgtgatatgc aacggtattt      6300
     actgaggtat gtatatccgt tgactgcgat acgtattact acatcctttt gtggataacc      6360
     gttgaggatc aagatgacga gcgaaaataa tagcttactt ctgaaccttc aggaagttga      6420
     taagacaacc ggtgaagttg ttaagctgga tgtcaacagc accagtaccg tgcagccagt      6480
     agcgctcatg agactcggtc tcttcgtccc aactctgaaa tcaacaggga agagcaaggc      6540
     gaaccggaaa aacgttacag acgcgactga ggagcttgta cagctggcca ttgccaaaag      6600
     cgaaggatac actgacgtta agatcaccgg ttcgcgtctt gatatggaca cggattttaa      6660
     agtctggctg gggataattc gctccatgtc ggagtatggg gtaaaaagtg acaccctgga      6720
     actgtcgttc gtcgaattcg ttaagatgtg cggatttgac tcccgtcgtt caaacaaaaa      6780
     aatgcgcgat cgcatcagta attccctgtt taaactcgcc tcggttacgc tgaagttcca      6840
     gagcgagacc aaaggatgga ccacccatct ggtgcagtca gcctattatg acatcaacga      6900
     ggatatcgtt gagatcaagg ctgaacctaa gctgtttgag ctttaccaca tggacagaag      6960
     ggtactgctg cggctgaaag ccattgacgc cctgcagcgc aaggaatcag cccaggcgct      7020
     ttatacctac atcgaaagtc ttccccagaa tcctgcacct atttccatga aacggatgcg      7080
     tgaccggctg aatctcacct caaatgtcta tacacagaac cacacggtgc gtaaggcgat      7140
     ggagcagctg cgtgatattg gttatctgga ttacaccgag tttaaacgtg gccgagccac      7200
     ctatttcagc gtgcattatc gcaaccccaa actcatcagt agtcctgtga aggttccgcg      7260
     caaagaggaa gaagagaagg cgccagagca aaattatgac gaagtcatta aggcgctgaa      7320
     ggctgctggc atcgatcctc ttaaactggc tgaagccctc tcagcgatga agccagaaaa      7380
     ttgactgcga tatgcatatc atgactgccg tatgccgcta aggacattcc attgactgtg      7440
     atatgcatca cgcataccgc agtcaatatt tattctctat catgtctgcc cggatcgaac      7500
     aatattgact gtcatatgtg atttcgggtc atgatacgca gatattgact acggaatgcg      7560
     ggtttaatgg gggtaatccc tggtctgttc accattccat gggggataac atgccacagt      7620
     caatttttca gtaacgctct atatccctta cgaaaatctc aatcgggtgc tgagacggtc      7680
     atgttacctg acggtatccg ttcccctgtg tactgcaggt ttagcccggc aggatgagac      7740
     tgcagctgtc tgtataaccc ggcgccagct tcacactgtt aaatgcgatc aggaaacggg      7800
     agccgaatgg cagaaaggtg ttggctaggg aaggtgcgaa taagcaggtt atttcttccc      7860
     aagctgactc gctgattaaa atttcgcgga tctgggccga ttttttcccg caaacacatc      7920
     gaatcagcct atttaggggt cagtttggag atcggaaatt tttgtacgtt aagcacatta      7980
     tttaaccaat tcggatacgt aagtgattga tttatcgtca ttggctatcg cttttaggtt      8040
     gtcgctcttg ctgtatcgca tttaggttat ccgattaaga caaaatcccc tgaaaacgct      8100
     gtatagcgcg ggagtacacc ctattgctac aggtaagcct gttcaaaaaa caggcttacc      8160
     gtacaataat tctctatatc caaactgacc ccaagaagga caccttcagc gcggccgtgg      8220
     tcggttcgcc ggtaaagtag gctttaccct cgctctcatt ccacttgttc ttcacagggt      8280
     cgtagccgcg gttaagcacg ctgatgccgc cgtcgctgcg cttgccgtag gtggcggtaa      8340
     cctgctctag gccgcgttca aagcggtttt ccaggcgagc gacttcgtac catttgccaa      8400
     gatagcggct ggcgtcaaaa ccggaaatgg gctgcacgcc cttcggtggg gtaggggatt      8460
     tacaggctac cagcgtcagg gcaatggcaa caccggtcac aacaggccat agcttcatga      8520
     gaattccttt catttgcacg gttggaaatt aagtgtagtg caccgcggcg gcgcttcatc      8580
     ccatccgcga aaattcgtag tatattgaga gtattcctca actctggaca cggacatggc      8640
     ttactccatc ggcgaattcg ccagactcag cgggatcacc gccaccacgc tgcgggcctg      8700
     gcagcggcgc tacggcttac tcaagcctca gcgcacggag ggcggccacc gccagtacag      8760
     cgatgaggac gtccagcagg cgctaaaaat cctcgactgg gtaaaaaaag gcgtcccgat      8820
     tggccaggtc aaaccgctgc tggagcgccc tacgtcgcgc ctgaccaaca actggctcac      8880
     gctgcagcag agcatgttac agcgcctgca ggacggcaaa atcgagtccc tgcgtcagat      8940
     gatttacgac gcaggacgcg agtacccaag accagaactg gtcgcgaacg tgctgcgtcc      9000
     gctgcgcagt caggtgtcgg caaacgtcgc cgccgccatg accctgcggg agatcctcga      9060
     cggcatcatc atcgcctaca cctcgttttg cttggaaggc gataaaaaag cgccgggcga      9120
     caacatcctg ctcagcggct ggaacctgaa tgacccgtgc gaagtctggc tcgaagcctt      9180
     aacccgcacc gggcaaggcc accgtatcga tattttaccc acgccgcccg ccacgctggc      9240
     cccggagatt ttcccggacc gccactggct tctggtcacg cgcggtaaac tcaccgccgc      9300
     gcgcaaaaag cagatcgagc agtggcagca gcaggtatcg cttgaagtga ttatcctcta      9360
     atcattttct cctgcgggaa tcttcacgaa aagttgaata ttttcccgcg ccacaaatgc      9420
     taacgttttc ctgtgaccga caaccccaca ggaaaacaca atgaaaaaaa ctgcctctct      9480
     gctgatgctg accaccctgg cctttgcccc tgccgccttt agcgcccctg ccggcacgct      9540
     gagcgtacac attcttgacc agcaaaccgg gatgccgcca tcgtacgtta ccgtcacgct      9600
     ggaaaaacag cagcaggaca aatggacccc aattgccagc ggcaaaactg accatgacgg      9660
     ccgcatcaaa tcgctttatc cggaggatca ggatatgcag cccggcgtct ataaagtggc      9720
     ctttaaaacc gcagattact tccacgggaa gaagctggac tccttcttcc cggagatccc      9780
     ggtgctgttc accgtaaccc ggaccaacga aaagctgcac atccctctcc tgctgagcca      9840
     atacggttat tcaacttaca agggcagtta agaaacgttg attttaaagg caaataaaaa      9900
     ataattccgc taatacttgg acaaattagt tatgttgtgt aagttttaaa gagaagaacg      9960
     ggaggaccac accatgacaa caaaacctgt gctcggtatt agcggatgtt tgaccgggtc     10020
     tgccgttcgc ttcgacggcg gacacaagcg tatgggcttt gtcatggatg aactggccca     10080
     gtgggtgagt ttcaggcccg tctgcccgga aatggcgatt ggcctgccga cgccacgccc     10140
     ggccatacgc ctgacgctga cggacagcgg cgaaacgcag ctccgcttca gcaagccgcc     10200
     ccatgatgat ataacgcaga aaatggccga ctttacggcg gactatctgc caaaaatcgg     10260
     cgatctgtcg ggatttatcg tctgcgcgaa atcgccaagc tgcggcatgg aacgcgtgcg     10320
     gctatatgat gaaaacggca accggggccg caaggagggt gtcgggctgt tcaccgccgc     10380
     cctgcttgaa acctacccgt ggctgcccgt ggaggaagac ggtcggctgc acgccccggt     10440
     gctgcgggaa aactttatcg agcgggtatt tgccctgcac gagctgaaca cgctgcgcgc     10500
     taaaggcctg acgcgccgcg cgctgctgga tttccacagc cgctataaat tgcagcttct     10560
     ggcgcaccat caggcgggct accgcgagat tggcccgttc gttgcgtcgc tgcatgaatg     10620
     ggaagatctg gacgcgttct tcgtggcgta ccgcgaaaag ctgatgacca tcctgaaaaa     10680
     gcccgcctcg cggaaaaacc ataccaacgt gctaatgcat atccagggct atttccgtaa     10740
     ccagctgaac agccgccagc gcgtcgagct gcgcgatgtg atcctgcact atcgcgacgg     10800
     gctgctaccc atcctcgcgc cgttgacgct actgaaacac tacatggccg aataccctga     10860
     ccggtatctg atgacgcaaa actactttga tccctatcct gatgatttgg gtctgcgtct     10920
     ggcagtaacc tgacgataaa aatgcgaagg cccgtttgac ccacagaggc ccaaagcagt     10980
     accccgttta gacgacaccc tcactgtcgt ctcttttttg cattccacac aaaagactgt     11040
     aattatgtac aggattgtaa cgcaaaaagg gactgcctgt gatcaccacc ctgcacattc     11100
     aaaactaccg ctcgattcgc gaaatgtcgc tggagctgga acagctcaac atcgtctttg     11160
     gcccaaacgg caccggaaaa tccaatatct acaaggcgat ccacctgatg cacagcgccg     11220
     cacaggggca gttttcgcag gcactggcga acgagggtgg gattttaaaa gtgttctggg     11280
     caggcaaaac ccgcagcgac cagctgcggc ggatgaattt ggccgttgaa accgaaacct     11340
     acgaatacga gctgcaggta ggctttgtcg aaaaactgcc ttacccctca cagtttcaac     11400
     tcgatccggt gatcaaagaa gagtccatct ggctgagtgg tcaataccgc cgcccgtcgt     11460
     cacagctgat gaagcgtaaa aatcaggccg tatttctgaa caacgtgcat cacgagaaag     11520
     tcacccacag cggcacgctg tatgagaacg aatcggtgtt cggccagctt ggcgagccgc     11580
     atctttaccc ggaagtgtcg cagatgcgcg agtcgctgcg taactggcgc ttttatcagg     11640
     agttttctgt atcaatcggc tcggccatgc gcgcgcctca ggtcggtttc cgctccccag     11700
     tgctggccag cgacggcgca aacctggcgg cggcgtttca gaccatcgtg gaaattggcg     11760
     acgagctgct gctgatgcgc atcctcgacc aggccttccc cggctgcgtg ttttacagcg     11820
     acaacaccgg cggacgcttc cggatgatga tgcagcgtga agggctaagc agaccgctgg     11880
     agccggcgga attctccgac ggcactctgc gttttctgtg cctggcggtg gcgctattaa     11940
     gcccgcgtcc accggccttt atcgccctca acgaaccgga aaacagcctg catccgcaga     12000
     tgctgcccgc gctggcgagc ttaatcgccg aggccagccg ctactcgcaa atttggctga     12060
     ccagccactc gccggaactg gcgaatttaa ttgagaaaca gagatcgttt tcgctgtatc     12120
     agctgtcgat ggtggaagga gaaacgaagg tggagaggct ggggtagtct cccagagggc     12180
     actgttgcaa agttagcgat gaggcagcct tttgtcttat tcaaaggcct tacatttcaa     12240
     aaactctgct taccaggcgt atttcgccca ggggatcacc ataataaaat gctgaggcct     12300
     ggcctttgcg tagtgcacgc atcacctcaa tacctttgat ggtggcgtaa gccgtcttca     12360
     tggatttaaa tcccagcgtg gcgccgatta tccgtttcag tttgccatga tcgcattcaa     12420
     tcacgttgtt ccggtactta atctgtcggt gttcaacgtc agacgggcac cggccttcgc     12480
     gtttgagcag agcaagcgcg cgaccatagg cgggcgcttt atccgtgttg atgaatcgcg     12540
     ggatctgcca cttcttcacg ttgttgagga ttttacccag aaaccggtat gcagctttgc     12600
     tgttacgacg ggaggagaga taaaaatcga cagtgcggcc ccggctgtcg acggcccggt     12660
     acagatacgc ccagcggcca ttgaccttca cgtaggtttc atccatgtgc cacgggcaaa     12720
     gatcggaagg gttacgccag taccagcgca gccgtttttc catttcaggc gcataacgct     12780
     gaacccagcg gtaaatcgtg gagtgatcga cattcactcc gcgttcagcc agcatctcct     12840
     gcagctcacg gtaactgatg ccgtatttgc agtaccagcg tacggcccac agaatgatgt     12900
     cacgctgaaa atgccggcct ttgaatgggt tcatgtgcag ctccatcagc aaaaggggat     12960
     gataagttta tcaccaccga ctatttgcaa cagtgccata gattcttacg tagcgtttct     13020
     ggcgtgcatt ttcgggtggt ttgttactgt ttttaacggg gatacgtcag aaacgcgctc     13080
     aggccgtctg agcggtacgc gtaatgaggc gttatggtaa atagcctatg ctaatgtccg     13140
     ctaagagcga ggagcagacg ttgaaggcta aaagaaggct actgaatttg tggcgattca     13200
     gtcttcatcc gcacaatgtg ggcagcccgt atacctcatt gtctcgccca ttgcttcaca     13260
     gggagtccca caaatttcac aagtatcata gcctgtatgg atctcaagac atcgtgtgca     13320
     caggaagttc tcgccaaaca cacagaccgt ttcatggccc tcacagtgag cgcaatttgc     13380
     taggccatcg ggatacatca tttcgtccac atgacgaaaa ttctcctcat caagcaagtt     13440
     ataccttgag agttctgcgt tacaggtgcg gcagatgaag gtatcgtcat cttcttcttc     13500
     caccggcaga acctggtctg tatcacactc aggacaggta aactttacat ggcgctctga     13560
     gtgaaaacag acgcgacaag tttgctcata aacggtagga ccgttcttcc cgacggcaag     13620
     aatttccatg atggctgctg gcttgtggca aatggtgcag ggatgaaatt cagcgccctc     13680
     agtcgcaagt tgttccagct cgggctggat atgtttcaga cgggcttcgg cataaaactc     13740
     gttgcctcgc aggagttgtg tttcacctaa tgccagtgcc cagttgtgtg gtgaagcaaa     13800
     atgctgttgc cagtcttcac gcattagtcg gttcagtgca aaccatgccc gagcctgttc     13860
     agccagaatg gtctccacct cagaatcact aaaagctgta tgaaagaaat gaactacacg     13920
     gtttcggtga ttgcgaatgg tattaaacac agcttcggtt tctttaggca ggggcttttc     13980
     aaggatatcc ctcaaccggg tacagacatc atcaaaggac accgactgaa aatcaccggc     14040
     aaggtagctt ttacgcgata cttttttacc gctgcagacc agcgtccagt gttcgctggc     14100
     aaggggtacc ttgagcaaaa tttctacagc tatccagaaa ctaactaccg agtgtttgta     14160
     ctgtttggcc tcgaactctt cacgtgcctt atccagaaaa tccatgccat tcttaatgag     14220
     agccgccaca tcagctgcga gaggggcagg taattttgtt cgtgtatgca tcctgatctc     14280
     cgttatcacg gggggccggc agctgctgca gagattagtg ggtatagagg ataaatctta     14340
     gttgctggct ggccaccaca tcgagggcaa agactttggt gttgacctca ttgcactcaa     14400
     acttctcatg caccatcagc cattgcagga tcttcggatg aacaaggcca tacaacaggt     14460
     gcattacaag actgatccta cccaatgtga gcaagaccct agcgaggtta tagtttcaat     14520
     aaattccgag ctgagtccgc cacagcacag tgatttcgcc accgattgta atctcactcg     14580
     ataaaattaa acacagttat tcgcatcatt tcccggctgg caatgcgttc accgtggatg     14640
     ccatattaga tagctccctt ggaaaccctt aacgtccgct cctggcacaa agcggacagt     14700
     gatcaccgtt cttacgacta ctttctgact tccttcgtga cttgccctaa gcatgttgta     14760
     gtgcgatact tgtaatgaca tttgtaatta caagaggtgt aagacatggg tagcattaac     14820
     ctgcgtattg acgatgaact taaagcgcgt tcttacgccg cgcttgaaaa aatgggcgta     14880
     actccttctg aagcgcttcg tctcatgctc gagtatatcg ctgacaatga acgcttgccg     14940
     ttcaaacaga cactcctgag tgatgaagat gctgaacttg tggagatagt gaaagaacgg     15000
     cttcgtaagc ctaagccagt acgtgtgacg ctggatgaac tctgatggcg tattttctgg     15060
     attttgacga gcgggcacta aaggaatggc gaaagctggg ctcgacggta cgtgaacagt     15120
     tgaaaaagaa gctggttgaa gtacttgagt caccccggat tgaagcaaac aagctccgtg     15180
     gtatgcctga ttgttacaag attaagctcc ggtcttcagg ctatcgcctt gtataccagg     15240
     ttatagacga gaaagttgtc gttttcgtga tttctgttgg gaaaagagaa cgctcggaag     15300
     tatatagcga ggcggtcaaa cgcattctct gaaccaaagc atgacatctc tgtttcgcac     15360
     cgagggtgac acttctgctt tgcgttgaca ccctctgatt tagacaattg cagccataaa     15420
     gccccgttgg tgatacagca acaagcggag cgtagtgacg tcatcagatt gtcagaggga     15480
     tcacacctta tcaggataac cgtgtacctt tcggagcgtg actgaaacgc tgatagaact     15540
     tgcatgtggt ttgcaagaac caatcactgt caacaacggg taaaaagtga tccacttacc     15600
     gccaccacca acggtttaat attgatccac cttgtttact caggattagc ttcagcgata     15660
     accccggcct ttcgtttctg cttcagtcga tagctttccc cttttatttg cacgacgtgt     15720
     gagtgatgta agatccggtc cagcatcgcc gatgtcagcg ctgcatcacc ggcgaacgtc     15780
     tgatcccact gcccgaacgg caggttggag gtcaggatca tcgcgctctt ctcgtaacgt     15840
     ttggcgatga cctggaagaa cagcttggct tcctcctgac tgaacggcag ataacctatt     15900
     tcatcgatga taagcagctt cggggccatg acaccacgat tgagagtcgt tttgtaacgg     15960
     ccctgacgct gtgaagtgga cagctgtagc agcaggtccg ctgctgttgt gaagcgaacc     16020
     ttgatgcccg cccgtactgc ttcgtagccc atggctatcg ccagatgcgt ttttcccacg     16080
     cccgatggcc ccagcaacac gatgttttcg ttacgctcta tgaagctcag ggatcgcagc     16140
     gactggattt gcttctgagg agcgccggtg gcgaaggtga agtcgtactc ctcgaacgtc     16200
     tttaccgccg ggaaggctgc catccgcgtg tacatcgcct gtttacgctg atgccgggcc     16260
     agtttctcct catgtaacag gtgctccagg aagtccatgt agctccattc ctgatccacc     16320
     gcctgttgcg acagcgccgg cgctgcgccg ataagactgt ccagctggag ctgttcggca     16380
     agcaccatca gccgttgatg ttgcagttcg accatcatgc ggctcctctg cagaacgtgt     16440
     catagatgga gagcggatga tgcaacggct gcctgtcgaa ggtcatcagg ctttcatcaa     16500
     cctgcacgtc atactgtttt ttctccggtg gcagtgccag catggattgc tgttcctcca     16560
     cccagcgatc gcaggggcgg gtctggatag tttcatgctt acgttgattg gccacatcgt     16620
     acagccagcg caggccgtaa cggtttgcgg tttcaacatc gacggtgatc cccatcggac     16680
     gcaggcgtgt cattaacggg atatagaagc tgttgcgggc gtactgcacc atcctctcca     16740
     ccttgccttt agtctgcgcc ctgaagggac ggcacaggcg gggagagaag cccatctctt     16800
     tgccgaactg ccacagggaa ggatggaacc ggtgctgccc ggtctggtaa gcatcacgct     16860
     gcagcaccac cgttttcata ttgtcgtaca ggacttcctg cggtacaccg ccgaagaagc     16920
     tgaacgcatt gcggtgacag gcttccagcg tgtcgtagcg catgttgtcg gtgaactcga     16980
     tgtaaagcat tctgctgtat cccagaacag cgacgaacac atgcaggggt gacttgccgt     17040
     ttcgcatggt cccccagtca acctgcatct gccgtccggg ctcggtttcg aagcgaacga     17100
     ccggttctgc ctgtgctggc agggtctgtt tacggatgaa ctctctcagg atagtaagcc     17160
     ctccacgata gcccagctcc atgatttccc tggcaataac ggtcgccggg attttgtagg     17220
     gatgcgcatc gctgatccgc ttagagatgt aatcacggta ttcatcgagc agtgatgatg     17280
     gtgccgggcg tggtgaatac tgcggctttt cagatttggc tttcaggtgg ctgcggacag     17340
     tattgcgcga aatacccagc tccctggcaa tggcccggat actcattccc cgcttgtgca     17400
     ggactttaat ttccatacga atctcaaaag tgatcataag ctcccctgta ttcagaggag     17460
     cagattaacc cctggatcaa ttttcaaccg ctggggtgga tcagttttgc accgttggta     17520
     acaatcacca ttaacctgtt tacgcagcca cagggccgca catcgggatt aaatgcggct     17580
     ttcagacggt gtacctaagc atccttggaa ggctttgtgc acaaagctgc tatgcccaag     17640
     gctaactaaa acccagttac cagaaagtgc ctctatccaa aaagccaaaa aatatgcaca     17700
     agaggccgag ttttggcagc atgttggtag caaaatgcac tttgttatgg tttcgggtga     17760
     ctcaatgaaa acgttggtta cggtttttgc agtaaagtga gtgagctaat gtagtattcg     17820
     aaatttctga atatttctta tgtgccaaaa gcagaccttg ccaaagcacg ttgtgcacgt     17880
     tgcaagactt gaccccagac tttcttagcg aagtgtccac ttttgctggt acggatcact     17940
     cgaaagtgtt agcaatagag tagacgcgat atgaagttgt gtagtggtaa gtggcactgt     18000
     caacattggt gctcatatca cggattcgcg aaacgcgatt atagaaactg ttgccatatt     18060
     agacttatgg tgtttaatat caggaactta aagaatttat tgaaatgctc gttggtgatt     18120
     atctcgctaa aaagtgctag ataagaagca aaactaaacc tgtttttctc gagatgtaga     18180
     tgtgttgagt ttgcaacacg taggtaatcc ctttatttat tgtttgaata gaaatcatgg     18240
     ctttagaaca agttatctac aaccttgaag aggttaaagg gctctctgat gaagagcttt     18300
     accaacgcct ttatgatagt tggggcttgg aaaatcataa aattgatgtc tggggtgaac     18360
     tgagtattaa cgtggcaggg aactgggctg gtatccgtaa cgcaaaaact cttagtggca     18420
     accaaagcat agaataccct ctggctgatt cgcatgaatt gcaatcaggt gtgtttttaa     18480
     ccccatcagt agcaaaaata gtgttaggca atgacactaa agggatggtt gcttgtgaac     18540
     tgatgttagc atccatcccg caaagagcta aaaaaaacaa cccatttcta ttagccgtca     18600
     atgataagac ggttgagcgt ttgacctatc tgcccgatgc attacctaat ttagatcggc     18660
     aagccctaat tcaaaatgaa gatgaaacac tgctacgcaa agttatttat gacgcagaag     18720
     ttaagcgcgt taaacataaa atcgcctcag aaacagaagc gttagaggca gcgttgcaag     18780
     aaaaacaaca ggatatgact gacaagttgg cggagttgtc agacgcattc aaaagtacac     18840
     aggataaaat cacagcatca acgacagagc ttgaaagctc aatcaagaga aatgaagaac     18900
     taaataatga taatcatcgg ctaaatctga agattcagga aagcaaagct gagttagacg     18960
     tcattatcga aaagagccga aaagtagagg aaagtatggc aagaaaagtc gagaaactaa     19020
     cagatttcat caaagagaaa gccatcttcc tgaagagttt tgagtttttg gatgaggaag     19080
     atttcgactt ttttgttgga agccccttgt ctaataagga gcgtggtgaa catatctctt     19140
     tttcacaagc cctttattca aactacagcg atgcagtttc ttacattcaa gcgtacctca     19200
     aagaacgaga catcctgtac cctcgccata ttatcgagaa cttcctaacg cttattcgca     19260
     ccaatgatct catcattctg gcgggggact caggctcagg caaaacaaac ctggttcagt     19320
     cgtttgccaa ggctattggt ggggtatcta agatcattcc ggttaagcct aactggacta     19380
     gttcagaaga tttgctgggc tattacaatc ccctagagaa gaaatatttg gcgacaccat     19440
     ttcttgaggc attgatcgag gctaagcaaa acccagatat cccatacttc atctgtttag     19500
     acgaaatgaa ccttgcccga gtggaatatt actttgccga ctttctttct aagctagagg     19560
     agcgtaacga gcaaccgacc attcaacttt actcggatga tgaagctgca cacgttcttg     19620
     ccgagctaaa aggggttgtt tctgtcattt ctaacgcgca agaaaagttc agcaaaaatg     19680
     gcatcgtgga cttcgttgcg ctcatgcaag atgaagaaat taacgctgaa atgaagcgcg     19740
     cgtttggctt tagcgataaa gactcactga ttaaatacca cggtgatatc agacgtatgt     19800
     tggcaggtgt tctcggcacg ccttcgtcaa tcacgattcc agcgaacgta agaattattg     19860
     gtgctatcaa catcgacgaa acaacccatt acctctcacc aaaaatactt gatcgtgcac     19920
     acgtgatgaa gttcaagagt cctttgctga ccgactggga tgctattttt gatgagattg     19980
     actcttacgg gctcgacgac gttactttac cgctagtgtt tgatattgaa gagcttggtg     20040
     agcgtacccc ttatccgaaa tttgaacgtt tgaatgaatt ctgcgagtta tttacgactt     20100
     taaaccgcga tgttttcgac ccgcttggcg tggaatttgg tatgcgaact attcgacaag     20160
     ggcttaacta tgtaagttta tttagcgatg taaacgataa taagtctctg gccatcaaca     20220
     actttatcgt tcataaggtg ctaccaaaat tcacatttga tggcgataag caagtgggtg     20280
     attacagtaa agctgagctt gttagccgtg tattcttacc tcgccttgag tcgctgctgg     20340
     acaaccaagt agaaatagcg gcggagtttt catgcaccaa atcgatagag cgtttagtta     20400
     aaacggctga atcgaatgat ggcgttgtga actactgggc gtaatcatgg aaactccatt     20460
     cgttatcaag tttatcgaga ccaaatggca cgataagcaa accttagtca gtgttagcga     20520
     gtcggagtac tcgctaaagc ttgagcagac ggggaacaat gcattttccg cacacaccac     20580
     catctaccct aaggtcgatg agctacgttt tgctcaactt gcgataaaaa ctaagcaggg     20640
     tgatcagtct ccgccttaca ttgtcatgcc taatggtgat agaaagcagt tagagtcgat     20700
     aaccgatccc gcatctaatg ctgtgtggtg ggttgagcct gctcattggg acgcaaaaca     20760
     acgggtgtgg cgcagtgaag cgaggcgaac ggctggtcag atcacgtttg ttattggtaa     20820
     ctcgacacta aagcttgata ttgatatctc cgaacagacc aaatcggatc tttcacgtta     20880
     cctgtcagat tttaaagcgg acctgtggga gctgatcctc gatgagaata gtcatatcac     20940
     gggcgacgct aaaaattcac aggttgcagc catcgaccaa gaagcgctgt cattagtcgc     21000
     atcaattctt agcaatgcac aaaccatcct caaaaagccc aaagttgaac tgaaagaaat     21060
     tcaagcgtta aagccagcaa aagaagtacg tcctgttcca cgtacattta tggagatttg     21120
     taccaaaggt tcgcgtaagc atttaacgag ccgcgcatct gagccgagtt acaacgtgcc     21180
     agaaaaccag tatgtgctgt atgtggtttt gagcacgctg agcattgtaa agcaattggt     21240
     taaggtggct gagagcaaaa agagtcgttt ttctggggct attgaaaagc tcaatgagcg     21300
     tttagacagt ttaaaagact atcgtattat caaccgtgac ctagtagtta aagacttaga     21360
     acgacttaaa aagcgctttg atacagaagt aatcaatgcc gagttggcga gtcagttagg     21420
     tgaaattaat gccaataaat atttttcgca aaatcatgcc gctaaaggtt acctcagatt     21480
     agaaaaaacc acaggatctg agaatgagtg gtgggcgaaa attaagccgt cccagcatga     21540
     tgattggcaa cagtttgaac ttgatggata taccattttt agttctggtg agtattacgc     21600
     gagcttgttt cagccataca gcgactatga catggtggcg attatgcctc ctccctctag     21660
     gagaggaaca gcttcgatct tgtacccaga gtacatatcc aaactaacga ttctggcgga     21720
     ttcacgatcc ctcttaagag ataaagagaa gttttccaag ttgcgcgagc aaggcattgc     21780
     tctaaatgaa aatggttgga aaacgaagct gacaccggaa gagctctctg aacaggagaa     21840
     agaacgagag acaattcgaa agcgccttag ttactttgct agtgagcatg aaaaagtagg     21900
     aatagtgcat caggtactgg cgcccaaaat aaagcctttc cagcaagtag aaaaagaatg     21960
     gcgtcaatgc aaagtcaaaa gtaaaagcac ctttcctaac tctatgactt ttgtgcaaaa     22020
     ccctgcctat caagcggttc actcgggttt taaaaagtta aaagagcaga ttggcttggc     22080
     cgatgaagac attttacttt cgctggagaa aatcgaggcg attggactag tcaacatgcc     22140
     actaatttat gaacgttggt gtttgctgca aatcatcaaa gtgctgactc aggcattccg     22200
     atatctgcca gaggacaact ggaaacgaaa attgattgcg aatattcaag gcaatgaaga     22260
     acaaatcagc attcagtttt tcaaccctaa tgtttcaaga aaagtcacct tgcaatacga     22320
     gccgttctta gccaatggta agcgccctga ttttgttttg gatgtagaag cgattaccaa     22380
     aagtggtaac cagatttcaa agcggttagt cgtcgatgca aagtactatt ctgctgccta     22440
     tctcaagctt agaggcggga tcggtggggt tatccatgaa ctttacaacg gcaaagatta     22500
     tagcgaatgc caagaaaaca gtgtgtttgt tctgcacccc gtgttagatg cggttgagaa     22560
     agtcgtatct ccacaggaat gggcgaaaga cagttatttg ggcgaactat ccatgtttga     22620
     ttgggagcca gcataccatc aacgtcaagc tacaaactat ggtgcagtat gtgctaaccc     22680
     aatgaagtcg caacgctatc ttgatgaaat ccaacgtatg ctagggatgt ttctacagta     22740
     cggcattgaa gacaatacat cttttcgagg agcatcggat gatactcatg cggtgaattt     22800
     ttgtgtttct tgcgggtctg aaaaagtagt tgatgtaacg aaatcaatga gttcaaataa     22860
     tcaaaagcgt tggtatcggt gcaatgagtg tacacacttt accgtgtata cccactgtgg     22920
     tacatgcaat acacgattaa ttaagaatgg cgagtattgg acctatttgt ctttgatgcc     22980
     tatgtcttca attaacataa agtgtccaaa ctgcgagtct cccgtatgac gggttctatt     23040
     tggggtctga cgctcagtgg aacgaaaact cacgttaagc aacgttttct acctctgacg     23100
     cctcttttaa tggtctcaga tgtcctttgg tcaccagttc tgccagcgtg aaggaataat     23160
     ggccgagcat attgatatgt ccgtggcaaa gcggggagag gcgtgcgata tcttcatcat     23220
     tcagtgtttc accttgcgcc cggagatgat ccagggctgc ctgcatatac atagtgttcc     23280
     ataacacgac ggcgttagtg accagcccca gtgcgcccag ttgatcttcc tggggtcagt     23340
     ttggagatcg gaaatttttg tacgttaagc gcattattta accaatcttg gttcgtaagg     23400
     ggttgatttt gcgtcagtgg tgacctgccc ccacgattag atacaacact cagttagtaa     23460
     cgtcggaatc ttcattctca gaatgaccct ttctccagcc cgctgcaaat tcagacggtg     23520
     tctgataatt cagcgtggag tgcgggcggc attcgttata atcctgccgc cagtcattaa     23580
     taattttcct ggcatgaacg atatcgctga accagtgctc attcaaacat tcatcgcgaa     23640
     atcgtccgtt aaagctctca ataaatccgt tctgcgttgg cttgcccggc tggattaagc     23700
     gcaactcaac accatgctca aaggcccatt gatccagtgc acggcaagtg aactccggcc     23760
     cctggtcagt tcttatcgtc gccggatagc ctcgaaacag tgcaatgctg tccagaatac     23820
     gcgtgacctg aacgcctgaa atcccaaagg caacagtgac cgtcaggcat tcctttgtga     23880
     aatcatcgac gcaggtaaga cacttgatcc tgcgaccggt ggaaagtgcg tccatgacga     23940
     aatccatcga ccaggtcaga ttgggcgccg ccggacggag cagcggcaga cgttctgttg     24000
     ccagcccttt acgacgtctt ctgcgtttta cgcccaggcc actgaggtga taaagccggt     24060
     acacgcgctt atgattaaca tgaagccctt cacggcgcag caactgccaa atacgacggt     24120
     agccaaaacg cctgcgctcc agtgccagct cagtgatgcg ccctgataaa tgcgcatcag     24180
     cagccggacg gtgagcctca tagcggcagg tcgacaggga taaacctgta agcctgcagg     24240
     cacgacgttg cgacagaccg gtcgcatcac acatcaacat cacggcttcc cgcttctggt     24300
     ctgtcgtcag tactttcgcc caagagccac ctgaagcgcc tctttatcca gcatggcttc     24360
     ggcaagcagc ttcttgagtc tggtgttctc ttcctcaagc gacttcaggc gcttaacttc     24420
     aggcacctcc ataccgccat acttcttacg ccaggtgtaa aacgtggcat cggaaatggc     24480
     atgcttgcgg cagagttcac gggcgggtac cccagcttcg gcttcgcgga gaatactgat     24540
     gatctgttcg tcggaaaaac gcttcttcat ggggatgtcc tcatgtggct tatgaagaca     24600
     ttactaacat cggggtgtac taatcaacgg ggagcaggtc agattcattg caccatcttc     24660
     tcaccgaccg cgtcagcctc tctgcgtatg ttaccggaac agcacgccgc agaagcgcgc     24720
     tatcctattc ctgttgagga tttccatttc agtattttca ctgcggtgaa caatcaaacg     24780
     gtaatgacat ccagcgctga aattgtgtta gtgattgagg ggaccgcgac attaagccat     24840
     gccagcggcg agagcctttt gcttcacgtc gggctgtcag catttatccc agcctccatc     24900
     gggcgatggt tgctgactac gactgggaaa gtctgtcgag tatcgtgtta atgtaaaatt     24960
     agagggggta cagccccctt gtttgtgttt acttagccct aaataaggtt gagtctatcc     25020
     cgcgcgtcct gcaggcgttg ctccccgcga cggtcatact gctgggtggt ggtgacgctc     25080
     gcgtggccca tcgcatcctt cacggtaatt aaatcctccc cgttatccag catcgcggtg     25140
     gcgaaggttc gcctcagatc gtgtggagaa catttcgtga tgccggcctg accctggcgc     25200
     acctgcagga tatggtacac cgcctggtcg gttagccggt ttagagtcac atccccgaaa     25260
     cgacggatgc gtgtgaacag cgggcccggg gtctcgcccc ggatctcatc gatccagatc     25320
     tgcagccgct gccaggcacc ggccgggaca tatgccagtc gctccttgtt tcccttaccc     25380
     agcactctaa gcgcacggtc ctgagtgaca acgtcacgca aatccaggct cactacttcg     25440
     gatcgtcgca ggccgcagcc gagaatgacc gccagcatcg ctgcatcccg cgccccgagg     25500
     cagctgcgat cggcttcaca gacggcaaac agggcgcgga tctccccctg gggcagcgcc     25560
     cgaccgctgg gcagccgact gccgcgcagg ttacggaccg cccggatatg ctggaagctc     25620
     tccacatcca tgagccggag catccaggct tccttcgcca cgcccttgag tgccgaaaga     25680
     taggtgttga cggtggcggt ggcccggccg gtgtcgcgca gcagttcggt cacggccatc     25740
     acgtgatggc gccgcaggct gccccagctg caggactcca gggaggcagc tccgagcata     25800
     acggcgacga tgttcaggaa cgaggccatg gtctgccggc tgcggtggga attgagtgaa     25860
     agcaggtagg cccgggccgg gctgaccggg gcattctcac ctgacagcgc cggcaggaat     25920
     tcctcactgg ctgcgggcag actcagctcc ggttcgtcat cgggaatcag gatcatgtcg     25980
     ggctccgtcc ggcgcgctgc gtaaaaaatc gggggcaaac ttactgtcag agcgtaccgc     26040
     agaaagtcta ctttttcaaa ggtacatttt aataagtaga cttgaagcac ttgttcttag     26100
     ctgtacgatt acggtgatgc tgccaactta ctgatttagt gtatgatggt ggttttgagg     26160
     tgctcccgtg gcttccatct ccatcagttg tccctcctgc tcagctactg aaggcgtggt     26220
     gcgtaacggt aaaagtactg ccggacatca gcgctatctc tgctctcact gccgtaaaac     26280
     atggcagcta cagttcactt acaccgcctc tcaggccgca gtcggtaaac tcacgcatac     26340
     aaccgggcag tgacgtcatt gtttgcgcgg aaatggacga acagtggggt tacgtcggcg     26400
     ctaaatcacg ccagcgctgg ttgttttacg cgtatgacag gatacggagg acggttgttg     26460
     cacacgtctt cggtgaacgt actatggcca cgctggagca tcttctgagc ctgccgtcgg     26520
     tctttcaggg cgcgtagttc cttttaaaca ccagttctgt atctctttta aagatccttt     26580
     aataaatcct gtaaacacat aacctcttca tcgcctaccc tgtggacagg ctccggagaa     26640
     tgcccgctct tgcagcgacc tgacggtcgc gccggttcgg caacatcaga aagagctccc     26700
     atcgcttcgc gaagggcccc gaccggagaa ccaaattagt tacagcattc aaaagaaagc     26760
     tcatcataaa accggcgccg gtttgccggc cgggtgcccc tccccaccac tgaaaagcgc     26820
     cgccgccccc ggccgaaggc cgggagtagt gtcgctttta atgatgggtg ttgtaactac     26880
     tcttcttcat cgctgtgggt ggagctgcgg tcagttgtcg ggtacacgct cgtaagcggc     26940
     ccttcggccc gctaacgcgg agatacgccc cggctgcggc tgacgccttg ccgggaccac     27000
     tccgaccgcg tacaggggag cccgcagaat tcggaaaaaa tcgtacgcta aggttttccg     27060
     ggcatccgta agggccgaaa cttcccgtct tccagtctgc ggctctgccg ccagacgtaa     27120
     tcgccggtta ggttgatgtg ctcccagccc agcggcgaca ggaattgcag cagctcgccg     27180
     tccaccggct tgccggcctc gaccaacccc tgggtggcgc gttccaggta caccgtgttc     27240
     cacagcacga tagccgccgt caccaggttg aggccgctgg cccggtagcg ctgctgctcg     27300
     aagctccgat ccctgatttc cccaaggcgg ttgaagaaca ccgccctggc cagcgagttg     27360
     cgcgcctcac ctttgttcag gccggcatgc acgcggcggc gcagttcaac actttgcagc     27420
     cagtccagga tgaacagcgt gcgctcgatc cggcccagct cgcgcagggc cacggccagt     27480
     ccgttctggc gcgggtagct gccgagcttg cgcagcatca gcgaggcggt gacggtgccc     27540
     tgcttgatcg agctggccag gcgcaggatg tcgtcccagt gggcacgcac gtgcttgatg     27600
     ttcagggtgc cgccgatcag cgggcgcaac gtcgggtagg cttgcacgcc ctgcggcacg     27660
     tacagcttgg tttcgccgag gtcgcggatg cgcggcgcga agcggaagcc tagcaggtgc     27720
     atcagggcaa agacgtgatc ggtgaagccg gccgtgtcgg tgtagtgctc ctcgatccgc     27780
     aggtcggact cgtggtacag caggccgtcg agcacatagg tggaatcgcg gacgccgaca     27840
     ttcaccacgc gggtgctgaa cggcgcgtac tggtcggaga tatgggtata gaacagccgt     27900
     cccggctcgc taccgtactt cgggttgacg tgcccggtgc tctcgccccg gccacccgcg     27960
     cggaagcgct ggccatcgga ggatgaggtc gtgccgtcgc cccagtgggc ggcaaaggcg     28020
     tggcgatact ggtggttgac cagctcggcc aaggccgccg aataggtttc gtcgcggatg     28080
     tgccaggctt gcagccagga cagcttggcg taggtcaggc cggggctcga ctcggccatc     28140
     ttggtcagcc cgaggttgat cgcatcaccg aggattgcgg acagcagcaa cgtcctgtct     28200
     ttggcctcgg ccccgtcctt caagtgggtg aagtggcggc tgaagcccgt ccagtcgtcc     28260
     acgtccatca gcagttcggt gatcttgatg cgcggcagta actggctggt ttggtcgatc     28320
     agcgcctgcg cccgatccgg caccgccgca tccagcgggg tgattttcag ccctgactcg     28380
     gtgaggatgg catcgggcag ctcgttgtcc ttggccaggc gggtgacggt ggccaactgc     28440
     tcgtccagca gctgcaaacg ctcttccagg tactggtcgc tgttcgggtt gatcgccagg     28500
     ggcagggcct gctcgcgctt gagtgcggcg aacttctcgg ccggcagcag gtagtcgtcg     28560
     aagtcgcgga actgccgcga gcccttgacc cagatgtcgc cggagcgcag ggcgttcttc     28620
     agctcggaca gggcgcagat ttcgtagaat ttccggtcga ggccttccgg ggtgatcacc     28680
     agcggcttcc agcgcggctt gatgaaggcc gtgggtgcat cggccggcac cttgcgcagg     28740
     ttgtcggcgt tcatctcacg cagggtctgc acggctgcca gcacgccttg cgcggccggc     28800
     gcgtgctgtt ccccaacttt tcgctcggcg aagagtatga acatgcgccg ccggcgacga     28860
     atcgccaaat ctcaccgtat ctcccgagcg gacgatttcg caccggtctg cccgtcgaag     28920
     ggcttgcgat cgaacggggc gaccttttct atgcatgtcc gcgagccagc gtcttttatg     28980
     gcacggcgct cgacgccgac cttcggacgc gcggcgtaag cacgcttgtc atggccggga     29040
     taagcaccac cggcgttgtt ctttcaagcg tcgcctgggc tagtgatgcg gactacgacg     29100
     tgcgtttggt ccaggactgc tgctacgacc cggatcggga tgcccacgaa gctctgttgc     29160
     gttccgggtt cggcggacgt gtacaggtcg tgtaattttc gggcctcgca tgatcgcggc     29220
     catagccgca ggtggattgg tgcgaggcag ggccagtcca agtcagggtg cggtcatcgc     29280
     ggcgcctgca actctcaaaa acccatcgcc gtagcggagg tcttgtaatc gcatgtcatt     29340
     acgcacgccc gatttattgt tcacagcgat agcacctgcc atttggggca gcacctacat     29400
     tgtcaccacc caatacctgc cgaacttctc accgatgacg gtcgcgatgc tgcgggcgtt     29460
     gccggcgggt ttattgctcg tgatgatcgt ccgacagatt ccaacgggaa tctggtggat     29520
     gcgcatcttc atcctcggcg cacttaatat ttcgctattc tggagcttgt tgtttatttc     29580
     ggtctaccgc ctgccgggcg gggtcgcggc gacggtaggc gctgtgcagc cgctgatggt     29640
     cgtgttcatc tctgccgctc tgctaggtag cccgatacga ttgatggcgg tcctgggggc     29700
     tatttgcgga actgcgggcg tggcgctgtt ggtgttgaca ccaaacgcag cgctagatcc     29760
     tgtcggcgtc gcagcgggcc tggcgggggc ggtttccatg gcgttcggaa ccgtgctgac     29820
     ccgcaagtgg caacctcccg tgcctctgct cacctttacc gcctggcaac tggcggccgg     29880
     aggacttctg ctcgttccag tagctttagt gtttgatccg ccaatcccga tgcctacagg     29940
     aaccaatgtt ctcggcctgg cgtggctcgg cctgatcgga gcgggtttaa cctacttcct     30000
     ttggttccgg gggatctcgc gactcgaacc tacagttgtt tccttactgg gctttctcag     30060
     cccggggacc gccgtgttgc taggatggtt gttcttggat cagacgctga gtgcgcttca     30120
     aatcatcggc gtcctgctcg tgatcgggag tatctggctg ggccaacgtt ccaaccgcac     30180
     tcctagggcg cgtatagctt gccggaagtc gccttgaccc gcatggcata ggcctatcgt     30240
     ttccacgatc agcgatcggc tcgttgccct gcgccgctcc aaagcccgcg acgcagcgcc     30300
     ggcaggcaga gcaagtagag ggcagcgcct gcaatccatg cccacccgtt ccacgttgtt     30360
     atagaagccg catagatcgc cgtgaagagg aggggtccga cgatcgaggt caggctggtg     30420
     agcgccgcca gtgagccttg cagctgcccc tgacgttcct catccacctg cctggacaac     30480
     attgcttgca gcgccggcat tccgatgcca cccgaagcaa gcaggaccat gatcgggaac     30540
     gccatccatc cccgtgtcgc gaaggcaagc aggatgtagc ctgtgccgtc ggcaatcatt     30600
     ccgagcatga gtgcccgcct ttcgccgagc cgggcggcta cagggccggt gatcattgcc     30660
     tgggcgagtg aatgcagaat gccaaatgcg gcaagcgaaa tgccgatcgt ggtcgcgtcc     30720
     cagtgaaagc gatcctcgcc gaaaatgacc caaagcgcgg ccggcacctg tccgacaagt     30780
     tgcatgatga agaagaccgc catcagggcg gcgacgacgg tcatgccccg ggcccaccgg     30840
     aacgaagcga gcgggttgag agcctcccgg cgtaacggcc ggcgttcgcc tttgtgcgac     30900
     tccggcaaaa ggaaacagcc cgtcaggaaa ttgaggccgt tcaaggctgc cgcggcgaag     30960
     aacggagcgt ggggggagaa accgcccatc agcccaccga gcacaggtcc cgcgaccatc     31020
     ccgaacccga aacaggcgct catgaagccg aagtgccgcg cgcgctcatc gccatcagtg     31080
     atatcggcaa tataagcgcc ggctaccgcc ccagtcgccc cggtgatgcc ggccacgatc     31140
     cgcccgatat agagaaccca aaggaaaggc gccgtcgcca tgatggcgta gtcgacagca     31200
     gcgccggcca gcgagacgag caagaccggc cgccgcccga aacgatccga cagcgcgccc     31260
     agcacaggtg cgcaggcaaa ttgcatcaac gcatacagcg ccagcagaat gccatagtgg     31320
     gcggtgacgt cgttcgagtg aaccagatcg cgcaggaggc ccggcagcac cggcataatc     31380
     aggccgatgc cgacagcgtc gagcgcgaca gtgctcagaa ttacgatcag gggtctgttg     31440
     ggtttcacgt ctggcctccg gaccagcctc cgctggtccg attgaacgcg cggattcttt     31500
     atcactgata agttggtgga catattatgt ttatcagtga taaagtgtca agcatgacaa     31560
     agttgcagcc gaatacagtg atccgtgccg ccctggacct gttgaacgag gtcggcgtag     31620
     acggtctgac gacacgcaaa ctggcggaac ggttgggggt tcagcagccg gcgctttact     31680
     ggcacttcag gaacaagcgg gcgctgctcg acgcactggc cgaagccatg ctggcggaga     31740
     atcatacgca ttcggtgccg agagccgacg acgactggcg ctcatttctg atcgggaatg     31800
     cccgcagctt caggcaggcg ctgctcgcct accgcgatgg cgcgcgcatc catgccggca     31860
     cgcgaccggg cgcaccgcag atggaaacgg ccgacgcgca gcttcgcttc ctctgcgagg     31920
     cgggtttttc ggccggggac gccgtcaatg cgctgatgac aatcagctac ttcactgttg     31980
     gggccgtgct tgaggagcag gccggcgaca gcgatgccgg cgagcgcggc ggcaccgttg     32040
     aacaggctcc gctctcgccg ctgttgcggg ccgcgataga cgccttcgac gaagccggtc     32100
     cggacgcagc gttcgagcag ggactcgcgg tgattgtcga tggattggcg aaaaggaggc     32160
     tcgttgtcag gaacgttgaa ggaccgagaa agggtgacga ttgatcagga ccgctgccgg     32220
     agcgcaaccc actcactaca gcagagccat gtagacaaca tcccctcccc ctttccaccg     32280
     cgtcagacgc ccgtagcagc ccgctacggg ctttttcatg ccctgcccta gcgtccaagc     32340
     ctcacggccg cgctcggcct ctctggcggc cttctggcgc tcctgctgcg gcgtccgctc     32400
     gtgggccgtg gcgcgggtcc gcgcgccggc ctcgtgcgcc tggcgctcgc gggcgaggtc     32460
     cagggcggcc gtcttcacgt tctgccttgc gcagatgaga taggggagcc cgcagaattc     32520
     ggaaaaaatc gtacgctaag gttttccggg catccgtaag ggccgaaact tcccgtcttc     32580
     cagtctgcgg ctctgccgcc agacgtaatc gccggttagg ttgatgtgct cccagcccag     32640
     cggcgacagg aattgcagca gctcgccgtc caccggcttg ccggcctcga ccaacccctg     32700
     ggtggcgcgt tccaggtaca ccgtgttcca cagcacgata gccgccgtca ccaggttgag     32760
     gccgctggcc cggtagcgct gctgctcgaa gctccgatcc ctgatttccc caaggcggtt     32820
     gaagaacacc gccctggcca gcgagttgcg cgcctcacct ttgttcaggc cggcatgcac     32880
     gcggcggcgc agttcaacac tttgcagcca gtccaggatg aacagcgtgc gctcgatccg     32940
     gcccagctcg cgcagggcca cggccagtcc gttctggcgc gggtagctgc cgagcttgcg     33000
     cagcatcagc gaggcggtga cggtgccctg cttgatcgag ctggccaggc gcaggatgtc     33060
     gtcccagtgg gcacgcacgt gcttgatgtt cagggtgccg ccgatcagcg ggcgcaacgt     33120
     cgggtaggct tgcacgccct gcggcacgta cagcttggtt tcgccgaggt cgcggatgcg     33180
     cggcgcgaag cggaagccta gcaggtgcat cagggcaaag acgtgatcgg tgaagccggc     33240
     cgtgtcggtg tagtgctcct cgatccgcag gtcggactcg tggtacagca ggccgtcgag     33300
     cacatagggg tcgtttgcgg gagagggcga aatcctacgc taaggctttg gccaacgata     33360
     ttctccggta agattgatgt gttcccaggg gataggagaa gtcgcttgat atctagtatg     33420
     acgtctgtcg cacctgcttg atcgcggccg cgatagctag atcgcgttgc tcctcttctc     33480
     catccgcgtt ccaagctgcg gaaaggcacc cataaggggt cgtctcagaa aacggaaaat     33540
     aaagcacgct aagccggtgg cagcggtcgc aatggcctaa acttccccgc accgaccttg     33600
     gcgctgctgc gccataggta atcgccggtc aggttgatgt gctcccaccc cagcggcgac     33660
     agatattgca acaatgtgtc gtccagcgcc gtgccgttgc cacgcaaagc actggtggca     33720
     cgctccagat ataccgtgtt ccacaacacg atggccgccg tcaccagatt gaggccgctg     33780
     gcccggtagc gctgctgctc aaaactgcgg tcgcggattt cacccaatcg gtagaagaag     33840
     accgccctgg ccagcgcgtt gcgcgcctcg cccttattca gccccgcatg gacgcggcgg     33900
     cgcagctcca cgctttgcag ccaatccaaa atgaacagcg tgcgctcgat gcgccccagc     33960
     tcgcgcaacg ccacggccaa gccgttctgg cgcgggtagc tgccgagttt gcgcagcatc     34020
     agcgaagccg ttaccgtgcc ttgcttgatg gaggtggcca gccgcagaat ttcatcccaa     34080
     tgggcgcgta tttgcttgat gttcagcctg tcgctgctaa tcatcggctt gagcgcgtca     34140
     taggcggcat cgcccttggg gatgaatagc ttggtttcgc ccaagtcacg gatacgcggc     34200
     gcgaagcgaa atcccagcaa atgcatcaag ccaaacacgt gatcggtgaa gcctgccgtg     34260
     tcggtgtagt gttcctcgat gcgcaagtcc gactcgtggt acagcaggcc atcaagcacg     34320
     taagttgaat cacgaatgcc cacgttgacc accttggcac tgaagggcgc gtactggtcg     34380
     gagatatggg tgtagaaagt ccgtcctgga ctgcttccat acttcgggtt gatatgacca     34440
     gtgctttctg ctttgctgcc ggttctgaag ttctggccgt ccgacgatga cgtggtgccg     34500
     tcaccccagt tgccggcgaa gggttgccga aactgcgcat tcaccagctc ggccagcgcc     34560
     gtcgaatagg tttcatcgcg gatgtgccag gcttgcagcc aagacagctt ggcgtaggtg     34620
     gtgccagggc aggactcggc cattttggtc agacccaggt tgatcgcgtc ggccaggatc     34680
     gtcgtcaaca gcaaggtttt gtccttggcc gtgtcgctgg tcttcaggtg tgtgaagtgg     34740
     cgggtgaagc ccgtccattc atcgacctcc atcagcaact cggtgatttt gaggtgcggc     34800
     agcagcatag ctgtctggtc gatcatggct tgcgcggcgt ctggtactgc cgcgtccagc     34860
     ggcgtgatct tcaggcctga cgcggtggtg atgatggcat ccggtaagtc gttggccgca     34920
     gccatgcggt tgactgtggc gagttgcgcc tccaacaatt ccaaccggtc atgcaggtat     34980
     tggtcgcagt cggtggccac tgccagcggc aattcgctgg ccagcttcaa agtggcgaac     35040
     ttctcgaccg gcaccaggta ttcgtcgaag tccttgaact ggcgagaacc ctgcacccag     35100
     acatcaccgg agcgcagcgc gttcttcagc tccgacaggg cgcataactc gtagtaacgc     35160
     cggtcgatgc cgtcgtcggt cagaaccagc tttgcccagc gcggcttgat gaatgcggtt     35220
     ggcgcatcgg cgggcacctt gcgcgcgctg tcgctgttca tgccgcgcag catgtcgatg     35280
     gcatcgagca cacccttggc ggcgggcgca gcccgcaatt tgagcacgcc caggaactgc     35340
     ggcgcgtagc ggcgtagcgt ggcatagctt tcaccgatgt ggtgcaggaa atcaaagtcg     35400
     gcaggccgcg ccaatgtttg cgcttcggtg acgctggcgg cgaaggtgtc ccagggcata     35460
     acggcctcga tggcggcgaa cggatcgctg ccgctttgct tggcctcaat caacgcttga     35520
     ccgatgcgcc catacatccg caccttgtcg ttgatcgcct tgccggaagc ctggaactgc     35580
     tgctgatgct tgttcttggc cgcgttgaac agcttgccga tgatgcgatc gtgaaggtcg     35640
     atgatttcat cggtgacggt ggccatgcct tcgatggcca gcgctaccag cgtggcatag     35700
     cgtcgttgca cctcgaactt tgccagatca gcaggcgtca tctggccacc ttcacgagcg     35760
     attttgagca ggcggttctg gtgaacctgc cgctcgatgc ctgcgggcag atcaagtgct     35820
     tgccaggatt tcaggcgctc aatatgttcg agcatgtggc gagagttcgg tttggcaggc     35880
     gactggcgca gccatgccag ccacgtcact ttactgccgt ccttgcgctt gagaagttcg     35940
     tccaggcgct gacggtgggg tgataacaaa gaatcggtca gcgccgcgta aatgcgtcgg     36000
     ttggcacggg tgatggcctc ggcgcttgcg cgctcgatgg cattcatggc gggcaggata     36060
     atgctctgcc gccgcagatt ctcgacaagt gcgctcgcca gcacgatgcc tttgtcggtc     36120
     tgcaaggcca gctcggtcaa tgtatgcacg gcttgccgat agtggctcat ggtgaagggc     36180
     ttgaacccaa aaaccgtttg cagctcgacc aagtgctccc gccgtgtctg ttcgcgctgg     36240
     ccgtactcgc tccaactttc cactggcatc ttgagttgcg cggccaccat gcgcaacagg     36300
     ggcggaaacg gaggctcatc gacgcccaaa aaggtgccag ggaatcgcaa gtagcaaagc     36360
     tgcacagcga agcccaatcg attcgcggcg ccgcgacgct gacggatcac cgacaggtcg     36420
     gtttcgttga acgtgtagtg ccgtatcagt tcgtctttgg catctggcag tgccagcagg     36480
     ctttcgcgct cggtggcgga caggattgag cggcgtggca tggtcagtct tcccgcaggt     36540
     actggtacaa ggtttcgcgg ctgatgccga agtcacgggc caccaaggtt ttttggtcgc     36600
     ctgccgcaac tcgccgtttc aactcggcaa tttgttcgct gttcagcgat ttctttcgtc     36660
     cccggtaggc accgcgctgc ttggccagca cgattccctc gcgctgacgt tcgcggatca     36720
     gggcgcgctc gaactcagcg aaggctccca tgaccgacag catcagattg gccatcggtg     36780
     agtcctcgcc ggtgaacttc agcccttctt tgacgaactc catgcgcacg ccccgttgtg     36840
     tcagcccttg gacgatgcgg cgcaggtcat caaggttgcg tgccagcctg tccatgctat     36900
     gcaccaccac ggtgtcgccc tcgcggacga aggccagcag cctttccagc tcgggacgct     36960
     gggtgtcctt gccagaagcc ttgtcggtga acacccgcgc cacctgaaca ccctccaatt     37020
     gccgttccgg gttctggtcg aagctgctga cgcggacata gccgatgcgt tgaccttgca     37080
     agatgcctcc aaaggcaaaa gtgtcaggat gaaatctatt acctttgacg gaatatgtca     37140
     atcaatagga aatttaactc tattctgaca tcgtttgcac atggtgtcgt tttcagaaga     37200
     cggctgcact gaacgtcaga agccgactgc actatagcag cggaggggtt ggatccatca     37260
     ggcaacgacg ggctgctgcc ggccatcagc ggacgcaggg aggactttcc gcaaccggcc     37320
     gttcgatgcg gcaccgatgg ccttcgcgca ggggtagtga atccgccagg attgacttgc     37380
     gctgccctac ctctcactag tgaggggcgg cagcgcatca agcggtgagc gcactccggc     37440
     accgccaact ttcagcacat gcgtgtaaat catcgtcgta gagacgtcgg aatggccgag     37500
     cagatcctgc acggttcgaa tgtcgtaacc gctgcggagc aaggccgtcg cgaacgagtg     37560
     gcggagggtg tgcggtgtgg cgggcttcgt gatgcctgct tgttctacgg cacgtttgaa     37620
     ggcgcgctga aaggtctggt catacatgtg atggcgacgc acgacaccgc tccgtggatc     37680
     ggtcgaatgc gtgtgctgcg caaaaaccca gaaccacggc caggaatgcc cggcgcgcgg     37740
     atacttccgc tcaagggcgt cgggaagcgc aacgccgctg cggccctcgg cctggtcctt     37800
     cagccaccat gcccgtgcac gcgacagctg ctcgcgcagg ctgggtgcca agctctcggg     37860
     taacatcaag ggcactgttg caaagttagc gatgaggcag ccttttgtct tattcaaagg     37920
     ccttacattt caaaaactct gcttaccagg cgcatttcgc ccaggggatc accataataa     37980
     aatgctgagg cctggccttt gcgtagtgca cgcatcacct caataccttt gatggtggcg     38040
     taagccgtct tcatggattt aaatcccagc gtggcgccga ttatccgttt cagtttgcca     38100
     tgatcgcatt caatcacgtt gttccggtac ttaatctgtc ggtgttcaac gtcagacggg     38160
     caccggcctt cgcgtttgag cagagcaagc gcgcgaccat aggcgggcgc tttatccgtg     38220
     ttgatgaatc gcgggatctg ccacttcttc acgttgttga ggattttacc cagaaaccgg     38280
     tatgcagctt tgctgttacg acgggaggag agataaaaat cgacagtgcg gccccggctg     38340
     tcgacggccc ggtacagata cgcccagcgg ccattgacct tcacgtaggt ttcatccatg     38400
     tgccacgggc aaagatcgga agggttacgc cagtaccagc gcagccgttt ttccatttca     38460
     ggcgcataac gctgaaccca gcggtaaatc gtggagtgat cgacattcac tccgcgttca     38520
     gccagcatct cctgcagctc acggtaactg atgccgtatt tgcagtacca gcgtacggcc     38580
     cacagaatga tgtcacgctg aaaatgccgg cctttgaatg ggttcatgtg cagctccatc     38640
     agcaaaaggg gatgataagt ttatcaccac cgactatttg caacagtgcc catcggcgta     38700
     gtagtggatg tggtcgatga caaagccggt gcgggtcagc gtgcgccgga ggatcggcag     38760
     aaaatcgacc aggaacgaag tagcgcgtgt gacgacggcc ggtacgccga cacgcgccac     38820
     ggcctcggcc cagcgcgcgg ccggcggttg gagcaggccg ttgtgcaccg aaccgtggta     38880
     ggtgccgacc gccaatgtga gccagcgctc tagctcgcgc agcgtcaggg cggccttgtt     38940
     ttcggaatcg tagtcgccgc gctggtcagg gttggagaag gtcgttcccg gcagttcgtc     39000
     gtgaatcatc tgcatcgccg tgccgatgat ccgttccacg atgccgccat agtgcggctg     39060
     tcccagcggg cgatagtcca gccggatgcc atgctgctcg caaccccggc gcagggcctc     39120
     gctcttgaac tcggccgcgt tgtctaggta gagcagcaag ggcttgccgc tcatctgcca     39180
     atccatttcc acgttcagtc cttccagcca agggcgcttg tcgcaggcga catgcacgag     39240
     gcacaggcca accgaaacgg cagacggcgc ttccagcgtg acgaccatgc cgagcacgca     39300
     gcgggtgaac acgtcgatgg cgagggtcag gtacgggcgg ccaataggtt gccggtcgcg     39360
     gtcatcgacc acgatcaggt cgatgaccgt atggtctatc tgcacctgct ccagcggcgc     39420
     ggtcacggca ggaggctcgc cgcccacacc ttgtaggtca cgagcggcat cctggccttc     39480
     ccgccggcgg atgaccttgc gcgggtcaag gctagcgatc cgtaaggcca cggtattgcg     39540
     cgccggcact cgcagttttt gagccttgca cacctgagtg acttcgcggt gaaaggccgc     39600
     taggctgcgc ttctgcttgg tcaggaaccg cttttgcagt agctcgtgga tgacgcgctc     39660
     gaccggttcc ggcaagcgcc ccttaccttt acctccaccg gactggccgg gcaccagatc     39720
     cgtcacgagg ccgctgcctt gccgggcacg ccggatcaga acgtatacct ggcgccgaga     39780
     caagcccagc gcctgagccg ccatatcggc cgcttcgtgc ccgaccatct ccgactgcgc     39840
     caacggactg atgatctccg cacgacggcg cgcacgctcc caagcctcat caggcagagt     39900
     ggccacgcct tgttctggaa tccgtggggt gtccgtcgcc atgctcacct cgctttggtg     39960
     cacacgagta ttgagcatag tcgagattgg tgcagatcac ttctgatatt gaactgtcag     40020
     gagctggctg cacaacagcc attacgccca atcaactggt gcagtcgtct tctgaaaatg     40080
     acatccatgc ccagcccgtg cgcgagctgg atcaccgccc gcacgatagt ttggtcacgg     40140
     gcatcatccg ggagcctggc gacaaaggat tggtcgattt tcaatgtggt gatggggcag     40200
     catttcagat gttgcaggca ggaatagccg gtgccgaagt cgtcggcggc gaagcgcacg     40260
     ccgatggcgc gcaaggcgtc gaaactggcg aacagggctg gattgccgaa tgcgaccgat     40320
     tcggtcagtt cgatctccag aagctcggcg ggcagggcca tatcggccag cacccgcttt     40380
     acctcgtcgt cgaacgttgg cccaacctgg ctggcggaca cattgatggc aagacggaac     40440
     ggttgccatg ccggtccttg ccacttgtgc atctggcgac aggcctcgcc cagcacccac     40500
     gcgcctattt ccggcatcag gccgaacgac tcggccagcg gcaggaactg gccgggcggc     40560
     aacaggccaa gcctcggatg ccgccagcgc atcaacgctt ccgcgccagc gatccggtga     40620
     tcgcgcagat cgaccagcgg ctggtaatgc aggtcaagct gtccgcgcgc cgccgcctgc     40680
     gccaactcgg ccgccgtcca tccggcgggc tgcgaactcg tcatgatccg ccccggaagg     40740
     cgcgcagcag ccgcgttacg gccagaacga acaagccggt cagcgcgagc gcggcaacac     40800
     cccaatgctc gccaaggaag gcaccggcgg tcgtcccggc cagcacggcg gcgagaatcg     40860
     gcagatggca ggggcaggtc aacacggcca gcgcacccca caggtagccg gaaacgggtt     40920
     ggcgcgtctc gggcggcagt ttgtcagggg cgttcacggc aatgcctcct cgtgcgcccg     40980
     ctcggctggc atggaggcca gttgcgcgtc cagatgggcc aacgccgcgc gccgccgctc     41040
     gaccaactgg cgcagcacgg caagctgcgc tgcggcttgt gcgccgtccg ctgcgtcgag     41100
     cgcacggcac agccgcgcca gggcatccag gccgataccc gcctcgaagg ccgcgcgcac     41160
     gaagcacagc cgttgcaagg ccgcatcgtc gaacacgccg tagccgcccg tggtgcaggc     41220
     caccggccgt aacaagccgc gcaccaggta gtcgcgcacg atatgtacgc tcaccccagc     41280
     gttatgggcc agttgcgata ccgtgtaggc gctcatcgca cacctccttg tcctcacccg     41340
     gcgcagcagg aaagctgctt cacatccttg ttgaaggtct gcgccgcgag cttcaaccct     41400
     tcgaccatcg tcaggtaggg gaacaactgg tcggccagtt cctgcaccgt catccggttg     41460
     cgaatcgcca gtgcggccgt ctggatcagt tcgcccgctt ccggggccac tgcctgcacg     41520
     ccgatcagtc gtccgctgcc ttcttcaacc accagtttga tgaagccgcg cgtgtcgaag     41580
     ttggcgagcg cgcgcggcac gttgtccagc gttagcgtgc gactatcagt tttgatgccg     41640
     tcatggtgcg cttccgcctc gctgtagcct acggtcgcca cttgcgggtc ggtgaacacc     41700
     acggccggca tcgcggtcag gttcagggcc gcgtcaccgc cggtcatgtt gatcgcggcg     41760
     cgagtgccgg ccgctgccgc cacatagacg aactgcggct ggtcggtgca gtcgcctgcg     41820
     gcgtagatgt gttccacgct tgtacgcatg ccggggtcga tgacgatagc gccttgcggg     41880
     gtgagcgtga cgcccgtcgc atccagtgcc agcttgcgtg tgttgggcgc gcggccggtg     41940
     gcgaccagca gcttgtcggc gcgcagttcg ccgtgcgccg tggtgagcac gaattcgccg     42000
     tccccttcac cattgatata cgcgacctgg ctggcctggg tgtgttccct cacctcgatg     42060
     ccctccatgc ggaatgcggc cgtgacggct tcgcctatag ctgggtcttc gcggaagaac     42120
     agcgtgctgc gagccaggat cgtcaccttc gctccgagtc gggcgaacgc ctgcgccagc     42180
     tccagcgcca ccactgatga gccaatcacg gccaggcgct taggaatcgt ctcgctgacc     42240
     agcgcttcag tggaagtcca gtacggagtg tctttcaggc cgggaatcgg cggcacggcc     42300
     gggctcgcgc cggtggcgat caggcagcgg tcgaatgcca ccacgcgctc gccgccgtcg     42360
     ttgagttgca cgatcaggtt gcgattgtcc ttaaagcggg cggagccgtg cagcacagtg     42420
     atcgccggat tgccctccaa gatgccttcg tacttggcgt ggcgcagttc atcgacgcgg     42480
     gcctgctgct gggccagcag cgccgtgcgc tggatggtcg gcgtggtagc ggcgatgccg     42540
     ccatcgaacg ggctttcccg gcgcagatgg gcgatatggg cggcgcggat catgatcttg     42600
     gacggcacac aaccgacatt gacgcaggtg ccgccgatgg tgccgcgctc gatcagcgtg     42660
     acacgtgcgc cttgctcgac ggccttcagc gccgctgcca tcgcggcccc gccgctgccg     42720
     atgacggcga tatgcaatgc gccgctgcta cccgtcttgt cgtttctgcc cagcagatcg     42780
     cgcatcttgt cgagcaatcc gcccggcgtc gaaactgagg gggcatcggc cagcgtggcc     42840
     cgataaccga gtccagctac agcggccgtc agcgcgtcgg gtgacgtgcc gacctcaatg     42900
     gcgagcttgg cgctgccctt ggcgtaggag acatccgctg attgcacgcc gggcactttc     42960
     tccagggcgt ccttgacatg cactgcgcac gagtcgcaag tcatgccggt gattttgaga     43020
     gtgctcatac catcgttcct tattggggtc tgacgctcag tggaacgaaa actcacgtta     43080
     agggattttg gtcatgagat tatcaaaaag gatcttcacc tagatccttt taaattaaaa     43140
     atgaagtttt aaatcaatct aaagtatata tgagtaaact tggtctgaca gttaccaatg     43200
     cttaatcagt gaggcaccta tctcagcgat ctgtctattt cgttcatcca tagttgcctg     43260
     actccccgtc gtgtagataa ctacgatacg ggagggctta ccatctggcc ccagtgctgc     43320
     aatgataccg cgagacccac gctcaccggc tccagattta tcagcaataa accagccagc     43380
     cggaagggcc gagcgcagaa gtggtcctgc aactttatcc gcctccatcc agtctattaa     43440
     ttgttgccgg gaagctagag taagtagttc gccagttaat agtttgcgca acgttgttgc     43500
     cattgctgca ggcatcgtgg tgtcacgctc gtcgtttggt atggcttcat tcagctccgg     43560
     ttcccaacga tcaaggcgag ttacatgatc ccccatgttg tgcaaaaaag cggttagctc     43620
     cttcggtcct ccgatcgttg tcagaagtaa gttggcagca gtgttatcac tcatggttat     43680
     ggcagcactg cataattctc ttactgtcat gccatccgta agatgctttt ctgtgactgg     43740
     tgagtactca accaagtcat tctgagaata gtgtatgcgg cgaccgagtt gctcttgccc     43800
     ggcgtcaaca cgggataata ccgcaccaca tagcagaact ttaaaagtgc tcatcattgg     43860
     aaaacgttct tcggggcgaa aactctcaag gatcttaccg ctgttgagat ccagttcgat     43920
     gtaacccact cgtgcaccca actgatcttc agcatctttt actttcacca gcgtttctgg     43980
     gtgagcaaaa acaggaaggc aaaatgccgc aaaaaaggga ataagggcga cacgaaaatg     44040
     ttgaatactc atactcttcc tttttcaata ttattgaagc atttaccagg gttattgtct     44100
     catgagcgga tacatatttg aatgtattta gaaaaataaa caaatagggg ttccgcgcac     44160
     atttccccga aaagtgccac ctgacgtcta agaaaccatt attatcatga cattaaccta     44220
     taaaaatagg cgtatcacga ggccctttcg tcttcaagaa ttttataaac cgtggagcgg     44280
     gcaatactga gctgatgagc aatttccgtt gcaccagtgc ccttctgatg aagcgtcagc     44340
     acgacgttcc tgtccacggt acgcctgcgg ccaaatttga ttggcactgt tgcaaatagt     44400
     cggtggtgat aaacttatca tccccttttg ctgatggagc tgcacatgaa cccattcaaa     44460
     ggccggcatt ttcagcgtga catcattctg tgggccgtac gctggtactg caaatacggc     44520
     atcagttacc gtgagctgca ggagatgctg gctgaacgcg gagtgaatgt cgatcactcc     44580
     acgatttacc gctgggttca gcgttatgcg cctgaaatgg aaaaacggct gcgctggtac     44640
     tggcgtaacc cttccgatct ttgcccgtgg cacatggatg aaacctacgt gaaggtcaat     44700
     ggccgctggg cgtatctgta ccgggccgtc gacagccggg gccgcactgt cgatttttat     44760
     ctctcctccc gtcgtaacag caaagctgca taccggtttc tgggtaaaat cctcaacaac     44820
     gtgaagaagt ggcagatccc acgattcatc aacacggata aagcgcccgc ctatggtcgc     44880
     gcgcttgctc tgctcaaacg cgaaggccgg tgcccgtctg acgttgaaca ccgacagatt     44940
     aagtaccgga acaacgtgat tgaatgcgat catggcaaac tgaaacggat aatcaacgcc     45000
     acgctgggat ttaaatccat gaagacggct tacgccacca tcaaaggtat tgaggtgatg     45060
     cgtgcactac gcaaaggcca ggcctcagca ttttattatg gtgatcccct gggcgaaatg     45120
     cgcctggtaa gcagagtttt tgaaatgtaa ggcctttgaa taagacaaaa ggctgcctca     45180
     tcgctaactt tgcaacagtg cccaaggaag tgtatgaaaa atgtctggta taataaagat     45240
     atcatcttga aaatcgagtg ttgctctgtg gataacttgc agggtttaat aagtatcttt     45300
     actcaaaagt tgcaatcaat aatttattga aaaagattga aaggtggtgg taaataatgt     45360
     tacaatgtgg gagtatcagt ttaaattctt cgtgaaatag tgttctttta agctaataaa     45420
     aaatgcacgt ggaatttagg tcaaagaaaa gtaaagaaaa atttatttat ggaggtaaaa     45480
     aaggatgagt caagttgttg attttttaaa tgaagcaaaa actttttatt ttgcaaccgt     45540
     tgaaggagac cagccaaggg tcagaccgtt taatgcagcc atggagagga atggcaaggt     45600
     ctatcttggt acaaccaatc agaaaaaagt ttatcagcag ttattggcaa attcaaaggt     45660
     ggaagtctca ggtatggcaa aaggaaaatg gattcggctc accggcgaag ccgtaattga     45720
     tgataccgtg gaagcaaggg aagcaatgct tgaagcaaat ccgcctttga gagatatgta     45780
     tagcgctgat gatgggaaat tcaccgtatt ttatttgaaa aacatgcagg cagttttata     45840
     ttcctttaca ggagatccgg agatattaga taattaatca aaacatgcag cccaagtgta     45900
     gaatgaactg acccccataa gttagaccaa aaatctaact tatgggaggt cattttttat     45960
     ggcaaaatac agttatgaat ttaagttaca agttgttcaa gcatatttag atttttattt     46020
     tgtccgtttt gtctagctta ccgaaagcca gactcagcaa gaataaaatt tttattgtct     46080
     ttcggttttc tagtgtaacg gacaaaacca ctcaaaataa aaaagataca agagaggtct     46140
     ctcgtatctt ttattcagca atcgcgcccg attgctgaac agattaataa tagattttag     46200
     ctttttattt gttgaaaaaa gctaatcaaa ttgttgtcgg gatcaattac tgcaaagtct     46260
     cgttcatccc accactgatc ttttaatgat gtattggggt gcaaaatgcc caaaggctta     46320
     atatgttgat ataattcatc aattccctct acttcaatgc ggcaactagc agtaccagca     46380
     ataaacgact ccgcacctgt acaaaccggt gaatcattac tacgagagcg ccagccttca     46440
     tcacttgcct cccatagatg aatccgaacc tcattacaca ttagaactgc gaatccatct     46500
     tcatggtgaa ccaaagtgaa acctagttta tcgcaataaa aacctatact ctttttaata     46560
     tccccgactg gcaatgccgg gatagactat tattctcccc ggagccacta cgctgacccg     46620
     gttgatttca gaggtaaggg aaaaggcgac gttgcgcctg tggaacaaac tggcactgat     46680
     aggggtcgtc tcagaaaacg gaaaataaag cacgctaagc cggttgcaga ggccgtagcg     46740
     gcctgaactt ccccgcgccg atcttgacgc tgctgcgcca taggtaatca ccggtcaggt     46800
     tgatgtgctc ccagccgagt ggcgacaggt actgcaatag cgagtcatcg acggcatgac     46860
     cattgccgcg caacgcatgc gccgcacgct ccaggtagac cgtgttccac agcacgatgg     46920
     ccgccgtcac caggttgagg ccgctggccc ggtagcgctg ctgctcgaaa ctgcggtcac     46980
     ggatttcacc aaggcggttg aagaacacgg cacaggccag cgcattgcgc gcctcgccct     47040
     tgttcagccc ggcatgcacg cggcggcgta gctcgacgct ttgcagccag tcgaggatga     47100
     acagcgtgcg ctcgatgcgg cccaactcgc gcagcgcgac ggccaagccg ttctggcgcg     47160
     ggtagctgcc gagtttcctg agcatcagcg aggccgtcac cgtgccctgc ttgatcgagg     47220
     tggccagccg caggatttcg tcccaatggg cgcggacgtg cttgatgttg agcatgccgc     47280
     cgatcatcgg cttgagcgcg tcataggcgg catcgccctt cgggatgtag agcttggtgt     47340
     cgcccaggtc gcggatgcgc ggcgcgaagc ggaagcccaa gaggtgcatc agggcgaaga     47400
     cgtgatcggt gaagcccgcc gtgtcggtgt agtgctcctc gatccgcagg tcggattcgt     47460
     ggtacagcag gccgtcgagc acgtaggttg agtcgcgcag gccgacattg accaccttgg     47520
     tgtggaatgg cgcgtattgg tcggagatgt gggtgtagaa agtccgtcct gggctgctgc     47580
     catattttgg gttgatgtgc cccgtgctct ttgccttgct agcggttcgg aaattctgtc     47640
     cgtccgatga tgatgtggtg ccatcgcccc agtgcccggc aaagggatgc cgaaactgag     47700
     cgttgaccag ttcagccaac gctgtcgagt acgtttcgtc gcgggtatgc caggcttgca     47760
     gccaagcgag cttcgcgtag gtcgtgccgg ggcaggactc ggccatcttg gtcaggccca     47820
     ggttgatcgc gtcggccagg atcgtggtca acaacaggtt cttgtccttg gccagatcgc     47880
     ccgatttcaa gtgcgtgaag tgccgggtga agcccgtcca ctcatcgact tcgagcagca     47940
     gttcggtgat cttgacgtgc ggcaggacca tggctgtctg gtctatcagc gcctgcgcgg     48000
     tgtcgggcac cgccgcatcc agcggcgtga tcttcaagcc cgactcggtg atgatggcat     48060
     ccggcaggtc gttggctgcc gccatgcggt tgacggtggc aagttgtgct tccagcagcg     48120
     tcagccgctc atgcagatat tgttcgcagt cggtggccac ggccagcggc aattcgctgg     48180
     actgcttgag gctggtgaac ttctcgggcg gtaccaggta gtcctcgaag tccttgaact     48240
     ggcgtgaacc ctgcacccag atgtcgcccg agcgcaggga gttcttcaac tcggacagcg     48300
     cgcacagttc gtagtagcgc cggtcgatgc cggcgtcggt catcaccagt ttctgccagc     48360
     gcggcttgat gaagccggtc ggtgcatcgg ctggcagctt gcgggcgttg tcggtgttca     48420
     tgccgcgcag cacctcaatg gcatcaagca cgtttttggc ggcgggcgcg gcccgcagct     48480
     tgagcacggc aaggaattcc ggtgcatagc ggcgcagggt ggcgtagctc tcgccgatgc     48540
     gatgcaggaa atcgaagtca tcgggttgcg cgagcttctg cgcctcggtg acgctctcgg     48600
     caaaggaatc ccaggacatg acggcctcga tggcggcaaa cgcatcgcgg cctgattgct     48660
     tggcgtcgat cagcgcctga ccgatgcgcc cgtacagacg taccttggcg ttgatggcct     48720
     tgcctgacgc ctggaactgc tgctgatgct tattcttggc agcgttaaac agcttaccca     48780
     ggatgcggtc gtgcaggtcg atgatttcgt cggtgacggt ggccatgccc tcggtggcca     48840
     gcgccacgag agtggcgtag cgccgttgcg gctcgaattt ggccaggtcg gcgggtgtca     48900
     tctggccgcc ctcgcgggca atcttgagca ggcggttctg gtgaaccagc cgctcgatgc     48960
     cggtaggcag atcgagtgcc tgccatgcct tgaggcgttc gatgtgttcc agcatatgcc     49020
     gcgaatttgg cttggccgga gactggcgca accaagccaa ccaggtcgtc ttgccgttgt     49080
     cccggcgctt gagcagatcg tcgaggcggc ggcgatgcgc gtccgccagt ggttcggcca     49140
     aggcgtcgta gatgcgccgg ttagcacggg tgatcgcctc ggcactcgcc cgctcgacgg     49200
     cgttgagggc gggcagaatg accgactgcc gccgcaggtg cccgatcaag gcgctggcca     49260
     gcacgatgcc tttgtcggtt tgcatcgcca gctcggtcag catctggacg gcctgccggt     49320
     aatggctcat ggtgaagggc cggaaaccga acacggtttg cagctcgctc aggtgctcgc     49380
     gccgggtctg ctcccgctgg ccgtactcgt tccagctttc gacgccgacc ttgagctggt     49440
     cggcgaccag cttcaacaag ggcgggaacg gtagttcatc gacgcccagg atgacgccgg     49500
     gaaagcgcag gtaacagagc tgcaccgcga agcccagccg attggctggc ccgcgccgct     49560
     gtcggatgat cgagaggtcg gtatcgttga atgtgtaatg tcggatcagg tcgtccttgg     49620
     agtccggcaa cgccagcagg ctttcccgct cggcggcgga caggatggaa cgacgtggca     49680
     tatttactga tccgttctca agtattgata cagggtttcg cgactgattc cgaattcacg     49740
     agcaagcttg gtcttttgct cgccagcctc gacacgttgg cgcagttcgg caatacgctc     49800
     agacgacagg gatttcttcc tgccacggta agccccgcgt tgcttggcga gcgcaatacc     49860
     ctcgcgctga cgctcgcgga tcagggcgcg ctcgaactcg gcgaacgcgc ccatcaccga     49920
     gagcatcagg ttcgccatcg gagagtcttc gccagtaaaa ctgaggtgtt ccttgacgaa     49980
     ttcgatatgc acgccgcgtt gtgtcagcgt ttgcacgatc cggcgcaaat catcgagatt     50040
     gcgcgccagg cgatccatgc tatgcaccac cacggtgtcg ccggtgcggg cgaagcttat     50100
     cagcgcttcc agttgcggac gcttgacatc cttgccggat gccttgtcgc taaaagcgcg     50160
     atcaaccttg acgccttcca gttgccgttc cgggttctgg tcgaaggtgc tgaccctgat     50220
     atacccaatg cgctgtccag tcatggaatt ccctgcaaaa tgtcagggaa gactctatga     50280
     ccttcaacga gatatgtcaa taaattcaaa attcaatcct atcctgacgc aatttacaca     50340
     tggcatctga catcaggtta gggtatgcct caacctgacg gcggcgaatc acaagcgtcc     50400
     ggtttgacgc tggtttcggt cgcagtgctg gcccgcgcct ggaagcgctg atagcactcc     50460
     agcccgcaga aatgctccac gtactcggcc cggcactgtt gcaaatagtc ggtggtgata     50520
     aacttatcat ccccttttgc tgatggagct gcacatgaac ccattcaaag gccggcattt     50580
     tcagcgtgac atcattctgt gggccgtacg ctggtactgc aaatacggca tcagttaccg     50640
     tgagctgcag gagatgctgg ctgaacgcgg agtgaatgtc gatcactcca cgatttaccg     50700
     ctgggttcag cgttatgcgc ctgaaatgga aaaacggctg cgctggtact ggcgtaaccc     50760
     ttccgatctt tgcccgtggc acatggatga aacctacgtg aaggtcaatg gccgctgggc     50820
     gtatctgtac cgggccgtcg acagccgggg ccgcactgtc gatttttatc tctcctcccg     50880
     tcgtaacagc aaagctgcat accggtttct gggtaaaatc ctcaacaacg tgaagaagtg     50940
     gcagatccca cgattcatca acacggataa agcgcccgcc tatggtcgcg cgcttgctct     51000
     gctcaaacgc gaaggccggt gcccgtctga cgttgaacac cgacagatta agtaccggaa     51060
     caacgtgatt gaatgcgatc atggcaaact gaaacggata atcaacgcca cgctgggatt     51120
     taaatccatg aagacggctt acgccaccat caaaggtatt gaggtgatgc gtgcactacg     51180
     caaaggccag gcctcagcat tttattatgg tgatcccctg ggcgaaatgc gcctggtaag     51240
     cagagttttt gaaatgtaag gcctttgaat aagacaaaag gctgcctcat cgctaacttt     51300
     gcaacagtgc ccatttatga atgttcctgt tatggcttat gttcaagaaa gcattgcccc     51360
     tgaaatgatg ggcaaggtgt tttccctttt gatgaccgcc atgactcttt ctatgccgat     51420
     aggcttactt gttgcaggtc cggttgttga ggttataggt gttaatacat ggtttttctg     51480
     gtctggtgtt gcgttgatag taaacgctgt tctctgccgc attctgacac gacgctatga     51540
     caaagtaaca atgaaaccgc aagtggactg aaaaaaggac cgggttgatg ataatttgta     51600
     gtggtgagct tctgggagta caaaacaaag tgctcaaaat tgtcgggctc atggcgttta     51660
     acggtattaa tttcgcttat aataatcttt ctataatagc ctaaaggaga atatctatga     51720
     tacctaatag cgaaaataaa agagtatggt ttattaccgg agcaagcaag gggcttggct     51780
     atgcttttac atgcgccgcc ttgaaagccg gggataaagt tgttgcagtt gcaaggacta     51840
     tcgataattt ggcgaagcta gaagaaacat atcaagagag cttactgcca ttaaacctcg     51900
     atgttacaga tagggaggct gttttttcta cggttgaaac agcagttaaa catttcggta     51960
     ggcttgatat tgttgttaat aatgcgggta tcatgactat gggtatgatt gaagaactaa     52020
     acgaatccga tgctcggaaa ctaatggaca caaacttttt tggagctctt tgggtttgtc     52080
     aggcagtgat gccctatttg aggtcgcagc gttctggaca tatcatacag attacaagca     52140
     ttggcgctat tatctcgggt ccgatgtctg gtatttacag tgcaagtaaa tttgcgctgg     52200
     aaggaatgag tgaagcctta gcaaaagaag cggaacattt cggagtgaaa ctcactatgg     52260
     tggaaccagg aggatattgg acagatttat acacttcgat gagttacagc aatccattag     52320
     attcatacgg tacactgcgc gatgagctgg cgaaacagta ttccgaagat tcggtcgata     52380
     gtgatccttc cttggcagcg gaagccctta tgaaattagt agccagcaat aatccgcctt     52440
     tgaggcttat ccttggcagc atggtatacg atttggcgat ggatacctta aaagcacgga     52500
     tggctacctg ggaagaatgg gaagctgtta gccgtgcatc agaaaaggct attcctgcac     52560
     cggagagata tggagtataa taccaaacat ggtttttgag gcaaggacga aactatcatg     52620
     aaaattgaaa ttatggaata taacccggat tggacaaaga attttgaaga agagaaaata     52680
     aaattgctcc attttttcgg ttctcatgcc gtagccattg aacatatcgg aagcacggcg     52740
     atacccaatc aacgggcgaa accggttata gatatattta ttggcgtttc gccttttgct     52800
     gaactacctt ttatcagcgc atttttaatg caaaggagta tcaccacact ccgacagata     52860
     tgacaggcag atatttgttt gcaaaatata caaatgaagt ttggacccat aatcttcttg     52920
     ctttggtgta ggtataatac ccaaaaacga agtttatgcg gaacaggata acacctcgaa     52980
     atcggagttt atatggcttc gtgggggagt tatgtgtttg agctttgtcg cattaacgcg     53040
     aatcaggggt tgacggcaga aatagactgg aattacactt cttggagtcg gcgttgccgg     53100
     aaaattctga ttggattagt tgttcggggt gcgaaaacag tcgtagttcg gggaaaaaac     53160
     cgaattttga cccaaaaccg cgaaaaactc gaaatgacag ttcctatcag ttttcataat     53220
     gaattaaaac aaaaaaatta ggctgcaaag atagggaaaa tgtgtcaatt tgcgtaagtg     53280
     ataattagtc aattaagata aatgctactt ttgtaatcaa agcaaaatga tatgagcaag     53340
     atttttggaa tcgtaaatat aaccaccgat agtttttccg atggaggact ttatttagat     53400
     acagataagg caattgagca tgctctgcat ttggttgaag atggagcaga tgtgattgat     53460
     ttgggagccg cttccagtaa tcctgataca actgaagtgg gcgttgtgga agaaatcaaa     53520
     agactcaaac ctgtcattaa ggctttaaaa gaaaaaggca tttctatttc tgttgataca     53580
     tttaaacctg aggttcagag tttttgcata gaacaaaagg ttgattttat taatgatatt     53640
     caaggttttc cttatcctga gatttattca ggcttggcaa agtcagattg caaacttgtg     53700
     ttgatgcact ccgttcagcg aattggtgca gctactaaag ttgaaacgaa tccggaagag     53760
     gtttttactt ccatgatgga attttttaaa gaaagaattg ctgctttagt tgaggctggt     53820
     gtaaagcgtg aacgaattat tcttgatccg ggtatgggct tctttttagg ctctaatcca     53880
     gaaacatcta ttcttgtttt gaagcgtttc cctgaaattc aagaagcttt taatttgcaa     53940
     gtaatgattg cagtgtcacg gaaatcattc ttaggtaaaa taactggaac cgatgtgaaa     54000
     tctcgtttag caccaactct tgcagcagaa atgtatgcat acaaaaaagg tgcagattat     54060
     ctccgcaccc atgatgttaa gtctttatca gatgccttga aaatatccaa agccctaggt     54120
     tagttttatt tttttagctt tctaaatgaa tatgctatac ttgctctgaa gttgtgttgg     54180
     cgtacttgac ttaggtctgg atctttcgaa ctgttactaa gagggtaatc atagccaaac     54240
     ataaactgga aatgtcctaa ttctaaacct gttccaatac ctacactata atcaagagga     54300
     cttaaacttc catcacttcc aaaaggtttt gtgtacttct cttgagtttt cgtagctaaa     54360
     tagtagtgtt tgttggtaaa tccaaataat ccaatattca atcttgcgac cgggaaagtc     54420
     ctcttgaaag taccacaagt tcgcgggatg gagttttatc ccagctgcat cgagaaaggc     54480
     atgcgcagtg agcgtgctct caagctcgcc atcgccgaaa tgtatgtcaa aggagtaagt     54540
     acccgcaggg tctcggatat cgtcgaaatt ctttgtggca ccgaagtcag ctcgtcccag     54600
     gtcagcaggc tggcaaagga gctcgatgaa gagattacgt cttggaaggc gcagcctgtc     54660
     ggacagattc aatacttggt acttgatgcg acctatgaat cggttcgcgt cggttcccat     54720
     gtggtcaagc aggcgcttct agtggctatt ggcgttgatt acagcgggaa tcggcatatt     54780
     cttgacgccg aagtcgcgaa cagtgaggca gaggtaaact ggcgttcctt tctcgagggt     54840
     ctcgtacgac gagggatgca cggcctgcga atgatcacca gtgatgacca ctcaggactg     54900
     cgcgcggcaa tcgatgctgt cttccctgga attctgtggc aacgctgcca gtttcatctg     54960
     cagcagaatg cccactccta cgtcacgaaa aaagatgaga tcccgctgat agccgctgat     55020
     attcggaagg tgttcaatcg gaatatgtca agatagttta tgccagattt ttgagaggtt     55080
     tgcatcaagc agccttcgaa agaggacggc atgacattga gaccggcaag gcgtcgtaga     55140
     tacgcacttt cccagtacgc caccgtaagg ggtttttctc tttggcagca agaatggttt     55200
     ggtttctttt ttcctcggcg ccgtaggcgt ccgactaaca cctgaattaa gccgcgccgc     55260
     gaagcggcgt cggcttgaat gaactgttag atgccagccc gatcaatgtg cgctgacctt     55320
     ggatagcaga tttagaacgg cgacgccact aacgataagt cccatgccaa cgaacgccca     55380
     caagtctagt ttctggccat ggaagatcca agcgatagct gccacaagta cgatgccgag     55440
     gccagcccaa acagcataag caatgccgac cgggatggac ttgagtgcga gagagaggaa     55500
     atagaacgca agcccgtagc cagccacaac tacaacagaa ggaactaact tggtgaatcc     55560
     atggctggac ttcagtgcgg aagttgcgac gacctcacca aatattgcaa tagccagaaa     55620
     gagccagttc ttcacgtgca atctcctcta cggtatgaag gataaatagt ggtggctatg     55680
     agttgccaaa aacagtcttg cggctgtcga ttttctgtga gcatacgcaa cgccaaatct     55740
     ggcatctaac gcttgagtta agccgcgccg cgaagcggcg tcggcttgaa cgaattgtta     55800
     gacattattt gccgactacc ttggtgatct cgcctttcac gtagtgaaca aattcttcca     55860
     actgatctgc gcgggaggcc aagcgatctt cttcttgtcc aagataagcc tgtctagctt     55920
     caagtatgac gggctgatac tgggccggca ggcgctccat tgcccagtcg gcagcgacat     55980
     ccttcggcgc gattttgccg gttactgcgc tgtaccaaat gcgggacaac gtaagcacta     56040
     catttcgctc atcgccagcc cagtcgggcg gcgagttcca tagcgttaag gtttcattta     56100
     gcgcctcaaa tagatcctgt tcaggaaccg gatcaaagag ttcctccgcc gctggaccta     56160
     ccaaggcaac gctatgttct cttgcttttg tcagcaagat agccagatca atgtcgatcg     56220
     tggctggctc gaagatacct gcaagaatgt cattgcgctg ccattctcca aattgcagtt     56280
     cgcgcttagc tggataacgc cacggaatga tgtcgtcgtg cacaacaatg gtgacttcta     56340
     cagcgcggag aatctcgctc tctccagggg aagccgaagt ttccaaaagg tcgttgatca     56400
     aagctcgccg cgttgtttca tcaagcctta cggtcaccgt aaccagcaaa tcaatatcac     56460
     tgtgtggctt caggccgcca tccactgcgg agccgtacaa atgtacggcc agcaacgtcg     56520
     gttcgagatg gcgctcgatg acgccaacta cctctgatag ttgagtcgat acttcggcga     56580
     tcaccgcttc cctcatgatg tttaacgcct gagctcagcc gaccgaaacc gcgtagcggt     56640
     tttgggtcgg ctgcagcgat ttgttgggcg atagcttgcc acattctctc aacgattggg     56700
     atttgatgta ctttccgcac tttgtagcgc gaccacatca tgctccccct ggccgcgaga     56760
     gcccttcact cgggaaacac aagacagacc gagcacgact gttgcaaggg tcaaacagta     56820
     cacgacaacc ggccaagccg tgttgcgcgg caacagcgaa atgatcaacg ttccgatgct     56880
     tcctagcagt acaccgccca agcagaagta gactgccgtg accgttccag caacatggtc     56940
     gaatcctcga agagcgccat tgggcgccac agataccgct gtggcgacac caatacccac     57000
     tagccacatt ggagcaataa agcctaacac ggactgcaaa gcccatattt cggtgatggc     57060
     aagcaatact gctccagcta tcaggcatcc cattcccatt cgcaagacac ttgggctgcc     57120
     ccacttgggt atcacacgcc ccataaaacg agccgtaaac accatggcaa ttgccactgt     57180
     ggcgaacagc aggctgaagc caagctgaga cacaccttgc ctgcccatca ttagtccggg     57240
     cgcaatggag aaaaagacga agaagctacc cattccagcg gcgtaacaca acgtgtacaa     57300
     ccagaagttc aggcacttaa cggggagtag cagctgcgac cattgcaagc ccgcaactcg     57360
     ttgcacccgg gtttcaggcc agaatcgcca cgctgctgca gatgcagcga tcatgcccaa     57420
     acctagaaac gcaaagatag cccgccaccc aagccacatg tcgacgagcg ctccgagcaa     57480
     tgggcctacc gccgggacca tggccagcat ggatccgagt atgccgtaaa tgacattact     57540
     ttcctcgcga cctgcgtaaa tgtcacgtac tgttgcaaat gtggaaacaa ggcacgccga     57600
     ggcaccacaa gcctgaagaa tccgaagccc cagaaagact tcagccgatg acgtaagagc     57660
     gaggcccatt gacgccacaa cgtaggcgag gccacctccc agtagaacgg ggcggcgccc     57720
     cagtcggtcc gatagcggtc caaacaagag ctgaccggca ccaatcatga ccaagtacgt     57780
     tgtcagcgta agctgaattg tgctcgctgt cgtaccaagc gcgtttggca taaacggcac     57840
     tgctggcaag tacatgtcca tgccgagtga tgccaataaa tcgaacggtg ataacaacaa     57900
     caccgtggcg gcaagggagt accgccaact aaagtttttt gagctcacga aaccatctcc     57960
     ttgaacaaag gatttggcgg cgctcccgta gagcaaaagg attcatgaga acgccgcaac     58020
     aaccgaaaaa tgaaggttgc tgcggcttac ttgtctgcgt tcttggaagt gctcatctgc     58080
     tgactatctc atgattgaat ttgaatcgta acaactttca agcaactctg caaggagcct     58140
     tattgtgcgc ccaacgccgg agttaagccg ccgcgcgtag cgcggtcggc ttgaacgaat     58200
     tgttagacat catttaccaa ctgacttgat gatctcgcct ttcacaaagc gaataaattc     58260
     ttccaagtga tctgcgcgtg aggccaagtg atcttctttt tgtcccagat aagcttgctt     58320
     agcttcaagt aagacgggct gatactgggc aggtaggcgt tttattgccc agtcggcagc     58380
     gacatccttc ggcgcgattt tgccggttat tgcgctgtac caaatgcggg acaacgtaag     58440
     cactacattt cgctcatcgc cggcccagtc gggctgcgag ttccatagct tcaaggtttc     58500
     cctcagcgcc tcgaatagat cctgttcagg aaccgggtca aagaattcct ccgctgccgg     58560
     acctaccaag gcaacgctat gttctcttgc ttttgtaagc aggatagcta gatcaatgtc     58620
     gatcatggct ggctcgaaga tacccgcaag aatgtcattg cgctgccatt ctccaaattg     58680
     cagctcgcgc ttagccggat aacgccacgg gatgatgtcg tcatgcacga caagggtgac     58740
     ttctatagcg cggagcgtct cgctctcgcc agggaaagcc gaagcctcca taaggtcatt     58800
     gagcaatgct cgccgcgtcg tttcatcaag ctttacggcc acagtaacca acaaatcaat     58860
     atcgctgtat ggcttcaggc cgccatccac tgcggagccg tacaaatgca cggccagcaa     58920
     cgttgattcc agatggcgct caatgacgct tagcacctct gatagttggt tcgaaatttc     58980
     gatggtcacc gctaccctca tgatgtctaa caccagaatt aagccgcgcc gcgaagcggc     59040
     gtcggcttga atgacttgtt agcgcccacc tgcgacgcca acctcttgcc actgatagta     59100
     ctgcttagta gcaatggcca gcatatccag gtcctccggc gtgtctccgt acgcgtagat     59160
     ggtcggatat gtcgccaggt cgtagcgctc acggaccaag cgagccttct ccgtcaagac     59220
     gcactgccgc ccttcatagc ggcccgttag gattccgtcc gactgttgca aggaagaaca     59280
     gatgagctca acgccgtgcg agtcgcacca cggctccaag taagcctcaa gtccgccgga     59340
     aacaacgaca accttgtgcc cctgcgcttt gtgccatgcg atgcgctgca ttgcctcgcc     59400
     gcggagggta ttgggcaggt agctctgagc gaagtcacga ccttgggcct ccaggaccga     59460
     ggccgggatg ccgctgtaag cgaagcgaac gatgacgcga cggatcaggg tgccagacaa     59520
     gatcccaatc ttatacccaa gcacgagcgg cgccagaagc agttgtccca caagcagtcg     59580
     acgtcggctc acggaccgcc gcacaaaatc cggcatcgtc tcgcgagtgg taattgtgcc     59640
     atcgaagtca aagagtgcga gagacatgcg ttgtgggcgc taacgccttg ctcaccggaa     59700
     aattgcgagc gcagcgagta atttttccgg tgcagcaact tgttgtacgg tgcaaccgat     59760
     agctatgacg tttgcccctt aatcgcctgg ataatcctcg gccagtcttc atgatgcaac     59820
     tcatgtcccg tgccttcgag tgtcagcatt tttgaaccac gaatcgcatc tttcagtgcc     59880
     aacccatgca cataaggaag tacaggatcc tccgtgccgt gaatgatcaa agttggtaca     59940
     gctatctcat ttaatctccc gagccatctc tcgccaccac ctaaagtagt gtggttgaat     60000
     gttgtcagga tattcggagt gcgatcaaaa tttaactcag cgatgttttg tatcttctca     60060
     gcgtcaaaag catgcgcagt acctgagttg attcgccacg ctccgacctg atacgcgacg     60120
     acagcatctc tatcagacca atccagcgat tccgcccgtt ggtgatactc aatgatggca     60180
     ggatcaaaag cgggcatatc cggatctgca tctgcaagcc gttctgaagc aatcagcgtc     60240
     aagctcttca cacgtttcgg atacttgaga gctacaagct gggaaagaaa tccccccaaa     60300
     gacatgccga ctaaatgagc agcttccaga ccataaccat caatgacgcg aaccacatca     60360
     tctgctaatt cttcaacgga atatggagcc tgacctggct catagcttgt tgatttcccg     60420
     gtatcacggt ggtcgtaccg gatcacatag cgacccattt tggcaagttg ggaacaaaac     60480
     tcatcaggcc accacaccgc agacgacatt gcccccatga tcagaataat gggttcatgg     60540
     gccgggtcgc cgaatgattc ggtatagagt gaaatcgctt tatcaacaac taccttttct     60600
     ttcatactta aattgccttc gagttctacg tacaactttg ttttagggcg actgccctgc     60660
     tgcgtaacat cgttgctgct ccataacatc aaacatcgac ccacggcgta acgcgcttgc     60720
     tgcttggatg ctcgaggcat agactgtaca aaaaaacagt cataacaagc catgaaaacc     60780
     gccactgcgc cgttaccacc gctgcgttcg gtcaaggttc tggaccagtt gcgtgagcgc     60840
     atacgctact tgcattacag tttacgaacc gaacaggctt atgtccactg ggttcgtgcc     60900
     ttcatccgtt tccacggtgt gcgtcacccg gcaaccttgg gcagcagcga agtcgaggca     60960
     tttctgtcct ggctggcgaa cgagcgcaag gtttcggtct ccacgcatcg tcaggcattg     61020
     gcggccttgc tgttcttcta cggcaaggtg ctgtgcacgg atctgccctg gcttcaggag     61080
     atcggaagac ctcggccgtc gcggcgcttg ccggtggtgc tgaccccgga tgaagtggtt     61140
     cgcatcctcg gttttctgga aggcgagcat cgtttgttcg cccagcttct gtatggaacg     61200
     ggcatgcgga tcagtgaggg tttgcaactg cgggtcaagg atctggattt cgatcacggc     61260
     acgatcatcg tgcgggaggg caagggctcc aaggatcggg ccttgatgtt acccgagagc     61320
     ttggcaccca gcctgcgcga gcagctgtcg cgtgcacggg catggtggct gaaggaccag     61380
     gccgagggcc gcagcggcgt tgcgcttccc gacgcccttg agcggaagta tccgcgcgcc     61440
     gggcattcct ggccgtggtt ctgggttttt gcgcagcaca cgcattcgac cgatccacgg     61500
     agcggtgtcg tgcgtcgcca tcacatgtat gaccagacct ttcagcgcgc cttcaaacgt     61560
     gccgtagaac aagcaggcat cacgaagccc gccacaccgc acaccctccg ccactcgttc     61620
     gcgacggcct tgctccgcag cggttacgac attcgaaccg tgcaggatct gctcggccat     61680
     tccgacgtct ctacgacgat gatttacacg catgtgctga aagttggcgg tgccggagtg     61740
     cgctcaccgc ttgatgcgct gccgcccctc actagtgaga ggtagggcag cgcaagtcaa     61800
     tcctggcgga ttcactaccc ctgcgcgaag gccatcggtg ccgcatcgaa cggccggttg     61860
     cggaaagtcc tccctgcgtc cgctgatggc cggcagcagc ccgtcgttgc ctgatggatc     61920
     caacccctcc gctgctatag tgcagtcggc ttctgacgtt cagtgcagcc gtcttctgaa     61980
     aacgacaatg gaggtggtag ccgagggtgt ggaaacaccc gactgccttg cgtggttgcg     62040
     gcaggcgggt tgcgacacgg tgcagggttt cctgttcgcc aggccgatgc cggcggcggc     62100
     cttcgtcggc ttcgtcaacc aatggaggaa caccaccatg aacgccaatg aaccgagcac     62160
     cagttgctgc gtgtgctgca aggaaatccc gctcgatgcc gccttcacgc cggaaggggc     62220
     cgagggcact gttgcaaagt tagcgatgag gcagcctttt gtcttattca aaggccttac     62280
     atttcaaaaa ctctgcttac caggcgcatt tcgcccaggg gatcaccata ataaaatgct     62340
     gaggcctggc ctttgcgtag tgcacgcatc acctcaatac ctttgatggt ggcgtaagcc     62400
     gtcttcatgg atttaaatcc cagcgtggcg ttgattatcc gtttcagttt gccatgatcg     62460
     cattcaatca cgttgttccg gtacttaatc tgtcggtgtt caacgtcaga cgggcaccgg     62520
     ccttcgcgtt tgagcagagc aagcgcgcga ccataggcgg gcgctttatc cgtgttgatg     62580
     aatcgtggga tctgccactt cttcacgttg ttgaggattt tacccagaaa ccggtatgca     62640
     gctttgctgt tacgacggga ggagagataa aaatcgacag tgcggccccg gctgtcgacg     62700
     gcccggtaca gatacgccca gcggccattg accttcacgt aggtttcatc catgtgccac     62760
     gggcaaagat cggaagggtt acgccagtac cagcgcagcc gtttttccat ttcaggcgca     62820
     taacgctgaa cccagcggta aatcgtggag tgatcgacat tcactccgcg ttcagccagc     62880
     atctcctgca gctcacggta actgatgccg tatttgcagt accagcgtac ggcccacaga     62940
     atgatgtcac gctgaaaatg ccggcctttg aatgggttca tgtgcagctc catcagcaaa     63000
     aggggatgat aagtttatca ccaccgacta tttgcaacag tgcccgccgc gccgtgttaa     63060
     aggattggaa accgccgatc ttcggcatgt tcttcttcac ccggaaatgg tcgctctcaa     63120
     tcccctgctg gagatgtttg gtcacataat gcacgggatc gggatggaga agcccatcat     63180
     caaccgacgt tttgatcgtt gacgggaagg tgttggcccc gtccgtccca atcctgttcg     63240
     gcgacaacaa gggttcatct ttaagcatct ttcggaagaa ccgcttggca gcgtcgagat     63300
     cgcgcttagc ggtcagcagg aaatccaccg gattgccatg cttatcgatg gctcggtaca     63360
     gatagcgcca tttgccgcgg atcttgacat aggtctcatc aatccggacc gagccgcaat     63420
     ggggtcgacg aaactgccgc agccgtttct cgatgacagg tgcataagcc aatacccagc     63480
     ggttgatcgt gctatgatcg acctcgaagc cccgctcgcg aaacatctct tccaagtcac     63540
     gatagctgag cgggtagcgc aagtaccagg caaccgcctg tacaatcagc caggcctcga     63600
     aatgcctgcc cttgaaatca tccttcgact ggcgcttcag cttttcggca atggtattca     63660
     aaatcatcgg ctcgctccgc aatatcagga gcggcaactt ctctccccat ggtcaacatc     63720
     gagttaacct gaagaatttg cgacaaggcc atgcgttccg ctccggagat gtctggctta     63780
     ctaggtcccg gcgctatggc gatctgaaac acgcactcgt tccggcacaa tccatcgcgg     63840
     aaggcggtcg tctcgctgtg ccattgcggc cggaggaatg gctggcagac cggcaagctc     63900
     gcctcgacat gcggttgcgc gagcttggcc gtgccgctcg cgcaggcacg atcccgggcg     63960
     ggtcgattga aaacggcgtt ctgcatatcg agaaactcga agccgccgcg ccgacaggcg     64020
     ccgaagatct ggtgctcgat ctctacaagc agatcccgcc cacgcgcatc accgatctcc     64080
     tgctggaggt ggatgcggcg accggcttca ccgaagcgtt cacccatctg cgcacaggag     64140
     caccctgcgc tgaccggatc gggctaatga acgttatctt ggcggaaggg atcaacctcg     64200
     gcttgcgcaa aatggcggat gcgacaaaca cccacacctt ctgggaattg atccgcattg     64260
     gacggtggca tgtcgagggc gaagcctatg accgggcgct ggccatggtg gtcgaggcac     64320
     aggcagcgtt acccatggcc cggttctggg gcatgggcac gtcggcttcg agcgacggac     64380
     agttcttcgt cgctacagag caaggtgagg ccatgaacct ggtcaacgcg aaatatggca     64440
     ataccccggg cctgaaagcc tatagccacg tctccgacca atatgcgccg ttcgcaaccc     64500
     aggtgattcc tgcaacggca agcgaagcgc cttacatcct cgatggcctg ctgatgaacg     64560
     atgctggacg ccatatccgc gagcagttca ccgacacggg cggcttcacc gatcacgtct     64620
     ttgccgcatg tgccattctc ggctaccggt tcgctccgcg catccgcgac ctgccatcca     64680
     aacggctcta cgcgttcaat ccgtcggccg ccccggcgca cctgcgagcg ttgatcggcg     64740
     gaaaggtcaa ccaagccatg atcgagcgca attggcccga catcctgcgc atcgccgcca     64800
     ccattgctgc cgggaccgtc gcgccaagcc agattctgcg gaaactcgcc tcctatccgc     64860
     ggcagaacga gctcgcgaca gccctgcggg aagtcggtcg cgtcgagcgc accctgttca     64920
     tgatcgactg gattctggat gccgaactcc aacggcgtgc ccagatcggg ctcaacaaag     64980
     gcgaagctca tcatgcgctg aagcgggcaa tcagcttcca ccgccgcggt gaaatccgcg     65040
     accgttccgc cgaaggccag cattaccgca tcgccggcat gaatctgctc gccgccatca     65100
     tcatcttctg gaacaccatg aagctcggcg aggtcgttgc aaaccagaaa cgcgatggaa     65160
     agctgctatc gcccgatctc ttggcccatg tttcgccgct cggatgggaa cacatcaatc     65220
     tcaccggaga atatcgctgg ccaaagcctt agcgtaggat tccgccccct cccgcaaacg     65280
     accccttggt ggtcagtcgt ggcgctgacc ttcatcgtta aagggaaatg ccgccgccct     65340
     tcgaggcgct gcgctgctgc tgttgcgcca gactggcggc ttggccgggc cgggcggtgc     65400
     ccttcccgtt cacatagccg accgtgtagg tgcgaccggc aacgatctgg tcgcccttgg     65460
     cttccagatc ggcaaaggcc gagcgcgaat gctcgacaat gcccttgccg gaaagctggt     65520
     agaccgcctt gctatcgacg tgcagaacct gcccggtgta ggcggattcc ttgccatcct     65580
     tgccggtgtc cggcttggtg gcttcggcca gttggtagat gcccttgggc agtccgtttt     65640
     ccggcagaac cttgatagtc atccactcgc ctttcaccac ctggtcgagc tggcgactac     65700
     cgttcaggac gcagaccttg cgcgagcctt ccggcatcat cttcggcgct ggcccggtcg     65760
     ggttcaggct gttaggggtg cttgccatac gtttcgtact cctgtccatt gcagtgaaaa     65820
     aagcggccgc gaacggccgc cggtagtcat caattgcagc ccttgccggt gcttccggcc     65880
     atcgggtggc cttcccacgt cggcaggata atgtccttcg tcaccatgat gttgaactcg     65940
     tagcccggac ggatttcgag cgtcggctga atgttcatgt tgcgttgggc catctgcata     66000
     ccaatctgcc ccatctgctg acccagcgac ccggcgatga tttgcgagct gctgtagttc     66060
     tcgccgttgc tggcctgcgg ctgcgaaagc tggatgcctg cggagaagac cgaaagcagc     66120
     aagccactgc cgaagatgcg cagataatgg ttgttcacct tgtcattgaa cccagcatag     66180
     ccgcccacat cagcgcccgg catgttgtca atcgagatcg aagaaccatc cgggtagatg     66240
     atgcgccgcc agaccgcgag cgcccgctgc tggccgaggg ttacgccgct gtcgtaggtg     66300
     ccaaccaaac gcgaacccgg cgggatcagg cattgcgtgc tggtcgcgct gtcgtacacc     66360
     gcttcgcgca cctgcccgat gatttggccc ggcagatcgg agttgatacc ggaaatcatc     66420
     acgccgggga taacccaacc ggctttgatt tcctgcgacg gagcgacggc ccccttgcgc     66480
     tggcgagcca gataaacctc agcttctggc gtacctgcga gggcactgtt gcaaagttag     66540
     cgatgaggca gccttttgtc ttattcaaag gccttacatt tcaaaaactc tgcttaccag     66600
     gcgcatttcg cccaggggat caccataata aaatgctgag gcctggcctt tgcgtagtgc     66660
     acgcatcacc tcaatacctt tgatggtggc gtaagccgtc ttcatggatt taaatcccag     66720
     cgtggcgccg attatccgtt tcagtttgcc atgatcgcat tcaatcacgt tgttccggta     66780
     cttaatctgt cggtgttcaa cgtcagacgg gcaccggcct tcgcgtttga gcagagcaag     66840
     cgcgcgacca taggcgggcg ctttatccgt gttgatgaat cgcgggatct gccacttctt     66900
     cacgttgttg aggattttac ccagaaaccg gtatgcagct ttgctgttac gacgggagga     66960
     gagataaaaa tcgacagtgc ggccccggct gtcgacggcc cggtacagat acgcccagcg     67020
     gccattgacc ttcacgtagg tttcatccat gtgccacggg caaagatcgg aagggttacg     67080
     ccagtaccag cgcagccgtt tttccatttc aggcgcataa cgctgaaccc agcggtaaat     67140
     cgtggagtga tcgacattca ctccgcgttc agccagcatc tcctgcagct cacggtaact     67200
     gatgccgtat ttgcagtacc agcgtacggc ccacagaatg atgtcacgct gaaaatgccg     67260
     gcctttgaat gggttcatgt gcagctccat cagcaaaagg ggatgataag tttatcacca     67320
     ccgactattt gcaacagtgc cgaatgatgt cacgctgaaa atgccggcct ttgaatgggt     67380
     tcatgtgcag ctccatcagc aaaaggggat gataagttta tcaccaccga ctatttgcaa     67440
     cagtgccaaa tatcgtgcca gctgaagctc atccggttca ccggtgaatc tgccatagct     67500
     ttcagtctgc tcagtggtca gaaagtcaac gggcatatcg gcctccctgc ctgacgggca     67560
     tttagtaaca tttttccaac cgtacgaaat gttataaatt atcggacatc gtaaaactgt     67620
     tacattaata tgtctattaa atcgtaaatt tgtaataata gacatgagtt gtccgatatt     67680
     cgatttaagg tacattttta tgcgactttt tggttacgct cgggtctcaa ccagtcagca     67740
     gtctcttgat cttcaggtca gagcactcaa agacgcaggt gtgaaagcaa accgtatatt     67800
     taccgataag gcatccggca gttcaacaga ccgggaaggg ctggatttgc tgaggatgaa     67860
     ggtggaggaa ggtgatgtca ttctggttaa gaagctcgac cgtcttggcc gcgacactgc     67920
     cgatatgatc caactgataa aggaatttga cgctcagggc gtggcagtcc ggttcattga     67980
     tgacgggatc agtaccgacg gtgatatggg gcaaatggtg gtcaccatcc tgtcggctgt     68040
     ggcacaggct gaacgccgga ggatcctaga acgcacgaat gagggccgac aggaagcaaa     68100
     gctgaaagga atcaaatggc actgttgcaa agttagcgat gaggcagcct tttgtcttat     68160
     tcaaaggcct tacatttcaa aaactctgct taccaggcgc atttcgccca ggggatcacc     68220
     ataataaaat gctgaggcct ggcctttgcg tagtgcacgc atcacctcaa tacctttgat     68280
     ggtggcgtaa gccgtcttca tggatttaaa tcccagcgtg gcgttgatta tccgtttcag     68340
     tttgccatga tcgcattcaa tcacgttgtt ccggtactta atctgtcggt gttcaacgtc     68400
     agacgggcac cggccttcgc gtttgagcag agcaagcgcg cgaccatagg cgggcgcttt     68460
     atccgtgttg atgaatcgtg ggatctgcca cttcttcacg ttgttgagga ttttacccag     68520
     aaaccggtat gcagctttgc tgttacgacg ggaggagaga taaaaatcga cagtgcggcc     68580
     ccggctgtcg acggcccggt acagatacgc ccagcggcca ttgaccttca cgtaggtttc     68640
     atccatgtgc cacgggcaaa gatcggaagg gttacgccag taccagcgca gccgtttttc     68700
     catttcaggc gcataacgct gaacccagcg gtaaatcgtg gagtgatcga cattcactcc     68760
     gcgttcagcc agcatctcct gcagctcacg gtaactgatg ccgtatttgc agtaccagcg     68820
     tacggcccac agaatgatgt cacgctgaaa atgccggcct ttgaatgggt tcatgtgcag     68880
     ctccatcagc aaaaggggat gataagttta tcaccaccga ctatttgcaa cagtgccgaa     68940
     acgactgagc aaaatgatca gtgatctact ccctccggtg gatttaacgg agttgctgct     69000
     cgaaattaac gcccataccg gatttgctga tgagtttttc catgctagtg aagccagtgc     69060
     cagagttgat gatctgcccg tcagcatcag cgccgtgctg atggctgaag cctgcaatat     69120
     cggtctggaa ccactgatca gatcaaatgt tcctgcactg acccgacacc ggctgaactg     69180
     gacaaaagcg aactatctgc gggctgaaac tatcaccagc gctaatgcca gactggttga     69240
     ttttcaggca acgctgccac tggcacagat atggggtgga ggagaagtgg catctgcaga     69300
     tggaatgcgc tttgttacgc cagtcagaac aatcaatgcc ggaccgaacc gcaaatactt     69360
     tggtaataac agagggatca cctggtacaa ctttgtgtcc gatcagtatt ccggctttca     69420
     tggcatcgtt ataccgggga cgctgaggga ctctatcttt gtgctggaag gtcttctgga     69480
     acaggagacc gggctgaatc caaccgaaat tatgaccgat acagcaggtg ccagcgaact     69540
     tgtctttggc cttttctggc tgctgggata ccagttttct ccacgcctgg ctgatgccgg     69600
     tgcttcggtt ttctggcgaa tggaccatga tgccgactat ggcgtgctga atgatattgc     69660
     cagagggcaa tcagatcccc gaaaaatagt ccttcagtgg gacgaaatga tccggaccgc     69720
     tggctccctg aagctgggca aagtacaggt ttcagtgctg gtccgttcat tgctgaaaag     69780
     tgaacgtcct tccggactga ctcaggcaat cattgaagtg gggcgcatca acaaaacgct     69840
     gtatctgctt aattatattg atgatgaaga ttaccgccgg cgcattctga cccagcttaa     69900
     tcggggagaa agtcgccatg ccgttgccag agccatctgt cacggtcaaa aaggtgagat     69960
     aagaaaacga tataccgacg gtcaggaaga tcaactgggc acactggggc tggtcactaa     70020
     cgccgtcgtg ttatggaaca ctatttatat gcaggcagcc ctggatcatc tccgggcgca     70080
     gggtgaaaca ctgaatgatg aagatatcgc acgcctctcc ccgctttgcc acggacatat     70140
     caatatgctc ggccattatt ccttcacgct ggcagaactg gtgaccaaag gacatctgag     70200
     accattaaaa gaggcgtcag aggcagaaaa cgttgcttaa cgtgagtttt cgttccactg     70260
     agcgtcagac cccttattcg tgtgggccgc cgtgtcgcac ggtcagccgt ctttcacaag     70320
     cgcttggcgg ggagttcgca gccgtccggt ccgcaacggc gatgcgccgg cgacacgaag     70380
     tcccagatcg acaccccaat catcaaggcc aggccgacgt acatcaggtt cgccgtccac     70440
     cagttgccga gcagccagac cgtggccgca aacacgatgg ccgggccgat catgccgagc     70500
     agactgcgca gccattgccg atgactgaac caacccagcg cgttcgccag gaaggccagc     70560
     gcggcaaaca gcggcagcag gcggctgatg aacagtccct cgtactggct caagaagccc     70620
     agcccgatgg ccgcgccgaa gctggcgagg gctggaaagc aggcggcgca gcccatcgcg     70680
     gaaacgacgc tgccgagcgc gccggtttta tcggcaatgc gtgtcatcag tcccatgaag     70740
     cggctctcgc tgttgtcgtt ggcttgctgg ctcactgctt gacgctggac ggatagccgg     70800
     cgtctgcggt ggccttggtc agcttctgta cgctggcctt ggtgtcgtca aaagtgacga     70860
     cggcctcgcg cttctcgaag cccacatcga ccttgctcac gccttcgacc ttggagagcg     70920
     ctttcttgac tgtgatcggg caggcggcgc aagtcatgcc gggaaccgct agcgtgacgg     70980
     tctgggtagc ggcccacacc ggggcaacag cggcggcgag ggcaagggag gcaaacagtt     71040
     tcttcatgat gaactcctgg ttaatagaaa aatggaacga catagggaaa tccaagcgcg     71100
     accaggacca gcacggccac gatccagaaa atcagcttgt aggtggcgcg cacctgcgga     71160
     atcgcgcaga cctcacctgg cttgcatgcc tgcacgggcc ggtaaatccg cttccaggcg     71220
     aagaacagcg ccactagcgc cgcgccgatg aacaacggtc gatagggttc cagcaccgtc     71280
     aggttgccga tccaagcacc ggagaagccc agggcgacca gtactagcgg ccccaggcag     71340
     caggtcgatg caagaatggc ggccagcccg ccggcgaaga gcgcaccgcg cccgttttgt     71400
     ggttcagaca tacgttggcc cttttgaatt tggattggat agcgtaacct tacttccgta     71460
     ctcatgtacg gagtcaagcg atatggaaaa taatttggaa aacctgacca ttggcgtttt     71520
     tgccaaggcg gccggggtca acgtggagac aatccgcttc tatcagcgca agggcctgtt     71580
     gcgggaaccg gacaagcctt acggcagcat ccgccgctat ggggaggcgg acgtggttcg     71640
     ggtgaaattc gtgaaatcgg cacagcggct ggggttcagt ctggacgaga ttgccgagct     71700
     gttgcggctc gacgatggca cccactgcga ggaggccagc agcctggccg aacacaagct     71760
     caaggacgtg cgcgagaaga tggccgactt ggcgcgcatg gaaaccgtgc tgtctgaact     71820
     cgtgtgcgcc tgccatgcac gaaaggggaa tgtttcctgc ccgttgatcg cgtcactaca     71880
     gggcgaagca ggcctggcaa ggtcagctat gccttagcgt gctttatttt ccgttttctg     71940
     aggtgccccc cataagcgta cgcctggtcg agcaggcgac gcggatcgac gtccagcgca     72000
     cgagagaatg cgtccgccat ctgtgcaatg cgtctaggat cgagacaaag gtcgtctctg     72060
     tcagccggat cgtagaacat attggcggcg ccaaagccca cttcaccgac cagaccgacg     72120
     ggatctatca ccagccagcc gcgactggag aacatgatgt tttcatgatg cagatcgcca     72180
     tgtagcccac gcagttccga ggcattgctc atcatttgat cggctataat cgccgcgtgg     72240
     acgtagtcag tttgacaacc tgcgttttga tcatcgcgcg cccgctgaaa caaagctgca     72300
     aagcgatccc ggatcgggag aagggcagaa ggcaggggtt cctcagatgc ggcatacagc     72360
     ttcgccatta gttccgctgc aatttcggtc gcctggtagt cgccgtgctc ggcaacgatg     72420
     tgagagagca ttcgctcccc ggcatattcg agcaacatca gattgttctc acgaccgagc     72480
     aaccggactg ctcccctccc attgcgccat accagatagt cggccccgcg cagttcatca     72540
     gcaatgtctt ctataggttt caatcccttg acgattgcag gagtcccgtc tggcaatgaa     72600
     actttccaaa cgaggctgga aaaggtgtcc gcaatgagaa caggttgcga aacgtgccaa     72660
     tgagcaggaa aaacaggcgg catgaacatc aaccccaagt cagagggtcc aatcgcagat     72720
     agaaggcaag gcgttcgcgg tcgggggctt cgatccccaa tacattgaat aggacagcga     72780
     aggcgcgctc tgcttcatct ggcgctgccc agttctcttc ggcgttagca atcatgagtg     72840
     ccaaatcggc atagcgatct gctgttccga gccgcccaag gtcgatcaga cccgtgcatt     72900
     gaagagtttt agggtccacc atgaagttcg gcatgcaggg atcaccatgg caaacaacca     72960
     tatcggtgcg ctcttggtcg agccgcaccg gtagctctcg ttcgacacga gccaaaagat     73020
     cgagctgcgg cgtactcttg tcctcgtccg gtaagaagtc gggattgacg gcattgcggg     73080
     acaccacatc aacggcgcgt ccgaacattc gcgacagcct gcgctcaaac ggacattgat     73140
     caaccgatag gctgtgaaca gcgccaagtt gctgccccat tgacggccac gctttgagca     73200
     aatccgctcc agacagatca gccgccggta ctcccggaat tgccgttatc accaagcatg     73260
     caccctcctg ttcctcctgc cagttgatca cctcggggca agccacacct cgacctttga     73320
     gccaaatgag gcggtcacgc tctccagcga gctcaccgcg gcgggaagca ggtgcgattt     73380
     tcgcgaaggc atgcccgtca ccacgtcgaa aaacaaaatc accagattct ccgcctctga     73440
     caggcaacca gtcagaatgc gattcaccaa aaaaaatatt agttcgattc aatggaggtt     73500
     ccttcagttt tctgatgaag cgcggaggtg gctcaacctg cgaaaagaaa cgagttgcta     73560
     tggacttgca ccggttgtgt tccggtctat ctctcatttt aagcggcttt tttctcaaat     73620
     gccaccggcg atttccagcc gagtgttgaa tgtcttcggc gtggattata aaagccattt     73680
     acccatataa tgcgcctact tatcagcctt tgggacgttg ggacggtatt tttcactata     73740
     tacccccaag tttttagaca tgaaaaaagc tcgatatatt ataaatatat cgagccttta     73800
     agttactgtt tttcaatatc gttcaaaatc ttgataatta cagtatacgg ttttatgaag     73860
     tggtatattt gcaaatgctt attttgcaag gtctatttgc ttgatttatc ctacaatcgt     73920
     aatgcaaaac ccatgaccgg aagcaacgaa cttaggttca atctcactca aatccgagga     73980
     tagcttttgt ccggattctt gattgggcaa tgtatctgcg ccgcttgatt ttaccgctgc     74040
     gtcccaactg ctttcgataa cttgtccgtg attctcaccc atgccgaaca tgaggtcgct     74100
     gctaaagaaa ataccacgtt tcttttcaaa aaataaaagt ccttcccaca tatgcatttc     74160
     agatgggtaa ctgatagttt gaaattcaaa atcatctccg gcaaatattt cattcggctt     74220
     tttaataagc acattgttag taataccaaa ccccatcagt tgtcttgctg tggtttcgga     74280
     acaaaccgcg acagcttcgg gatgttcttt gagaaccaaa gcaagtccgc cacattcgtc     74340
     tgattcaaaa tgagaaatta gaatgtattt tattttgcgt tcaccgagca actcttgcaa     74400
     cttaggaatg gtagtttgcg cttgtgatac ggctccggtc tgaatgagaa caggctcatt     74460
     tgtcatcaat aagtattggt gcattgaaag cttaatcggc tccattacct ctgtaaattg     74520
     gtataaatct ttgataatct ctgtcattgt caaaacgcct ttttctattt atagtctaac     74580
     ctaaattcca cgtgtgtttt ttattagctt caaaaatcac tatttcacga agaatttaga     74640
     ctgcttctca cacattgtaa cattatttac aaccaccttt caatcatttt tgataaatca     74700
     ttgatttcat ctttgctgca atgatactta ataaactctg caagggtaat gactccaact     74760
     tattgatagt gttttatgtt cagataatgc ccgatgactt tgtcatgcag ctccaccgat     74820
     tttgagaacg acagcgactt ccgtcccagc cgtgccaggt gctgcctcag attcaggtta     74880
     tgccgctcaa ttcgctgcgt atatcgcttg ctgattacgt gcagctttcc cttcaggcgg     74940
     gattcataca gcggccagcc atccgtcatc catatcacca cgtcaaaggg tgacagcagg     75000
     ctcataagac gccccagcgt cgccatagtg cgttcaccga atacgtgcgc aacaaccgtc     75060
     ttccggagcc tgtcatacgc gtaaaacagc cagcgctggc gcgatttagc cccgacgtat     75120
     ccccactgtt cgtccatttc cgcgcagacg atgacgtcac tgcccggctg tatgcgcgag     75180
     gttaccgact gcggcctgag ttttttaaat ggcggaaaat cgtgttgagg ccaacgccca     75240
     taatgcgggc ggttgcccgg catccaacgc cattcatggc catatcaatg attttctggt     75300
     gcgtaccggg ttgagaagcg gtgtaagtga actgcagttg ccatgtttta cggcagtgag     75360
     agcagagata gcgctgatgt ccggcggtgc ttttgccgtt acgcaccacc ccgtcagtag     75420
     ctgaacagga gggacagctg atagaaacag aagccactgg agcacctcaa aaacaccatc     75480
     atacactaaa tcagtaagtt ggcagcatca ccggctcatt gaagccgtat attttctgga     75540
     ggttcatcag gcgcggaact catcgaggcg cgggaataaa atcccattca gacgccggat     75600
     agattcaagc aagccaactt gtcgtcaaaa tcggtgttgc aaaaacggga gtgaccatag     75660
     attccgtttt ctgaggcgac ccccacatag agaccttccc ggtcattcac tttgtagagt     75720
     ttgtccctgg gcttgagatt gcgcagcttg gtatcggtca gcatgtacct tgtccttctt     75780
     cgtctccgat acccactcta ttgtaaacaa gacattttta tcttttatat tcaatggctt     75840
     attttcctgc taattggtaa taccatgaaa aataccatgc tcagaaaagg cttaacaata     75900
     ttttgaaaaa ttgcctactg agcgctgccg cacagctcca taggccgctt tcctggcttt     75960
     gcttccagat gtatgctatt ctgctcctgc agctaatgga tcaccgcaaa caggttactc     76020
     gcctggggat tccctttcga cccgagcatc cgtatgagac tcatgctcga ttattattat     76080
     agaagccccc atgaataaat cgctcatcat tttcggcatc gtcaacataa cctcggacag     76140
     tttctccgat ggaggccggt atctggcgcc agacgcagcc attgcgcagg cgcgtaagct     76200
     gatggccgag ggggcagatg tgatcgacct cggtccggca tccagcaatc ccgacgccgc     76260
     gcctgtttcg tccgacacag aaatcgcgcg tatcgcgccg gtgctggacg cgctcaaggc     76320
     agatggcatt cccgtctcgc tcgacagtta tcaacccgcg acgcaagcct atgccttgtc     76380
     gcgtggtgtg gcctatctca atgatattcg cggttttcca gacgctgcgt tctatccgca     76440
     attggcgaaa tcatctgcca aactcgtcgt tatgcattcg gtgcaagacg ggcaggcaga     76500
     tcggcgcgag gcacccgctg gcgacatcat ggatcacatt gcggcgttct ttgacgcgcg     76560
     catcgcggcg ctgacgggtg ccggtatcaa acgcaaccgc cttgtccttg atcccggcat     76620
     ggggtttttt ctgggggctg ctcccgaaac ctcgctctcg gtgctggcgc ggttcgatga     76680
     attgcggctg cgcttcgatt tgccggtgct tctgtctgtt tcgcgcaaat cctttctgcg     76740
     cgcgctcaca ggccgtggtc cgggggatgt cggggccgcg acactcgctg cagagcttgc     76800
     cgccgccgca ggtggagctg acttcatccg cacacacgag ccgcgcccct tgcgcgacgg     76860
     gctggcggta ttggcggcgc tgaaagaaac cgcaagaatt cgttaactgc acattcggga     76920
     tatttctcta tattcgcggt tcagcaggca tgtccccttt gagggcgacc cgacgacagg     76980
     ataatcgacc ttatggtgcg caaatatttc ggcacagacg gtattcgtgg caaagccaac     77040
     gaaggcgcga tgacggcgga aaccgccttg cgcgtcggca tggcggctgg ccgtgtcttt     77100
     cgtcgcggtg accaccgcca tcgtgtcgtg atcggcaagg atacgcgcct gtcgggctat     77160
     atgcttgaac ccgcgctcac agccggtttc acctcgatgg gcatggacgt attccttttt     77220
     ggcccgctgc cgacaacgta taggaagaat aaacgccctt ttcacccaag tccaacagct     77280
     ttggaccgca gttgactctt tcgacacccc tgcgatgcaa cccaatccgg ctgacgggga     77340
     gccagcaacg ctgaaaattt accctcctct ttcccactag cggctccttt tccgacaacc     77400
     agcacggcgg atccctgccg cggcgctgtg aacgcagcat tttgattggt atcgttggcc     77460
     ttcaggctcg tcagtcaaac agacccagga gcagctcagc cggtggcgcc cggctttcgg     77520
     gtaacgccct ggtcccgctg gtttcggctt tgtgcttcag gtgatcaagg atctgcttga     77580
     tcactatagg gtcttcaatg caggcgatga ctttcatggc gccgccgcag ccgctgcagg     77640
     tctcgatgtc gatattgaaa acacgcttga gccgttgcgc ccatgtcatc gacgctcgcc     77700
     gttgtgctgg tgttgccggt tcatcagcca ccctgacctt gttgcccctg ccccgttttg     77760
     ccggcgtgac caacgcccgg tgccgactgt tgggtgcgaa caccccgtgg aagcgggtta     77820
     ggttgactct gggcttcggt accagggcgg ccagccttgc aatgaaatcc aatggttcga     77880
     aaatgacgtg cgtggtgccg tcccggtacg gcgtcttgag ctggtagcgc acgttgccgc     77940
     ctcgtgttaa cgacagccgc ttctcggata ccgccgggcg gctgatgtac cggcacagcc     78000
     gttcgagctt cttgcgttca tcggccctgg ccgccacgcc ggcgtgcagg ctggacccgg     78060
     ctaccttgcc aatcccgtca ccgaacggat caccactggt cggcagagtt tgcaaagtga     78120
     acacctttcg ccccgcctgt gaaccgacag cgatacggta agtgatcgag tgccccagca     78180
     ggggtgtcat cgggtcgtca tccaccgcat ccgaggccag atagctgttt tcgacatccc     78240
     gttccagcag gccttgccgt tccagatagc gacccacccg gtgggcgatg gtgtgcgtca     78300
     gctgggtgag ctctgggctg gtcggcgcct tgacccagcg gaaacgcgct gagccgtggg     78360
     attgctcgac atacacaccg tcgagaaaca gcatgtggaa gtgaacattc agattgagcg     78420
     ccgatccaaa acgctggatc agggtgaccg cgcccgtctt ggccacttgg tgggtatggc     78480
     ccgctttctt gaccaggtgc gtggcaatga cgcggtaaac gatgcccagc acccacccca     78540
     tgatctcggg ccggctggca aacaggaaac gcagctgaaa cgggaagctc aacacccact     78600
     gacgcatggg ttgttcaggc agtacttcat caaccagcaa ggcggcactt tcggccatcc     78660
     gccgcgcccc acagctcggg cagaaaccgc gacgcttaca gctgaaagcg accaggtgct     78720
     cggcgtggca agactcgcag cgaacccgta gaaagccatg ctccagccgc ccgcattgga     78780
     gaaattcttc aaattcccgt tgcacatagc ccggcaattc ctttccctgc tctgccataa     78840
     gcgcagcgaa tgccgggtaa tactcgtcaa cgatctgata gagaagggtt tgctcgggtc     78900
     ggtggctctg gtaacgacca gtatcccgat cccggctggc cgtcctggcc gccacatgag     78960
     gcatgttccg cgtccttgca atactgtgtt tacatacagt ctatcgctta gcggaaagtt     79020
     cttttatcct cagccgaaat gcctgccgtt gctagacatt gccagccagt gcccgtcact     79080
     cccactcgat tgtaaacaag cacacaaaac cctttagtga caacaatttg caagaactat     79140
     caggctcagt gccatgaaaa ataccatgac cagatcatga ggttgaacac ggcttgcgcc     79200
     ggcagcgttc acgctcctgg tcggcgatct cgcccggctg caatgctagc tcagcatcgg     79260
     tcatgcgctc cagcacgtcg cgtaggcgga tggtgcaagg aatgggcggc agctcgaact     79320
     catagccgcc ggcgatcatt tcggccgcaa tctcctcggt gatgaaaaac ggctcgtcgt     79380
     cttggttcgg cttcttcatg ccctttcctc ctggcgctca tcctggccga cagcggccag     79440
     ggcatcggct tccgtcaatg cgtcctccac gaacgcgccg tgctgcttcg cttcggcctg     79500
     gctgacctcg gcccatatcc gtttcacctg ggccgcactg tacccggcca gctcggcggt     79560
     cttgttgatg ctgtagccgg acttgcgcag cgcgacaact tgggcgcggc gcttcggatc     79620
     agcacggcgg cccttgtacc gcccggcctg gcgggccaac tcaatgcctt ggcgctggcg     79680
     ttcgcgcctg tcctcgtagt cgtcgcgggc catctgcaag gccaggcgaa aaagcatgat     79740
     ctgcacggct tccagcacga tcttggcgac gccctgggcc tcggccgcca ggtcggatag     79800
     atcgaccacg ccagggacgg ccaggcttgc gcctttggcc tgtatcgagg ccaccaggcg     79860
     ctcggcctcg ggcaaaggta ggcggctgat gcggtcgatc ttctcggcaa tgaccacctc     79920
     gccgggctgt aggtcgccga tcatgcgcag cagctcaggc cggtcggcgc gtgcgccgga     79980
     tgccttctca cggtagatgc cggcgacgta gtagccggcg gccttcgcgg ccgtagtgat     80040
     cgcctcttgg cgttccaagt cctgcgcgtc ggtgctgacg cgcagataga cccgcgccac     80100
     catcggcgcg gctactggct tcgtcctgcg catacttgcg ggctcctttg ggcatacgca     80160
     aagtgtccgg tcatgctacc cccggccaaa aaggccgtca tgcgatttat cttggccggg     80220
     tcgttattgg cgggtctaaa tggccgctcc gtggatctca tcgccagaaa tggcgatgcg     80280
     agatccaggg cagggcggcc gccatcgtca gacctggcga tggtcgacgc cggcgcgcat     80340
     cgtcggatgt ggcgatgcga gctcgaggtc ggtggccacc gccggcgacc tggtgccatc     80400
     gtcggcaatg gcgatgctgc agctcgacgt gcgcggcctg gtcgtctcgg catcgtcgga     80460
     tgcggcgatg ctcgagcgag gcgaaaaaaa accgcctcgg ggtgtccgag gcggcaagtc     80520
     tgcatgcggt tcagggagga agaaaccgcg ccggcgatca gggaggaaaa ccgcgcggcc     80580
     tgatgtgcag ctcggccact ttagccggat ttttcgactt atccgatgcg agcggcccgc     80640
     cgtgggcgct gctcgatctg ctgttgcttt ttctcgacgt gcttctgctc ctggtgctgc     80700
     tgctcgtcgc gcggcactgt tgcaaagtta gcgatgaggc agccttttgt cttattcaaa     80760
     ggccttacat ttcaaaaact ctgcttacca ggcgcatttc gcccagggga tcaccataat     80820
     aaaatgctga ggcctggcct ttgcgtagtg cacgcatcac ctcaatacct ttgatggtgg     80880
     cgtaagccgt cttcatggat ttaaatccca gcgtggcgcc gattatccgt ttcagtttgc     80940
     catgatcgca ttcaatcacg ttgttccggt acttaatctg tcggtgttca acgtcagacg     81000
     ggcaccggcc ttcgcgtttg agcagagcaa gcgcgcgacc ataggcgggc gctttatccg     81060
     tgttgatgaa tcgcgggatc tgccacttct tcacgttgtt gaggatttta cccagaaacc     81120
     ggtatgcagc tttgctgtta cgacgggagg agagataaaa atcgacagtg cggccccggc     81180
     tgtcgacggc ccggtacaga tacgcccagc ggccattgac cttcacgtag gtttcatcca     81240
     tgtgccacgg gcaaagatcg gaagggttac gccagtacca gcgcagccgt ttttccattt     81300
     caggcgcata acgctgaacc cagcggtaaa tcgtggagtg atcgacattc actccgcgtt     81360
     cagccagcat ctcctgcagc tcacggtaac tgatgccgta tttgcagtac cagcgtacgg     81420
     cccacagaat gatgtcacgc tgaaaatgcc ggcctttgaa tgggttcatg tgcagctcca     81480
     tcagcaaaag gggatgataa gtttatcacc accgactatt tgcaacagtg ccctgtttag     81540
     agtactatat gcgcctgcaa cagtgggcca ccgaaaatat taaaaaactg ctttatctcg     81600
     cgggggatga cgcggtgatt aattacggga aaatgcggct ggaatttttg cagaaagcac     81660
     tggcgcagga tacctccggt gacttctgct ttcgtgtgct gcatccggaa gtgtctggcc     81720
     cgccggatat gaaaaaggct tccgccgggt accgtgactt tattatcggt aacagagcgt     81780
     tgctggatct ggtgaattca gccggtgaag gggctccggt tgcgcattat tccgctgatg     81840
     aaattcagtc attattttcg gcacaaatac aggggtcggt ggataaatac ggcgatagtt     81900
     tcctgacgga tgatccgtat gtgctggcgg aagacaagct gcaaacctgt cagatggaaa     81960
     ttgatttaat ggcggatgtg ctgagagcac cgccccgtga atccgcagaa ctgatccgct     82020
     atgtatttgc ggatgagtgg ccggaataaa taaaaccggg cttaatacag attaagcccg     82080
     tatcgggtat tattactgaa taccagacag cttacggagg acggaatgtt acccattgag     82140
     acaaccagac tgccttctga ttattaatat ttttcactat taatcagaag gaataaccat     82200
     gaattttacc cggattgacc tgaatacctg gaatcgcagg gaacattttg ccctttatcg     82260
     tcagcagatt aaatgcggat tcagcctgac caccaaactc gatattaccg ctttgcgtac     82320
     tgcactggcg aaaaccggtt ataagtttta tccgctgatg atttacctga tctcccgggc     82380
     tgttaatcag tttccggagt tccggatggc aatgaaagat aatgaactga tttactggga     82440
     acagtcagac ccggtcttta ctgtctttca taaagaaacc gaaacattct ccgcactgtc     82500
     ctgccgttat tttccggatc tcagtgagtt tatggcgggt tataacgcgg taacagcaga     82560
     atatcagcat gataccaggt tgtttccgca gggaaattta ccggagaatc acctgaatat     82620
     atcatcgtta ccctgggtga gttttgacgg atttaatctg aatatcaccg gaaatgatga     82680
     ttatttttcc ccggttttta caatggcaaa gtttcagcag gaaggtgacc gcgtactatt     82740
     acctgtttct gtacaggttc atcatgcagt ctgtgatggt tttcatgcag caaggtttat     82800
     caatacactt cagctgatgt gtgataacat actgaaataa attaattaat tctgtattta     82860
     agccaccgta tccggcagga ttggtggctt ttttttatat tttaaccgta atctgtaatt     82920
     tcgtttcaga aggcactgtt gcaaagttag cgatgaggca gccttttgtc ttattcaaag     82980
     gccttacatt tcaaaaactc tgcttaccag gcgcatttcg cccaggggat caccataata     83040
     aaatgctgag gcctggcctt tgcgtagtgc acgcatcacc tcaatacctt tgatggtggc     83100
     gtaagccgtc ttcatggatt taaatcccag cgtggcgccg attatccgtt tcagtttgcc     83160
     atgatcgcat tcaatcacgt tgttccggta cttaatctgt cggtgttcaa cgtcagacgg     83220
     gcaccggcct tcgcgtttga gcagagcaag cgcgcgacca taggcgggcg ctttatccgt     83280
     gttgatgaat cgcgggatct gccacttctt cacgttgttg aggattttac ccagaaaccg     83340
     gtatgcagct ttgctgttac gacgggagga gagataaaaa tcgacagtgc ggccccggct     83400
     gtcgacggcc cggtacagat acgcccagcg gccattgacc ttcacgtagg tttcatccat     83460
     gtgccacggg caaagatcgg aagggttacg ccagtaccag cgcagccgtt tttccatttc     83520
     aggcgcataa cgctgaaccc agcggtaaat cgtggagtga tcgacattca ctccgcgttc     83580
     agccagcatc tcctgcagct cacggtaact gatgccgtat ttgcagtacc agcgtacggc     83640
     ccacagaatg atgtcacgct gaaaatgccg gcctttgaat gggttcatgt gcagctccat     83700
     cagcaaaagg ggatgataag tttatcacca ccgactattt gcaacagtgc cgttaaggct     83760
     aatcagggca gggggtaggg tggcagagtt tatagccagg taaccggcta cgccgggctt     83820
     tcggcgccat ttgactccac aaattttcaa aattcgcaac gatcgagaac accaaagcta     83880
     taatcgcaaa tattacgaca atgcctactc acttttgact cgtccttgat ttgacataac     83940
     ctcatgtatt ttaaggttta tatcttttaa cctgacaggt ttagttaaca aaggagcctg     84000
     tccgatagag tgtgcatcac tgtatgcgct gatgaatatg aaaggcgtgg atcgattagg     84060
     attctgactg ctactaacag ttgcatacag ctcatcacct gtcatgcctg gcatttgtaa     84120
     atcactcagg acaacgtcat aaggtttacg cagaagcttt tccagggctc gttcaggcga     84180
     ggttgtagcc tcgacaatgt atccagcatt agtaagcaga ctggaaagag acgaacaggc     84240
     catttcatta tcatcaataa caagcaagct aagaacgccg aagacatctc cgggagctga     84300
     agcagatacc tcagctgttg caaggctgct atctcccaac ttgataggta ttctcactgt     84360
     aacagttgta cctacattta cttcactaga tatatgaata gtacctttta atagtctgat     84420
     tatccctgca acaatagcaa gtcccatccc aaatccaggt acagtggatt tcgaatctac     84480
     aactcgtgta aatggtttaa atatgaactt tagtttgtct ttagggattc cctttccggt     84540
     atcagaaatg acaatattta ataccttacc tttttctata aagtaatcta cattaacttc     84600
     cccgcgctca gtgtacttaa tagcgttact ggttaagttt tcaattactt gattaaggcg     84660
     tagagcatct gtaaaaatca ctgcatcatt attgtttttt attttaactg tgacatcctt     84720
     tttttcataa atagcaatgc aatcctgcac agcgttagta acaattgctt gcaagctatt     84780
     ataggtgttt tttatctcta cagatccgtt gtcaattttt gcaaattcag ccaaatcatt     84840
     taactggcgc tccattttcg aaacagcagt ttcaagtcgt tctatctgac cagatttaat     84900
     ccctccactc agattattgg ttacgacatc aatgatagac actattgcct gtaaagatgt     84960
     tctgagttca tggcctacca tacctaaaaa tgcattttta ctggcaaaag cagcccgttc     85020
     tgatagtaac aatcggttaa ttttacttat gtaaataaat aggacaaaaa gaagtaagga     85080
     aatcaaccca cctgtaataa aaagcagagt ccataactgc tgacgtttgc tcctgaaatc     85140
     tttaagagcg tcattccttt gtgctatttc agccatatca gcaagatttg taacggtttt     85200
     agttagcggt tttatatcag ctatgattgt acttattttt ttataatcag ggtgattatg     85260
     cgaaagcagc ccgtctatgt cttcaagctt tttgtttatc gaatcaattg tttcttcata     85320
     gccttgctgt ttatatagag gtgcagtcgc ctcactcttt acataaataa cattcaaacg     85380
     agaataaagg atatcgaatt taagcctaac atcgtcaata gtattatcgc tattgattag     85440
     cgtgtaaagc tcattcaact gtataatgaa ttttgccact gagaaaccgt agttttcttg     85500
     ggtgccagcg acggtgtata aatttttctc cgataaaaga ctggtgtact taacaacact     85560
     agacacagtg aatgctatca acaaaagcag agcaaccaaa atgataaaga aatttttttt     85620
     catttgagca ccgtaatttt gtctatctgc caaatgaacc gtgcaagata gtgtggcgtg     85680
     ttaagctcaa tataatgttc atctaaagga tataccaaaa aataaggtcc aaaatccctt     85740
     atttgaagcc tttttccatc catttctgta gccaataaaa tgttatattt ttcaacgtca     85800
     ttcatgtcta caatgatttc ataatcattc agagcatgga attttagctt tgctccatta     85860
     gcgccagcga gttttaaaac ataacttagg tcgacgccct tgaattttac ttttttaccg     85920
     gttggcgtcc aaggtgttgt cgttacgatg gtatcccgtg ggaacgaatc aaactgcttt     85980
     tcagtaatca cataaccttt atcactgtta gcattagcga ttgaaccatc tataactata     86040
     tccccaatat tgctatatgc actaattgac aaaagcatta gggataagaa tgatattatt     86100
     ttaaccataa agatactccc tgtaattatt ttccaccatt ttaaccagtt ggaaatcttc     86160
     actactctga attttttcta atcttttatt cccaacataa atcgacttac acttactgta     86220
     atactttgtt cttaattctg gcggtattgt attaaacacg cattcagtag gtacaccaaa     86280
     tccagcggct atatgcaatg cagaggagtc acaagtataa acgttgctag catacttaat     86340
     tagcgctatg aaatctttcg tatggggtga atactttgat atgttaatat aatttttatg     86400
     attcacatcc acgaaaccta gtaccgtttt tccttcgcgc ctagaaagca tatcaactat     86460
     gtcataatag aacttcgacg gtatacttct tatttttgtg ctagcaatag gtgcaaaaag     86520
     tgtgtagttt tcaaaaactg gcgctccgag atcaatattg cctaaccatt tattagatag     86580
     ctcattatgg ttaacatcat caagtttcac gccaagacct tggataaaat aatcatgcat     86640
     ttccataata tggaaatctg gagaatatag ctgatttccc acatcaatat tcaatgcagt     86700
     acaaggcaat ttctgaatat gaaaaggcat gtaatgaagc tcatctataa ccgaggatgc     86760
     taattcatac agttcctcaa catatgacgg tgcagtctcc ggtcgaataa gcttaatttt     86820
     aatcttggga ttcttttttt tgattgctga cagcacagaa atcccgacga tagaatcacc     86880
     taatgtcact cccatgccat tgatcacatt taggtgttct atttcagagt aatcacttga     86940
     gaatttttgt atattccagt tttttataag accattgttt aatggtaaaa tattttcata     87000
     gcttagcttc tgataatcgt aaggtgctac gatcaaacta tcgttactta tcaagctacc     87060
     ggaatattca agtaaatttc tcataatcta tctggcgaaa tatttttcaa tgttagattt     87120
     gatgatgcct gatttaatcg gcttttcgta tggtcccaca atgtcataat catgaattga     87180
     ctttacaatt tcatcatctt ttataccaga tagttgacct gtaagaacga ttatcattgc     87240
     atttttattt tttgacgacc ttatagcttt aaccaactta aagcttgttt catcaccgat     87300
     gatccagtcc aaaacatatg cgtcatacgg atttgttgcg acagcttgag taagtttttt     87360
     caagttatca taagtatcta cttgataata atcgttcgaa aggatttctt ttaagctttc     87420
     ggtgatatta gcatcgtcat caagtagtgc aattcgatac ttagtgctgc taattacctt     87480
     tggatttatg acaatacttt ctatgcttcg ttttgattca taaagcagtt catcttttaa     87540
     atcatttgtc ggaaaaatgt tccattggtc agctactttc agtgctgagt attctgtgtt     87600
     tacttccgaa ccttcaggat agaggcatac cttacaagag tgttcactgc ggccatcgtt     87660
     ccagatcgca tcttgaattt ctttattatc ctcataataa atacggaaaa actcaatcat     87720
     atccatgcca acggattgga ctacttttat gagttgctga acctcccact tggtcgcacc     87780
     attcaacttc ttatagcccg ctgatgtagt gatctgtagc accttactta tgtaactatt     87840
     gtgctttacc ttggaaatac cttttttggt caataccttc gccagtacct ctatcacttt     87900
     tgcatcatcg agatcttgca tttttattac tctgaatttg gagattttct tgattttatc     87960
     ctgccagtat tttttttcaa ttttttcaaa catctccaac attttacaca gctgaaaaag     88020
     tcctaaaaat tggaatcatt cttaaatcga tactataagt tataatttta ttgaataccc     88080
     aacttataag cactattgta ttaatcaaat cattagctct ttaataacct agcagcggcg     88140
     ttccccggtc aggataagga ggtgttttct gtgactgcgt aaagagatga cgtgccgcgc     88200
     ctgtaatggg taacactctc actcctctgt atcgttaagc ctcccgttta atccttccct     88260
     gtctcccact gtgcaccgca cgcgggtggc ttactcatac ccaggagaaa cagccatgag     88320
     catgcaaacc gtccgccgta aggcgctgcg tcagaatcct tattcaactc tcggcaagcc     88380
     gccgctacgc tcctcccgtg accgtatcac gcgtgccatt aatggcacct ggtcgctcag     88440
     ggagctgccg gataacgtcc gagaattgct aattgaacgg gcagccctgc gggcagaaat     88500
     cactaccctg actgtgaaag cgcagggact caaaaaatcc gatgtatccg tacttattgc     88560
     cgacaggctg cgacgtatcg atgcaatcac ctcactgctg gaaaatagga aatgtaatgc     88620
     ctgacatcac gcctgctccg gcctcactgc ttgaagccgt attcaccccc atgaccgagt     88680
     acacgcacaa cgtgtattcg gtgaagggtg atcggctggc aatgacgctt acaaaaatcg     88740
     gtgttgccca agctaacagc cagggcgaca ttcagttatt tatcaacccg gactgtgcca     88800
     ccggtaaggt actgctctac agaaaggact gactatgtta accactgccg cgttgtttca     88860
     gctcgcaatg cagtgtgctc ccgccgttca ccccgatacc atccacgaca tcacccgcac     88920
     cgaatccggc ttaaatccat atgccatcgc tgagattgtc ccggtaaagg gcggcaggag     88980
     ccgcgtgatt tctcatctgc cttcgtcgaa agacgaggcg ctaaaaattg tggaggccat     89040
     aaagcagaaa aagcaccgtt attcagtagg gctgatgcag ataaccagca ccaacttccc     89100
     gcagttcggc gtaagcgccg aatccatgtt taacccctgt gacaacatga ctgttgccgc     89160
     gaaaatcatc accgactgct atcaacgagg aggaacatta cagcgcgccc tgagctgcta     89220
     ttactcaggc aactttgaaa ccggccagcg cccggaaagc gcgttcggca acacaagcta     89280
     cgtacagcgt attggctacg ttgtgccctc aacgcgggca gaacagcaga cagcatctcc     89340
     ctcatccggg gaagcgcctg ccgtcccgtc cgacaacact gtttacccgg atagcgtcat     89400
     acgcggcgta attccggcac ccgacaccac cccgaccagc atcgctgctt atccgccaca     89460
     tgtcgtgcgc ggcggcctcg ctgtgtcttc tgattaagga agagatcatg actttacgta     89520
     ctatcaaaac cgctgcaacc cgcctgattg ccgcattttc cgccctgtct gctgttccag     89580
     caatggcggc cagcgctgac caggcatttc agaaaggcag tgacgccatt aactgggtct     89640
     tcctcggcct aactggtatg tcagtcgtca ctatcagctg tgcggtggcc tttatcgcct     89700
     acaagatgct tgttgacggc aaggcctggc acgatctcca gcgcgtgttc tgggcgggtg     89760
     tcctgctcgc cggggcgtcc gggttcggtg cctacttcgc cgcctaagga ggcagcatga     89820
     ccatcctcaa caaggcgctg acccgaccgg cggcgctgtg gggggtcccg cttgtccccc     89880
     tgctgttcac cctgtgcatc cttaccctgg cggccgtctg gtcacgtttt tactggcttc     89940
     tcctgcttct catacctgcc tttatcgagc tgagacggct ggcaaaagag gacattcatt     90000
     tctttgacct gaagttgctg gcgtttaaaa cgcgtggcaa ccgcgcggcg acccggcatt     90060
     tcgggacaaa ggcgcttgtc gcaaaccagt acgacgccat agacgttacg gagtttataa     90120
     aacatatgcg gctcaacgag agtatcccgc tgtcccgcta tctcccctgg tcttcccacc     90180
     tgcacgagca ggtggtgaag aacaaaaaag gtgactttgt cagcacctgg gagatcggcg     90240
     gtatcatttt tgaatgcgag gatgaacatt acctcgccac cctggacatg cagctcaaca     90300
     acgttatccg ctcctttgag gggctacccg ttaccttcta tacccatctg gtgagcgacg     90360
     aatttaccga cacgcttgaa tgtgaatccg ggattccgtt ttcagatgaa atcgcgcgtc     90420
     tgttttacgc ctcccgcgag ggcaaacctt tctaccagcg tcgcctcttc ttcaccgtct     90480
     gcttcaatcc gcacaccggc attgagcggg cgaccatgaa acagaagtcc ctgggcgaac     90540
     gtaaaaccct gctcgacaat gccctgcagg tgatgcagga gcaccggcaa gcgattggca     90600
     cggcgctgtc acgctacgcg gcgcggccgc ttggcactta tgaggagaac gggcacgtgt     90660
     tctcctccca gctggcgttt tacaactttc tgatcaccgg caggtggcag aaagtccgcg     90720
     tcacccgcac gccgttttat gacgtgctgg gcggcacgga tattttccct tccaccgaca     90780
     ttggccaggt cagccacacc gacggccaga gctactttcg cgggctggaa atcaaggatt     90840
     acagcactga aaccatcacc gggctgtatg actcgcttct ttatgcccgc tgccggtacc     90900
     tgttcacgca gtcctatacc tgcatgggta aggatgaagc gcggggctgc atccgcacca     90960
     tcgagaaacg cctgaagtct gccgaggatg atgcgatctc ccagcaggaa gacctgaagg     91020
     tcgcccgcga catgcttcag tccggcatta tttcattcgg gaaatatcac cagacgctta     91080
     ttgtcagcgc cccaaccagc gagcaggtta tccgggacac caacaccctg gcggataccc     91140
     tgaaggatct cggtttcatc atgaccctgt cccgcgagtc gctgtcggcg gcgtatctcg     91200
     cgcagttgcc gggtgtgtat cacctgcgcc cgcgtctggt gccggtgagc agcctcaact     91260
     acgccgaaat ggtgtcgttt cacaactttc acccgcacaa gcgggacggg aatgcctggg     91320
     gggaggcgat tgccgttgtt ccgaccccgt ccgggggatg tcagtacgtg aatctgcaca     91380
     acagccaggc cgatgttgac gagttcagcg agaagccgcc gggtaacacc atgctgctcg     91440
     gcagtaccgg gacggggaaa tcgaccctgc tgatgatgtt ccagcatctg atgcagaaat     91500
     accggcgtcc tgagtcgttt gcgccggggg cgacgaaaaa gcgcttcacc tcggtggtct     91560
     ttgataaaga ccgttcggcg gaaatgtcga tacgcctcca gggcggctcg tacttccgtt     91620
     tccgttcagg cgagaagacc ggccttaacc cgtttgcgct cgctccaacg aaacgtaacc     91680
     gcaacttcct caagaagctg atgcgaatga tgtgcacaag ggacggcaaa ccgctcgacc     91740
     cgcgcgatga agaacgcctc agcgaggcag tggacaccat catgctggac tacccgcctg     91800
     agcttcgtcg caacggcatc acccgcatgc tggaagtgct gcatgaagcc ccgacgaagg     91860
     acgcacggat gaacgggctg cgcatccgtc tccagcagtg ggcgcagggc ggggagtttg     91920
     gctgggtgtt tgataatgac gtggacacct ttgatatcga caatattgat aatttcggca     91980
     tcgacggcac ggagttcctg aacgacaaag acgtgcgcag cccgctcacc ttctacctgc     92040
     tctaccgcgt gaccagcctc ctcgatggcc gccgcctggt cattttcatg gatgaattct     92100
     ggaaatggct tcaggacccg gagttttcaa aattcgccct cgacatgctg aaggtcattc     92160
     gaaagctcaa cggcattttc ttcccggcca cgcagtcgcc ggaggagatg tgcaagcacg     92220
     agatctcggc ggccattatc gagcagtgta gtacccgcat cttcatggcg aaccagcagg     92280
     cgaaggagta cgactacgtg gacatgctgc gggtgccgaa agcggtttac gacatcgtga     92340
     ccaccctcga cccctacgcc cgccagatgg tgatcatgaa atctccgctg cggcgtggtg     92400
     acgtgcgccc gtatatcgca caaatcaccc tcgacctctc cgggctaggt cgctacacga     92460
     agctgctcag cgccagtgcg gacaacctga aaatttttga cgagatctgg caggagggta     92520
     tgaagccgga agactggaaa gacgaaatgc tgagacgtgc cgtttaatca caaaaggata     92580
     acaccatgaa actgaaaacc accctgacgg cgctgaccgt cgccttgtgt ctctttcacg     92640
     tcccggctca ggccggtatt cccgtttttg atgaagtagc caacgccagc aacatccagc     92700
     agtgggcgga gaagctccag cagtggcagc agacggttca acattatcag tcgcagatga     92760
     acgcttataa acaacagctg gcaacggcca ccggtattcg ggacgtccag gcattcctga     92820
     atcaggcaaa aaacctgacg gctgacatta aaaatctgaa aaacaggggg atttccttaa     92880
     acgatctgtt aaccggctca ggcgggtctt atgctgggga actaaacagg ctgtatgaca     92940
     aatacaaact gttcgacaac tgcccggaga acgccagcga ggcgtaccgg gatagctgca     93000
     aacagatgct cctcaatcag gcggtgtccg tcgaggacac ttctgacatc caggaaaaaa     93060
     tttccgacac gctgagcgat attagtaatc tcgccagtcg catcgagaat gcgaaggaca     93120
     gtaaagaatc gcaggatctg gcgaacgtag tgtccgcgcg gagtatccag ctgaacgccc     93180
     tgaccactca atgggaaatg tcggtcaaac aaagtgagat gcgcaaccag ctgcttgccg     93240
     aacaacgccg aaaggcgcag gccgagcaaa tgcgcacagc tccaatcgca gaccttaact     93300
     aacaggtgac cccatgaaac tgaagacact gacctttatt gttctggcct cagtggccgc     93360
     gcttactggc tgcgaggata aaacctccgt agactggtat atggcacacc atgacgacat     93420
     gctggcgaaa tacagggagt gcatttttaa tcataatttt gtgcccaccg attgccagaa     93480
     tgcacgctcc gcccttcacc gtgaaaaagc taaacctgat gttgccgaag gatataagca     93540
     aatcctgaaa gaccttgata aagctcgcgt gcaagagcct attgctgacc tgaattagcg     93600
     acaggagaac gcaccatgag tggaatattc gtcggattaa acagccacat catggagggg     93660
     tttgacagcg tgctcaccag cgtggccgcc gatacggggg ggtggatggc acacctgttc     93720
     tccgtcgcgg tgctctcgct gtacatcacg tggcgcgcct accagacgat ggcaggcaag     93780
     ctagtccgcc ccttcgagga gatcgtgtgg gacgtgagcc ggatgctcat catcatgatt     93840
     ttcgtcacca acgccggagg ctatctcgat ctggtttcgg atgccatcac cggcctgcgg     93900
     gacggattca gcggcgacgc gtcgatctgg gcgcggctgg ataccgtctg ggaaaaggct     93960
     caagcacttg gggagaagct ttactcttat gatgattcaa cctatgtcgc tctaaaaggc     94020
     actctggcgc agtttctggt ctgggcaggc gtcatgttac tggtaggcat cacggccatc     94080
     attaacctga tagccgaact ggtgatgctg ctgatgctgg cgaccgcccc gatctttatc     94140
     tactgcctga tgtggtcgtg gttccgggat atgttcagca actggctcag aattattctg     94200
     ggctgcatcc ttacatccct gttcagcggc atcgccctga cggtggtaat ggattacctg     94260
     gactacatcc tggcgggcgc cacaaaagca tccgatgcca actacctgac tctggccgtt     94320
     caggtcttcc tcggcacggc gggtgccgcc gccgtgatgg tcctgaccta taagctggcc     94380
     gaggcgcttg ccggtgcatc cgcacagggt gccgctcagg cacttgccgc gtcgggagta     94440
     ggttcagccc gtcaatccgc ctcctccgca gccggtgcgg tgggggataa agcctcacag     94500
     aaccttaaca gcaccggcag cgcaacggcc tcgtctgcct ccacggcctc ccgcgccacc     94560
     ggcgatgcgc gcagccgcag ccgcgccgcc gttcagcgga tgcaggaacg ctaccagaga     94620
     taacccagtc tgactgaact gcgggacgcc gcaacggcgt cctgcggctt cgtcacgtct     94680
     ttaccacagg aaaaacacca tgaaatacgg catcacgctg ctgatgctgt gcctgcttgc     94740
     aggctgcgca cagcgaaaca cccaacttcc gcccgtgtcg ggcaacccgg agccggtcaa     94800
     ttccccggcc attattcagg agttaacccc ccatgtctga acttaccgcc aaagccctga     94860
     gcgactcgcg ctcgtttgag aacgccattc ttgagcggga tatgcgcatg aaaaaggcgg     94920
     gctggatcgt ggcggcgctc gccggtctgc tgctcgtctt cgcccttgcc gcccttatcc     94980
     tgctgctacc gctcaaaacc accaccgtgg agctgtacac gctcgaccgt cagaccgggc     95040
     gcatcgagcg cgtcaccacc gtcggcgagg acaagctgga cacctccgag gtgctcaatc     95100
     tctcgcagac tgcgtcctac gtgaagcgcc gcgaggggta caactatttc gcccttcagc     95160
     aggactacag agagacgcag atgttcaaca gcgacgaggt caacaaggaa tacctcgact     95220
     ggtttaacag cccggacgcg ccggacgctg tgtttcagca ggcggcctat gtagtcacgg     95280
     tggaagtcct ctccaacgta ccgtcagagg gcaccggctc cagcatggtg gagatgctgc     95340
     gcatcaagcg caccattcga aaggtcaagg acaacaccga aacgtatgat tactggacgg     95400
     tgcgcatgac ctaccgctat ttcccgcaga agaaaatgac ggcctccgag cgcgaggtga     95460
     acccgttcgg cttcatcgtc accagttacc agcggtttaa ggagaaaagc gatgaataag     95520
     gtactgatgt gtgccctcct gctgaccgca gcgtcagcat ggggtgcggc gacaccgcgc     95580
     ggcagcgcct atgacagccg catgcagaac atcccctaca acagccagaa cacgacagtg     95640
     attaacacgc gggcgggtta catcacgacg ctggtttttg acgccgacga ggaggtgatc     95700
     accgccaccg ctggttttcc gcagggctgg acgatcacac ccgaccgtaa ccgcgtgggg     95760
     attagccccg cgccggtgaa gcagccggta acggatgcgg acggcaaaac cgtccagaag     95820
     attttcaccc ccacgcagca ggactggcag accaacctgt ttgtgaccac cacaaagcgc     95880
     gactacagcc tgatgctgaa cgtgatcgat aacgatcgcg aggcgggaaa tctggccttt     95940
     gtggtgcgct tcagctaccc cgacgatacc cgcaggcaga acgacgcagc ccgcctcgcc     96000
     cgtcagcagg agcttcaggc cgcgcaggag aaagaacgca ttcagtttgc cctgaagaaa     96060
     tccactgcgc cgcgcaactg gaactacacc cgcagggtgg cggcaggttc ggagtcgatc     96120
     accccggatt ttgcgtatga cgacggccgg tttacctatc tcggcttttc accgcagaag     96180
     ctgatcccgt cgccgaccgt catcgtcggc ggcagcgagc aggtgatcac cccgaccttc     96240
     agcaccgagg gtaactaccg ggtgatggta ctgcgctctc tttctccacg ctttgtgctg     96300
     cgctacggca gccaggtcgt ggggattgaa aacggcagtt acgggaaagt caccgtggcg     96360
     aacggcagca ccgtctcacc ggatgtgaaa ctggagagca aatgatgaac gaacaggaag     96420
     acattaaaac cgccgccgaa ctggaggcgg aagcccgcga gcgggcgcgg gcagagattg     96480
     acggcgataa acccgccgca ggcgcggtgc cacccggaca gccacaggtg gtgcagcacg     96540
     cgaagcgccg cagccgccgc tcgctcgtgc tggccgccat cagcctggtg ttactggtca     96600
     ttatcgccac cggcggggat tacctgatgg cgaaactgaa gggtgacggc agcggaaaaa     96660
     gcgcgagcca tgaaccggaa tcgcacgcca cctcccccgc ccgcgagcgc aataacctcg     96720
     gacgggatct gaacccgctg ggacagctgg cagacacaac cggccaggag aagactactc     96780
     cgactgatac cgccgcgccg ccgcaggcat caccgccccc cctgacgttt gacaaggtca     96840
     gcgccctggc agacagcgcc ccaaccactg caagcagcgc cccgaaaagc acgtccagca     96900
     gtaacgtatc acctgcgggc agcgcgtccg cgccaggctc tgcaacaccc gccgggcagt     96960
     cgcaggataa cgggctggcg cgcattaccg gcgtgaagcg gctcggcctc gatccggatt     97020
     tgtacattcc ggccgaccgg catatcccct gcgcgatgat gcagcgcttt gtatcggacg     97080
     tgggcgggcg ctttaactgc cttatcagcg aggacattta cagcgccagc aacgccgtgc     97140
     gccttatccc ggcaggcact gaggcgcgcg gcctgtaccg caccggcacg ctgaaaaacg     97200
     ggcaggggcg tctgttcctc gccatcaccg agctgcgcac gccggaaccc ggccgcctgg     97260
     ttattccgat ggttgacagc caggccgtgg gggcgcttgg cgagaacggc gtcgcgggct     97320
     ggatagacaa tcactggctg gagcggatag gtaataccct cctgctcggc acggtacagg     97380
     actttgccgc tgcggcctcc ggctcgtcgc cgggcaagga tcgcaacacg gactacacgg     97440
     agaacacccg cgcggccacg gcggaaatgg caaaaacgct cctggaaaac agcatcaaca     97500
     tcccgccgac gatgtacctc aaccagggtg acgtgattgg cctggtcacg ggggcggaca     97560
     ttgatttttc agacgtctac agactgcgca tgaggtaagc gatggacgat aaactgactg     97620
     ataccccgtc agagggcaac gtcgcgctgt cacacctgcg cgatctgttg ttcggggact     97680
     acctgagccg ggaggggctg acggaaattg ccatcaaccg ccccggagag ctgcacacaa     97740
     aaatcaacgg ggcgtgggaa atgcacgcct cgccggtcac gctgcgccag tgctcgtcct     97800
     ttgccagggc gctggccgtg tggaacaacg acaccattga tgaaacgtcg cctatcctct     97860
     cggccacgct ccctacagga gaacgctgcc agatagtggt gcccccggcc tgtgagcgta     97920
     acaccatctc aatcaccctg cgtaagccgg actacttcca gcgcacccat cagtcgtata     97980
     tcgatgccgg gttttatgac cgggtgcagg gtacagaaaa ggtggaatca aaagacgggg     98040
     agctgagccg catatacctg tccgggaata tcccgctttt tatggaaaag tgcgtggagt     98100
     acggcaaaac gctctttgtg gtgggggaaa caggctctgg gaaaaccacc tacatgaaga     98160
     tgctgctgca ctacattccc gagacgctgc gccttatcac catcgaggac aacccggagc     98220
     tgaagtttta cagccagaaa aactacgttc atctgttcta cccggcggac gccggagagg     98280
     gcgcaatagt cacctctgat cgcctggtgc gcgcgattta ccgtatgaac cccgaccgcc     98340
     ccctgctcgc cgaggtgcgt ggccgcgagg cgtgggacgc actcaagctg attgagtccg     98400
     ggcacgaggg gtttatgtcc tccctgcacg cgggcagccc gcgcgagtgt atctccgggc     98460
     tgattgaccg ctgctacgag catccggcgt gccggggcat gccggttgac gtgctgctgc     98520
     gcaaggtact gcactgcgtc gacgtcattg tgagcgtgga cgttcacggc aacgtgcgcc     98580
     gcatgagcga cgtctatttt aaacccctgc acatgcaggc tatgaaggag agtttcaatg     98640
     atgctgccta aactgaccgg cctgacggcg atcgtcgtcc tcctggcggg ctgttcttcg     98700
     ccaccggagc ctgcggccgt tgactggtca caaccggcgc agccggtaac gaccacccgg     98760
     ccggtatggg aacccaaccg tcttatcgtg gcctcgccgg tgacggaagg gcactggtcg     98820
     caggtgctta cgcgttttga acccggcggg atttacccgg ccgcacagtg gtacgcggtt     98880
     gcgcacgcct cgcgcgcggt agtaaatgcc ccggacggcc agcgcttctt tgcggccaaa     98940
     acctggctcc gcgagggcgg ctacaagggt gtggtggagt ttcgcccccg ctccggctgc     99000
     ctgacctgcg acacctcaga aatcgtcttc taccgataac ggcggcgacg gtctgagtcc     99060
     ttcagaccgt caccgacgtt gaacaaccaa cgggcgttag cgccctgctt cccttcagag     99120
     gaaatcatca tgaaacacac cgtaatcacg gcggcgctgc tgtgcgccct tacttctccg     99180
     gcgttcgccg ccgatggcca gaatgccgac ccgaatgacc cgtgcgcgat ggtgctgtgc     99240
     ctggccggaa agctcgacgg cagcagtccc gccgagtgtg acccgatgta caaaaatttc     99300
     atgagcatca aaaagaaaaa aaaggggtcg tttttacccg atcacaccgc cgcagcgcgg     99360
     cagaaaaaac tgagcgcctg cccgtccgct gacagcgcca ttgtcggcaa gatcatctcg     99420
     aaatttggcc gtatgaacgg ttggtaaaac ggcagccgta aaggagacac cacgtgatta     99480
     atcaaaccgt ttctattaat aacttttccg ggctgctgaa agatgaggag cttcctgcag     99540
     gtgatttgca gacggtgctg ctcgttttgt cggaaatcag ccagaaacag gatcattttc     99600
     aggccaacac gtccgaactc gtccagctcg ccgcgcagca ctcgccgacc ttccaggcat     99660
     taccagcaga acgtcagtcg ttcttccgct ccgtgctcag tatgccggtc ttcttttaca     99720
     ccgttccgct gagcgacgac gaggcggcgg aatgggaaaa actcaacgat aaggatgcac     99780
     tccaatggca acaaaaaccg gatttatagc cccgccgtgg ccgcatgtgc gtggtgattc     99840
     cgttagtgcc gcgagcctga tttctcgcat cgagaaagaa gcgcatcgcg gctgcggcct     99900
     gcattacgaa atctaccaat atcgcgccct gtgcgaattg cacgatgttc tgaccagtct     99960
     cagcgtccgt gatgctgaga cgttcatgac agtagcggcg gatcatggct ttagtctgtc    100020
     tgataacgac tttcaggaaa gtcgaatgat gtacttcgaa acgatggatg aaatcaggag    100080
     agatcaagaa tgagactgtg gattgcagaa aaacccgcag tcgcgagcga tatcgcgaaa    100140
     gcgctgggcg gcaacttcac ccggcacgac ggctatgccg aatcggcgac cgatatcgtg    100200
     agctactgcg tcggccacgt gctggaaatg gtgcccccgg agacgatcaa cccggcctac    100260
     gccacctggt cgctcgacac cctgccgctg aagctgtacc cggtacagct tcagccaaaa    100320
     gcgagcgtgg caaagcaggc taataccctg gtgaagctga ttcggcgccc ggatatcaaa    100380
     atggttgtcc actgcggcga cccggacgac gaggggcagc tcctggttga cgaggtgctg    100440
     gagttcgccg gaaacaccgc gccggtgaaa cgggcgctta ttaacgacaa caccgcgcca    100500
     gcggtgaaaa aagccatcaa ctccctgcgc gataacagcg attttcgtgg gatgtacctg    100560
     aaagccctga tgcgcagcgc aggagacgcg atttttggct tcagtatgag ccgctgttac    100620
     accctcaaag cccgcgataa gggctataag ggcacgattt cggttggccg cgtccagacg    100680
     ccggtgctgg gaatgattgt gcgccggtgg cgcgacaatc aggcgcacag cgaggcgttt    100740
     tactaccagc tcgcagggca gtttatcagc ggtacggacg ttgtctgcgc ccgctggcag    100800
     acgtccgaat acgcgccggt ggacgataaa aagcggctga cggataaggc ctggggggaa    100860
     ggactcgcga gggctctggc cggaaaaccg gccagcgtgc tcgcggccgc caccgaccgg    100920
     ggaaaaacca cggccgcacc gctgccgttt aacctgctgc gcctccaggt gtatatgaac    100980
     cgcaggcaca aactgaccgc gcagcagacg ctcgatatca cgcagaagct caaggacagt    101040
     aaatacatta cctacaaccg ctctgactgt tcttatctgt ccgatgaaca attcaacgac    101100
     gcgccacagg tggtggcggc cttaaaaacg ctcgacgttt ttaacggcct taccaccgac    101160
     acggcgcaaa aaagtgcggc gtttgacagt aaaaaagtca ccgcccacac cgccattatc    101220
     ccgacgacga acatgccgga tttaagccgc cttaccgaca aggaaaaggc ggtttatctc    101280
     accatcgcgc agttttatct cgcgcagttc gtggcgaaaa agcgctatga cgagtcgatc    101340
     gcggagatta aatgcggtga cgagatgttt aaagtctcgg cgcgtaaaat caccgatgcg    101400
     ggttttacga cgttcctgaa cgacgcggaa gaagacgacg aggaggacga aaacagcacc    101460
     tcgtttgagg ccatcagccg cctgcaaacc ggggcgacat taacctgccg cgaggtggtg    101520
     atttcggaga aaaaaactaa accgctgccg ctgtttaccg aggcgaccct gctcgctgcc    101580
     ctcgttcgcg tggccgattt tgtcgccgat ccgcgcatta aaaaattgct caaggagaag    101640
     gataaagaca aaaaagatga acacggcggc atcggcacac cggcgacccg cgcggctatt    101700
     attgagacgc tgaaaacccg cgattacatc accgtggaaa agggcaaatt tatcccaact    101760
     gccgccgggc tggcgttaat tgatgccctg cccgactcgg tgacgcagcc ggatatgacc    101820
     gccgtatggg ctgaaaaaca ggcggcggtt gaaaccggcg aaatgaccat cgagcgcttt    101880
     attgatggtc tttacgcgga agtttcccgc ctggttgaga gcgccgatat tgccatcagc    101940
     gcgacggaaa aacatcccgt taaaacggcg cttaaccgcc tcgcggttaa atgtccgtcg    102000
     tgcggttctg agctggttat gacgccgaaa acctgcgcct gtacgggctg tcagttcaaa    102060
     atatggctgg aagtgcgcgg caaaaagctg acggaaaaac aggccgagaa gttaatcggc    102120
     aagggcaaaa ccgacgttat taaaggtttt aaatcgaaga aaaacgacga cacctattcg    102180
     atgatcgtca cgctgaaaaa cgcgcaaacc ggggaactcg gttttgaata tccaccacgc    102240
     gatccgctga aaggattgaa cgtatctatg ccgaaggagc tgaaattatg aaccgtatcc    102300
     aggacgaatt aacctcagag cgcgcgctga aaaagttttt acgtgaaagt gattttgcct    102360
     ttctggagat gctgagtgca cgtatttcag cagcgcttga tgaaaaacgc gcagagcata    102420
     tcgagcagga aaagctacgc cgacagcggg aagaaaagcg caatgaattg ctggcgctga    102480
     ttgaatcgga gggcttttca ccgacagagc tggttagtac aactcccgcc aaaaagtcgg    102540
     caaaacgcaa agctaaatat cagtattttg aaaacggcgt gcataaaaaa tggtcaggcg    102600
     tcggacgcgt gccggttgta attcagcaag aacttgacgc cggaaaacct cttgaatcct    102660
     tccttattac caccgactaa caacggcaca gggtcggttt tgacctggct tttcgggctt    102720
     cgaagactgg cgagcatggc gattcaattt tgaaaaaatt gctaatcgac aggccgcctg    102780
     agtctgcgaa gtggcaggag gcgagtaaat tcaatttcga agaaattgct aatttgcgtc    102840
     gccgattcca ctttttgagc gctcacccca agtgagccga aaaaagccgg ggggggccga    102900
     ataaattttg ccgccccagc gagcaaaaag acgcgcccac gcgtcggttt atttgggggg    102960
     cttgcccccc acaccgtcgt gcctaagtct ccggccaaaa gccggtagcg tggcgcgacc    103020
     accccctaaa aagcctagtt tccctttaat tcgtcttgtg aggaacgaac aaggcgaaga    103080
     aaagggctaa aacaggcgtc ttttaggggg tggtcgcgcg tagcgcgcga cggtgtggcc    103140
     tcttttgacc ttgggggttt tggccgggcg ttcagccagg acattacccc catgcgacat    103200
     gcagtaaggg cgtccagccc gcgcgtaatg ccgcacgccg ttagatcgcg ggagtgtacc    103260
     tcctgcgatc atggccgctt agcggccact tcttttgcag catggaatcg gtcagtcaga    103320
     acgatcacaa cctgtgaccg ttctgactga ccgatggtgc tgaccgaatt taagtgaagg    103380
     agaatatcgt gatattcgac aaactgaatc atttgctgtc gccgatagca aatgccgtcc    103440
     tggcctttat cgcctttttg caggcgcatc aactggcgtt agcgctgctg tccggcgtca    103500
     tgctgccttt tatattttct gcgaaacacg gcggtcagga aaagccgacg tttctgcaaa    103560
     ggatcttaat tctgctttcc atgatctgtt ttgttttcgg ctcgatagcg ccagtggccg    103620
     tctggttttt acagcgcatt tatggccggg aagatatcgc cagtccgccg ctgcttacct    103680
     ggacaatggc gctactgttt accgtcgccg gttttattct gcacgtggtt ttacggcgtt    103740
     tgatctcgcc tgaatttgat aaggtcaaat gcggcatggt gaaaaaaacc agcatggagc    103800
     gcgaccgcag aaccgacgtt cgccgggtaa aagaaatttt acccgtcacc acagaatacg    103860
     atccgatgga ttacatcgat ctgaataagg ggatttttat cgggctgagc cgcgagggtg    103920
     agccgcaata tattccgtta aaagaatggc agacccagca cgccgacatt atcggcacca    103980
     ctggtgccgg taaaggcgtc gtaaccggta ttctgcttta tcagagcatc ctcgccgacg    104040
     agggcgtttt tgttctcgac cccaaaaacg acgagtgggc accgcacctg tataaaaaag    104100
     cgtgcgcgga cgccggaaaa ccctttgtgc ttatcgacct gaataaacag gaataccaga    104160
     tgaaccttat cgacggtatc accgccgacc atctggagga attattcgtg gccggtttca    104220
     gtctggcgga aaaaggcgag gcggcggatt tttaccgtat cgacgaccgc aaggcggcga    104280
     gaacggcggc gcagttcgtg aaggataatc cgggcgcaac cgtgcgggat atttataacg    104340
     gcgattatgt tcagggcatt ggcgagacga ttaaagcctt tcacggtaaa accgaggagc    104400
     tggcaatgct caacagcatt aacgcgccag gcggttttgc gctgaaggag attttcgaca    104460
     agggcggctg ctgctatatc atcggttcga tgcgtaactc taaaatcatt accgcgcagc    104520
     gcatgatttt agttcgcctg ttccagctcg cggaattgcg cgaccgcgtc gcggggaata    104580
     tccgccccat cgccatcttt aaggacgagg tgaaatatca cctgtccaaa ccggcgctcg    104640
     aagggttagg cgcggcacgc gataaaggcg tccatatatt aatggcgcac cagtcaattg    104700
     ccgacctgcg cgactgtccg gcggatttaa acggcgacgc cgtggttggg gcggttgtgg    104760
     aaaactgcaa gtttaagctg gtatataaac ttcaggatcc agacaccgcc gaatggattg    104820
     cgcgcatgtc gggcacgatt ttagtcgatg atgaaagccg gaaagtcacc accacggcgg    104880
     tgctgacaga aaaagtcgat aacgagcgca tgcttcggca ggcggaaagc tattacatcg    104940
     acagcaatat gctccagaac ctgccgaagt tcgtcagcta tatcttcagc cagaacgcgc    105000
     tcgcgttccc gtcgttaatc tcaccgctca aggttaaaaa agccccactg gagctgttta    105060
     ccctgccgcc ggtcgcagtc gctacggtgg cagaagttaa accggtgctg gatctggatt    105120
     ttgataaaac ggctccggca gttccggcac ctgacattat tccggtcagc gcaacaacca    105180
     ccaaaaaacc ctcagcaacg ccaataccca ctccgccggt gcaacctgac gaggagtggc    105240
     tgatggcatc acagcccgct ccaaatgacg aaatacattc gttgctggat ttataaaata    105300
     aggagtttct atgcttattt cgtcgtatca ggaacgttat gcacgcagca ctgaaaaaat    105360
     tcgcgtactg ctgaattttc tcaaggagga aacctacagc gattttcaaa tcataaagct    105420
     gctttttgat tttaaatctg accgccctct ctaccggttg ttggagaagg tggagaaaat    105480
     ggggctgatt cagaagcacg tgcatgaatc ccgcgcgtcg agaatatccc tgtggggcat    105540
     taccaccgac gggctggccg ttatcctcac ggcggacgac aacataatgc ccgcccgctt    105600
     tgaaccctac cgcctgaccg gctggtcact cgaccatcac cttgataacc agctagtgcg    105660
     ccttacgctg gagaagaacg gcgcgacagg gtggattaac ggcgaccgtt caacgttcct    105720
     cagtcagtac agcgtcaaac accgtcccga cgggcttatc agcctgccgg acggcaggct    105780
     gatcgccgtt gaaaccgaac gacgtatcaa aacaaaggcg cgctatcagt ccatcatggc    105840
     gagccacctg ctggctatca gcgataaaaa atggcggtac gcgttttacg tcgccccgga    105900
     cgaggcgaaa aagcgcgccc tgaagattat tttcgacagc atcgccagcg tgatcgtgaa    105960
     aaaccagcat gtgcaactgg aggcaaaaca ccgcgacgtt ttccgctttt acaccctcga    106020
     tgaactgaaa aacctggagc tggacaacta tgcgtaaaac cacccttctg gtgctggccg    106080
     ccgccctctg cgtgcccgcg ttcgccaccg ccgcgcccgt cctgacggcg ggtttttcgc    106140
     cgtctgacgg gcgccctgct cttgaaatcg tgctcggcgc cataaacaac gccaggcaga    106200
     gcattgacgt cgcggcctac agcttcacca gtaagccggt cgcgacggcg ctcgccggtg    106260
     ctaaccggcg cggcgtggcc gtgcgcgtgg tggccgacga aaaggcgaac agcgaccgct    106320
     acaccgccgt gacgtatctg ataaaccagg gcgtgccggt gcaccttaac ggccgttacg    106380
     ccatcatgca caacaagttt atggtgatcg acggcaaaaa cgtccagacc gggtcgttta    106440
     actacacggc aagcgccgtt tcgcgcaacg cggaaaacgt gctgctgatc gaggatgcgc    106500
     cgcagctggc ggaggcgtac cagcgagaat ttaaccgcct gtgggatgag ggcatcccgc    106560
     tgaatgccct gtactgaatc agccccgtct gcggacgggg cttttttttt actccacttc    106620
     cagccaggct ttgcgtcctt caagatgcag cgctttcagc atggcgatca cgtcttctgc    106680
     tgaacgtccg ccatagttga gacgggtctg ctccccttca aactccacca cgataatggt    106740
     gtccagcgtc accgacagca gctcgcggag atcacgtagc gtctgccctg tactgcgtga    106800
     atgcatgcac tgggttatcc ggttggccgc ctcctggcac aatccctcta cggcctcgcg    106860
     atataccaga cgctgatcga ggttgccctc gatgtcgctg atcagtttaa ccaccgccgt    106920
     tttgacggtt ttgatttcag gaaatttcgt ttttggggag cctgactgct ccagcgggga    106980
     tacgctggtc gccggtgcag ctttaggggc ggttgtcggg gtgtgcaggt tcatcgtcat    107040
     ggtcgtttct ccgtcagtgt gaatttcgtc ttcgtatcgc ctgacggttc ggcctgcccg    107100
     gagtcgttct ggtcagcaag ggcgcgcagc gtgccattta cccttgctgt ccaggttgtg    107160
     acgggggacg attaccggaa gctgatacgc aggagaaagg catcacagga gaaaatgacg    107220
     atgtgcacac ccggacttac cgccccttta gctgcggcgg cgaaagccgt tacgtcattt    107280
     tttacgtaag acatcgcgcc gttacgtatc ccggatacgt aacggctacc gcctgaaaaa    107340
     gggttcattt tttttgaatc tgtccggttt atttttccgt gccggcctca gctgcaggac    107400
     gtcctgcagc tgaggccggc cgcgttacag aattctaaaa aacagtgact tatataattc    107460
     cctccctgat tctctctctt tcaaaaattc tgaagccctg caccgcaggg ctccagctgt    107520
     cagcagtcca tcagccagcg gtgcgctttt gaggccgctg ccgccgcttt aaagatgtag    107580
     cgcttgtctc ccttcagcgc tttcagccag gacgcgatat agctttcatg ctgcacctct    107640
     cccgtaatcc ccaaatccgc caacagaaac gcgctgccca gctcggcgat cagttcctca    107700
     aacgcatacg cctcagagcc aaacttattg cctttttcac gattgaggcg ggacgctgca    107760
     cccgtccagt gaaccagctc atgcaggccg gtggcgtaga agttcgccgc gtccgcgaag    107820
     cggaaccgct ccggcaggac gatttcatcg gtggccggac gatagaacgc ctttacgccc    107880
     tgctcggtga tttttgcccc gctccgggtc atgagtgctt ccgcctgcgg cagcggatcg    107940
     aaaccggcaa ccggctgcgg cacgctctcg atgctcaggc cgtcgatttg ctccacgtta    108000
     aacacggtaa aggctttcag catcgggatt ttttcgattt ccccgtcctc gtcctctttc    108060
     tccagcgtct tgtaaaagat ggccgtcgtg ccgtgttcac ctttacgaac ctggccgccc    108120
     agctcctgcg cctgtttgta ggtcagccag cgctcgtcct gaaaaccctg ttttgccgca    108180
     ctacaccaca gcagcatgat attaattccg ctgtatgtcg tgccggtgct gaagttggcc    108240
     ggtaatccca ccgctgcgcc gttgcgaacc cacggacaca cccacggctt aacgccgctt    108300
     tccagggctg caatgatgct gtccgttact gtctggtaaa ggtctgtttt gactgcgcca    108360
     gcacgggctt tgcttttgcc cctggaaaat ttcgtttttg aggagcctga ctgctccagc    108420
     ggggatacgc tggtcgcctg tgaagcttta ggggcggttg tctgagtgtg caggttcatc    108480
     gtcatggctg tttctccgtc agtgtgaatt tcgtcttcgt atcgcctgac ggttcggcct    108540
     gcccggagtc gttctggtca gcaagggcgc gcagcgtgcc atttaccctt gctgtccagg    108600
     ttgtgacggg ggacgattac cggaagctga tacgcaggag aaaggcatca caggagaaaa    108660
     tgacgatgtg cacacccgga cttaccgccc ctttagctgc acgggtgaaa ctgcccttca    108720
     gcgtccggga ggacgggtaa aaaaagcact gacgacgtca gtgctgcctt tgtgacatgc    108780
     ggtgttacac tgcctctgcc ggtcagttcg cccttcctga aaccgggggc ggtttgtttt    108840
     cggggacgtt ctgaccggct atccccccat cacttgcaga aatttcaccg ccccttatac    108900
     tgtatgcata tgggtcttcc ccgatcatgg tgggaaggct cagaacgcca tattcagctt    108960
     tccgtagtgg aacatcaccc ccagtttaaa gcgctcccgg tttcggtatc ccctggcttt    109020
     tatcctcagc agcctgatct tgctgttaag tgcctccgca tttccgtttg agacactgtg    109080
     tcgcatcgca ttcaggatcc cctacagcct ttttcctatc gttttcgcgg catttttcat    109140
     catgggaacg tcactgttag ccgccagcgc caaccatctc tgccagtcac tccgtctttc    109200
     ctcgctccat ggcctgttcc agatatcctt tgccagctct ttcagcgccc agcactggct    109260
     cgtcagcttc atctgtgcac gcagccacat cagcttttcc tgccgggatt cggtcatcca    109320
     cttatcgctg tactgccaca ggaagcgggt tccttttgcc tggtgtcggc tttcaacagg    109380
     gaggtgcgga tgttcattct gacgggtttt atcaactacc tcgcccagtt gcttcgccac    109440
     atggaagcgg tcaaaggcga ttttctcaac cgcactgggt aagtggatac gcgctgctct    109500
     tatatagccc gcgttcatgt ccattgagag cgttttgata gccagcaact gcccatcagt    109560
     gagcgtgcga agatagccgg caagactctc tgtgccgcga tcatccgtta aggccagcgc    109620
     ccgaccatcg cgatcggaga tcaccgttat gtaacgatgt ccttttttaa aggcgacctc    109680
     atccacattc atatgacggg cggataatgg cttttttatc cgggcaagac ctcgcttaac    109740
     tgcccgggtc ataatgccgt caaccgcatt ccaactgagc ttaagttgct tcctgacagc    109800
     atcaacggtg ctgattttca gccatgagag aacgaacgat tcgaatagca acgtataccg    109860
     gcttccgggg ccagcccacg gaacaggcaa cgtcaggcag ccatgctccg gacacataat    109920
     tcgtggaaca tcggcttcaa caatagtggt gaactggcag gtatcaagat ggcgccattt    109980
     acgatgacgg tgatcgtgaa cagaacagga tttaccgcag gtcggacagg ctagccgggt    110040
     gttttcagcg atctcaatag tgacagtaac agaaccggca ttttcatcga gagaaaggga    110100
     ctttacctgc cacggatcgg acaggttgag aatatgagcg tagagggact tttcgtccat    110160
     ggcggtgacc tctggcgatt aaatacacca ttatcatgcc ttcagccacc acaacaaggg    110220
     aagaccc                                                              110227
//

If you have problems or comments...

PBIL Back to PBIL home page