(data stored in ACNUC7421 zone)

EMBL: CP001131

ID   CP001131; SV 1; circular; genomic DNA; STD; PRO; 5061632 BP.
XX
AC   CP001131; ABHX01000000-ABHX01000135;
XX
PR   Project:PRJNA19743;
XX
DT   16-AUG-2008 (Rel. 96, Created)
DT   12-DEC-2013 (Rel. 119, Last updated, Version 4)
XX
DE   Anaeromyxobacter sp. K, complete genome.
XX
KW   .
XX
OS   Anaeromyxobacter sp. K
OC   Bacteria; Proteobacteria; Deltaproteobacteria; Myxococcales;
OC   Cystobacterineae; Anaeromyxobacteraceae; Anaeromyxobacter.
XX
RN   [1]
RP   1-5061632
RG   US DOE Joint Genome Institute
RA   Lucas S., Copeland A., Lapidus A., Glavina del Rio T., Dalin E., Tice H.,
RA   Bruce D., Goodwin L., Pitluck S., Saunders E., Brettin T., Detter J.C.,
RA   Han C., Larimer F., Land M., Hauser L., Kyrpides N., Ovchinnikiva G.,
RA   Beliaev A.;
RT   "Complete sequence of Anaeromyxobacter sp. K";
RL   Unpublished.
XX
RN   [2]
RP   1-5061632
RG   US DOE Joint Genome Institute
RA   Lucas S., Copeland A., Lapidus A., Glavina del Rio T., Dalin E., Tice H.,
RA   Bruce D., Goodwin L., Pitluck S., Saunders E., Brettin T., Detter J.C.,
RA   Han C., Larimer F., Land M., Hauser L., Kyrpides N., Ovchinnikova G.,
RA   Beliaev A.;
RT   ;
RL   Submitted (08-AUG-2008) to the INSDC.
RL   US DOE Joint Genome Institute, 2800 Mitchell Drive B100, Walnut Creek, CA
RL   94598-1698, USA
XX
DR   MD5; f4a39c7ac2d116c8bd7cd80c6e644a81.
DR   BioSample; SAMN00000041.
DR   EnsemblGenomes-Gn; AnaeK_R0001.
DR   EnsemblGenomes-Gn; AnaeK_R0002.
DR   EnsemblGenomes-Gn; AnaeK_R0003.
DR   EnsemblGenomes-Gn; AnaeK_R0004.
DR   EnsemblGenomes-Gn; AnaeK_R0005.
DR   EnsemblGenomes-Gn; AnaeK_R0006.
DR   EnsemblGenomes-Gn; AnaeK_R0007.
DR   EnsemblGenomes-Gn; AnaeK_R0008.
DR   EnsemblGenomes-Gn; AnaeK_R0009.
DR   EnsemblGenomes-Gn; AnaeK_R0010.
DR   EnsemblGenomes-Gn; AnaeK_R0011.
DR   EnsemblGenomes-Gn; AnaeK_R0012.
DR   EnsemblGenomes-Gn; AnaeK_R0013.
DR   EnsemblGenomes-Gn; AnaeK_R0014.
DR   EnsemblGenomes-Gn; AnaeK_R0015.
DR   EnsemblGenomes-Gn; AnaeK_R0016.
DR   EnsemblGenomes-Gn; AnaeK_R0017.
DR   EnsemblGenomes-Gn; AnaeK_R0018.
DR   EnsemblGenomes-Gn; AnaeK_R0019.
DR   EnsemblGenomes-Gn; AnaeK_R0020.
DR   EnsemblGenomes-Gn; AnaeK_R0021.
DR   EnsemblGenomes-Gn; AnaeK_R0022.
DR   EnsemblGenomes-Gn; AnaeK_R0023.
DR   EnsemblGenomes-Gn; AnaeK_R0024.
DR   EnsemblGenomes-Gn; AnaeK_R0025.
DR   EnsemblGenomes-Gn; AnaeK_R0026.
DR   EnsemblGenomes-Gn; AnaeK_R0027.
DR   EnsemblGenomes-Gn; AnaeK_R0028.
DR   EnsemblGenomes-Gn; AnaeK_R0029.
DR   EnsemblGenomes-Gn; AnaeK_R0030.
DR   EnsemblGenomes-Gn; AnaeK_R0031.
DR   EnsemblGenomes-Gn; AnaeK_R0032.
DR   EnsemblGenomes-Gn; AnaeK_R0033.
DR   EnsemblGenomes-Gn; AnaeK_R0034.
DR   EnsemblGenomes-Gn; AnaeK_R0035.
DR   EnsemblGenomes-Gn; AnaeK_R0036.
DR   EnsemblGenomes-Gn; AnaeK_R0037.
DR   EnsemblGenomes-Gn; AnaeK_R0038.
DR   EnsemblGenomes-Gn; AnaeK_R0039.
DR   EnsemblGenomes-Gn; AnaeK_R0040.
DR   EnsemblGenomes-Gn; AnaeK_R0041.
DR   EnsemblGenomes-Gn; AnaeK_R0042.
DR   EnsemblGenomes-Gn; AnaeK_R0043.
DR   EnsemblGenomes-Gn; AnaeK_R0044.
DR   EnsemblGenomes-Gn; AnaeK_R0045.
DR   EnsemblGenomes-Gn; AnaeK_R0046.
DR   EnsemblGenomes-Gn; AnaeK_R0047.
DR   EnsemblGenomes-Gn; AnaeK_R0048.
DR   EnsemblGenomes-Gn; AnaeK_R0049.
DR   EnsemblGenomes-Gn; AnaeK_R0050.
DR   EnsemblGenomes-Gn; AnaeK_R0051.
DR   EnsemblGenomes-Gn; AnaeK_R0052.
DR   EnsemblGenomes-Gn; AnaeK_R0053.
DR   EnsemblGenomes-Gn; AnaeK_R0054.
DR   EnsemblGenomes-Gn; AnaeK_R0055.
DR   EnsemblGenomes-Gn; AnaeK_R0056.
DR   EnsemblGenomes-Gn; AnaeK_R0057.
DR   EnsemblGenomes-Gn; AnaeK_R0058.
DR   EnsemblGenomes-Gn; AnaeK_R0059.
DR   EnsemblGenomes-Gn; EBG00001028436.
DR   EnsemblGenomes-Gn; EBG00001028437.
DR   EnsemblGenomes-Gn; EBG00001028438.
DR   EnsemblGenomes-Gn; EBG00001028439.
DR   EnsemblGenomes-Gn; EBG00001028440.
DR   EnsemblGenomes-Gn; EBG00001028441.
DR   EnsemblGenomes-Gn; EBG00001028442.
DR   EnsemblGenomes-Gn; EBG00001028443.
DR   EnsemblGenomes-Gn; EBG00001028444.
DR   EnsemblGenomes-Gn; EBG00001028445.
DR   EnsemblGenomes-Gn; EBG00001028446.
DR   EnsemblGenomes-Gn; EBG00001028447.
DR   EnsemblGenomes-Gn; EBG00001028448.
DR   EnsemblGenomes-Gn; EBG00001028449.
DR   EnsemblGenomes-Gn; EBG00001028450.
DR   EnsemblGenomes-Gn; EBG00001028451.
DR   EnsemblGenomes-Gn; EBG00001028452.
DR   EnsemblGenomes-Gn; EBG00001028453.
DR   EnsemblGenomes-Gn; EBG00001028454.
DR   EnsemblGenomes-Gn; EBG00001028455.
DR   EnsemblGenomes-Gn; EBG00001028456.
DR   EnsemblGenomes-Gn; EBG00001028457.
DR   EnsemblGenomes-Gn; EBG00001028458.
DR   EnsemblGenomes-Gn; EBG00001028459.
DR   EnsemblGenomes-Gn; EBG00001028460.
DR   EnsemblGenomes-Gn; EBG00001028461.
DR   EnsemblGenomes-Gn; EBG00001028462.
DR   EnsemblGenomes-Gn; EBG00001028463.
DR   EnsemblGenomes-Gn; EBG00001028464.
DR   EnsemblGenomes-Gn; EBG00001028465.
DR   EnsemblGenomes-Gn; EBG00001028466.
DR   EnsemblGenomes-Gn; EBG00001028467.
DR   EnsemblGenomes-Gn; EBG00001028468.
DR   EnsemblGenomes-Gn; EBG00001028469.
DR   EnsemblGenomes-Gn; EBG00001028470.
DR   EnsemblGenomes-Gn; EBG00001028471.
DR   EnsemblGenomes-Gn; EBG00001028472.
DR   EnsemblGenomes-Gn; EBG00001028473.
DR   EnsemblGenomes-Gn; EBG00001028474.
DR   EnsemblGenomes-Gn; EBG00001028475.
DR   EnsemblGenomes-Gn; EBG00001028476.
DR   EnsemblGenomes-Gn; EBG00001028477.
DR   EnsemblGenomes-Gn; EBG00001028478.
DR   EnsemblGenomes-Gn; EBG00001028479.
DR   EnsemblGenomes-Gn; EBG00001028480.
DR   EnsemblGenomes-Gn; EBG00001028481.
DR   EnsemblGenomes-Gn; EBG00001028482.
DR   EnsemblGenomes-Gn; EBG00001028483.
DR   EnsemblGenomes-Gn; EBG00001028484.
DR   EnsemblGenomes-Gn; EBG00001028485.
DR   EnsemblGenomes-Gn; EBG00001028486.
DR   EnsemblGenomes-Gn; EBG00001028487.
DR   EnsemblGenomes-Gn; EBG00001028488.
DR   EnsemblGenomes-Gn; EBG00001028489.
DR   EnsemblGenomes-Gn; EBG00001028490.
DR   EnsemblGenomes-Gn; EBG00001028491.
DR   EnsemblGenomes-Gn; EBG00001028492.
DR   EnsemblGenomes-Gn; EBG00001028493.
DR   EnsemblGenomes-Gn; EBG00001028494.
DR   EnsemblGenomes-Gn; EBG00001028495.
DR   EnsemblGenomes-Gn; EBG00001028496.
DR   EnsemblGenomes-Gn; EBG00001028497.
DR   EnsemblGenomes-Gn; EBG00001028498.
DR   EnsemblGenomes-Gn; EBG00001028499.
DR   EnsemblGenomes-Tr; AnaeK_R0001-1.
DR   EnsemblGenomes-Tr; AnaeK_R0002-1.
DR   EnsemblGenomes-Tr; AnaeK_R0003-1.
DR   EnsemblGenomes-Tr; AnaeK_R0004-1.
DR   EnsemblGenomes-Tr; AnaeK_R0005-1.
DR   EnsemblGenomes-Tr; AnaeK_R0006-1.
DR   EnsemblGenomes-Tr; AnaeK_R0007-1.
DR   EnsemblGenomes-Tr; AnaeK_R0008-1.
DR   EnsemblGenomes-Tr; AnaeK_R0009-1.
DR   EnsemblGenomes-Tr; AnaeK_R0010-1.
DR   EnsemblGenomes-Tr; AnaeK_R0011-1.
DR   EnsemblGenomes-Tr; AnaeK_R0012-1.
DR   EnsemblGenomes-Tr; AnaeK_R0013-1.
DR   EnsemblGenomes-Tr; AnaeK_R0014-1.
DR   EnsemblGenomes-Tr; AnaeK_R0015-1.
DR   EnsemblGenomes-Tr; AnaeK_R0016-1.
DR   EnsemblGenomes-Tr; AnaeK_R0017-1.
DR   EnsemblGenomes-Tr; AnaeK_R0018-1.
DR   EnsemblGenomes-Tr; AnaeK_R0019-1.
DR   EnsemblGenomes-Tr; AnaeK_R0020-1.
DR   EnsemblGenomes-Tr; AnaeK_R0021-1.
DR   EnsemblGenomes-Tr; AnaeK_R0022-1.
DR   EnsemblGenomes-Tr; AnaeK_R0023-1.
DR   EnsemblGenomes-Tr; AnaeK_R0024-1.
DR   EnsemblGenomes-Tr; AnaeK_R0025-1.
DR   EnsemblGenomes-Tr; AnaeK_R0026-1.
DR   EnsemblGenomes-Tr; AnaeK_R0027-1.
DR   EnsemblGenomes-Tr; AnaeK_R0028-1.
DR   EnsemblGenomes-Tr; AnaeK_R0029-1.
DR   EnsemblGenomes-Tr; AnaeK_R0030-1.
DR   EnsemblGenomes-Tr; AnaeK_R0031-1.
DR   EnsemblGenomes-Tr; AnaeK_R0032-1.
DR   EnsemblGenomes-Tr; AnaeK_R0033-1.
DR   EnsemblGenomes-Tr; AnaeK_R0034-1.
DR   EnsemblGenomes-Tr; AnaeK_R0035-1.
DR   EnsemblGenomes-Tr; AnaeK_R0036-1.
DR   EnsemblGenomes-Tr; AnaeK_R0037-1.
DR   EnsemblGenomes-Tr; AnaeK_R0038-1.
DR   EnsemblGenomes-Tr; AnaeK_R0039-1.
DR   EnsemblGenomes-Tr; AnaeK_R0040-1.
DR   EnsemblGenomes-Tr; AnaeK_R0041-1.
DR   EnsemblGenomes-Tr; AnaeK_R0042-1.
DR   EnsemblGenomes-Tr; AnaeK_R0043-1.
DR   EnsemblGenomes-Tr; AnaeK_R0044-1.
DR   EnsemblGenomes-Tr; AnaeK_R0045-1.
DR   EnsemblGenomes-Tr; AnaeK_R0046-1.
DR   EnsemblGenomes-Tr; AnaeK_R0047-1.
DR   EnsemblGenomes-Tr; AnaeK_R0048-1.
DR   EnsemblGenomes-Tr; AnaeK_R0049-1.
DR   EnsemblGenomes-Tr; AnaeK_R0050-1.
DR   EnsemblGenomes-Tr; AnaeK_R0051-1.
DR   EnsemblGenomes-Tr; AnaeK_R0052-1.
DR   EnsemblGenomes-Tr; AnaeK_R0053-1.
DR   EnsemblGenomes-Tr; AnaeK_R0054-1.
DR   EnsemblGenomes-Tr; AnaeK_R0055-1.
DR   EnsemblGenomes-Tr; AnaeK_R0056-1.
DR   EnsemblGenomes-Tr; AnaeK_R0057-1.
DR   EnsemblGenomes-Tr; AnaeK_R0058-1.
DR   EnsemblGenomes-Tr; AnaeK_R0059-1.
DR   EnsemblGenomes-Tr; EBT00001631470.
DR   EnsemblGenomes-Tr; EBT00001631471.
DR   EnsemblGenomes-Tr; EBT00001631472.
DR   EnsemblGenomes-Tr; EBT00001631473.
DR   EnsemblGenomes-Tr; EBT00001631474.
DR   EnsemblGenomes-Tr; EBT00001631475.
DR   EnsemblGenomes-Tr; EBT00001631476.
DR   EnsemblGenomes-Tr; EBT00001631477.
DR   EnsemblGenomes-Tr; EBT00001631478.
DR   EnsemblGenomes-Tr; EBT00001631479.
DR   EnsemblGenomes-Tr; EBT00001631480.
DR   EnsemblGenomes-Tr; EBT00001631481.
DR   EnsemblGenomes-Tr; EBT00001631482.
DR   EnsemblGenomes-Tr; EBT00001631483.
DR   EnsemblGenomes-Tr; EBT00001631484.
DR   EnsemblGenomes-Tr; EBT00001631485.
DR   EnsemblGenomes-Tr; EBT00001631486.
DR   EnsemblGenomes-Tr; EBT00001631487.
DR   EnsemblGenomes-Tr; EBT00001631488.
DR   EnsemblGenomes-Tr; EBT00001631489.
DR   EnsemblGenomes-Tr; EBT00001631490.
DR   EnsemblGenomes-Tr; EBT00001631491.
DR   EnsemblGenomes-Tr; EBT00001631492.
DR   EnsemblGenomes-Tr; EBT00001631493.
DR   EnsemblGenomes-Tr; EBT00001631494.
DR   EnsemblGenomes-Tr; EBT00001631495.
DR   EnsemblGenomes-Tr; EBT00001631496.
DR   EnsemblGenomes-Tr; EBT00001631497.
DR   EnsemblGenomes-Tr; EBT00001631498.
DR   EnsemblGenomes-Tr; EBT00001631499.
DR   EnsemblGenomes-Tr; EBT00001631500.
DR   EnsemblGenomes-Tr; EBT00001631501.
DR   EnsemblGenomes-Tr; EBT00001631502.
DR   EnsemblGenomes-Tr; EBT00001631503.
DR   EnsemblGenomes-Tr; EBT00001631504.
DR   EnsemblGenomes-Tr; EBT00001631505.
DR   EnsemblGenomes-Tr; EBT00001631506.
DR   EnsemblGenomes-Tr; EBT00001631507.
DR   EnsemblGenomes-Tr; EBT00001631508.
DR   EnsemblGenomes-Tr; EBT00001631509.
DR   EnsemblGenomes-Tr; EBT00001631510.
DR   EnsemblGenomes-Tr; EBT00001631511.
DR   EnsemblGenomes-Tr; EBT00001631512.
DR   EnsemblGenomes-Tr; EBT00001631513.
DR   EnsemblGenomes-Tr; EBT00001631514.
DR   EnsemblGenomes-Tr; EBT00001631515.
DR   EnsemblGenomes-Tr; EBT00001631516.
DR   EnsemblGenomes-Tr; EBT00001631517.
DR   EnsemblGenomes-Tr; EBT00001631518.
DR   EnsemblGenomes-Tr; EBT00001631519.
DR   EnsemblGenomes-Tr; EBT00001631520.
DR   EnsemblGenomes-Tr; EBT00001631521.
DR   EnsemblGenomes-Tr; EBT00001631522.
DR   EnsemblGenomes-Tr; EBT00001631523.
DR   EnsemblGenomes-Tr; EBT00001631524.
DR   EnsemblGenomes-Tr; EBT00001631525.
DR   EnsemblGenomes-Tr; EBT00001631526.
DR   EnsemblGenomes-Tr; EBT00001631527.
DR   EnsemblGenomes-Tr; EBT00001631528.
DR   EnsemblGenomes-Tr; EBT00001631529.
DR   EnsemblGenomes-Tr; EBT00001631530.
DR   EnsemblGenomes-Tr; EBT00001631531.
DR   EnsemblGenomes-Tr; EBT00001631532.
DR   EnsemblGenomes-Tr; EBT00001631533.
DR   EuropePMC; PMC2687297; 19346346.
DR   EuropePMC; PMC2798628; 19897758.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00521; SAM_alpha.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01763; ykkC-III.
DR   RFAM; RF01852; tRNA-Sec.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   RFAM; RF01989; SECIS_3.
DR   SILVA-LSU; CP001131.
DR   SILVA-SSU; CP001131.
XX
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID: 4003785
CC   Source DNA and bacteria available from Alexander Beliaev
CC   (alex.beliaev@pnl.gov)
CC   Contacts: Alexander Beliaev (alex.beliaev@pnl.gov)
CC             David Bruce (microbe@cuba.jgi-psf.org)
CC   Annotation done by JGI-ORNL and JGI-PGF
CC   Finishing done by JGI-LANL
CC   Finished microbial genomes have been curated to close all gaps with
CC   greater than 98% coverage of at least two independent clones. Each
CC   base pair has a minimum q (quality) value of 30 and the total error
CC   rate is less than one per 50000.
CC   We have identified the following SNP locations:
CC   284749 C/T
CC   1247970 G/C
CC   1523337 G/C
CC   2865641 ACT/AGCT
CC   3299926 T/C
CC   3575656 G/C
CC   4039922 C/A
CC   4325683 C/T
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. it is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..5061632
FT                   /organism="Anaeromyxobacter sp. K"
FT                   /strain="K"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:447217"
FT   gene            36..1412
FT                   /locus_tag="AnaeK_0001"
FT   CDS_pept        36..1412
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0001"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /note="TIGRFAM: chromosomal replication initiator protein
FT                   DnaA; PFAM: Chromosomal replication initiator DnaA domain;
FT                   Chromosomal replication initiator DnaA; SMART: AAA ATPase;
FT                   KEGG: ade:Adeh_0001 chromosomal replication initiator
FT                   protein DnaA"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71244"
FT                   /db_xref="GOA:B4UJU9"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/TrEMBL:B4UJU9"
FT                   /protein_id="ACG71244.1"
FT                   /translation="MEAPASALVETPLDDLWSRIDGFLRARCREDLYERWFEPLRPVSL
FT                   DEGRLQIGAPDKFHRDFVEDNYRGWFEEFIPELTGERLRIAFAVDDAPRPIGAAAAPAP
FT                   AAVSAARAPEPHLDPRDSRPNPRYAFDTFVVGASNHFAFAAAQAVAANPGRTWNPLFLH
FT                   GDSGLGKTHLLHAVAHAILEKSGGRVAIVSSERYTNDFVAALSKGTMDEFRRKYRECSA
FT                   LLVDDVQFLAGKDKTAEEFFHTFNELHDHHVQIVLSSDRSPKELKGLDERLCSRFEWGM
FT                   RVQIEVPEFETRAAILQKKADVEKIDLPDDVTQLLAQHIRSNVRELEGALMRLAAFASL
FT                   KSEPITVPLARDVLADVIPPPGYRPPIEKIQEAVAGHYGLTVAKLTSASREQKIAFPRQ
FT                   VAMYLCRELAKEKFQSIAEKFNKKDHTTVIAAVDRVKGLLESDDAVRTAVAQLSAKLAP
FT                   "
FT   gene            1830..2957
FT                   /locus_tag="AnaeK_0002"
FT   CDS_pept        1830..2957
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0002"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="TIGRFAM: DNA polymerase III, beta subunit; PFAM: DNA
FT                   polymerase III beta chain; KEGG: ade:Adeh_0002 DNA
FT                   polymerase III, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71245"
FT                   /db_xref="GOA:B4UJV0"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:B4UJV0"
FT                   /protein_id="ACG71245.1"
FT                   /translation="MELKIGAQELAKALGRSQGIVEKKSTMPILSHVLLEAKKGDQLVV
FT                   SATDLDLAVSSEHACEVVKEGAVAVSARHLYEIVRALPEQSVTLKKAHNNYLEVKSGPS
FT                   EFRIVGLPAEDFPALPRFDKVPFADVDPALLLEMIERTFFAVSNDETRYNLNGVYFEPA
FT                   GDALRLVATDGHRLSLSERAVGATFGLKRGVILPKKGLAELKKLLAEAAESGEEKPEAK
FT                   LGFVENSAIFRRPNVVLVMRLIEGLFPDYKQVIPKAGEKVFKVGRGRFLETLRRISLLS
FT                   SDKAHAVKLDLSKDLLRVLSQNPDLGEAKEEVPVEYAGEPLKIGFNARYIMEVLQAVKS
FT                   NEVVFELADDLSPGVLKGGEEADQGFTAVVMPMRI"
FT   gene            3087..4205
FT                   /locus_tag="AnaeK_0003"
FT   CDS_pept        3087..4205
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0003"
FT                   /product="DNA replication and repair protein RecF"
FT                   /note="TIGRFAM: DNA replication and repair protein RecF;
FT                   PFAM: SMC domain protein; KEGG: ade:Adeh_0003 DNA
FT                   replication and repair protein RecF"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71246"
FT                   /db_xref="GOA:B4UJV1"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4UJV1"
FT                   /protein_id="ACG71246.1"
FT                   /translation="MKLLSLHVQDFRNLAAVALAPSPRATVLLGENGQGKTNLLEAIYF
FT                   LTTLKPLRAVRLAELVRFGADQGAVAGDFEGPGGVRRVAVQVAAGGRTATLDGKALGSG
FT                   ARLDDYFEGLASVCFSPDDLLLVKAGPDGRRRFLDRAAFNRWPAVLGEAREYVRALRAR
FT                   NAALRAGPAEVEASFREPLVRAGARLLVRRRELVAELAPRLQAAFAEISGPEAPEAHLA
FT                   YRAAGGVDVAHPEAEVAARLAHALEARLERDREKGFTSAGPHMDDLVLALGGKGARLYG
FT                   SQGQQRALVLALKIAEIENLRAALGRPPLLLLDDVSSELDPAKNRFLLGYLAALPAQAF
FT                   LTSTDRRLIEPAAGPDTAFFEVRSGVVSPLVS"
FT   gene            4393..6780
FT                   /locus_tag="AnaeK_0004"
FT   CDS_pept        4393..6780
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0004"
FT                   /product="DNA gyrase, B subunit"
FT                   /note="TIGRFAM: DNA gyrase, B subunit; PFAM: DNA gyrase
FT                   subunit B domain protein; ATP-binding region ATPase domain
FT                   protein; TOPRIM domain protein; DNA topoisomerase type IIA
FT                   subunit B region 2 domain protein; SMART: DNA topoisomerase
FT                   II; KEGG: ade:Adeh_0004 DNA gyrase subunit B"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71247"
FT                   /db_xref="GOA:B4UJV2"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR034160"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR041423"
FT                   /db_xref="UniProtKB/TrEMBL:B4UJV2"
FT                   /protein_id="ACG71247.1"
FT                   /translation="MLEGLEAVRKRPHMYIGDVGARGLHHLVYEVVDNSVDEAMAGRAN
FT                   EINVAIHADNSITVLDNGSGIPIGPHPTVKGMDTLDVVLTKLHAGGKFESNAYKVSGGL
FT                   HGVGVTCVNALSEWLKAEVYRDGKVWAQRYERGTPAGKVTAIGETQRRGTRITFKPDAT
FT                   IFEVTEYSFETLSGRLRELAFLNAGLKITIEDERHGKKHEFLFKDGIREFVAFLNKSRE
FT                   VLFQPPIALRQEVETERGAALVEIALQWNDGYDEKVFAFANNIHNHEGGTHLIGFKAAL
FT                   TRTINAYGQKNNLFKDLKDELPSGDDMREGLAAVISVRLPGASFEGQTKTKLSNTEAKS
FT                   MVETMLNERLSAFLEENPNVAKRICGKVAEAARARIAARKARETVRRKGALDSASLPGK
FT                   LADCQSRDPKESELYLVEGDSAGGSAKQGRDRRTQAILPLRGKILNVEKARFDKMLGSA
FT                   EIATIITALGTGIGPEEFDVEKIRYHKIVIMTDADVDGSHIRTLLLTFFFRQMPSVIER
FT                   GLVYIAQPPLFRVAKGKKESYLKDEAALDEYLLALGTDRTRLVAGETVIEGRDLARLAR
FT                   DAIAYRALLARVDRRRDSRIVDAAIQLGDLDLDLLKHHEQVKEQVQKIFDKAQKLHPEL
FT                   QVRIAKIERDEEHGCDALVYQTSMAGAPRDTRLDHDYLSGAEWGELAALHAAIAELGPG
FT                   PFRLETPEGAEEVRDVFEAVEAVKKAAGQGQTIQRYKGLGEMNPEQLWETTMDPARRTM
FT                   LQVRVDDTVEADEVFSILMGDAVEPRREFIEKHALDVQNLDI"
FT   gene            6807..7802
FT                   /locus_tag="AnaeK_0005"
FT   CDS_pept        6807..7802
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0005"
FT                   /product="3-oxoacyl-(acyl-carrier-protein) synthase III"
FT                   /EC_number="2.3.1.41"
FT                   /note="TIGRFAM: 3-oxoacyl-(acyl-carrier-protein) synthase
FT                   III; PFAM: 3-Oxoacyl-[acyl-carrier-protein (ACP)] synthase
FT                   III domain protein; 3-Oxoacyl-[acyl-carrier-protein (ACP)]
FT                   synthase III; KEGG: ade:Adeh_0005
FT                   3-oxoacyl-[acyl-carrier-protein] synthase III"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71248"
FT                   /db_xref="GOA:B4UJV3"
FT                   /db_xref="InterPro:IPR004655"
FT                   /db_xref="InterPro:IPR013747"
FT                   /db_xref="InterPro:IPR013751"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="UniProtKB/TrEMBL:B4UJV3"
FT                   /protein_id="ACG71248.1"
FT                   /translation="MPRAAIVALGTHVPDRVVTNEELTKHMETTDAWIQERTGIQERRW
FT                   VREGTGNSDLALEATKKALDKAGWKPTDIEAIVYASLSPDHMFPGDGCFLNAKLGIPGV
FT                   PAIDIRNQCTGFLYGLSVADAWIRTGTYRRVLLVGSEVHSTGLDVTTRGRDVAVIFGDG
FT                   AGAALLEATDDPGRGVLSCHLHADGRFARDLFTDAPGSIYHPRIQPRMLEDTSIYPHME
FT                   GQKVFKHAVVRMPEVLKEAFEKNGVGPQDLKVLVPHQANLRIAQMVQRSLGLRDDQVFN
FT                   NIQRYGNTTAASIPLALAEAVEARGVARGDLVGLCAFGAGFTWASALVRW"
FT   gene            7894..7967
FT                   /locus_tag="AnaeK_R0001"
FT                   /note="tRNA-Gln1"
FT   tRNA            7894..7967
FT                   /locus_tag="AnaeK_R0001"
FT                   /product="tRNA-Gln"
FT   gene            8012..8533
FT                   /locus_tag="AnaeK_0006"
FT   CDS_pept        8012..8533
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0006"
FT                   /product="peptidase zinc-dependent"
FT                   /note="PFAM: peptidase zinc-dependent; KEGG: ade:Adeh_0006
FT                   Zn-dependent protease"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71249"
FT                   /db_xref="GOA:B4UJV4"
FT                   /db_xref="InterPro:IPR012091"
FT                   /db_xref="InterPro:IPR012962"
FT                   /db_xref="InterPro:IPR024079"
FT                   /db_xref="UniProtKB/TrEMBL:B4UJV4"
FT                   /protein_id="ACG71249.1"
FT                   /translation="MAAPSHVLLIGLGNVGHKTLAEAAQALRDVYALASKAGPSLDRPQ
FT                   YAFNKDRGQYHAPAIVRRLAALRAGAGGVPVLGVVDVDLFLPDAAYVLGDADRDAGAAV
FT                   YSVSRLGAADPALARRRIQVEAVHGVGHLLGLSHCLDFRCAMFLSRDAADSDRKGPGLC
FT                   ASCRASLARP"
FT   gene            8530..9312
FT                   /locus_tag="AnaeK_0007"
FT   CDS_pept        8530..9312
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0007"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ade:Adeh_0007 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71250"
FT                   /db_xref="UniProtKB/TrEMBL:B4UJV5"
FT                   /protein_id="ACG71250.1"
FT                   /translation="MKSLCQRDGMSCGACCGLYNAEDLSRPALHAELGRRTRALREVER
FT                   TPAAFRAAAAALAGGGPSPMFPSVRVCPLLGFLDEAETRVGCLAHPAANGGVDLRDCGV
FT                   YDVATCDAFLCPSHAWLSEEEAAIAAAACDDYHLYGLVITDVEFVRAALGGVAVRAGAR
FT                   VELRHLEHGPFRAALRELFALKEELAPGSDGLFGAFRPGADGEPVARRIDYEALGRAGG
FT                   SPYDRILTCVGADPRSGNDLEALEAEVRRRLDACAAVI"
FT   gene            complement(9718..11853)
FT                   /locus_tag="AnaeK_0008"
FT   CDS_pept        complement(9718..11853)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0008"
FT                   /product="protein of unknown function DUF224 cysteine-rich
FT                   region domain protein"
FT                   /note="PFAM: HEAT domain containing protein; protein of
FT                   unknown function DUF224 cysteine-rich region domain
FT                   protein; KEGG: ade:Adeh_0008 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71251"
FT                   /db_xref="GOA:B4UJV6"
FT                   /db_xref="InterPro:IPR004017"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR021133"
FT                   /db_xref="InterPro:IPR036197"
FT                   /db_xref="UniProtKB/TrEMBL:B4UJV6"
FT                   /protein_id="ACG71251.1"
FT                   /translation="MSPALTSALLLVAAAVFTFTMTRRVMPLLALRRDVRTDRPGERIR
FT                   ALLRYGLGQRRLVDPEERRPGLLHVVIFAAFLVLAIRTVTMFGMGFSAGFHLPLLAPDS
FT                   GLGRAYGLVKDVMVLLALAAVLGFLWRRLVTRPDRVTRSAEGVVILFFIAGLMITDVLF
FT                   DGALHLLREDPLGLGDLLAGAGFDLPAPRFDWLAPAGSLGAALYHASGASAGTVSAVGE
FT                   ASFWLHLALILVFGNVLPYGKHFHIITGLPNVFFARLPPAGALRKLDLEAEDASYGAAT
FT                   VKDLSWKEAWDVYSCTECGRCQTHCPTYVTGKPLSHKEVNRSIRHHLAEVAPALTALAR
FT                   AKDPAVREAAAGALPPISEVIPPETFWACTTCGWCETACPVLIENVPRLVDMRRQAVQV
FT                   DSVFPDEAQRVFKGIETQGNPWGIGSNKRTEWCEDLDVPRAADGGDHEWLFFVGCAGAF
FT                   DDRQKKVSRAIVRILREAKVSFAILGEEETCTGDAARRLGNEYLFQMQATALTETLNGH
FT                   GVKKILVQCPHCLNTIANELPQFGGRYEVVHHADLIARLVADGRLAPGVAEGLGQVTFH
FT                   DPCYLARWNGVTEAPREALAAAGVQVSEMPRNRRQGFCCGAGGGRFWLEEKLGARVNQN
FT                   RVDEAAATLGKAGGVIATGCPFCLTMMKDGVNETGREETLRVMDVAEIVALGLPKRADA
FT                   APATAPEHTPAAPRGDA"
FT   sig_peptide     complement(11797..11853)
FT                   /locus_tag="AnaeK_0008"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.983) with cleavage site probability 0.701 at
FT                   residue 19"
FT   gene            complement(11969..13012)
FT                   /locus_tag="AnaeK_0009"
FT   CDS_pept        complement(11969..13012)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0009"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ade:Adeh_0009 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71252"
FT                   /db_xref="UniProtKB/TrEMBL:B4UJV7"
FT                   /protein_id="ACG71252.1"
FT                   /translation="MKRTLAILAPLAIAASGCVVATPVPSEPPPVAMPAPAPAPAPPLQ
FT                   VWYYGEHFVPDAFGGGWCYEPGAHWHDYYPDQPSAYVLDGGYYFYRGPLVFTYWEGHPV
FT                   PGGGWCYVRGPHRHDYYPPRGNDWQWRRGHGWAYRGHWRPERPPPAAYWPSRPAPYPSR
FT                   PAPAPAPYPGRPAPAPYPGRPAPAPAPAPYPDRPYPGRPAPAPAPAPLPAPAPAPYPGR
FT                   PVPAPAPAPVPDDRGRRDDAPGHGNLPPGHGGTPPGQAAPSAPAYPAPGRGNDRGNIQP
FT                   PGHGGTPPGRAAPAPAPAPAPRDDARSGGNGQGRRDDKNDKADTGKKDDRKSRQQDDLK
FT                   DRRFQRL"
FT   sig_peptide     complement(12947..13012)
FT                   /locus_tag="AnaeK_0009"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.968 at
FT                   residue 22"
FT   gene            complement(13324..13992)
FT                   /locus_tag="AnaeK_0010"
FT   CDS_pept        complement(13324..13992)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0010"
FT                   /product="DSBA oxidoreductase"
FT                   /note="PFAM: DSBA oxidoreductase; KEGG: ade:Adeh_0010 DsbA
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71253"
FT                   /db_xref="GOA:B4UJV8"
FT                   /db_xref="InterPro:IPR001853"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B4UJV8"
FT                   /protein_id="ACG71253.1"
FT                   /translation="MSPNFRHAQPVTLVLYEDPLSPWCLVAERRILTALEDVEGAFGAL
FT                   QLEPFPTRLEPRAMTKAERRALARAARKAAREPEAAAITDDLWLSPDPPLTSIPALTAL
FT                   AAARLQGPSREAALRHAIREASLVRGLNVARTDVLLELAERAGLDLHRFAGALAAPATE
FT                   RRVRAVHESAFDKGIRGAPALVIGDEWLVTGPRSVDEYRTVLQRYASARLGLAPLKTLH
FT                   "
FT   gene            complement(14111..15094)
FT                   /locus_tag="AnaeK_0011"
FT   CDS_pept        complement(14111..15094)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0011"
FT                   /product="alpha-L-glutamate ligase, RimK family"
FT                   /note="TIGRFAM: alpha-L-glutamate ligase, RimK family;
FT                   PFAM: protein of unknown function DUF201; RimK domain
FT                   protein ATP-grasp; KEGG: ade:Adeh_0011 SSU ribosomal
FT                   protein S6P modification protein"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71254"
FT                   /db_xref="GOA:B4UJV9"
FT                   /db_xref="InterPro:IPR004666"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013651"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR041107"
FT                   /db_xref="UniProtKB/TrEMBL:B4UJV9"
FT                   /protein_id="ACG71254.1"
FT                   /translation="MPPGKKTARAKRAAARPRRDGELGVAILSRNPRLYSTRRLVEAAT
FT                   ALGHAPRVLDTLRCNMVLARDRPRIFYLGEEVVASDVHVVVPRIGASITGYGVAVVNQF
FT                   DLMGVPVLAAATPIGRSRDKLRALQLLSRFGIDIPRTVMCRYREEVPEAVQMVGGLPCI
FT                   IKLIQGSQGVGVMIANTEVEVRGLLDTLWTLGQEILLQELVAESKGRDVRALVVGDRVV
FT                   AAMRRTARAGEFRSNIHRGGVAEALELGREYAETAVKAARVMGLEVAGVDMLEARTGPK
FT                   IMEVNSSPGFEGLEAATGLDIAALYVRHAVDFASTRQSGYASGHLA"
FT   gene            15217..18057
FT                   /locus_tag="AnaeK_0012"
FT   CDS_pept        15217..18057
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0012"
FT                   /product="isoleucyl-tRNA synthetase"
FT                   /note="TIGRFAM: isoleucyl-tRNA synthetase; KEGG:
FT                   ade:Adeh_0012 isoleucyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71255"
FT                   /db_xref="GOA:B4UJW0"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002301"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR010663"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR023585"
FT                   /db_xref="InterPro:IPR033708"
FT                   /db_xref="UniProtKB/TrEMBL:B4UJW0"
FT                   /protein_id="ACG71255.1"
FT                   /translation="MDSKYSVNLPKTDFPMKANLPQREPEILRQWEEQAIFQRLVAQNA
FT                   GRPGAKRFVLHDGPPYANGDIHIGHALNKILKDVVVKYRNLNGEVADYIPGWDCHGLPI
FT                   ELKVDKELGPKKRELDRPAIIEACRKYAQKWIEKQRESFKRLGVFGRWETPYATMSRGY
FT                   EAEIVRTFARAAEKGFLYRGKKPVYWCITDRTALAEAEVEYEQHRSPSIYVAFDLVSAL
FT                   PDPKLAGRPARLVIWTTTPWTLPANLAVAAHPDFTYVAYDLNGQVVVVAKDLLAAFLAD
FT                   VAPGELSVSDVPAPHSPPAHEASTGGGGTVLAPQLAHPERVLAHLDGSALEGLRYRHPF
FT                   LDRESQVILGDHVTLEAGTGLVHTAPGHGQEDYVVGLRYGLEVLNPVDGAGRFTERAGK
FT                   YAGKKIFEANPEIVADLHASGHLLSDPKASLEHSYPHCWRCHNPVVFRATDQWFLSLEH
FT                   ADLRKATLAEIDRVRWIPHWGRERIHNMIENRPDWCVSRQRTWGVPIPVFYCEGCNEAL
FT                   LSPPVMERVAAAFEAEGMEAWYRHPPADFTAGAACPKCGKTEFRREQDILDVWWDSGVS
FT                   WAAVIEREGLELPVDLYLEGSDQHRGWFHSSLLTSMALRGAAPYRAVLTHGFILDQHGK
FT                   AMSKSAGNGIEPSEIIKKYGADILRLWVSASDYRDDIGLGDQILAGLAEGYRKIRNTIR
FT                   YALGALDGFDPARDAVPEAELEPIDRWALARLAAWDEKVAKAYEDYEFHLAYHATMQFC
FT                   AVELSALYFDVIKDRLYTWKADGRQRRSAQTALHAIAQDLIRLLAPILSFTASEAWTYL
FT                   PGRPTESVWLAGLPRRARPADADALEARYGKLFEVRGVVQSKLEEARRAKLIGSGLEAM
FT                   VTVRAEGEQRRLLEEARAELPTLFIVSKVVLADGPLSAEVARAPGVKCERCWIYAEDVG
FT                   RDPAHPTLCGKCVGNL"
FT   gene            18057..18677
FT                   /locus_tag="AnaeK_0013"
FT   CDS_pept        18057..18677
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0013"
FT                   /product="lipoprotein signal peptidase"
FT                   /note="TIGRFAM: lipoprotein signal peptidase; PFAM:
FT                   peptidase A8 signal peptidase II; KEGG: ade:Adeh_0013
FT                   Signal peptidase II. Aspartic peptidase. MEROPS family A08"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71256"
FT                   /db_xref="GOA:B4UKG5"
FT                   /db_xref="InterPro:IPR001872"
FT                   /db_xref="UniProtKB/TrEMBL:B4UKG5"
FT                   /protein_id="ACG71256.1"
FT                   /translation="MRRPVSKWALLALLFAALLAADQWTKYLAVERLTVVFERGGDETL
FT                   AERVRGFYTYRHLEPLSTEPYYVWRPVWRMNYVENPGAAWGLFRGHSQLFRNAFFTLVS
FT                   LAAVAFILHYYRKLRQDQRYLQVALALVLAGAVGNFVDRLARRYVIDFVEWYWWNRPDL
FT                   RWPTFNVADSLIVVGVAMLVLHPGSKREAARAPERRGAAAERV"
FT   sig_peptide     18057..18119
FT                   /locus_tag="AnaeK_0013"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.831 at
FT                   residue 21"
FT   gene            18690..19595
FT                   /locus_tag="AnaeK_0014"
FT   CDS_pept        18690..19595
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0014"
FT                   /product="prolipoprotein diacylglyceryl transferase"
FT                   /note="PFAM: prolipoprotein diacylglyceryl transferase;
FT                   KEGG: ade:Adeh_0014 prolipoprotein diacylglyceryl
FT                   transferase"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71257"
FT                   /db_xref="GOA:B4UKG6"
FT                   /db_xref="InterPro:IPR001640"
FT                   /db_xref="UniProtKB/TrEMBL:B4UKG6"
FT                   /protein_id="ACG71257.1"
FT                   /translation="MLPVLFRIPLPGGAFLPLHTYGLLIAVGFMVGIWLAQREAARRGQ
FT                   DPRRLADLAFWILVAALVGSRVYYMLVNPGDFFSSARFLVATPFGRIPRVLAVWQGGLV
FT                   FYGGFIGAALTAAWYMRRHRMGFLEHADTLIPSVALGHFFGRLGCFGAGCCWGDVAHGH
FT                   LPWAARFPPESLAFQSFADRPDPGQYLAPDRLSTLPLHPTQLYEAFGELGLFLLLVIVV
FT                   RPRKRFHGQVLAAWLMLYAVLRTGVEAFRGDVERGVVLGLGVGQWTSIVIFAAGAAVWA
FT                   RARRSGPSGAGAAAAPAGGR"
FT   gene            19629..20375
FT                   /locus_tag="AnaeK_0015"
FT   CDS_pept        19629..20375
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0015"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ade:Adeh_0015 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71258"
FT                   /db_xref="UniProtKB/TrEMBL:B4UKG7"
FT                   /protein_id="ACG71258.1"
FT                   /translation="MALPPQKPGRPAGPPPSAEEAARAARHATDELTDETAKLEEELEA
FT                   LKARYEQYFLGTERREPAHWRDEVRKKVLRLKGAFTRNTGLRFRIQSLHARYLSYERLW
FT                   QRSVREREEGTYRRDLLKARRHAREAAEPAAAAGSAAPGGAAAPGSPRVEPPGPGRAAA
FT                   TPPSATPPPSAARGDDEVRMRALYDAYISAKRQCNEDVSRLSYDVVARSVAKQVPEVMA
FT                   RFKAKSVDFRVEVKDGKAILKAIPRV"
FT   gene            20563..21003
FT                   /locus_tag="AnaeK_0016"
FT   CDS_pept        20563..21003
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0016"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ade:Adeh_0016 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71259"
FT                   /db_xref="UniProtKB/TrEMBL:B4UKG8"
FT                   /protein_id="ACG71259.1"
FT                   /translation="MTNVLPERLLMWGEGSLRALLPSIAVALLCAACGASDADARRARL
FT                   GAERRALEATLDHLEDRLIVNQARVRFWKEMQSRHESVTAVACTSQEEHAIEMARHVLP
FT                   GEPARRAGRRASTDRASIDRARVAAAPRAPSPAPARTAAAAP"
FT   sig_peptide     20563..20679
FT                   /locus_tag="AnaeK_0016"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.688) with cleavage site probability 0.414 at
FT                   residue 39"
FT   gene            21140..21212
FT                   /locus_tag="AnaeK_R0002"
FT                   /note="tRNA-Phe1"
FT   tRNA            21140..21212
FT                   /locus_tag="AnaeK_R0002"
FT                   /product="tRNA-Phe"
FT   gene            complement(21489..21893)
FT                   /locus_tag="AnaeK_0017"
FT   CDS_pept        complement(21489..21893)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0017"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="PFAM: helix-turn-helix domain protein; KEGG:
FT                   pth:PTH_2444 hypothetical transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71260"
FT                   /db_xref="GOA:B4UKG9"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:B4UKG9"
FT                   /protein_id="ACG71260.1"
FT                   /translation="MSRSKPTTFDTFMREVEAEARAEGADAVAQVEELKDHFRLAAQVL
FT                   RRRRELGLTQKQLAGRVGIHQSEISDIERGAATPGYRTLAKLAIGLDAEVKLVPRPTTR
FT                   RASTSKVRSTSRRAPRAAAYAHNVSSKRRN"
FT   gene            complement(21945..22397)
FT                   /locus_tag="AnaeK_0018"
FT   CDS_pept        complement(21945..22397)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0018"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cgb:cg3229 hypothetical protein predicted by
FT                   Glimmer"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71261"
FT                   /db_xref="UniProtKB/TrEMBL:B4UKH0"
FT                   /protein_id="ACG71261.1"
FT                   /translation="MARYTITFFRDQGGDEPVYRWLTEELSPVLRRILGFAMNEVLQEE
FT                   GVDVCGTEYGRQLGDGLFEFRIRGTVGDFIKKPVPVPNPDEKLLLRIFCHAHGDKVILL
FT                   LAGYDKLANPSKSRQDTEIELARMRLRAWKLGQKRAAKAVSRRRSP"
FT   gene            complement(22583..23107)
FT                   /locus_tag="AnaeK_0019"
FT   CDS_pept        complement(22583..23107)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0019"
FT                   /product="response regulator receiver protein"
FT                   /note="KEGG: ade:Adeh_0017 response regulator receiver
FT                   domain protein (CheY-like)"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71262"
FT                   /db_xref="GOA:B4UKH1"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:B4UKH1"
FT                   /protein_id="ACG71262.1"
FT                   /translation="MNPTFDAIPAPRPRALVLHPDVSTRAELGWALGSRDIASLSAADG
FT                   ASGLALLLEELLALDALAVKLDLPGRDARAFADLVRRAGGEQDLAIVVLASDPSPSLRA
FT                   ELAALGVDEVVDPRLGPDAVAEAVVEAVEARRASAAIGVSPGRRPRRRRSAGAPSCPRG
FT                   EARQGALSTAA"
FT   gene            23413..23775
FT                   /locus_tag="AnaeK_0020"
FT   CDS_pept        23413..23775
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0020"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ade:Adeh_0018 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71263"
FT                   /db_xref="UniProtKB/TrEMBL:B4UKH2"
FT                   /protein_id="ACG71263.1"
FT                   /translation="MSYDYTVFRAPSDQPMASWPAAAPPALGSVAEVRQRLDELLHEVT
FT                   WTQRGSTWFGCSQGQEGSAELQLTPEPDGQVHFVTIRRVERALVEHLCARLGLVAVDPQ
FT                   AMTLYRPETRGWTDAR"
FT   gene            complement(23788..24594)
FT                   /locus_tag="AnaeK_0021"
FT   CDS_pept        complement(23788..24594)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0021"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ade:Adeh_0019 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71264"
FT                   /db_xref="UniProtKB/TrEMBL:B4UKH3"
FT                   /protein_id="ACG71264.1"
FT                   /translation="MSTHGTATLVSIVTFGLLLGAPARAAGQCTSSDVPAGGIFTKLDA
FT                   HGMDSDHFSLTIINLSDVELEGDADITASMAKYSLVYPPEFVMWECAEPPFYKLCSSAE
FT                   MSDATCQDVTHGFRPAPWKISVARNDSAIWTGGWANDCYEGKIDFTWRTSTFQLRFKRQ
FT                   KVYGGAVAYPHYGTWTTLLPRTGSWCAPGTFCSGVWTTPHDYEMRNLTTIAANELVVSL
FT                   YSPDNQSLVVVLRETHWDGAQGDAYDGKRLDWVDNDSPRVPGDCNH"
FT   sig_peptide     complement(24517..24594)
FT                   /locus_tag="AnaeK_0021"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.996) with cleavage site probability 0.949 at
FT                   residue 26"
FT   gene            complement(24609..25961)
FT                   /locus_tag="AnaeK_0022"
FT   CDS_pept        complement(24609..25961)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0022"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ade:Adeh_0020 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71265"
FT                   /db_xref="UniProtKB/TrEMBL:B4UKH4"
FT                   /protein_id="ACG71265.1"
FT                   /translation="MSRSSRLHVLTLTVLLPLAATAQTNYFPYGTAGEMQTDLLTYDGA
FT                   ARSVVVRILNLTPFRIEHTEATSAAYGDQYQVGTPATDVLDRDRFVPKSFLFAPVGVPA
FT                   IIPGVPPEAYTEGYVNTVTRPYEMVFSWDERGARVEQSRVSWVVRGVEWWECPPPSVGG
FT                   DCTVRRDDVHLGLWVTRPLDDPGESLYAGFFGSDFLATLTMAVSFAGVVTDPFNPLSWY
FT                   GLFISIADMADPARFEEEQVAPDDGIKMYVAAYPIPAPDQDCYRSNHNLVENEVAAPSP
FT                   ALPDPRICTPQTVSGAADDGTDAQWADAAGPGASELITTIHVLRGRRFGGSSCAGKWGA
FT                   VPIVNVTVWTRDQYAASNVAGLAHASLAARPQRDPDAAKVVEEFRKLYEKYDRAGLLAI
FT                   REVVLALAPGEREQLRAAVVTVRSGGVLDKDARKALHQVIVAARARLTDAE"
FT   sig_peptide     complement(25893..25961)
FT                   /locus_tag="AnaeK_0022"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.983 at
FT                   residue 23"
FT   gene            26366..27763
FT                   /locus_tag="AnaeK_0023"
FT   CDS_pept        26366..27763
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0023"
FT                   /product="histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase A domain protein; KEGG: ade:Adeh_0021
FT                   periplasmic sensor signal transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71266"
FT                   /db_xref="GOA:B4UKH5"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B4UKH5"
FT                   /protein_id="ACG71266.1"
FT                   /translation="MASPGPDRRSRRFLFGGYVVVVASFIAASVYTAEHIREIDVASDE
FT                   IARDAMPTIRCLAEARHILGQFEIESAAFAAVPVTPAARVAAEAPLRALAEQVGIYLAL
FT                   PLFPGERPFWEDVRRGTSRFVGAANRMLGQADAGDARLARETFLREVRPAAAHLHELLS
FT                   RDLDFNARNGSQLAEHIKAVRARGLWLSLSLGILCGGIALLAGRVVAGQLRRHEALVSE
FT                   HERMMEERAGELEAFAGRVAHDIMNPTASAQLAIDLELRRRQAAGEPAGEGLERARRSL
FT                   RRIQTLVAGLLGFARAGARPEPGAAADVVEVVHDVVSGAEARATAAGMIVGAELVPGTV
FT                   ACAKGVLTSLVANLLDNAIKYARRDGRVVIRAAPDAAAIRVEVEDDGPGLPPDLGDRVF
FT                   EPYVRGGGRDVPGLGLGLATVKRLAEAHGGHVGVCSEPGRGTTFWFELPRAAAVSESAS
FT                   MRGSARG"
FT   gene            complement(27793..28182)
FT                   /locus_tag="AnaeK_0024"
FT   CDS_pept        complement(27793..28182)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0024"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; KEGG: ade:Adeh_0022
FT                   glyoxalase/bleomycin resistance protein/dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71267"
FT                   /db_xref="GOA:B4UKH6"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:B4UKH6"
FT                   /protein_id="ACG71267.1"
FT                   /translation="MTALQSIRQLDYTVLFARDPERMRRFYAEVMGFPIARELGPGWVE
FT                   FRVGSNLLVLTQRGGLFHDPPTPEGALSVQLAFRVAPAAVAACAEELRRLEVPIVSPPT
FT                   DQPWGHRTLFFRDPDGNVLEIYADL"
FT   gene            28217..29119
FT                   /locus_tag="AnaeK_0025"
FT   CDS_pept        28217..29119
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0025"
FT                   /product="helix-turn-helix domain protein"
FT                   /note="SMART: helix-turn-helix domain protein; KEGG:
FT                   ade:Adeh_0023 transcriptional regulator, XRE family"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71268"
FT                   /db_xref="GOA:B4UKH7"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR041413"
FT                   /db_xref="UniProtKB/TrEMBL:B4UKH7"
FT                   /protein_id="ACG71268.1"
FT                   /translation="MVMPASVARKVPGDAGGGTTTLAARALGDFLRRMRSRPALAVAGG
FT                   GRRRVTGLRREEVAVAANISITWYTWLEQGRPVRTSPRTVRALARALRLGEAEAAHLAR
FT                   LADAVASAAPRWRRTAQASPALRAMVDGLRDSPAYVVNGRWDVLHANAAARAVLGSFEA
FT                   TPGVTDNVLARLFLDPGWRGRFLDWEAVASSAVAQFRAAGGRLVAHPDWNAFVADLAAR
FT                   SPEFAHAWESQALADAHLRRKRLAAPGGEPLELLYASFAPEGEPEDVRVVLYVPADDAA
FT                   RGVLARALRPFGPARRPAR"
FT   gene            29196..30728
FT                   /locus_tag="AnaeK_0026"
FT   CDS_pept        29196..30728
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0026"
FT                   /product="prolyl-tRNA synthetase"
FT                   /EC_number="6.1.1.15"
FT                   /note="TIGRFAM: prolyl-tRNA synthetase; PFAM: tRNA
FT                   synthetase class II (G H P and S); Anticodon-binding domain
FT                   protein; Prolyl-tRNA synthetase, class II-like; KEGG:
FT                   ade:Adeh_0024 prolyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71269"
FT                   /db_xref="GOA:B4UKH8"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR004499"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR016061"
FT                   /db_xref="InterPro:IPR017449"
FT                   /db_xref="InterPro:IPR033721"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="UniProtKB/TrEMBL:B4UKH8"
FT                   /protein_id="ACG71269.1"
FT                   /translation="MASASADTAIRPTRAENFSEWYLEVIKAADLAESSTVRGCMVIKP
FT                   WGYALWEHVQRVLDGMFKATGHVNAYFPLFIPLSLLEKEAAHVEGFAKECAVVTHHRLE
FT                   ARDGKLVPVGELEEPLVVRPTSETIIGESFARWVQSYRDLPLLINQWANVVRWEMRTRM
FT                   FLRTAEFLWQEGHTAHATEREAIDETMQMLRIYARFAEEWMALPVVQGEKTASERFPGA
FT                   VRTYCIEAMMQDRKALQAGTSHFLGQNFAKASGIQFQDENGTLTHAWTTSWGLSTRMIG
FT                   AMIMTHGDDDGMVCPPRLAPQQVVIIPVIQKPEVREQVLAWCAELKRELEAQSYAGAPV
FT                   RVHLDARDVQGAKKSWEWIKKGAPIRLEVGPKDIEKGAVFMGRRDRKPREKQSVPRGEL
FT                   VAGVAALLQEIQDALLQRARAVRAEHTRPIDTKDEFYAYFTPPATARPNDPTPIHGGFA
FT                   LAHFSGDPAVEARIKEDLGVTVRCIPLEPGEPGTCPFTGQPSPKRVVWAKSY"
FT   gene            30892..32274
FT                   /locus_tag="AnaeK_0027"
FT   CDS_pept        30892..32274
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0027"
FT                   /product="Fibronectin type III domain protein"
FT                   /note="PFAM: NHL repeat containing protein; Fibronectin
FT                   type III domain protein; KEGG: bba:Bd0727 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71270"
FT                   /db_xref="InterPro:IPR003961"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR036116"
FT                   /db_xref="UniProtKB/TrEMBL:B4UKH9"
FT                   /protein_id="ACG71270.1"
FT                   /translation="MPARATSSRFFLVAAALALTACGGGGGSKASSPPRVERVTGVVAV
FT                   AGDGEVTVSWDPFPGALSYNLYWSKTPGVDAATGNLLQDVTSPQVLTATNGVTYYVVVT
FT                   AVTAAGESAESAEAWFTPGASPVPPGTGHVGVVTTIAGSSMDYADGDAIHARFNTPTGI
FT                   VGVGTSLYVCDTTNMLIRRLDLSTRQVTTLAGDPRTYAGHQDGIGTAASFNSPRGITSD
FT                   GTYLYVADTANNLVRRIDLATAAVTTLAGSTTQAGAADGPGASATFRWPRGVATDGTTL
FT                   YVADTMNNAIRALDLATGVVSTLAGDPASYAGYADGRGTAARFSAPYGLAMHGGELLVA
FT                   DSGNSAIRAVDPLTGEVTTVSTTTAAPYAIAVIGGYVYVANHASGGGDPVPGTGNTITE
FT                   IDLATGEAWTLAGGNWYATLADGTGTAAAINYPEGMTGLDGKLYVSDTFSHVLRRIDLQ
FT                   PL"
FT   sig_peptide     30892..30984
FT                   /locus_tag="AnaeK_0027"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.972 at
FT                   residue 31"
FT   gene            complement(32467..32994)
FT                   /locus_tag="AnaeK_0028"
FT   CDS_pept        complement(32467..32994)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0028"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ade:Adeh_0025 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71271"
FT                   /db_xref="UniProtKB/TrEMBL:B4UKI0"
FT                   /protein_id="ACG71271.1"
FT                   /translation="MHLPSRVAPAVLAVSLVTACAGAREAGRGPPQSLTVRELTVVDAR
FT                   GQPRLRIGAPLPPPKGAERRAVDAFGIQFMDQDGYEIAGLGMLEPVDIRGLCFDIKDAY
FT                   EAMCVGLVKGEPSITFRHDWKERITLGVEQGVASIVLRDAQGEPRVRLEVDRDGKTRVE
FT                   GVGQGAAVPPAP"
FT   sig_peptide     complement(32923..32994)
FT                   /locus_tag="AnaeK_0028"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.985) with cleavage site probability 0.628 at
FT                   residue 24"
FT   gene            complement(33083..33682)
FT                   /locus_tag="AnaeK_0029"
FT   CDS_pept        complement(33083..33682)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0029"
FT                   /product="NAD(P)H dehydrogenase (quinone)"
FT                   /note="PFAM: NAD(P)H dehydrogenase (quinone); KEGG:
FT                   sfu:Sfum_2320 NAD(P)H dehydrogenase (quinone)"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71272"
FT                   /db_xref="InterPro:IPR003680"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:B4UKI1"
FT                   /protein_id="ACG71272.1"
FT                   /translation="MNLLVLLAHPDRASLNHALADAACRAARRAGHEVTLRDLYAEGFD
FT                   PVLPGPEIPRDAPLPGWLREHCDALASAGGIVIVHPNWWGQPPAILTGWIDRVVRPGVA
FT                   YAFQEGDSGEGVPVGLLRARTAVVLNTSNTPIAREREAFGDPLDAIWRRCVFDLCGVKD
FT                   VRRRTFSVVVTSTDAERAAWLAEAEALVADAFPRER"
FT   gene            complement(33774..34763)
FT                   /locus_tag="AnaeK_0030"
FT   CDS_pept        complement(33774..34763)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0030"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase; KEGG:
FT                   ade:Adeh_0027 NAD-dependent epimerase/dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71273"
FT                   /db_xref="GOA:B4UKI2"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B4UKI2"
FT                   /protein_id="ACG71273.1"
FT                   /translation="MPRPDPFVPPELHVVFGAGQVGRRLARELLGLGHSVRLVRRGPPG
FT                   PELPGLRWLSGDATDPLFAGEACRGADVVYDCTNPPDYHRWDELLAPLRRGIRDAAARA
FT                   GARLVALDCLYMYGRPAASPFDEDAPLAPCSHKGELRALLARELLEAHARGDLRATTGR
FT                   ASDFFGPGAGAAALLGDRLAARLRAGKPFEAFGDPDLPHAYSYVADVARGLAVLGTDDA
FT                   ALGRAWHLPVAWTGSTRGLVEAVGAALGRPARLRIVPDWLLRVGGLLDPTLGAAVEMTY
FT                   QWKVPYVPDDRRFRAAFSVEPTPAAEAVAATARAILDAEAPAGRREAA"
FT   gene            34843..35781
FT                   /locus_tag="AnaeK_0031"
FT   CDS_pept        34843..35781
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0031"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: ade:Adeh_0028 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71274"
FT                   /db_xref="GOA:B4UKI3"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B4UKI3"
FT                   /protein_id="ACG71274.1"
FT                   /translation="MQRPPPAPPAAALDWDHARVLRALLEARSLSGAAARLGVNASTVS
FT                   RRLGALEAALGARLFDRTPDGVLPTALAESLGPHAEAMERAANALALAAQGRELAAEGE
FT                   VRLTAAPGVAEYLLAPALPRLLAAHPGLRLTLDATIGYADLTRREADLAIRGVLPASGD
FT                   LLARKLGTATGGVFGAPRQARALGTLRSLDAARWITWGDDLAHLELTRAVLDHVPPERI
FT                   ALRTSHMGTQMAAARAGVGLVLADRNMALACGLAEVRLAPAARRQLPSARAGDLWLVVH
FT                   RALREVPRVAAVWDFVLEEARRLGLSPGDGT"
FT   gene            35952..38183
FT                   /locus_tag="AnaeK_0032"
FT   CDS_pept        35952..38183
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0032"
FT                   /product="fibronectin, type III"
FT                   /note="KEGG: ade:Adeh_0029 fibronectin, type III"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71275"
FT                   /db_xref="GOA:B4UKI4"
FT                   /db_xref="InterPro:IPR011031"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR036116"
FT                   /db_xref="InterPro:IPR036280"
FT                   /db_xref="UniProtKB/TrEMBL:B4UKI4"
FT                   /protein_id="ACG71275.1"
FT                   /translation="MRQPVHRSSRGGLHAPRARGSSRLDPTLAMAFALSAVLVSGCGPD
FT                   EAPTAASGLAGDPMPGKTVEPAPAPLPPRFTTQALPVAGEVCVGSAAHDKHAASGIGCT
FT                   ACHPCGGALGFANPVTFPGGTTSANGSVVSDASGTTCSVGCHAPLGAEPHGVSWTAGPL
FT                   QCVTCHTDVGAIDPATALSAHPLPDGSSGTSCQSCHDTSQHLSGEVRMVDGGGGSAAVT
FT                   CAGCHAGQGQTLSGETPPLLVGWDDLVSGDFHGDRPGTCRFDALDPAGQRSIGRGAYAC
FT                   PPNQPDQPGAMRITPRWWYANGTSGAWAWTCVLQPVDAAGNPVGAARTGQPCPEGTIQN
FT                   SSCSSNLSSPSCYPTTLVTRGFGGTLLAPYARGQGAIACARCHDFHASNNAFLLAAHVN
FT                   GVAIPPGSIDRAGVGAQVLCTACHQGDRHEVCKACHRERWVTDGSYSWFEGAPADPAPD
FT                   GAACFFCHGHEGIQQMEVTSPVYPPNHPYSTGLPQSACTHCHDGWAPPPTEYVAPRFQA
FT                   GPALSGVTATTATVAWTSSEKATSYVEYGVGTAGHVVGNDAFVVQHSVQLTGLTPGTTY
FT                   VWRVRTSDVFRNVTHTALQSFTTPAEGALSSPDLAPVSASFEVGTYDATVPLVWFPVTA
FT                   AAGVVLQYEVQLASDAAFTYLQNGSLTGPGVPGSTVGSTGWVSGTPTTSGGRPALQVPA
FT                   RLLNIPQDSCGPYAPRPYYWRVRVRDQQGHESGWSAPGNFGAFAWDPWC"
FT   gene            complement(38299..40254)
FT                   /locus_tag="AnaeK_0033"
FT   CDS_pept        complement(38299..40254)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0033"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="PFAM: histidine kinase HAMP region domain protein;
FT                   chemotaxis sensory transducer; KEGG: ade:Adeh_0030
FT                   methyl-accepting chemotaxis sensory transducer"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71276"
FT                   /db_xref="GOA:B4UKI5"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR033462"
FT                   /db_xref="UniProtKB/TrEMBL:B4UKI5"
FT                   /protein_id="ACG71276.1"
FT                   /translation="MRSASLATKLVLALGLAFAVVLGGFTAASAAFTARTVEQQTADAL
FT                   RGRVALVRDMVGVYDASLARATADLLHVFRAAYPEGIRADPSRAAYVEGVALPGLAAGD
FT                   RMVDLDYPTVDRFTATSRAVATVFARAGGDFVRITTSVQTDDGRRAVGTFLGADHPAHR
FT                   RLLEGEPYTGKAVLFGRDFFTRYEPIVQDGKVIGALFVGVDFTDGLAALRERIRGVRAG
FT                   DQGYFFVVDASAGAGRNRLIVHPTRAGEAAPDGLGPALATGSGGAEGLRIAGADAKGAA
FT                   RPEIATCQAFEPWQWLVCGAVPEEELTHDGQRLGLLLSTGGAALVIVLAGLALWLVRRM
FT                   VLEPLARTARFAERVAAGDLASELEIRAGDEVGALGEALNEMVRALRAVVGTLRSASDA
FT                   VAEACQALSASTAQIAEGASEQAAGAETASGATTELAARVRDVAGGAAETEALAARSAA
FT                   SARSGGEAVRRAVEAVQEIAGRTAVIEEIAHQTNLLALNAAIEAARSGVHGRGFAVVAT
FT                   EIRRLAERSRAAAAEIGALGTSTVQAARLAGEALDAVVPDIGRTSELVRGMAVATEEIS
FT                   AGAHEVTGAIGQLDAAIQASASSSEELASTAARLAEEAEALRRSAAWFRTGEPEHGTAP
FT                   ATRAPALPAVAPGRAA"
FT   sig_peptide     complement(40162..40254)
FT                   /locus_tag="AnaeK_0033"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.390 at
FT                   residue 31"
FT   gene            40522..41544
FT                   /locus_tag="AnaeK_0034"
FT   CDS_pept        40522..41544
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0034"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase;
FT                   short-chain dehydrogenase/reductase SDR; KR domain protein;
FT                   KEGG: ade:Adeh_0031 short-chain dehydrogenase/reductase
FT                   SDR"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71277"
FT                   /db_xref="GOA:B4UKI6"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B4UKI6"
FT                   /protein_id="ACG71277.1"
FT                   /translation="MRRSTALSLTAALAAGAWLAARRLRRRRPLAGGVALVTGGSRGLG
FT                   LVLARELGRRGMRIVLCARDEEELERARSGLAQEGIDATGLPGDVTDEDGTRTLVADVE
FT                   ENLGPVELLVNSAGIIQVGPAEAMSVEDYRHAMDVLFYGALHAAEAVLPGMRARRRGTI
FT                   VNVTSIGAAVGIPHLAPYDAAKFAARGWSEALGAETAKYGVDVITVVPGLMRTGSFGRA
FT                   LVKGRRYAEASLFSLLASLPLVTVSAERAARRIVRAIEHRERFVIIGLPARVLRLAHSL
FT                   MPGAIVATLGFVNRFLPTAAPGARHGIALPAELFRRGLARSILTALGERAARRYNEEPA
FT                   "
FT   sig_peptide     40522..40581
FT                   /locus_tag="AnaeK_0034"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.995) with cleavage site probability 0.636 at
FT                   residue 20"
FT   gene            complement(41821..43044)
FT                   /locus_tag="AnaeK_0035"
FT   CDS_pept        complement(41821..43044)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0035"
FT                   /product="membrane protein involved in aromatic hydrocarbon
FT                   degradation"
FT                   /note="PFAM: membrane protein involved in aromatic
FT                   hydrocarbon degradation; KEGG: ade:Adeh_0032 membrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71278"
FT                   /db_xref="InterPro:IPR005017"
FT                   /db_xref="InterPro:IPR042117"
FT                   /db_xref="UniProtKB/TrEMBL:B4UKI7"
FT                   /protein_id="ACG71278.1"
FT                   /translation="MRKTFRIAFLAVLAAPAVALASGFEVINVNPRDLALSSSGVAAQE
FT                   DAAATFQNPAALSKLSGLNLSLAGSMLSLRTKWTGTAAYPGKETTKFAPTPPVAMYVAY
FT                   GTKLAGRGLGFGLGVGTPGGGQMKWDDQWEGRGRIITVERRMLGFYLNGGYEIAPWLRV
FT                   GGGAIYYEGIQYLKQGIQPFPDAYAELDTKGGGFAYQLSAEVKPLENLTLGFDYKHKGT
FT                   MHMKGDAHFQVPPSLVGPTTQDQDVKQDLTFPNRIDTGLAWRVAKPVLVTLQYSWSRFV
FT                   VYNQDLFEGETTAITVPRDYRNGNVIRGGVEWTALPTLRLRAGMMRDWSGLRTNTLSPT
FT                   LPDSNTTGYSLGAGWDAGADFGLNAAVFYGDRDKQTSTGTAAFPGSYKTDVWIVALGFT
FT                   WRTDLGNR"
FT   sig_peptide     complement(42979..43044)
FT                   /locus_tag="AnaeK_0035"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.983 at
FT                   residue 22"
FT   gene            complement(43058..46006)
FT                   /locus_tag="AnaeK_0036"
FT   CDS_pept        complement(43058..46006)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0036"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ade:Adeh_0033 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71279"
FT                   /db_xref="GOA:B4UKI8"
FT                   /db_xref="InterPro:IPR005065"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B4UKI8"
FT                   /protein_id="ACG71279.1"
FT                   /translation="MSLRRYGPPLALAFASLLACTDVKQEKPAPQLVIATFASPNIPTP
FT                   NDLVLQAVPTLPDGAQKELLQSFIDAGGFPSDQEVAITIPFRAVSWNGSAYVETTPPDL
FT                   DPATVTTSTVALLKVDGAPQAVEFEVGSATAGRLVLRKKADASGSRRFAPGRYVVAVRG
FT                   GASGVKTTAAQGGMPVNPDQAIAIAAQNKDLTVHENQPPGLTPALVAQLEAVRKVLWSP
FT                   LTWTDVGGRWTASVDTNVAPAFAAVAPTFAPAEVAAIAAFGIAPAAAQPLTDSGSGQIP
FT                   LPSTFLLDGTRPANDPPTRFYVRNVPAFGPAAAGLATLDGFSTTGMMLAPLSAPVAAST
FT                   VNAQTVLLFELPEGAGAPRRMRDVAAALGAGQPATAEYLTQPPALNRTVQVGGADVAVT
FT                   TAIGLQPGVAVPVPGVGIVPTPPLKEKRNYAVVITDGVKDLAGNPLKRSTLGNILFTFT
FT                   NPPAVDGVSQLSGVSNADATALASLRAGLEPLLANLGALTGGAVTRDNVVMAYTVQTQT
FT                   VTDVSVGLSALPYQTPTAFVGQGVAPLDLAALGFDAAAQAALFPNVGGFLTAMVPTVDA
FT                   INPANGALNPDTTQWAPKPIPAVVAYPADAACTAATPCVRPLVVFHHGLSGGRLQMITV
FT                   ANSLAAKGFIVAAIDAPYHGDRAFCMENSECTTDGTADGVCTPDQAKAGQGDAIPPGTC
FT                   TTGHLRGTNLSTVASGNYFISGNFFRIRDAIRQDHIDQAALVLAVARPPAPFPQPAQDP
FT                   LAAALFQRGFVVNPTAVHYEGISLGGIIGTELLATNPRFARGVLNVPGGTLVDVFTNAP
FT                   AFATSVNALFLSLGIDRSQIPTNPAVASRYLQTLILAKWILDPAEPLNYAAHVRTKLAS
FT                   PLLAAPPAGMGGTGLVHATTDVLGQLAKCDAVVPNATTVVGGIPLPYGDELLALAGAPS
FT                   TLYVSASAANNCVPHGVLNDTLLPNPIGGQVRDDAAQFLLDLTVPASPATLP"
FT   sig_peptide     complement(45941..46006)
FT                   /locus_tag="AnaeK_0036"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.917) with cleavage site probability 0.455 at
FT                   residue 22"
FT   gene            46285..47916
FT                   /locus_tag="AnaeK_0037"
FT   CDS_pept        46285..47916
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0037"
FT                   /product="Na+/solute symporter"
FT                   /note="PFAM: Na+/solute symporter; KEGG: ade:Adeh_0034
FT                   Na+/solute symporter"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71280"
FT                   /db_xref="GOA:B4UKI9"
FT                   /db_xref="InterPro:IPR001734"
FT                   /db_xref="InterPro:IPR038377"
FT                   /db_xref="UniProtKB/TrEMBL:B4UKI9"
FT                   /protein_id="ACG71280.1"
FT                   /translation="MNLELLTLAVGAYAAVLAFLGWLGYRRTRSAADYLVGGREIHPVL
FT                   MALAYGSTFISTSAIVGFAGVAALMGMGLLWLTMLNILLGVFVAFVVFGRPTRRLGAAL
FT                   DAHTFPELLGRRYRSRFIQGFAGGTIALLMPLYAAAVLIGGARFLEVQLQLDYQVALFV
FT                   FAAITVGYVLFGGLKGVVYTDAFQAVLMVCGMLVLLVATYAQVGGLSAHQALTDLAGQV
FT                   PPALRAQGHRGWTAMPAAGSPLWWQMVSTIVLGVGIGVLAQPQLTVRFMTVKSGRELHR
FT                   ALVPGGLFLLLMAGVAYVVGSLTNLWYFQRTGKIALAIMTDPATGKPNVDRLMPLYTQA
FT                   AMPEWFAYLFMLALLAAAMSTLSAQFHAIGTAIGRDLYEQAFRLGGGAERTVLLARAGI
FT                   LAGFAGTVLLAWNLGPGVIAIATALFFGMCAATFLPAFVSALFWARSTRGGVIAGMLAG
FT                   FAAWALWVLFVHERESAALGVVKTLTGRTSLGAGTTWALVDPIVVALPIAALVTVVGSL
FT                   LGRAAPAADAAGQARTREGGLDAGLR"
FT   sig_peptide     46285..46380
FT                   /locus_tag="AnaeK_0037"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.743) with cleavage site probability 0.280 at
FT                   residue 32"
FT   gene            47900..48061
FT                   /locus_tag="AnaeK_0038"
FT   CDS_pept        47900..48061
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0038"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71281"
FT                   /db_xref="UniProtKB/TrEMBL:B4UKJ0"
FT                   /protein_id="ACG71281.1"
FT                   /translation="MLGFGDLGVTAAFVLTLASAALCVAYGLLHWNDDDAPLPPPVHPP
FT                   GEAEVDDL"
FT   sig_peptide     47900..47977
FT                   /locus_tag="AnaeK_0038"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.888) with cleavage site probability 0.851 at
FT                   residue 26"
FT   gene            48112..49386
FT                   /locus_tag="AnaeK_0039"
FT   CDS_pept        48112..49386
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0039"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ade:Adeh_0035 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71282"
FT                   /db_xref="UniProtKB/TrEMBL:B4UKJ1"
FT                   /protein_id="ACG71282.1"
FT                   /translation="MRRIRLALAVLAALAALPPALAQTPPAPAPPPASQAPAPAPAPAA
FT                   KPPGVTVDLSGWLIANAYWSDGGLNASDLPQWATTAHSTAGMTVRQSRVRAALGLPVDG
FT                   LLGGAVLKGLVEADFMGTYVNSDASMPQARLRHAYLTAACANGNLTLLVGQTWSMFGGP
FT                   WFAASLGHVALPRFAGAGYLFRRAPQVRLTAEAGRGRDLGVTVAVAALASSGDKATSQN
FT                   QLVGERAGVPDAEGRVALVLRRGGKAWLEVGASGRFGQQLWKLDGLSTPREERLTGWGA
FT                   AADGRLEVPHLVVQGGTFMGEVLGGYGSVAPVVRQTKNATDTNKLDAISPVRTGGFWAQ
FT                   AVVTPIPVLQLLGGYGIEEPRTSDLPAGSEATTIERNQQVSGGAILALTSRWKVSLEGT
FT                   LYTTETLDGARRESTQVEVGSLYAF"
FT   sig_peptide     48112..48180
FT                   /locus_tag="AnaeK_0039"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 23"
FT   gene            complement(49569..50894)
FT                   /locus_tag="AnaeK_0040"
FT   CDS_pept        complement(49569..50894)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0040"
FT                   /product="Phenylacetate--CoA ligase"
FT                   /EC_number="6.2.1.30"
FT                   /note="KEGG: ade:Adeh_0036 phenylacetate-CoA ligase"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71283"
FT                   /db_xref="GOA:B4UKJ2"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR011880"
FT                   /db_xref="InterPro:IPR028154"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:B4UKJ2"
FT                   /protein_id="ACG71283.1"
FT                   /translation="MARFALENRILDPEETLDRDALAALQGRRLAETVRRARAVPHHRK
FT                   ALERAGVRDEDLRGPADVRRLPFTVKDDLRQSYPLGLLAVPREQVVRIHGSSGTTGRPT
FT                   FVAYTRRDLDTWTGLVARFLVAGGLRPEHTVHVAFGYGLFTGGFGLHYGIERVGAAVVP
FT                   SGGGNTPRQVRLICDLSADVLISTPSYALHVGEVARAEGLKPGDLPLRYGHFGGEPWTE
FT                   EMRGEIERSLGILAFNNYGLSEVIGPGVAGECPARDGMHVQEDHFIVECLDPVTLEPVP
FT                   DGEVGELVFTSLTKEAMPVLRYRTRDLAALDRSPCPCGRTGVRMSRVRGRSDDMLIIRG
FT                   VNVFPSQVEEALLRVEGTAPHYLIEVSRPGALDEAVVKVEVRPEDFRDEMREMVGLRDR
FT                   IDREIHAVTGIRMVVELVAPNTLERSAGKARRVLDHRKAGPA"
FT   gene            complement(50898..51341)
FT                   /locus_tag="AnaeK_0041"
FT   CDS_pept        complement(50898..51341)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0041"
FT                   /product="amino acid-binding ACT domain protein"
FT                   /note="PFAM: amino acid-binding ACT domain protein; KEGG:
FT                   ade:Adeh_0037 ACT domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71284"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="UniProtKB/TrEMBL:B4UKJ3"
FT                   /protein_id="ACG71284.1"
FT                   /translation="MKIRQLSLFLENRPGQLRVPCQVLGDAGIDILTLSLADTQQFGIL
FT                   RLIVKDPERAKQVLEKAGVVVNVTDVLAVDVPDRPGGLAEVLEGFEACGLGIEYMYAYS
FT                   VRSRGEHATLVFRLSDPDRAAALLQARGVRLVGAAELFARAGA"
FT   gene            complement(51361..52686)
FT                   /locus_tag="AnaeK_0042"
FT   CDS_pept        complement(51361..52686)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0042"
FT                   /product="Phenylacetate--CoA ligase"
FT                   /EC_number="6.2.1.30"
FT                   /note="KEGG: ade:Adeh_0038 phenylacetate-CoA ligase"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71285"
FT                   /db_xref="GOA:B4UKJ4"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR011880"
FT                   /db_xref="InterPro:IPR028154"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:B4UKJ4"
FT                   /protein_id="ACG71285.1"
FT                   /translation="MTTSWNDAGSAFHPASAPDFLPRRELEQLQLARLRAVVARAYEKV
FT                   PLLRQRMEARGVFPDALRALEDLARLPFTVKADLRDTYPFGLFASPVEEIVRLHASSGT
FT                   TGKPIVVAYTAADLEVWTSVMVRAFAACGLHQGDLIQNAYGYGLFTGGLGAHYGGEALG
FT                   ATVIPISGGNTERQLMVLQDFGVTAICCTPSYMVHLIERARDAKIGFGRLKVGVFGAEP
FT                   WSESMRAHIEREAGIRAHDIYGLSEIIGPGVGIECVHRDGLHLFEDHFYPEIVDPETGA
FT                   VLPDGAEGELVLTTLSKQAMPMIRYRTRDITAIDPSPCRCGRTLRRIRRIGRRSDDMFI
FT                   IRGVNVFPSQVETALLQVEGTLPHYQIVLTRAKGLDEMEVQIEVTPEVFSDEIRGLQRL
FT                   QEHLGAALEQVLGLRAQVTLVAPRTLQRSEGKAKRVIDRRNI"
FT   gene            complement(52700..53188)
FT                   /locus_tag="AnaeK_0043"
FT   CDS_pept        complement(52700..53188)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0043"
FT                   /product="pyruvate ferredoxin/flavodoxin oxidoreductase"
FT                   /note="PFAM: pyruvate ferredoxin/flavodoxin oxidoreductase;
FT                   KEGG: ade:Adeh_0039 pyruvate ferredoxin/flavodoxin
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71286"
FT                   /db_xref="GOA:B4UKJ5"
FT                   /db_xref="InterPro:IPR002869"
FT                   /db_xref="InterPro:IPR019752"
FT                   /db_xref="UniProtKB/TrEMBL:B4UKJ5"
FT                   /protein_id="ACG71286.1"
FT                   /translation="MPSRTVNVVVAGLGGQGVIKASEILADAAFRAGLDVKKAEVHGMS
FT                   QRGGSVTTDVRFGAEVLSPMVPAGEADFLLVLAPSELEVTRPLLRPGGLLIPPDAVDEA
FT                   RLPNRRSLNVALLGLLSHHLELDEAHWLAAIHAALPERLHAVNDAAFRLGRETAAAAR"
FT   gene            complement(53181..54821)
FT                   /locus_tag="AnaeK_0044"
FT   CDS_pept        complement(53181..54821)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0044"
FT                   /product="thiamine pyrophosphate protein domain protein
FT                   TPP-binding"
FT                   /note="PFAM: thiamine pyrophosphate protein domain protein
FT                   TPP-binding; KEGG: ade:Adeh_0040 indolepyruvate ferredoxin
FT                   oxidoreductase, alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71287"
FT                   /db_xref="GOA:B4UKJ6"
FT                   /db_xref="InterPro:IPR002880"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR017721"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:B4UKJ6"
FT                   /protein_id="ACG71287.1"
FT                   /translation="MERRLLSGDEAVAAAARDAGVRLGTGYPGTPSTEILQALDALGGR
FT                   AQWAPNEKVALEVGLGAAFGGARALVTMKHVGLNVAADPLFTAAYTGVKGGLVVVSADD
FT                   PGMASSQNEQDNRHYAAAAGLPMLEPADSQEAYDLTVAALELSERFSIPVILRMTTRVC
FT                   HSKTLAARRADLPAPPAPAFVRDIPGRVMIPAYARPAHRRLRKKLEALQAFAEETPLNV
FT                   WVKGDRALGVITSGVTARHVAEAAPTASRLELKTVYPLPLEKIRAFAASVDRCIVVEEG
FT                   DPIFADAIRAAGIAVEAKEAPYRFGELDVQRVRRILARDTSPEPELPKGRPPALCEACP
FT                   YHPVYATLRKLDCIVAGDIGCYTLGVLPPYQGIDTCVAMGASLGVGLGLRHVLPEADAR
FT                   RVVSIIGDSTFVHTGLNGLVEMVYNPPPTGHVLVVLDNGTTAMTGQQEHPGTGRTLDHE
FT                   PTGKVSIEGLARALGVANVDVVDPVADPAGWEKLLKDRLAEPRLSVIIARRPCILAAAD
FT                   IRRYEKAADEKRAALACAGCAGAGEASDA"
FT   gene            54948..55871
FT                   /locus_tag="AnaeK_0045"
FT   CDS_pept        54948..55871
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0045"
FT                   /product="phosphate butyryltransferase"
FT                   /EC_number="2.3.1.19"
FT                   /note="PFAM: phosphate acetyl/butaryl transferase; KEGG:
FT                   ade:Adeh_0041 phosphate butyryltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71288"
FT                   /db_xref="GOA:B4UKJ7"
FT                   /db_xref="InterPro:IPR002505"
FT                   /db_xref="InterPro:IPR012147"
FT                   /db_xref="UniProtKB/TrEMBL:B4UKJ7"
FT                   /protein_id="ACG71288.1"
FT                   /translation="MIPIPTLARLTAEARTAGPLRLVVAAAASDSALGAAALARRQRIA
FT                   DAVLVGGRSEIAARLRALGEDPALFELHEAANDEDAARRAVAMVRGGEAAVLMKGRLQT
FT                   AALLAAILDREAGLRDGRLLSDVLVADHPLSAAPRLLGVTDGGVNVAPDLGQKRAIVEN
FT                   AAALFRALGHDRPRVACLCAVETVTEAMPHTRDAAALAALNARGELTGCVVGGPFALDN
FT                   ALSADAAREKGIDHPVAGRADLLLAPTIEVGNALGKAFTYLAHRSVAHVIVGARAPVLI
FT                   PSRVERPEDKLCSIALGVLAAARGTR"
FT   gene            55868..56998
FT                   /locus_tag="AnaeK_0046"
FT   CDS_pept        55868..56998
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0046"
FT                   /product="butyrate kinase"
FT                   /note="TIGRFAM: butyrate kinase; PFAM: acetate and butyrate
FT                   kinase; KEGG: ade:Adeh_0042 butyrate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71289"
FT                   /db_xref="GOA:B4UKJ8"
FT                   /db_xref="InterPro:IPR000890"
FT                   /db_xref="InterPro:IPR011245"
FT                   /db_xref="InterPro:IPR023865"
FT                   /db_xref="UniProtKB/TrEMBL:B4UKJ8"
FT                   /protein_id="ACG71289.1"
FT                   /translation="MSAGAGHRPTGDGAGGGPLVLAVNPGAGSTKLGLFRGGLPVREEK
FT                   VLHPEAMARPAARIWDELPGRVAAAEDFLSRAGVRAGVLAAVAGRGGLLPPLAAGAYLV
FT                   DDALVAELERAAHGEHASNLGAPMARALAAPHGCPALVVDPVSVDELAPVARVTGLAGV
FT                   ERTSFVHALNLRAVARRHAAAAGRPLEALRLVLAHLGTGISLCALSGGRMVDVVNPRDE
FT                   GPFSGDRAGGVPANALVELCFAPGADARSVKRRLFGDGGLYAHLGTRDVREALARAERG
FT                   DARAALLVDAMCYQAAKAVAAMAVALDGRVDAIVLTGGLAHLAPVVEGVRRRVAWIAPV
FT                   EVHPGEDELRALAEGALRVLSGEEPARRYAPLDPAR"
FT   gene            complement(57042..58490)
FT                   /locus_tag="AnaeK_0047"
FT   CDS_pept        complement(57042..58490)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0047"
FT                   /product="transcriptional regulator, GntR family with
FT                   aminotransferase domain"
FT                   /note="PFAM: regulatory protein GntR HTH; aminotransferase
FT                   class I and II; KEGG: ade:Adeh_0043 transcriptional
FT                   regulator, GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71290"
FT                   /db_xref="GOA:B4UKJ9"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B4UKJ9"
FT                   /protein_id="ACG71290.1"
FT                   /translation="MRTWQTPLAIDRADPAPLSVQIARALGARIRAGALRPGAPLPSSR
FT                   ALARTLGVHRNTVLAAYGELAAEGWIASDPARATLVSRDLPPLPPGAAGAPGPAARAGF
FT                   DLPAAPADATWETLPPGTLELLGGTPDPRLVPVAALGSAYRRALRRREHLSYGDAAGHP
FT                   RLRAALARMLGEARGLAVAADGILVTRGAQMALSLAGRALLGPGDGVAVEALGYRPAWE
FT                   SLRLAGLRTVPVPVDARGLQVERLEALAAAGAVRAVYLTPHHQYPTTVTLAPARRLALL
FT                   ELARRARLLVLEDDYDAEFHYDGRPVPPLASADGAGVVVYVGTLSKVLAPGLRIGWLAG
FT                   PPDAIERVTAHRRFLDRQGDLAVEAAVAELFEEGEAQRHAWRTRRVYAGRREALAAALR
FT                   ARLPGALSFRTPAGGMALWCRVAPGLDPEAWAARALRAGVAVQPGRLFAHDRRARPFLR
FT                   LGFGRLDERELAEAVRRLAAALPR"
FT   gene            58555..59634
FT                   /locus_tag="AnaeK_0048"
FT   CDS_pept        58555..59634
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0048"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; pyridoxamine
FT                   5'-phosphate oxidase-related FMN-binding; KEGG:
FT                   ade:Adeh_0044 GCN5-related N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71291"
FT                   /db_xref="GOA:B4UKK0"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR024747"
FT                   /db_xref="InterPro:IPR039143"
FT                   /db_xref="UniProtKB/TrEMBL:B4UKK0"
FT                   /protein_id="ACG71291.1"
FT                   /translation="MRREIFRAGREEALALLRRAPTVHLATTTPEGAPVLRALDAAVLE
FT                   DGVWFHGARSGEKARCLGRAAVVSAEELVAHLPSWMADPVRACPATTLYRSVQAHGTLE
FT                   ELTDPARKAEVLSALMARWQPEGRYRPIRADDPLYAGELRGLLVLGVRLGEALDGKWKL
FT                   LQNRTPEQIGAALEGLWARGAPGDVAAIEAVRAANPHAPEPAFLAAGIPGVRLQVALGE
FT                   ADAPAIRALLAGEYWWEGEPLALAGPSHLASTAWVGARDADGALVASARAMADPRHAWI
FT                   YDVVVAPAWRRRGLGKRLVALLLDHPAVRRTRFVRLVTADAQGLYARFGFVDAAGKRRF
FT                   GTSTEMVLVRDPPAGAEAS"
FT   gene            complement(59641..60231)
FT                   /locus_tag="AnaeK_0049"
FT   CDS_pept        complement(59641..60231)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0049"
FT                   /product="SNARE associated Golgi protein"
FT                   /note="PFAM: SNARE associated Golgi protein; KEGG:
FT                   ade:Adeh_0045 DedA"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71292"
FT                   /db_xref="GOA:B4UKK1"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="InterPro:IPR032818"
FT                   /db_xref="UniProtKB/TrEMBL:B4UKK1"
FT                   /protein_id="ACG71292.1"
FT                   /translation="MLQALLSRFGYLAVLALLAGAGLGVPIPEEATQLGAGALAHQGYL
FT                   RLPLVIAVCWLGIVLGDLAFFLLARRHGERVLRSRPVARVLTPARRDRLEAHLARHAFL
FT                   SVAVARHTSGLRLAAFALAATHGVRLRTFALADGLSALLSVPLVVSVGYLFAHHLGTAE
FT                   RGVRRVELAVLGAVLLAAAVAVWLRRRRARAAA"
FT   sig_peptide     complement(60157..60231)
FT                   /locus_tag="AnaeK_0049"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.846) with cleavage site probability 0.673 at
FT                   residue 25"
FT   gene            complement(60268..62265)
FT                   /locus_tag="AnaeK_0050"
FT   CDS_pept        complement(60268..62265)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0050"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ade:Adeh_0046 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71293"
FT                   /db_xref="InterPro:IPR025178"
FT                   /db_xref="UniProtKB/TrEMBL:B4UKK2"
FT                   /protein_id="ACG71293.1"
FT                   /translation="MLGPLALALALASPPAAPASPSADPGTAPAAAIAPAAAPAAGATA
FT                   APDPAYLAELVAKARALRLAEDPGWLKLGHWRRRPLGGWKSEADGGKFFRARDGKTDPA
FT                   AELEATLAGFFDATPKAEELDDAQCRFPARFAFLGGRLGFDLARLPPRRCPKFEDFYGK
FT                   IRPQGVTVVFSSYYLNNPASAFGHTLLRLDKAPEAIGGKHFELLDYGVDYAATVDTGNA
FT                   LLYAAKGLLGFFKGEFKYYPYYYKVREYGDYESRDLWEYDLELTPGEVALLGAHVWELG
FT                   GTWFDYWYLDENCSYHVLGALEAAAPRLDLLSHVGRAVVLPSDTVVALFENPGLVRRVH
FT                   YRPSIRTQFEARARGLSGAELREVEALSGDPAAPLAPGTPPDGQAKVLDAAVDLLDLRH
FT                   ARELIRGFEPKAAQDRQALLERRAALGVPSAPLALPLPEARRPERGHGSLRLGVGGGAV
FT                   DGQGGTVLLDARLALHDLGDPPEGYPPTAQIEFLPTRLRWTPRERRVDLDDVALVRIVS
FT                   LSPVTRFDARPSWKASFGATTVRDRGCDRCLAFASDLGGGLAAALPGGLDLAATGDLEL
FT                   RASPGLSGAGGTGWRPGIGPSALARLRLGTRAVLLADARWRWLPEAAPRTTWSWGGALR
FT                   LHLARDLSLALEGRRQPLATEAAALVLGYF"
FT   sig_peptide     complement(62194..62265)
FT                   /locus_tag="AnaeK_0050"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.997 at
FT                   residue 24"
FT   gene            complement(62340..62837)
FT                   /locus_tag="AnaeK_0051"
FT   CDS_pept        complement(62340..62837)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0051"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ade:Adeh_0047 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71294"
FT                   /db_xref="InterPro:IPR021383"
FT                   /db_xref="UniProtKB/TrEMBL:B4UKK3"
FT                   /protein_id="ACG71294.1"
FT                   /translation="MTRITLALVAALLAVPAAAADQTASAIKGTGRYGTAGCGLGSMAF
FT                   GSTPGAVQILAATTNGTFGNQTFGITTGTSNCGSGVFTAGTKNFVDANREALAKDISRG
FT                   EGEAIGALTVINACENSHAVGAALQKNFKAIFPSESASNEDVTKAILDTLHGDAALGCG
FT                   RS"
FT   sig_peptide     complement(62778..62837)
FT                   /locus_tag="AnaeK_0051"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.939 at
FT                   residue 20"
FT   gene            63058..63861
FT                   /locus_tag="AnaeK_0052"
FT   CDS_pept        63058..63861
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0052"
FT                   /product="Electron transfer flavoprotein
FT                   alpha/beta-subunit"
FT                   /note="PFAM: Electron transfer flavoprotein
FT                   alpha/beta-subunit; KEGG: ade:Adeh_0048 electron transfer
FT                   flavoprotein beta-subunit"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71295"
FT                   /db_xref="GOA:B4UKK4"
FT                   /db_xref="InterPro:IPR000049"
FT                   /db_xref="InterPro:IPR012255"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014730"
FT                   /db_xref="InterPro:IPR033948"
FT                   /db_xref="UniProtKB/TrEMBL:B4UKK4"
FT                   /protein_id="ACG71295.1"
FT                   /translation="MALKIVVTAKRVEDPESKIRVKPDGSGIVTDGVNYKINPFDEIAV
FT                   EEALRLKERHGGEVVVASIGGERSQTEIRAALAMGADRGILVRHEGPLDPVVVSALLAK
FT                   LVEQEKPDLVILGKQSIDDDQNQAGQYLAERLGWPQGTFASKTESLESEAEQKKEPGLV
FT                   LSADGKALTVVREVDGGVETLELGLPAVVTTDLRLNKPRFASLPGIMKAKKKPLQELAA
FT                   ASLGVDLAPKVVVKRLAEPPARKGGVKVADVEELWKKLHDEAKVL"
FT   gene            63907..64869
FT                   /locus_tag="AnaeK_0053"
FT   CDS_pept        63907..64869
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0053"
FT                   /product="Electron transfer flavoprotein alpha subunit"
FT                   /note="PFAM: Electron transfer flavoprotein
FT                   alpha/beta-subunit ; Electron transfer flavoprotein alpha
FT                   subunit; KEGG: ade:Adeh_0049 electron transfer flavoprotein
FT                   alpha and beta subunits"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71296"
FT                   /db_xref="GOA:B4UKK5"
FT                   /db_xref="InterPro:IPR001308"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014730"
FT                   /db_xref="InterPro:IPR014731"
FT                   /db_xref="InterPro:IPR018206"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR033947"
FT                   /db_xref="UniProtKB/TrEMBL:B4UKK5"
FT                   /protein_id="ACG71296.1"
FT                   /translation="MSNVLIVAEQGGGQLRKATLHAISAGRALAARTGGALHLALLGKG
FT                   VRPLADALAATGAEVHVADAPALEHPLADAWAPVIADIAKACGAAYVGAAATAQGKDLL
FT                   PRVAARLGAGMATEVLGFGGDGAAVTFRRPMWAGNVLAEVEIATPVKVFTVRATEFPAA
FT                   EQGAGKGAVHEVAAQVPAGLRTRHVAFREVKSERPELTEARVVVSGGRGTKGDFKPVEA
FT                   LADALGAAVGASRAAVDAGWVPNDWQVGQTGKVVAPDLYVAAGISGAIQHLAGMKGSKV
FT                   IVAVNKDPDAPVFQIADYGLVADLFQALPALTEKVKASK"
FT   gene            64898..65902
FT                   /locus_tag="AnaeK_0054"
FT   CDS_pept        64898..65902
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0054"
FT                   /product="beta-lactamase domain protein"
FT                   /note="PFAM: beta-lactamase domain protein; KEGG:
FT                   ade:Adeh_0050 beta-lactamase-like"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71297"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:B4UKK6"
FT                   /protein_id="ACG71297.1"
FT                   /translation="MTEADLEGLGVHRIAIPVPFPQAGGPVNAYLVEEAGGGLLMFDSG
FT                   LGTPEAQAALEAGFQRLGRRFDEVDRIVVSHGHVDHYGAARFVQERHGGPDVPVFGHPA
FT                   DAPKMSEQGPRWRELAPRLAAYLARQGVPPEVVELLAKQGEGGFRYARRLPEIRPIAEG
FT                   EVLRTRHLALEVMHMPGHTPGLLCLYEREKRLFLSDDHLLEKVSPNPLIELGPDGQDGF
FT                   FRPLLAYLDSIRRLRALEVDLVLPGHGPPFGGHREIIDALLGFYAKRQARLLELLQGGP
FT                   QTAHELARALWPRARPTDAFLTLSETVANLEVMESRGEVRRDRAAEPWRYLAA"
FT   gene            65957..66718
FT                   /locus_tag="AnaeK_0055"
FT   CDS_pept        65957..66718
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0055"
FT                   /product="Integral membrane protein TerC"
FT                   /note="PFAM: Integral membrane protein TerC; KEGG:
FT                   ade:Adeh_0051 integral membrane protein TerC"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71298"
FT                   /db_xref="GOA:B4UKK7"
FT                   /db_xref="InterPro:IPR005496"
FT                   /db_xref="UniProtKB/TrEMBL:B4UKK7"
FT                   /protein_id="ACG71298.1"
FT                   /translation="MLELLGQADTWISLVTLSAMEIVLGIDNVVFLTILAGRLPQEQQG
FT                   RARKLGLSFALLTRLGLLFAISWVMGLTRPLFSVLGREVSGRDLILLGGGLFLIAKATH
FT                   EIHDKLEVEHAEERKAGGGAAFWAVIVQIALLDIVFSLDSVITAVGMAKHLPVMVAAMV
FT                   LAVGVMLVFADAIGGFVERHPTIKMLALSFLILIGVMLVAEGLGKHIEKGYVYFAMAFS
FT                   LGVELLNMRVRKARQAPVHLHGRFEEERAGR"
FT   gene            66737..67651
FT                   /locus_tag="AnaeK_0056"
FT   CDS_pept        66737..67651
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0056"
FT                   /product="protein of unknown function DUF6 transmembrane"
FT                   /note="PFAM: protein of unknown function DUF6
FT                   transmembrane; KEGG: ade:Adeh_0052 protein of unknown
FT                   function DUF6, transmembrane"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71299"
FT                   /db_xref="GOA:B4UKK8"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:B4UKK8"
FT                   /protein_id="ACG71299.1"
FT                   /translation="MADLALLVLTLLWGTTFALVKEALEIASPGVFLTARFGLAAVALL
FT                   AAWALRPRAPLGEGFWRHGILLGLTMLVGFVLQTVALRHTTPSRSGFITGLNVLVVPIV
FT                   ARWFLGRRVRLAFWVGVTFALAGLVLLTRPFTPGAVTEEVRFGDLLTLFCAVAYGLQVT
FT                   FTSEWAPRHPLAPFVAVQVLVTLAGALVLAPLEGPRFDLAGAGHFLAVVAFTGLVMTAL
FT                   AFFVMNWGQRHTTAVRAALIFSLEPAAAAVFSWLYYGEPLGPLDWAGGGLMVLGVVAGE
FT                   VGGVLEARAAEARARARAGAPAA"
FT   sig_peptide     66737..66799
FT                   /locus_tag="AnaeK_0056"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.929) with cleavage site probability 0.762 at
FT                   residue 21"
FT   gene            67713..68900
FT                   /locus_tag="AnaeK_0057"
FT   CDS_pept        67713..68900
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0057"
FT                   /product="MltA domain protein"
FT                   /note="PFAM: MltA domain protein; 3D domain protein; KEGG:
FT                   ade:Adeh_0053 membrane-bound lytic murein transglycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71300"
FT                   /db_xref="GOA:B4UKK9"
FT                   /db_xref="InterPro:IPR005300"
FT                   /db_xref="InterPro:IPR010611"
FT                   /db_xref="InterPro:IPR026044"
FT                   /db_xref="InterPro:IPR034654"
FT                   /db_xref="InterPro:IPR036908"
FT                   /db_xref="UniProtKB/TrEMBL:B4UKK9"
FT                   /protein_id="ACG71300.1"
FT                   /translation="MRRTHLPHALLAALALSVAACRHAPPPAPARTADEALREVPPSDF
FT                   PAFADDLDYAGLEDAIGRSETWLARLAASDPGRTFAYGRERVPLARVQATLARFRAIVA
FT                   ARPAPAALRETLRREFRAFRSAGDGRGTVLFTGYYLPELRGALARGGPYQVPLHRAPDD
FT                   LVVVRARDFPQVAEDVVGRVEQGRLVPYPTRADIARGALAGKGAELCYVDSALDAFFLE
FT                   IQGSGVVRLEDGSARVVTFAGKNGQRYAAVGAELIRRGALRREEVSMQSIRAWLLAHPE
FT                   EQAGVLATNPSYVFFRFADDAIGALGVPVTPDRTVAADAKVFPKGGLAFLETERPVDAT
FT                   SAVMRPFSRFVLDQDAGGAIRTSGRVDLYLGSGPYAANAAGRMKQPGRLWYLLLR"
FT   sig_peptide     67713..67811
FT                   /locus_tag="AnaeK_0057"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.986) with cleavage site probability 0.777 at
FT                   residue 33"
FT   gene            complement(69005..70303)
FT                   /locus_tag="AnaeK_0058"
FT   CDS_pept        complement(69005..70303)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0058"
FT                   /product="uracil-xanthine permease"
FT                   /note="TIGRFAM: uracil-xanthine permease; PFAM:
FT                   Xanthine/uracil/vitamin C permease; KEGG: ade:Adeh_0054
FT                   uracil-xanthine permease"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71301"
FT                   /db_xref="GOA:B4UKL0"
FT                   /db_xref="InterPro:IPR006042"
FT                   /db_xref="InterPro:IPR006043"
FT                   /db_xref="InterPro:IPR029935"
FT                   /db_xref="UniProtKB/TrEMBL:B4UKL0"
FT                   /protein_id="ACG71301.1"
FT                   /translation="MKRTVDVGERLPLLQSIPLSLQHLFAMFGATVLVPFLVGLDTSVT
FT                   LFTSGVGTLVYIFITKGKIPAYLGSSFAFIAALSAIIGVAPGQAAPADRVAVAMGGCVA
FT                   VGVCYLVVAALIAKFGTGWIDRLLPPVVIGSVVMVIGLGLARVAVVNMAMNGGGPTYRP
FT                   EFFAVALASLAIAILAAVFLKGFLGVIPVLIGIVGGYVVALLAGQVDLSGVAAARPLAV
FT                   PPFVLPRFTWAAIITLAPISLVVITEHIGHLIVTNNVVGRDFVKDPGLHRSLAGDGVAT
FT                   MISGALGGPPNTTYGENIGVMAITRVFSVWVIGGAAVLAVLMSFLPPVGALIRSIPTQV
FT                   MGGICILLFGIIASAGIRMLVEAGIDFSQKRNLIIASVVLVIGVGGAEMHFGSVKIDAM
FT                   PLATYVGILLNLVLPRGMEGTAANGAVAEAPDV"
FT   gene            70555..70698
FT                   /locus_tag="AnaeK_0059"
FT   CDS_pept        70555..70698
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0059"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71302"
FT                   /db_xref="UniProtKB/TrEMBL:B4UKL1"
FT                   /protein_id="ACG71302.1"
FT                   /translation="MAEEKKKGGFHSLEKRIHQIEEEDRSQAAQESKPEEKKAPAKEPP
FT                   KK"
FT   gene            70762..71754
FT                   /locus_tag="AnaeK_0060"
FT   CDS_pept        70762..71754
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0060"
FT                   /product="putative mRNA 3'-end processing factor"
FT                   /note="KEGG: ade:Adeh_0055 putative mRNA 3'-end processing
FT                   factor"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71303"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR011108"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:B4UKL2"
FT                   /protein_id="ACG71303.1"
FT                   /translation="MRRPPIELHRGELKVTGSSLHLDATRRVECAFVSHAHGDHIGRHD
FT                   RTIATAPTLALMRHRLGEGKRRKTEHLPASYRSPFGLGELTLELFPAGHVLGSAQVRVT
FT                   RNGVSLGYSGDLCTEPTHAAERAEVMGCDVLVIESTFGHPRYVFPPKDQTLAAVRRFVD
FT                   DALADGVTPVLLGYALGKAQEILKYLSDLGYACRAHPVVHAVNKVYEAHGVALPNVRPL
FT                   GPEGAGMDEVVVCPPHLARSPAMRGLRKRRTAILTGWAIDGGRFFRGVDAAFPLSDHAD
FT                   FPSLVRYARATGAGRVFTVHGHEDALAAALRKEGIRAEPLREHMQLELI"
FT   gene            71789..72808
FT                   /locus_tag="AnaeK_0061"
FT   CDS_pept        71789..72808
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0061"
FT                   /product="pseudouridine synthase, RluA family"
FT                   /EC_number="3.2.1.17"
FT                   /note="TIGRFAM: pseudouridine synthase, RluA family; PFAM:
FT                   RNA-binding S4 domain protein; pseudouridine synthase;
FT                   KEGG: ade:Adeh_0056 ribosomal large subunit pseudouridine
FT                   synthase C"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71304"
FT                   /db_xref="GOA:B4UKL3"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR006224"
FT                   /db_xref="InterPro:IPR006225"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:B4UKL3"
FT                   /protein_id="ACG71304.1"
FT                   /translation="MIQLTVTADAAGQRLDKLVRKALRDVPLSHVYKMFRTRKVRVNGQ
FT                   RGKADQLVAEGDVVVIRGDEERLLAKAAPAAPGGAPRVTFGVLHEDADLLAVDKPAGLA
FT                   AHPGTGIEGATLVEMARGYLRTPDDLPPTEFKPSPAHRLDRDTSGVVLVAKHRKAMVRL
FT                   TETFTSGEGVHKTYLALVKGKMPREAGTIDLPLSEHEQTSRSKALRGVNFQEALTRWKV
FT                   VSAAKEISLLAVTIETGRTHQIRRHLEAVGHPVAGDRRYGDFAFNRTARTRWGLRRMGL
FT                   HAWKLEVPHPLTGAPLRLEAPFPAELAEVLSRANLKLPGSPTGAHAPAARRDGPHRER"
FT   gene            72845..75403
FT                   /locus_tag="AnaeK_0062"
FT   CDS_pept        72845..75403
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0062"
FT                   /product="penicillin-binding protein, 1A family"
FT                   /EC_number="2.4.1.129"
FT                   /note="TIGRFAM: penicillin-binding protein, 1A family;
FT                   PFAM: glycosyl transferase family 51; penicillin-binding
FT                   protein transpeptidase; KEGG: ade:Adeh_0057
FT                   penicillin-binding protein 1A"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71305"
FT                   /db_xref="GOA:B4UKL4"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR031376"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/TrEMBL:B4UKL4"
FT                   /protein_id="ACG71305.1"
FT                   /translation="MREPGDPQQPPEEPSSRVVLDGLPPERPLRRRLLRWGLFAAIAAV
FT                   NAAIVVAVVGWLVFSRGLPDIPTLEQYRPPIITEMISADGQIAGEFFVERRKVVPYARI
FT                   PKRVIQAFIASEDKNFFEHGGIDLLGTLRAAVKTYVLRSRIQGASTLTQQTAKALLISA
FT                   EGFERGTERSLRRKIRELILARRLEARFTKEQILWIYLNGVYLGHHSYGVQSAAENYYR
FT                   KNVEDLTLEEAALIAGLPQAPSRYSPFSRPEAAAERRRYVLRRMAEEGMITEAERRSAE
FT                   KAEVKVFGVDDVFRETAPFYVETVRRQVVDRYGNDRLLHDGLRVEMAMDLEKQRAAQAA
FT                   VLKGLVEVDQRQGFTGPVAKVAGAERTALGTRLAKTWPKGTLRPGDFCVGIVDRVDDRA
FT                   GIVEVEVGETRGVLPISGMRWARKPNPVVSYADSLLSRPSSALHAGDVVVLKRVDRAEL
FT                   QKKEAQLGVGRPKDVPEAPVLFSLQQDPTLQGALVAVDPGTAYVTAMVGGYDFEASEFN
FT                   RAFQACRQPGSAFKPVVYSAAVEKLDYTPATILTDAPIVFRDDESSWKPQNYGEDFKGD
FT                   VTLRTALVNSMNIPAVKTAEALNAKLGPAGLGDWAKALGITTPVKQELGSALGSSCVTP
FT                   WELTNVYALFARYGEKRPSAFVKRVLDRDGRVLEDRVDYRDPWVGLDERLAGAVAEVTR
FT                   PREQVMDPRSAYILVRLMREVATVGTGARAAALGKPAAGKTGTTNDSFDTWFMGFTRDL
FT                   ATGVWLGYDVNVTPLGRYETGGHAALPIWLDFMSAALKGRAQPEFEAPSGIVEVRIDPA
FT                   TGKAVADGAGGVPEPFKQGTEPVLADAEKKQVEVQDLFMQ"
FT   gene            75606..77672
FT                   /locus_tag="AnaeK_0063"
FT   CDS_pept        75606..77672
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0063"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="PFAM: histidine kinase HAMP region domain protein;
FT                   chemotaxis sensory transducer; KEGG: ade:Adeh_0058
FT                   methyl-accepting chemotaxis sensory transducer"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71306"
FT                   /db_xref="GOA:B4UKL5"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="UniProtKB/TrEMBL:B4UKL5"
FT                   /protein_id="ACG71306.1"
FT                   /translation="MRPKLAHLGVKRILFLSIAGALAIAGVLTSIAVNREIHVALERAA
FT                   VHRGEADARVYASALAPALAAGDAARIAARVDEDWDEESFAYVVVVREDWSVAAKHLSR
FT                   NLGRSAEEVVAWHQAAGGAAQPQAPGVLAFTRPVEGAGGGARAGYVLLGLDRDPLDGQA
FT                   GRAGWYIFALLVGGGMVLAGLVYVFVSRLVLRPLDEMSAVARRVSDCDLTARSAQLGPD
FT                   ELGTLAESLNRIGENLAATLSRVQNVTGGVATVIDRISRTGSAVSSGAGTVSARVVDTS
FT                   SSMSQMISSLKGIADNVEVLAQSAEESSSSILEMAATNDEVAENIQALAASVEETTAAI
FT                   EQMTYSIKEVAKNIEDLSATTEETSSSMNEMDVSISQVESNANETARLSEQAQRDAESG
FT                   AEALSRTLLGIDKIKESSKEAASVIEALGAKIAAIGNILNVIDDVAEQTNLLALNAAIL
FT                   AAQSGEHGKGFAVVADEIKDLAERTGASTKEISELIRAVQDQSRNAIQAMDRGVRNVEE
FT                   GVRLGQETETALKKIQESSQKSTQMVKAIARATLEQARGSKQVTMAINRIAETVQQIAS
FT                   ATAEQARGSEQIMKSAERMKAITKHVERSAQEQARGSKQITRAIESISEMVHHLNRAQK
FT                   EQTKGSEQVMTAVVQIKQVAEAQTHSVRDLEAAIVDLASQAEVLRGEVRRFRI"
FT   sig_peptide     75606..75704
FT                   /locus_tag="AnaeK_0063"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.991) with cleavage site probability 0.761 at
FT                   residue 33"
FT   gene            complement(77844..78284)
FT                   /locus_tag="AnaeK_0064"
FT   CDS_pept        complement(77844..78284)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0064"
FT                   /product="protein of unknown function DUF55"
FT                   /note="PFAM: protein of unknown function DUF55; KEGG:
FT                   ade:Adeh_0059 protein of unknown function DUF589"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71307"
FT                   /db_xref="InterPro:IPR002740"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="UniProtKB/TrEMBL:B4UKL6"
FT                   /protein_id="ACG71307.1"
FT                   /translation="MAYWLLKTEPGTYAWSDLVADGTTPWTGVANPQAQTNLRAMKAGD
FT                   RAIVYHSGEKRAVGIAEVVRTAYPDPTAGGELVCVDVKAVEALPAPVPLEALKQEPAFE
FT                   GSVLLRQGRLSVVPLAPAEWRDLASLADVIARTGGLRRKARF"
FT   gene            78380..78799
FT                   /locus_tag="AnaeK_0065"
FT   CDS_pept        78380..78799
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0065"
FT                   /product="sec-independent translocation protein
FT                   mttA/Hcf106"
FT                   /note="PFAM: sec-independent translocation protein
FT                   mttA/Hcf106; KEGG: ade:Adeh_0060 sec-independent
FT                   translocation protein MttA/Hcf106"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71308"
FT                   /db_xref="GOA:B4UKL7"
FT                   /db_xref="InterPro:IPR003369"
FT                   /db_xref="InterPro:IPR006312"
FT                   /db_xref="UniProtKB/TrEMBL:B4UKL7"
FT                   /protein_id="ACG71308.1"
FT                   /translation="MFGLSFGEIVIIAVLALILLGPDRLPEAAKTIGKGLRQFKQATDD
FT                   LKDQIETEIYKDDRKVARPSLVPPVPNRPVPGPAGPPPAATAENVPGLEAALVDAEPAA
FT                   PAAEPAAPAAEPAPTPSPAPSGEGAPPPGTGGTAA"
FT   gene            78806..79612
FT                   /locus_tag="AnaeK_0066"
FT   CDS_pept        78806..79612
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0066"
FT                   /product="Sec-independent protein translocase, TatC
FT                   subunit"
FT                   /note="TIGRFAM: Sec-independent protein translocase, TatC
FT                   subunit; PFAM: Sec-independent periplasmic protein
FT                   translocase; KEGG: ade:Adeh_0061 sec-independent protein
FT                   translocase TatC"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71309"
FT                   /db_xref="GOA:B4UKL8"
FT                   /db_xref="InterPro:IPR002033"
FT                   /db_xref="UniProtKB/TrEMBL:B4UKL8"
FT                   /protein_id="ACG71309.1"
FT                   /translation="MSETVPQLPPPPPPSPEPEGEVKLSFLDHLRDLRVRMVRAMLGIA
FT                   IGMGLVGGFVPQIVDHLMKPVRDALPAGRQQLVYTSAIEPMMVYIKVAMYGGVFVAAPW
FT                   VLWQLWLFIAPGLYKREKKVVFPFLFWGTLLFYLGALFCFELVMPQAFPAMLAFAESDT
FT                   LSPMLSLSEQLSLVLAMLLGFGVVFEVPVVIAFLSMIGLVQWRTLAKYRRIAIIVNVIA
FT                   AAIITPTGDPLNLALMAVPMIVFYEVGIVLARILGKKPAADAAPAA"
FT   gene            79686..79883
FT                   /locus_tag="AnaeK_0067"
FT   CDS_pept        79686..79883
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0067"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71310"
FT                   /db_xref="GOA:B4UKL9"
FT                   /db_xref="UniProtKB/TrEMBL:B4UKL9"
FT                   /protein_id="ACG71310.1"
FT                   /translation="MLVFQSVAALFAVYMLARHAPRAYAALRGRAGDRVGALVPALNVA
FT                   LALAILVVAVKGLAGALISR"
FT   sig_peptide     79686..79763
FT                   /locus_tag="AnaeK_0067"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.865) with cleavage site probability 0.819 at
FT                   residue 26"
FT   gene            79900..81096
FT                   /locus_tag="AnaeK_0068"
FT   CDS_pept        79900..81096
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0068"
FT                   /product="acetyl-CoA acetyltransferase"
FT                   /EC_number="2.3.1.9"
FT                   /note="TIGRFAM: acetyl-CoA acetyltransferase; PFAM:
FT                   Thiolase; KEGG: ade:Adeh_0062 acetyl-CoA acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71311"
FT                   /db_xref="GOA:B4UKM0"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020610"
FT                   /db_xref="InterPro:IPR020613"
FT                   /db_xref="InterPro:IPR020615"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:B4UKM0"
FT                   /protein_id="ACG71311.1"
FT                   /translation="MNRAGQQDVVFLAAKRTPFGTFGGSLKDLSATDLAVHAAQAAIEQ
FT                   AGAPPADYGHVVVGNVAQTSPDAIYLARHVGLRAGLPEGVPAVTVNRLCGSGFEAVIEA
FT                   ARLIHGGEAELVLAGGTESMSQAPLVLRGTRFGHAFGKTPPLEDMLWSALTDTYAGMPM
FT                   ALTAEKLAERHGIGQDAVDELSVSSQRRWAAADEAGRFREELAPVELRTRKGTVRFEKD
FT                   EHPRPGTTLEGLRKLPKVFKADGVIHAGAASGIADGAGMLVVASRAYAERRGLRPLGRL
FT                   VNWGHAGVDPTVMGIGPVPAVRNALARAGATLSDLDLFEVNEAFAPQYLAVEQELGLPR
FT                   DRTNVDGGAIALGHPLAASGARITMHLLYELRRRKARAGLGSACIGGGQGVAVILEPL"
FT   gene            81168..81365
FT                   /locus_tag="AnaeK_0069"
FT   CDS_pept        81168..81365
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0069"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ade:Adeh_0063 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71312"
FT                   /db_xref="UniProtKB/TrEMBL:B4UKM1"
FT                   /protein_id="ACG71312.1"
FT                   /translation="MTSFTGVKVFSTTLARDRDAMGETITRWLAGNPELEVVSHEVRQS
FT                   SDKEFHCLTITLFYRERKKG"
FT   gene            81372..82112
FT                   /locus_tag="AnaeK_0070"
FT   CDS_pept        81372..82112
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0070"
FT                   /product="Rhomboid family protein"
FT                   /note="PFAM: Rhomboid family protein; KEGG: ade:Adeh_0064
FT                   rhomboid-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71313"
FT                   /db_xref="GOA:B4UKM2"
FT                   /db_xref="InterPro:IPR022764"
FT                   /db_xref="InterPro:IPR035952"
FT                   /db_xref="UniProtKB/TrEMBL:B4UKM2"
FT                   /protein_id="ACG71313.1"
FT                   /translation="MRSRRSPDLGSAFTFGGRIPSGLGLLLVLILVATVGSWVTRDDTW
FT                   AALVPGLVLRGQVWRLVSWAFVQNDPLTLLFGGFMLYSIGQQLAFTWSERRLVGTFLGL
FT                   AAGATAVTVAAALLWFPADRPHLGMWPVVNALLLMWAMMYPDRQVSIWGVLPLTGKTLA
FT                   LLVVFGTVLYGLAGGGLPGLGAFVPHFAALALGFALSRGGRMPTRRWKLQAREWWAERE
FT                   FRRRSKHLKVIGKDGKGEPPRWMN"
FT   gene            complement(82135..85404)
FT                   /locus_tag="AnaeK_0071"
FT   CDS_pept        complement(82135..85404)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0071"
FT                   /product="putative CheA signal transduction histidine
FT                   kinase"
FT                   /note="KEGG: ade:Adeh_0065 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71314"
FT                   /db_xref="GOA:B4UKM3"
FT                   /db_xref="UniProtKB/TrEMBL:B4UKM3"
FT                   /protein_id="ACG71314.1"
FT                   /translation="MPDPRSALKEFRQLDRKRLSEGLTAEEERRHAELRDLVEPELQAS
FT                   GSGFDVGAAADRLRASLEPAGLRRAPAEAPPAPPAAEAGPAPLFEDVAPDAGLAEAFEG
FT                   QAFEALEVPAPDAPAWEAAAQPAAPEAAEGWAPEAPASDPDAAQAWDPSAQPFDPNAAQ
FT                   AWDPTAQPYDPNAAQAWDPSAQPFDPDAAQAWDPNAQPFDPDAAQAWDPNAQPFDPNAA
FT                   QAWDPSAQPSDPNAAQAWDPNAQPFDPNAAQAWDPNAQPYDPNAAQAWDPNAQPFDPNA
FT                   AQAWDPNAQPFDPSAAQAWDPNAQPYDPNAAQAWDPNAQPYDPNAAQAWDPNAPPFDPS
FT                   AAQGWDPSAAASDPSAAQAWDPGAQPYDPDAAQPAWNPDTTATFGEPEPQPSPGAAPAE
FT                   AAPGYEAWTTPADEPETVDLATEAVIEELEPLSADGLALEGDPSAEPPAPLAGGDAASL
FT                   PPDGWEVTAPPPDAPEAAVLGEYDEAGAAPAALSPEDLGAEPAPEPAAPGAPLELGEYD
FT                   DTSGFAAPVGEDVLELATPGAAPAAEPGWAEEVALDQGFELESGGSFDAAAEATVPEWA
FT                   REAGLPPWDAPAPAAVDALDAGSLGLDGDVEAPVEPAAEPVALGDETGEPGEDGEPIAL
FT                   EPTLDLGAPVEPTLELAELEEPAAGEAGASPGDDPFALRAPEPEPTGARDLSALDFAAG
FT                   ELGEDADAWAAAETAPAEPEPFTLGDVGPQAEPLAGPDPEAELPAWDAGAAPALELEPS
FT                   RWDEAAAVDPVGGEAGIAVAEPSALLAEAAEALPPLELDGPAAPEPVADAEPAVDAAAS
FT                   LTAAAGTLLDAGAEAPPAIDDLLGDTLPAAPEADATEVAEVADLAAMPTPDADDLPTLD
FT                   GEDILEEIPADELVPLPPDEEAGGGIELGEVSLAAPVSAPAPAPAPEPASEPEPPAAPA
FT                   LPAPAAAIPDPAFEPLPVEEVSFTPPPVEAAPAPAGAWQVPGAHRVVIHTLEGLVKRGL
FT                   IEDAALDAPALDVVAQGPLPERIPTDKVKAIFFMLAPGEAAPAPEGKRVRVTFRDGRQV
FT                   AGFSPDYREDGPGFFMIPADTRTSTARIWIYRSAVRQVAVS"
FT   gene            85533..87479
FT                   /locus_tag="AnaeK_0072"
FT   CDS_pept        85533..87479
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0072"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: Radical SAM domain protein; Radical SAM domain
FT                   protein; SMART: Elongator protein 3/MiaB/NifB; KEGG:
FT                   ade:Adeh_0066 radical SAM"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71315"
FT                   /db_xref="GOA:B4UKM4"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013704"
FT                   /db_xref="InterPro:IPR020612"
FT                   /db_xref="InterPro:IPR022946"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR024560"
FT                   /db_xref="UniProtKB/TrEMBL:B4UKM4"
FT                   /protein_id="ACG71315.1"
FT                   /translation="MARLPVLQGDRARRPAPPGPEAFLPMFPEHLRARGWADLDVLLVS
FT                   GDAYVDHPSFGAAVIGRVLEAAGYKVGVVAQPDWRSPAELLRLGRPRLFVGITSGAMDS
FT                   MVNHYTAHKRRRSEDAYTPDGAAGRRPDRATTVYARLARAAFGPTTPIVLGGIEASLRR
FT                   IAHYDYWDDRVLPSVLVPSGADLLVYGQGEKPILEIARRLASGEDICGLTDVPGTALAV
FT                   PDLGMAMLDGRDRKVLELPAYEEIVLDKRRFAEFSRLYHLEHNEANARILVQRHGRGPA
FT                   QRHVVVNPPMRPPSTEELDRIAELPYVREAHPAYGGAHIPALEQIRWSVQILRGCAAGC
FT                   AFCCITEHQGRDIASRSEASVLREIATLASKETFRGTITDVGGATANMWRMECTSAEAH
FT                   AACRRASCVYPSVCQFFSVDHGPLVDLYEKARKVPGVKHVFVGSGVRYDLAQADEKNGA
FT                   RYLEALVANHVSGQLKVAPEHVCEPVLKVMKKPGVESFERFRKDFERYTRKAGKEQYLV
FT                   PYFISSHPGASLEEAADLMEYLQANRWKPQQVQDFMPTPMTLASDIFWSGFHPMTGKPV
FT                   HVTRDMEEKRMQKALLRWGDPANRPLIEKALRKIGRLRPGERLGPGMRPGRRGAGRPGP
FT                   GARGGTGPGRGPR"
FT   gene            87540..88145
FT                   /locus_tag="AnaeK_0073"
FT   CDS_pept        87540..88145
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0073"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ade:Adeh_0067 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71316"
FT                   /db_xref="InterPro:IPR018637"
FT                   /db_xref="UniProtKB/TrEMBL:B4UKM5"
FT                   /protein_id="ACG71316.1"
FT                   /translation="MPQIRLFPAAALLSLALALPARAADPAPAPAKPAAPAAAPAPAAK
FT                   PSPAAMDLARTLATQETWKRGMDGLTQSLVGQFRGHPGSELSMPKDFQAKARTEVEALL
FT                   PYEDLVNIHARQLSAAYTEQELKDLVAFYKSPLGQKALKAMPEVQEKVAMETQQRIEPK
FT                   LPQVMQKLAKDVKPPAGGAKVPASPHGGAAPAKPAPKK"
FT   sig_peptide     87540..87611
FT                   /locus_tag="AnaeK_0073"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 24"
FT   gene            88222..88971
FT                   /locus_tag="AnaeK_0074"
FT   CDS_pept        88222..88971
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0074"
FT                   /product="lipolytic protein G-D-S-L family"
FT                   /note="PFAM: lipolytic protein G-D-S-L family; KEGG:
FT                   ade:Adeh_0068 lipolytic enzyme, G-D-S-L"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71317"
FT                   /db_xref="InterPro:IPR013830"
FT                   /db_xref="InterPro:IPR036514"
FT                   /db_xref="UniProtKB/TrEMBL:B4UKM6"
FT                   /protein_id="ACG71317.1"
FT                   /translation="MIPPTPCRAGRLARPAVALAVVLVALGARAAGNAPAPLVYVALGD
FT                   STAAGQGGGPGGGYPPRLARRLEAAGLGVKLVNLGVAGATAGDLRRDQLPRALEARPGL
FT                   VTVGIGINDLVQGRPLREFARDLEIVADFLKQTRATVVISSLPDLVDSPSAKGAPAALA
FT                   RRLDQFNAAIERVAERHGFLVADAFGETRRAVRRLGAGAVFSGDGFHPSAAGYDAWADA
FT                   LRQPVERALGARLQGRRPPAPPAAARP"
FT   sig_peptide     88222..88314
FT                   /locus_tag="AnaeK_0074"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.990) with cleavage site probability 0.893 at
FT                   residue 31"
FT   gene            89006..90379
FT                   /locus_tag="AnaeK_0075"
FT   CDS_pept        89006..90379
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0075"
FT                   /product="adenosylmethionine-8-amino-7-oxononanoate
FT                   aminotransferase"
FT                   /note="TIGRFAM: adenosylmethionine-8-amino-7-oxononanoate
FT                   aminotransferase; PFAM: aminotransferase class-III; KEGG:
FT                   ade:Adeh_0069 adenosylmethionine-8-amino-7-oxononanoate
FT                   aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71318"
FT                   /db_xref="GOA:B4UKM7"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR005815"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:B4UKM7"
FT                   /protein_id="ACG71318.1"
FT                   /translation="MDDRERRERHRRLWEADHRHLWHPFTQMRDWLREEPLIVDAAEGV
FT                   HLVDTLGNRYLDGVSSLWCNVHGHRVPELDAAVRAQLDRVAHSTLLGLASTASIECAEE
FT                   LVRHLPPGLTRVFFSDAGATAVEIAIKMAFQHHQLRGDERRTEFVALHGGYHGDTIGSV
FT                   SVGGIDLFHRIFKPLLFDVHHAPQPYCYRCPLGKALPGCGMACADEVERILAAREGRVA
FT                   ALVVEPLVQGADGMITQPPGYLRRLRELCDRHGALLVCDEVATGWGRTGTTFAVEQEGV
FT                   VPDILTMAKGLTGGYLPLAATVTTEHVFESFLGEHAEKRTFFHGHTYAGNPLACAAATA
FT                   SMTLFRERGVGAAVPAKAAALARALAPAARLPHVGEVRQRGLMVGIELVRDRATKEEYA
FT                   YELQAGHRVILEARKLGAILRPLGNVVVLMPPLAMTEAELERLAGITLAAIEAATARL"
FT   gene            90379..91050
FT                   /locus_tag="AnaeK_0076"
FT   CDS_pept        90379..91050
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0076"
FT                   /product="dethiobiotin synthase"
FT                   /EC_number="6.3.3.3"
FT                   /note="TIGRFAM: dethiobiotin synthase; KEGG: ade:Adeh_0070
FT                   dethiobiotin synthase"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71319"
FT                   /db_xref="GOA:B4UKM8"
FT                   /db_xref="InterPro:IPR004472"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4UKM8"
FT                   /protein_id="ACG71319.1"
FT                   /translation="MRGLFVTGTDTGVGKTEVSCALLRAARAAGLDAVGMKPAQSGHVP
FT                   GEPSDAERLREASDCVEPLEAICPYTFAAPLAPAAAARLEGREVSLARVVEVARALAAR
FT                   HAAVVVEGAGGLLVPLTARETHADLAAALGLPVLVVARAGLGTVNHTALTVEALERRGL
FT                   AVAGIVLNRTGPEDDPSVPLNPAEIARLTHREPIALLPWEPDIARRARSLGSILGAKIQ
FT                   F"
FT   gene            91103..91375
FT                   /locus_tag="AnaeK_0077"
FT   CDS_pept        91103..91375
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0077"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ade:Adeh_0071 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71320"
FT                   /db_xref="UniProtKB/TrEMBL:B4UKM9"
FT                   /protein_id="ACG71320.1"
FT                   /translation="MPNVVDLTLVSRARRALHAVLEERGLGFFLAAGSRTPRLDPRRIA
FT                   WVVEVARRQVSLRARRDPDALSRTRRVLRRELIRRLTEAMLQAGL"
FT   gene            complement(91398..91667)
FT                   /locus_tag="AnaeK_0078"
FT   CDS_pept        complement(91398..91667)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0078"
FT                   /product="Domain of unknown function DUF1844"
FT                   /note="PFAM: Domain of unknown function DUF1844; KEGG:
FT                   ade:Adeh_0072 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71321"
FT                   /db_xref="InterPro:IPR014995"
FT                   /db_xref="UniProtKB/TrEMBL:B4UKN0"
FT                   /protein_id="ACG71321.1"
FT                   /translation="MADEKQPAPIDFYTFVLSLGSSAFVHLGDAPHPETGEIAEANLLL
FT                   AKQTIDILSMLAEKTKGNLTDEEARFLENLLTDLRLRYVAKSPR"
FT   gene            complement(91689..93113)
FT                   /locus_tag="AnaeK_0079"
FT   CDS_pept        complement(91689..93113)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0079"
FT                   /product="2-alkenal reductase"
FT                   /EC_number="1.3.1.74"
FT                   /note="PFAM: peptidase S1 and S6 chymotrypsin/Hap;
FT                   PDZ/DHR/GLGF domain protein; KEGG: ade:Adeh_0073 peptidase
FT                   S1 and S6, chymotrypsin/Hap"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71322"
FT                   /db_xref="GOA:B4UKN1"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR001940"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="InterPro:IPR041489"
FT                   /db_xref="UniProtKB/TrEMBL:B4UKN1"
FT                   /protein_id="ACG71322.1"
FT                   /translation="MERSRRSSSRSAVRGAGRALALAAALAAGLPAPAAARPPAALPRA
FT                   DERPSANRRTPVVIAVEKVRGAVVNVSAEELVRIRVPSQPRGGSMGDLLFGDLFERPRY
FT                   RKGYATTSLGSGVIVSPDGYVLTNNHVVERGARFRVGLLDGRELMAKVVGTDPSSDLAV
FT                   LKLDTREKLPYVTTGRSDDLLIGETVIAIGNPFGLAHTVTTGVVSAVHRNFKAGERMMF
FT                   DFIQTDASINPGNSGGPLLDIDGRLVGVNTAILGDRSAGIGFAIPIDRARRVAEDLIAH
FT                   GEVREGYLGVSVDDLPRKDGTVDGGSGGVRVTGVDPGSPGERAGVRAGDVVEAVDGTPP
FT                   GSAAELLFRLRDLPIGRAARLDLSRRGARVQAAVTAVELTPQRAAELVQRRVGLRVSEE
FT                   RVSGGTLVVVRSVTGRSPAAEAGLQPGDLVREVNSSEVSSVAAFQRAAARARRGGRLVL
FT                   LVQRGYAAERIAFDFD"
FT   sig_peptide     complement(93003..93113)
FT                   /locus_tag="AnaeK_0079"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.992 at
FT                   residue 37"
FT   gene            complement(93082..93321)
FT                   /locus_tag="AnaeK_0080"
FT   CDS_pept        complement(93082..93321)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0080"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ade:Adeh_0074 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71323"
FT                   /db_xref="UniProtKB/TrEMBL:B4UKN2"
FT                   /protein_id="ACG71323.1"
FT                   /translation="MADPFENKLVDKRVVQRYLRKGKVDEKEYEKFQKALPDLADQAMP
FT                   IEASMSGVEEPDDLDDDEPEEDVGGGEVPPQQQP"
FT   gene            93425..94072
FT                   /locus_tag="AnaeK_0081"
FT   CDS_pept        93425..94072
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0081"
FT                   /product="thiamine-phosphate pyrophosphorylase"
FT                   /EC_number="2.5.1.3"
FT                   /note="TIGRFAM: thiamine-phosphate pyrophosphorylase; PFAM:
FT                   thiamine monophosphate synthase; KEGG: ade:Adeh_0075
FT                   thiamine-phosphate pyrophosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71324"
FT                   /db_xref="GOA:B4UKN3"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022998"
FT                   /db_xref="InterPro:IPR034291"
FT                   /db_xref="InterPro:IPR036206"
FT                   /db_xref="UniProtKB/TrEMBL:B4UKN3"
FT                   /protein_id="ACG71324.1"
FT                   /translation="MGAGRRARLGGLYVIVGGADPVAQAHAAIGGGARAVQVRMKDAPA
FT                   GAVLEATRRILALAAGRALVLVNDRADLALLAGADGVHLGDDDLPVPEARRLLGPDLLV
FT                   GRTTRTLEEARAALDEGADHVGYGPIFASRSKALPVPPRGLQALAEVARALPAPVVAIG
FT                   GIGLDDVGAVARAGAACAAVIEAVVGAADPEAAAARMQAAFEAGRAARGANP"
FT   gene            94069..94779
FT                   /locus_tag="AnaeK_0082"
FT   CDS_pept        94069..94779
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0082"
FT                   /product="peptidase C26"
FT                   /note="PFAM: glutamine amidotransferase class-I; peptidase
FT                   C26; KEGG: ade:Adeh_0076 peptidase C26"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71325"
FT                   /db_xref="GOA:B4UKN4"
FT                   /db_xref="InterPro:IPR011697"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:B4UKN4"
FT                   /protein_id="ACG71325.1"
FT                   /translation="MNPRPRIGITLDADASGRRYELPRGYVEAVLDAGGLPILLPHAVD
FT                   VAGAYLSLLDGLVVSGGDFDLPPELYGEARRPGCGPSRPERTRFEKDLLEAALAARLPV
FT                   LGVCGGMQLLDVVRGGTLWQDLPGEAGLHGHEQPAPKDVPSHEVTIAPGTQLATLAGAG
FT                   PLMVNSTHHQAVREPGPGVLVSARAPDGVVEAIELPDLPFALGVQWHPEATRDDPRHAA
FT                   IYRGLVDAARSLRR"
FT   gene            94776..95534
FT                   /locus_tag="AnaeK_0083"
FT   CDS_pept        94776..95534
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0083"
FT                   /product="phosphomethylpyrimidine kinase"
FT                   /EC_number="2.7.4.7"
FT                   /note="PFAM: Phosphomethylpyrimidine kinase type-1; KEGG:
FT                   ade:Adeh_0077 phosphomethylpyrimidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71326"
FT                   /db_xref="GOA:B4UKN5"
FT                   /db_xref="InterPro:IPR004399"
FT                   /db_xref="InterPro:IPR013749"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:B4UKN5"
FT                   /protein_id="ACG71326.1"
FT                   /translation="MIPRVLVVAGLDPSGGAGLTADLEALAAVGARGWAVATALTAQGP
FT                   RGARGVSPASEAFLRLQIDALLEGRERPRAVKTGMLGTAGLAAALAARLAEPPLARVPL
FT                   VVDPVLLASSGAPLLDAGGVPPGEALAPLLARARLATPNLPELAALTGLEVSTDDAAVR
FT                   AARSLPARAVLVKGGHREGAPVDLLVEGRRVTRFTGRRRAGTARGTGCRLASAMAGLLA
FT                   GGASLEEAVRGGKRVVERYLDASGRGSAGR"
FT   gene            96522..97259
FT                   /locus_tag="AnaeK_0084"
FT   CDS_pept        96522..97259
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0084"
FT                   /product="protein of unknown function DUF1568"
FT                   /note="PFAM: protein of unknown function DUF1568; KEGG:
FT                   ade:Adeh_3956 protein of unknown function DUF1568"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71327"
FT                   /db_xref="GOA:B4UKN6"
FT                   /db_xref="InterPro:IPR002686"
FT                   /db_xref="InterPro:IPR036515"
FT                   /db_xref="UniProtKB/TrEMBL:B4UKN6"
FT                   /protein_id="ACG71327.1"
FT                   /translation="MRRGSRQLRFRLPAPRTHGGRRPGAGRKPRGARAGVSHHGRPVVT
FT                   AAAPVHVTLRVLPHVWNLRSQRAFRVVEAALEAATGTATATGFRVVHFSLQGNHLHLLV
FT                   EADGQRALSSGMQGLCIRLAKGLNRMMGRRGKVFADRYHARVLGTPSEVRNALAYVLLN
FT                   HRSHLARLGKPAGRGGVDRFSSGRWFDGWRGGGPAVPEGARRVTAAARTWLLRTGWRRG
FT                   STGSPRGAGGLLSFDEVPAAPAG"
FT   gene            complement(97281..98702)
FT                   /locus_tag="AnaeK_0085"
FT   CDS_pept        complement(97281..98702)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0085"
FT                   /product="replicative DNA helicase"
FT                   /note="TIGRFAM: replicative DNA helicase; PFAM: DnaB domain
FT                   protein helicase domain protein; KEGG: ade:Adeh_0079
FT                   primary replicative DNA helicase"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71328"
FT                   /db_xref="GOA:B4UKN7"
FT                   /db_xref="InterPro:IPR007692"
FT                   /db_xref="InterPro:IPR007693"
FT                   /db_xref="InterPro:IPR007694"
FT                   /db_xref="InterPro:IPR016136"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036185"
FT                   /db_xref="UniProtKB/TrEMBL:B4UKN7"
FT                   /protein_id="ACG71328.1"
FT                   /translation="MAESDPARRVAEAGVSPLRSARDLPHSLEAEQAVLGAILVEETAF
FT                   DQVAALLRAGDFYLLAHQHVYGACEELARESKTLDPILIQQRLDAKGLLGSAVPHELPL
FT                   TLARAIGTASNVGHYARTVQDLARLRVMMLTAQRLVERGYEAGANVQHFLDAAQQEVFG
FT                   AAQGTSVDTLKKISEPVLRALENLEAVQKRVQAGLSPITGVPTGIQTLDRNTLGLQPGT
FT                   LTVLAARPSVGKTAFALNIATHAATKAQRKVAFFSLEMPADQLALRMLASEGKLDWRKL
FT                   SQGQLSRHDWDKLATQADRIGAASLWLDDNFVLTPVELRSKCRKLKRENGGLDLVMIDY
FT                   LQLMHAPSDRSNQSREQEIATISRSLKSLAKELECPIVALSQLNRSVEKRKGEPPMLSD
FT                   LRESGAIEQDADIVMFLHRAEEDNKDVQQGTASGDTLPVQLIVAKQRQGPTCTIDLVFF
FT                   KSTTYFAEMDRRPQQ"
FT   gene            98919..99752
FT                   /locus_tag="AnaeK_0086"
FT   CDS_pept        98919..99752
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0086"
FT                   /product="Late embryogenesis abundant protein 2"
FT                   /note="PFAM: Late embryogenesis abundant protein 2; SMART:
FT                   Water Stress and Hypersensitive response domain protein;
FT                   KEGG: ade:Adeh_0080 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71329"
FT                   /db_xref="GOA:B4UKN8"
FT                   /db_xref="InterPro:IPR004864"
FT                   /db_xref="InterPro:IPR013990"
FT                   /db_xref="UniProtKB/TrEMBL:B4UKN8"
FT                   /protein_id="ACG71329.1"
FT                   /translation="MRSLRLLALTSIVALSGCAALNQLAASAFEKPKLTFRSATLQSLD
FT                   LEGATLGFQFDLENPNGFGLTLARLGYGVEVEGTRIAAGDMPGGLKIPAAGKAPVTFPV
FT                   RVRFKDVPGIVSLLGRQQESIRYKLGGTVGVSTPVGVVDLPISHEDSLKLPRLPGFTLE
FT                   GLSVRSVSLSDLALDVKLRVKNPNAFAIPSGTLDSAVSLAGSQVGRIDGRALAAVPAQG
FT                   STVLTIPLKVDLLRAGRAASELMRGAPVDVGMRGTADLGGLPVPLDLGGRVPVAK"
FT   sig_peptide     98919..98996
FT                   /locus_tag="AnaeK_0086"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.686 at
FT                   residue 26"
FT   gene            complement(99963..101885)
FT                   /locus_tag="AnaeK_0087"
FT   CDS_pept        complement(99963..101885)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0087"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cre:CHLREDRAFT_146003 hypothetical protein
FT                   PROSITE: ALA_RICH GLY_RICH"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71330"
FT                   /db_xref="GOA:B4UKN9"
FT                   /db_xref="InterPro:IPR008969"
FT                   /db_xref="InterPro:IPR013784"
FT                   /db_xref="UniProtKB/TrEMBL:B4UKN9"
FT                   /protein_id="ACG71330.1"
FT                   /translation="MSPFPFPRPGARAALAPAALVLVAALAACGGGGGGGGSSPPPPPP
FT                   PPGGASTVLGAVTDARSGARLAGVTVTAAGRTAVTDAAGEFTLTGLAAGDVRLTFTKEG
FT                   YAPSYAGARSGDRSEAVLATLKREGARQPYDPSTARTFSEVTEAGPYAVILPAGSLDTA
FT                   ATELEVTITPVDPSKETAVLPGELVAGSAGGTVLAPVTFAEFSIYEPSGRRVNLKPSAS
FT                   AVVELPIPPALRPRYPLGTVIHCYSYDPATGAWEDFVEGTVARSSVDGETPVLRAAIRH
FT                   FSWYGAAPEGNECADLYGRVVSAVDGRPLPNARVEAFPGTTAYTDANGNFQVVALRDGA
FT                   SSLVAYQTGFDLDGSLTGMPGAKYIEFGKVDDLPLTGLVARSCAGGAALAGAAGEMQAA
FT                   AAGVGTPADPLLVRVGVLSKLSYEVTAWVDANGAAALVSEGVPGPDGELVDPQPTDGAV
FT                   ITVTGPDGAHALPLAAEGTGVFSAAFTGEPGRRYTITVDANGDGAVDGTGFTYLVGEPA
FT                   FTSPAEGATLDAAGLRAAWTDAAVEAGTADADYAPLYWAAVTAAAEPWDGDFYWGSDRG
FT                   FDVRSLVSGEPLAPGAYSAAVLALCGPYAAAGQDVALVKNVTGAGISGEFFSFAAGTEV
FT                   GFTVR"
FT   sig_peptide     complement(101793..101885)
FT                   /locus_tag="AnaeK_0087"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.990) with cleavage site probability 0.629 at
FT                   residue 31"
FT   gene            complement(101908..102966)
FT                   /locus_tag="AnaeK_0088"
FT   CDS_pept        complement(101908..102966)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0088"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fal:FRAAL5406 glycine-rich cell wall
FT                   structural protein precursor (partial match)"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71331"
FT                   /db_xref="InterPro:IPR011048"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniProtKB/TrEMBL:B4UKP0"
FT                   /protein_id="ACG71331.1"
FT                   /translation="MSQAASGTVAVVDPERGETVRRIAVGQLPHQLLAVGDRLLVVLTG
FT                   SQAVAELDPATARPTRTFLTAPLPAAREDGSPIAGHATAEAAAATSCAACHGVPGGPPP
FT                   RYVGERPIAMLALPGGRLLVAHVRSGALTELDLATGAIHRRVALAPAGDAREAVALALL
FT                   GDEVLVALRPKPPSGEPAVIRRLDADTLAPLGDVAVGPDPVALLALPERGLALVSDFAS
FT                   DTVTPVTAGAAAGAGPAFTAAPGPMGLLPLPGGRRVLALDYYSDAISRLDLDTGEVRTE
FT                   RLRSAARPYANPSHAALSPDGRTAWVVSAGTEGHVLAVDVETLAVVGAVPVDGLSFAVA
FT                   VVPGPAPLPPAP"
FT   gene            complement(103122..103796)
FT                   /locus_tag="AnaeK_0089"
FT   CDS_pept        complement(103122..103796)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0089"
FT                   /product="LrgB family protein"
FT                   /note="PFAM: LrgB family protein; KEGG: ade:Adeh_0082
FT                   LrgB-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71332"
FT                   /db_xref="GOA:B4UKP1"
FT                   /db_xref="InterPro:IPR007300"
FT                   /db_xref="UniProtKB/TrEMBL:B4UKP1"
FT                   /protein_id="ACG71332.1"
FT                   /translation="MIAAAWIALTAALYAAARALHRRFPRPWLTPLLVVPGALAALLLA
FT                   ARVPYPGYMQGGRLLVDLLGPATVAFALPLHRHAGLLRRHAAELCAGILAGCAVAVGSS
FT                   FLLARALGLDRPLALSLAPRSITTPFAMQVAGDLGGVPALAAVFVILTAVVGLVVGQLL
FT                   VRWLPLRSAVARGALFGMGAHAAGTAQAMELGRVEGAVAGVVMIVAGLGVLVATPLLRL
FT                   AL"
FT   sig_peptide     complement(103743..103796)
FT                   /locus_tag="AnaeK_0089"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.699) with cleavage site probability 0.499 at
FT                   residue 18"
FT   gene            complement(103793..104209)
FT                   /locus_tag="AnaeK_0090"
FT   CDS_pept        complement(103793..104209)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0090"
FT                   /product="LrgA family protein"
FT                   /note="PFAM: LrgA family protein; KEGG: ade:Adeh_0083 LrgA"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71333"
FT                   /db_xref="GOA:B4UKP2"
FT                   /db_xref="InterPro:IPR005538"
FT                   /db_xref="UniProtKB/TrEMBL:B4UKP2"
FT                   /protein_id="ACG71333.1"
FT                   /translation="MPRAVHAASPAAPPPRTAALLALPLQLLALGAFWGAGALAARALR
FT                   LPLPGGVVGMLLLLAALRLGVVRAEWLERGAAWLFRHMLLFFIPAAVGAIQYPELLGSE
FT                   GARALAVVAVSTVLVMAVTGATVEWLARRREEAP"
FT   gene            104291..105226
FT                   /locus_tag="AnaeK_0091"
FT   CDS_pept        104291..105226
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0091"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: ade:Adeh_0084 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71334"
FT                   /db_xref="GOA:B4UKP3"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B4UKP3"
FT                   /protein_id="ACG71334.1"
FT                   /translation="MDLRGLGAFVEVVRQGGFTRAAAALHVTQPAVSKAVRALEDEIGV
FT                   PLLERGARRTVPTEAGRAVLARAEGVLAAVRAIEDEVADLGALRRGRARVGLPPMVSGA
FT                   FFPPVLAAYRQRYPGIQLELREEGAREVEALVASGALDVGVTVLPTDEARFEALPFVHD
FT                   VLAAVLHPASPLARRPRLALADLAGTPFLLYRADFALRGRILDACRAAGFSPQVASETG
FT                   QWDFMAAMAAADVGVALLPRTICRRLDPAQVAVVPLAAPAIGWNLGLIWRREGTLSAAA
FT                   RAFVETAREVLLPRRAAGYPAARSRPRTRK"
FT   gene            complement(105187..108639)
FT                   /locus_tag="AnaeK_0092"
FT   CDS_pept        complement(105187..108639)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0092"
FT                   /product="methionine synthase"
FT                   /note="TIGRFAM: methionine synthase; PFAM: dihydropteroate
FT                   synthase DHPS; homocysteine S-methyltransferase; Methionine
FT                   synthase B12-binding module cap domain protein; Vitamin B12
FT                   dependent methionine synthase activation region; cobalamin
FT                   B12-binding domain protein; KEGG: ade:Adeh_0085 methionine
FT                   synthase (B12-dependent)"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71335"
FT                   /db_xref="GOA:B4UKP4"
FT                   /db_xref="InterPro:IPR000489"
FT                   /db_xref="InterPro:IPR003726"
FT                   /db_xref="InterPro:IPR003759"
FT                   /db_xref="InterPro:IPR004223"
FT                   /db_xref="InterPro:IPR006158"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="InterPro:IPR011822"
FT                   /db_xref="InterPro:IPR036589"
FT                   /db_xref="InterPro:IPR036594"
FT                   /db_xref="InterPro:IPR036724"
FT                   /db_xref="InterPro:IPR037010"
FT                   /db_xref="UniProtKB/TrEMBL:B4UKP4"
FT                   /protein_id="ACG71335.1"
FT                   /translation="MNFREALERRPLVFDGAMGTQIQRHQLTAAEFGGKEGANDLLTLT
FT                   RPDLIEEIHARYFAVGCDVVETNTFGSSRLKLDEYGLGHRTYEVNCRAAILARRAADRY
FT                   STPDQPRFVAGSIGPTGMLPSSSDPALGNITSDALERIFFEQAKGLVEGGVDALIIETQ
FT                   QDMLELRAAVLACDAVRREALRDVFVIAQPTLIDANGRMLLGTDIGSAVATLERLPVDA
FT                   IGLNCSTGPDEMRASVKALAEKCSHFVSVLPNAGMPENVDGRAVYKLSPDDLARALVGF
FT                   VAEYGVDIVGGCCGTTPEHLRKVVEALRARPAPRRRRPAPAAELSSAMKAVPLAMEPRP
FT                   LVVGERLNSQGSRKVKELLLADDYAGLVQIARGQVEAGAHVLDVCVALNERDDEAAQMR
FT                   TLAKLLAQSVDAPLMIDSTEPDVIEGALKVYPGRCIVNSVNLEKSGERVRRVLPLVRRY
FT                   GAAVVAMTIDEKGMAQTAERKAEVARRIVAVAKDHGIPPDSLVFDALTFTLATGGEEYR
FT                   RSAVETLEGIRRIKAENPGVLTTLGVSNVSFGLAKSAREVVNSVFLYHAVQAGLDLAIV
FT                   NPKDILPYPAIDAAERALAEDLVFDRRPDALARLIAHFGAKGAPEKAAVDPLAGAGGKS
FT                   AEERIHLQILHRRPEGIEALIDEALTRRSAVDVLNQVLLPAMKDVGDRFGAGELILPFV
FT                   LQSAEVMKKAVAHLEQFLEKKAGATKGNVVLATVYGDVHDIGKNLVKTILSNNGFTVHD
FT                   LGKQVPVATVLDKALQVNADAIGLSALLVSTSKQMPFCVEELHRRNLSFPVIIGGAAIN
FT                   RRFGYRTHFAQDGNPYAGGVFYAKDAFEGLEVVEALVDPARREALRREVLQKAVAEKSR
FT                   PAAEPVAQAPARRTGSVAPAARVPAPPFWGPRVVPSGSIALADVWPHLDLAELFKLQWG
FT                   VKAKGAEYERLIREEFGPKLEELKAEAQAQGWLVPKVVYGYFPCHAEGNDLVVLDPTHR
FT                   KAEVARLQFPRQPDDRNLCLADYFREERGADVCALQVVTVGDQATHLAEQAQERGDYTR
FT                   ALFLHGLAVETAEALAEYWHRQVRGELGLADGQGKRYSPGYPSWPELSDQRQVWKLLDP
FT                   VRTIGVSLTDACQMVPEQSTSAIVLHHPDAIYFLVRGLERAAG"
FT   gene            108814..109884
FT                   /locus_tag="AnaeK_0093"
FT   CDS_pept        108814..109884
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0093"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: Radical SAM domain protein; KEGG:
FT                   ade:Adeh_0086 radical SAM"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71336"
FT                   /db_xref="GOA:B4UKP5"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR016431"
FT                   /db_xref="InterPro:IPR027596"
FT                   /db_xref="InterPro:IPR034457"
FT                   /db_xref="UniProtKB/TrEMBL:B4UKP5"
FT                   /protein_id="ACG71336.1"
FT                   /translation="MIHEARYWEPAAGGKVRCTLCPRDCRIGEGQAGFCFVRRNEGGKL
FT                   VTSAWGRSTGFAVDPIEKKPLAHFHPGARVLSFGTAGCNLGCRFCQNWDISKARLDELH
FT                   SEVDWTPERVVALAREAGCPGIAFTYNDPIIWAEYAIDVADAAHAAGLFTVLVTNGYVS
FT                   PEARRDLFSRADAANVDLKAFTEEFYRRQTFSHLAPVLDTLEWLARETRVWTEVTTLLI
FT                   PGLNDGDAELRDLAGWIRDHMGREVPLHFSAFHPAYKLTDRPRTPPATLTRARAIARAE
FT                   GLRHVYTGNVHDPEGDTTFCPGCGARVIERDWFAVRAVRMKGGACAACGTRIAGRFGDE
FT                   GVRLDDGIPLPLGVPV"
FT   gene            complement(109903..110265)
FT                   /locus_tag="AnaeK_0094"
FT   CDS_pept        complement(109903..110265)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0094"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ade:Adeh_0087 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71337"
FT                   /db_xref="UniProtKB/TrEMBL:B4UKP6"
FT                   /protein_id="ACG71337.1"
FT                   /translation="MRRLLLVPIALTFALAGCSGPCQDLGDRLCRCVGVGTTRDACERS
FT                   VKEQLQNHNPSKDVEHLCDQRLKTCRAPDGAEFCEWINTACGKASCGLSSDEPETACTP
FT                   AAAAALEGEPVQSVEP"
FT   sig_peptide     complement(110194..110265)
FT                   /locus_tag="AnaeK_0094"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.885) with cleavage site probability 0.351 at
FT                   residue 24"
FT   gene            110364..111044
FT                   /locus_tag="AnaeK_0095"
FT   CDS_pept        110364..111044
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0095"
FT                   /product="outer membrane lipoprotein carrier protein LolA"
FT                   /note="PFAM: outer membrane lipoprotein carrier protein
FT                   LolA; KEGG: ade:Adeh_0088 outer membrane lipoprotein
FT                   carrier protein LolA"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71338"
FT                   /db_xref="GOA:B4UKP7"
FT                   /db_xref="InterPro:IPR004564"
FT                   /db_xref="InterPro:IPR029046"
FT                   /db_xref="UniProtKB/TrEMBL:B4UKP7"
FT                   /protein_id="ACG71338.1"
FT                   /translation="MTSSFLLALPVALALAASGPAPAPAEPGGAAAARTLEDPRALARK
FT                   VQAFYERTRDLEARFRQAYTYAGFGRRQTSSGTLRVKKPGMMRWDYEKPAAKTVAVKGS
FT                   RLVQYEPEENQAYVDEAFDSSAMSAAVTFLLGKGDLLREFDVSLDGSGALLLRPKESDP
FT                   RVESIALTVAADGQVTATRVVDGAGNANEIRFEDVRRNVGLPDAAFEVKLPRDVRRIAA
FT                   PKAQ"
FT   sig_peptide     110364..110414
FT                   /locus_tag="AnaeK_0095"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.997) with cleavage site probability 0.481 at
FT                   residue 17"
FT   gene            111061..112533
FT                   /locus_tag="AnaeK_0096"
FT   CDS_pept        111061..112533
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0096"
FT                   /product="protein of unknown function DUF853 NPT hydrolase
FT                   putative"
FT                   /note="PFAM: protein of unknown function DUF853 NPT
FT                   hydrolase putative; KEGG: ade:Adeh_0089 protein of unknown
FT                   function DUF853, NPT hydrolase putative"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71339"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033186"
FT                   /db_xref="UniProtKB/TrEMBL:B4UKP8"
FT                   /protein_id="ACG71339.1"
FT                   /translation="MSDPILVAKAARAGAGFTDLALLPRLANRHGLVAGATGTGKTVTL
FT                   RVLAEGFSRLGVPVFLADVKGDLSGMARPGGEAPKLVERAQQLGIALAPEACPVAFLDV
FT                   YGEAGHPLRTTISEMGPLLLARVLGLNEVQAGVLNVAFRAADEGGLLLLDLKDLRAMLE
FT                   HVSENAAALRARYGNVSPTSVGAIQRALLALESQGADRLFGEPALALEDLLRTDLSGRG
FT                   QVTILHAEKLIRAPTLYATLLLWLLSELFEQLPEVGDPEKPRLVFFFDEAHLLFDDAPD
FT                   ELRQKVEQVVRLVRSKGVGVYFVTQNPLDVPDVVLGQLGNRVQHALRAFTPRDQKAVRA
FT                   AAETFRANPGVDVERAITELGVGEALVSFLDEKGTPHPVERAWVLPPRSRLAPLTAEER
FT                   AQVMASSPLRGRYDAPVDRESAYELLQRRAQATVAEPAPGGRAAPAPRTVGAEAASALG
FT                   KMAQSAMRAAGTQLGREIMRGILGSMFGGRRR"
FT   gene            112634..114052
FT                   /locus_tag="AnaeK_0097"
FT   CDS_pept        112634..114052
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0097"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase A domain protein; KEGG: ade:Adeh_0090
FT                   periplasmic sensor signal transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71340"
FT                   /db_xref="GOA:B4UKP9"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B4UKP9"
FT                   /protein_id="ACG71340.1"
FT                   /translation="MLEAADAALRAAVADAVREARRRSAEAVAWMRVALRGAILLVYLP
FT                   GWHEPAPWHAAALRVSVVYLAFAVGVLALLRRRWRWEAVALGAAALDLAVVAVGSWRVV
FT                   ALAGGNLALAVAAGAGNGMMLMVILFAALALPAAPAAAISAVAVANQMALAAHSAVSWR
FT                   LVLVVGLMLSAAAFVAIRNTMRATALAARLAAETYTASLCRAHGEALARASAQAVAQRD
FT                   EVVAAHRQARDLVRLMVHDLKNPLAALLQYLRLAEVELRGQPGAGPVREDLAQAEGEGQ
FT                   RLSEMIGDLLAISRLETGPVRLAADPVSIGDLLQAVARSCAPHARERGVTLSVRGGEDL
FT                   VVRIDRDLSRRLLENLVSNALRHCRTGDRVELAGEADGEGVRLAVRNSGPPVPAAIRAH
FT                   LFEKFAPGEAREWTSAGLGLYLCRLVAEAHGGGVALVDTPGWTVSFEARLAPPQAGGEA
FT                   APRAAALAPERRPG"
FT   gene            114062..114916
FT                   /locus_tag="AnaeK_0098"
FT   CDS_pept        114062..114916
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0098"
FT                   /product="protein of unknown function DUF1684"
FT                   /note="PFAM: protein of unknown function DUF1684; KEGG:
FT                   ade:Adeh_0091 protein of unknown function DUF1684"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71341"
FT                   /db_xref="InterPro:IPR012467"
FT                   /db_xref="UniProtKB/TrEMBL:B4UKQ0"
FT                   /protein_id="ACG71341.1"
FT                   /translation="MPGNLAPLSLVLLPLVLAACNRRPPADPAFAAEWKAWHDRREERL
FT                   RTPTGWLALTGLHWLEPGENRIPGLPGTFTLEAGRVTLAAARSDGYVLGGAPVERRALA
FT                   PDSAGEPDRVQVGSVTLAVIERSGRFAVRVWDAAAPARTGFRGIDAFPPEPRWRIEARW
FT                   EAYPAPREVEVPSVIGVATRELAPGRAHFTVEGRELTLEPTAEEDGGLFFVFKDATSRD
FT                   ATYGAGRFLSAGAPRDGKVVLDFNRAVNPPCAFSAFATCPLPTPENVLPVRIEAGEKRY
FT                   GEH"
FT   sig_peptide     114062..114121
FT                   /locus_tag="AnaeK_0098"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.771) with cleavage site probability 0.705 at
FT                   residue 20"
FT   gene            115168..115602
FT                   /locus_tag="AnaeK_0099"
FT   CDS_pept        115168..115602
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0099"
FT                   /product="hemerythrin-like metal-binding protein"
FT                   /note="TIGRFAM: hemerythrin-like metal-binding protein;
FT                   KEGG: ade:Adeh_0092 hemerythrin-like, metal-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71342"
FT                   /db_xref="GOA:B4UKQ1"
FT                   /db_xref="InterPro:IPR012312"
FT                   /db_xref="InterPro:IPR012827"
FT                   /db_xref="InterPro:IPR035938"
FT                   /db_xref="UniProtKB/TrEMBL:B4UKQ1"
FT                   /protein_id="ACG71342.1"
FT                   /translation="MGMEWTARLAVGIDDIDAQHRELFRRVNGLVAAMGERRGREELAE
FT                   VVAFLRAYVDVHFEAEARLMARTRYPGRAFHSAEHAHFRAQVEELAARIAAEGPESHHA
FT                   VKLAGILCDWLRQHVLLTDRQLADHVRAEDLLDEGWKGEG"
FT   gene            complement(115757..117166)
FT                   /locus_tag="AnaeK_0100"
FT   CDS_pept        complement(115757..117166)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0100"
FT                   /product="MiaB-like tRNA modifying enzyme YliG"
FT                   /EC_number="1.3.1.74"
FT                   /note="KEGG: ade:Adeh_0093 hypothetical protein; TIGRFAM:
FT                   RNA modification enzyme, MiaB family; MiaB-like tRNA
FT                   modifying enzyme YliG; PFAM: deoxyribonuclease/rho
FT                   motif-related TRAM; Radical SAM domain protein; Protein of
FT                   unknown function UPF0004; SMART: Elongator protein
FT                   3/MiaB/NifB"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71343"
FT                   /db_xref="GOA:B4UKQ2"
FT                   /db_xref="InterPro:IPR002792"
FT                   /db_xref="InterPro:IPR005839"
FT                   /db_xref="InterPro:IPR005840"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013848"
FT                   /db_xref="InterPro:IPR020612"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR038135"
FT                   /db_xref="InterPro:IPR041582"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4UKQ2"
FT                   /protein_id="ACG71343.1"
FT                   /translation="MATRVYMHTLGCPKNRVDSEVMLGTLAEAGYRLVQDPAQAEVIVV
FT                   NTCGFIESAKEESVEAIVELADQKREGRCRKLVVTGCLVQRHAEELARELPEVDHFLGT
FT                   GAYQDVARIVSDAQAKRLVVPDPDFVHSSATPRVNSLPSHTAYLKIAEGCDNACAFCII
FT                   PKLRGGQRSRPIDDLVAEAAALAAQGTVELSLVAQDLTAYGQDLPGKVRLHHLLPELAK
FT                   VDGIRWIRLHYAYPRDVPDALVAAIADEPRIVKYLDMPLQHSSDRLLRAMKRGRDSVFL
FT                   RDLLARLRSRIPGLALRTALIVGLPGETEADFEDLLRFVEEQRFERLGVFEYSAEEGTP
FT                   AAEMADQVPDAVKRERRDRIMAVQQAISRAHQQAMIGRRVEVLVEGRAEETEHLLAGRH
FT                   AQQAPEIDGLTYINDGVAYPGEIVTVEITDAAEYDLVGRVVARDPSRAARPLPAAPRAA
FT                   PARKGGLNVLR"
FT   gene            complement(117251..117739)
FT                   /locus_tag="AnaeK_0101"
FT   CDS_pept        complement(117251..117739)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0101"
FT                   /product="protein of unknown function DUF520"
FT                   /note="PFAM: protein of unknown function DUF520; KEGG:
FT                   ade:Adeh_0094 nucleotide-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71344"
FT                   /db_xref="InterPro:IPR007551"
FT                   /db_xref="InterPro:IPR035570"
FT                   /db_xref="InterPro:IPR035571"
FT                   /db_xref="InterPro:IPR036183"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4UKQ3"
FT                   /protein_id="ACG71344.1"
FT                   /translation="MPSFDVVSEVDLMEVENAFNQARKEIAQRFDFKGTHTELERDKEQ
FT                   NVLIRAGSEGRAEAALQVLMEKLAKRGVALESLDPQKLEPASGGHVRQLVKLKRGLKIE
FT                   DARKIVAKVKESGIKVQAAIQGDAVRVTGKKRDDLQAAIHAIRAAAFPIPLQFQNFRD"
FT   gene            complement(117780..119420)
FT                   /locus_tag="AnaeK_0102"
FT   CDS_pept        complement(117780..119420)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0102"
FT                   /product="beta-lactamase domain protein"
FT                   /note="PFAM: beta-lactamase domain protein;
FT                   RNA-metabolising metallo-beta-lactamase; KEGG:
FT                   ade:Adeh_0095 beta-lactamase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71345"
FT                   /db_xref="GOA:B4UKQ4"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR001587"
FT                   /db_xref="InterPro:IPR004613"
FT                   /db_xref="InterPro:IPR011108"
FT                   /db_xref="InterPro:IPR030854"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="InterPro:IPR041636"
FT                   /db_xref="InterPro:IPR042173"
FT                   /db_xref="UniProtKB/TrEMBL:B4UKQ4"
FT                   /protein_id="ACG71345.1"
FT                   /translation="MRIVPLGGLGEIGMNCMAVECDGRIAVVDCGVLFPNESLGVDLIA
FT                   PDLSWLRERREQVGAVFLTHGHEDHLGALPFLLREVPVPVYGTRFTLALLRPRLDEAGV
FT                   RADLREVRPGDVRPAGDASPIAAEFLAVTHSIPDACGLALSTPQGTLLHSGDFKIDPAP
FT                   VRGPGMDLDRIEALGRKGVRLLLSDSTNAEREGTSLSESQVGPALEQAFELARGRVFVA
FT                   CFASNVHRLQQIVNAARAFGRRVAFLGRSMEANARLAQELGYLELPAWMPVSPEEARTL
FT                   PPRELCVLTTGTQGEPRSALARLARGEHPDLAVSPGDLVVLSSRFIPGNEIAIGQVVNE
FT                   LCRRGAEVAYEGLAPLHVSGHAQADEQRRLIRLARPAHFVPIHGEYRHLSRHAAHAAAE
FT                   GVAGRDVLVDGQVLELADAGVRVLDEPVATGRVYTDRDALLGADIGALVVRDRRLLAET
FT                   GLCIAVLAIERTTGAVVRGPELFARGVAGFEGAEEELRAEILAGLGDLSPKARTDPAEV
FT                   QEAVRLAVRRFFRRTTGKKPPVLPVVLEL"
FT   gene            119529..120662
FT                   /locus_tag="AnaeK_0103"
FT   CDS_pept        119529..120662
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0103"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ade:Adeh_0096 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71346"
FT                   /db_xref="UniProtKB/TrEMBL:B4UKQ5"
FT                   /protein_id="ACG71346.1"
FT                   /translation="MVAARRILALPLAFALAALPAAPGADGPARGATPAPSAPAAEAEP
FT                   RAAGPELVRLRWAWPAPLEAQVTCRRTRVRTGAPPSVFTARYRQRAALAGAGEPGLAIS
FT                   TRGTTWEGDVPWAPPVARQALHASEQLVQRIGPDGAFAALEGAEALRPALRSLVDGAGV
FT                   QGAQAERAVARAEAAARGEAEELWNLSVGFWIDADLVLGQEYVMPSETELPLLPGVRGP
FT                   ASVEFAVRRRVPCAAAERAARCVEIVLHATPEPAALARHAAALRARLAEGAEGPVAVPA
FT                   AHGRDGGELQAEGTLVLVTDPATLVPRRVAWTRAVRLATGDDGAPALEHVDRVEYDYRY
FT                   PGKAPAAPPAHRRRRVPGTPLEPAPVPAPVPVLLPPA"
FT   sig_peptide     119529..119606
FT                   /locus_tag="AnaeK_0103"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.978 at
FT                   residue 26"
FT   gene            120687..123080
FT                   /locus_tag="AnaeK_0104"
FT   CDS_pept        120687..123080
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0104"
FT                   /product="UvrD/REP helicase"
FT                   /note="PFAM: UvrD/REP helicase; KEGG: ade:Adeh_0097
FT                   ATP-dependent DNA helicase, Rep family"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71347"
FT                   /db_xref="GOA:B4UKQ6"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR013986"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="UniProtKB/TrEMBL:B4UKQ6"
FT                   /protein_id="ACG71347.1"
FT                   /translation="MGYLPAPVAEDLLQDLNDAQREAVLHDDGPLLVLAGAGSGKTRVI
FT                   VHRIARLVRDRGVVPWHVLAVTFTNKAAGEMRERLERLLGPLARELWVQTFHAFGARFL
FT                   RREAARAGLSPSFAIYDDDDQLRLVKGLLSELGLDEGEGLTPRQVLSQIDRWKNQALRA
FT                   AEVKVAGLDPETARAKEVYHRYEQALARAGAVDFGDLLLRPVRLLEEDAALRARWAGRF
FT                   RYLLVDEFQDTNPVQYRLLQLLTGPRRNVCVVGDDDQAIYRWRGADVSNILGFDGDFPG
FT                   TKVVKLEQNYRSTRTILDAAHAVISRARRRREKRLWTESGAGAPLALLVGEDEHAEAER
FT                   IARAVAAERGRGTSGDEIAVLYRTNAQSRPLEAAMRAARIPYVIVRGTSFYERAEVRDA
FT                   AAYLRLALSPASDLDLERVVNRPPRGIGGKTVERLRAHAAARGLPLVEAVAERDAVAEL
FT                   KPAARRALAEFHALVTGLAADVPALDAGVAVQEVLKRSGMLSRLEEEHTDEAVERAENL
FT                   AELVAAAREFDESIAGEPPPGDPEEVRPPPLARFLEQIALLGEADAATPEGRVALMTLH
FT                   AAKGLEFEAVFLAGMEDGTLPYERPWADQTSSERDESLDEERRLCYVGMTRAKRRLTIS
FT                   LARRRIGYGENGPSYRNMEPSRFLRDLPPELFGDAVAREVRAREAAQAAPVARPPTIRR
FT                   LPGALEGEPHIELDGDDLPQPPAPAPRARAAAPRGEPTVDYSFDQRGDAGAAAFSRGER
FT                   VAHASLGEGVVLACDAGGADAKATVRFASAGDKRVLARFLRRAF"
FT   gene            123178..124308
FT                   /locus_tag="AnaeK_0105"
FT   CDS_pept        123178..124308
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0105"
FT                   /product="adenosine deaminase"
FT                   /EC_number="3.5.4.4"
FT                   /note="TIGRFAM: adenosine deaminase; PFAM: adenosine/AMP
FT                   deaminase; KEGG: ade:Adeh_0098 adenosine deaminase"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71348"
FT                   /db_xref="GOA:B4ULA1"
FT                   /db_xref="InterPro:IPR001365"
FT                   /db_xref="InterPro:IPR006330"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:B4ULA1"
FT                   /protein_id="ACG71348.1"
FT                   /translation="MAQAAATTLPQVTEALVRDLPKTDLHCHLDGSVRLATVLDLADQQ
FT                   GVRLPAETPEGLAKAIHMGEVCASLEDYLTAFDVTLAVLQTEDALYRTAYELALDAAAE
FT                   NVRYLEVRYSPVLHTRKGLKPTSIVDAVLAGLRAARRETGIESNVIICGIRHIDPMTSV
FT                   RLAELAVAYKGKGVVGFDLAGAEEGHPARRHRDAVQLILDNNVNVTIHAGEAFGPESIA
FT                   QAVHWCGAHRIGHGVRLRENGDLLNYLNDHRIPLEMCPSSNVQTGSVQGFASHPLKFYF
FT                   DFGLRVSVNTDNRLITDTTVTKELLVAHREMGFTLEDLCTVLVQGFKSAFLPFRDKQEL
FT                   LRRVNLEIAQVLARHGAPAPAAGDGAARAAVGAGTP"
FT   gene            124305..124790
FT                   /locus_tag="AnaeK_0106"
FT   CDS_pept        124305..124790
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0106"
FT                   /product="methylated-DNA/protein-cysteine
FT                   methyltransferase"
FT                   /note="TIGRFAM: methylated-DNA/protein-cysteine
FT                   methyltransferase; PFAM: Methylated-DNA-[protein]-cysteine
FT                   S-methyltransferase DNA binding; KEGG: ade:Adeh_0099
FT                   methylated-DNA--protein-cysteine methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71349"
FT                   /db_xref="GOA:B4ULA2"
FT                   /db_xref="InterPro:IPR001497"
FT                   /db_xref="InterPro:IPR014048"
FT                   /db_xref="InterPro:IPR023546"
FT                   /db_xref="InterPro:IPR036217"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036631"
FT                   /db_xref="UniProtKB/TrEMBL:B4ULA2"
FT                   /protein_id="ACG71349.1"
FT                   /translation="MTARLRYRSPVGILTVEASDEGVFGLSFGDRGPSRPGPSARARAH
FT                   LEAAARALDDYFAGRPPSLPPLVLQGSPFQQRVWDALLAIPWGDTRTYGEVAEALGAAG
FT                   GARAVGGANHENPVAILVPCHRVVQARGRLGGYGGGVEVKRWLLAHEAAHGPALRPA"
FT   gene            124938..126179
FT                   /locus_tag="AnaeK_0107"
FT   CDS_pept        124938..126179
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0107"
FT                   /product="glucose-1-phosphate adenylyltransferase"
FT                   /EC_number="2.7.7.27"
FT                   /note="TIGRFAM: glucose-1-phosphate adenylyltransferase;
FT                   PFAM: Nucleotidyl transferase; KEGG: ade:Adeh_0100
FT                   glucose-1-phosphate adenylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71350"
FT                   /db_xref="GOA:B4ULA3"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR005836"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR011831"
FT                   /db_xref="InterPro:IPR023049"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4ULA3"
FT                   /protein_id="ACG71350.1"
FT                   /translation="MAKLLAMILAGGEGRRLDPLTRDRAKPAVPFGGRYRIVDFVLSNM
FT                   ANSGILKMKVVVQYKSESLNTHVQRAWRLTSLLNQYVELVPAQMRVGPKWFEGSADAIY
FT                   QNLNIITDEEPDFTFVFGADHVYRMDARQMLEFHLDRKAELTVAAVPIPVQEASEFGII
FT                   EVDADGRMIGFVEKPQSAPKTIPGDPTRCLASMGNYLFSTDALVQEIVRDAGDPSSAHD
FT                   FGKSIVASMYQRKRVYVYDFARNVVPGQTERERGYWRDVGSIDAYFQANMDLVAVDPVF
FT                   SLYNDEWPIFTVQYNYPPAKFVFNNEHDHRVGRATDSLVSEGCIISGSHVHHSILSPKV
FT                   RVNSYATVDESIVFENVNIGRHCRIRRAIIDKHVDIPAHTTIGYDHEKDRKHFHVTESG
FT                   IVIIPKGMRIEAGR"
FT   gene            complement(126237..126623)
FT                   /locus_tag="AnaeK_0108"
FT   CDS_pept        complement(126237..126623)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0108"
FT                   /product="response regulator receiver protein"
FT                   /note="PFAM: response regulator receiver; KEGG:
FT                   ade:Adeh_0101 response regulator receiver domain protein
FT                   (CheY-like)"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71351"
FT                   /db_xref="GOA:B4ULA4"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:B4ULA4"
FT                   /protein_id="ACG71351.1"
FT                   /translation="MAPEPSPLRILVAEDDPAVARLYTAYAQSRGHTVLVAHDGAEAFS
FT                   AAADQGPDLILLDVAMPKVDGRDALRRLKSDPRTQGIPVLVISAHGSDQNLRELMLQLG
FT                   AWDVMEKPVDLQIAFNKAERLARR"
FT   gene            126762..128138
FT                   /locus_tag="AnaeK_0109"
FT   CDS_pept        126762..128138
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0109"
FT                   /product="peptidase M16 domain protein"
FT                   /note="PFAM: peptidase M16 domain protein; KEGG:
FT                   ade:Adeh_0102 peptidase M16-like"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71352"
FT                   /db_xref="GOA:B4ULA5"
FT                   /db_xref="InterPro:IPR007863"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="InterPro:IPR011765"
FT                   /db_xref="UniProtKB/TrEMBL:B4ULA5"
FT                   /protein_id="ACG71352.1"
FT                   /translation="MIASPLLVAALLTAAPAAAAPPPGDAPEIPYTMFTLGNGLTVILH
FT                   EDHTAPLVGVHVQYDVGSKDERPGRTGFAHLFEHLMFQGSAHLPKGEADRLVDAAGGEA
FT                   NGGTSPDSTVYWEQVPSGALEQMLFIEADRMGWMFPTLTQEKLDNQRDVVRNERRQSYE
FT                   MQPYGLVFEKLLANLWDPEFPYHWQTIGTHEDLEAATLADVKQFFERWYGPENAVLAIA
FT                   GDIDPARTRALVEKWFGPIPGKARPAHQAPAPKPLGAEQRVSMDDRVQLPRLYLAWQTP
FT                   RVFAPGDAALDVLSSVLSDGKSARLVKRLVMDEQIAQGVSAGQMSQALASMYLVVATPK
FT                   PGIPLERLEREIDEELARIAREPPSAEEVQRAKNKIEAGAVFGLEPVGGFGGRAASLAG
FT                   YYVRTGDPGYLAKDLARYRAVTPADVSEAARRFLRKDARVVLTVHPRPAAAGAAAGSAR
FT                   "
FT   sig_peptide     126762..126821
FT                   /locus_tag="AnaeK_0109"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 20"
FT   gene            128135..129697
FT                   /locus_tag="AnaeK_0110"
FT   CDS_pept        128135..129697
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0110"
FT                   /product="peptidase M16 domain protein"
FT                   /note="PFAM: peptidase M16 domain protein; KEGG:
FT                   ade:Adeh_0103 peptidase M16-like"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71353"
FT                   /db_xref="GOA:B4ULA6"
FT                   /db_xref="InterPro:IPR007863"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="InterPro:IPR011765"
FT                   /db_xref="UniProtKB/TrEMBL:B4ULA6"
FT                   /protein_id="ACG71353.1"
FT                   /translation="MTRSLRLLAVLLAAALGCAGSRPAPAPAAPAAAPQPQAAAAPAGA
FT                   DRTQVPAAGEAPELHLPRQQHFALANGLRVRLVEHRRLPIVALNLVVRAGAVNDPAGLP
FT                   GLASFTASMLTEGGTRTRTATRLSDEVGFLGASLGAGAGQDAASLSGSSLSRHLPKLLD
FT                   LFADVAMNPAFRAKDFARVQDQRKVTLLQQRDQPATIAGKAFLKAYWGEGHPYGHYVLG
FT                   DEASVAATRPADLAAFHARFWRPANAELVVVGDVSEGELRPLLERTLGKWPAGTAAAAP
FT                   RAPAPAAPHVTLLLDKPDAPQTLVMLGMPGLARASPDYVAATVAFQVLGGGMSSRLFRT
FT                   LREEKGYTYGMGAGADARRLGGVSIVHGNVKAEVTGAALGDLLGEIRKLREQPVGDAEL
FT                   ADARNALVRSLPADFATVGGIAGRVAELVIHGLPDDYWNGYADAVRHVAPADVQRIAER
FT                   YLDPARATLVLVGTPAAVRPQLEGLAIGKVEVRPVPGAAPVRAPPRSPRVRTQRPRASS
FT                   PAP"
FT   sig_peptide     128135..128233
FT                   /locus_tag="AnaeK_0110"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.806 at
FT                   residue 33"
FT   gene            129768..130697
FT                   /locus_tag="AnaeK_0111"
FT   CDS_pept        129768..130697
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0111"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ade:Adeh_0104 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71354"
FT                   /db_xref="InterPro:IPR038726"
FT                   /db_xref="UniProtKB/TrEMBL:B4ULA7"
FT                   /protein_id="ACG71354.1"
FT                   /translation="MADLQNEFSWSKSRHEKFAECRRAYFYAYYGSWGGWEAAHGTPVR
FT                   ELYVLKKLSSRWQWAGSVVHGALKQMLSAARVSGTFWPAEKLLDRTRRKARAEWASSRD
FT                   KSYWREASRITGLVEHEYGEPVSDADWKRLFDQVVDGGLRGFYASEAFEAIRATPRDRW
FT                   LSVDELDAWDFEGTKIWVAVDFAYRDAEGRVQILDWKTGRERTVDHTQLGIYSLYAQRK
FT                   WGAAPDAVVGGLVYLAAPEDGGAGRVSVAVDPAALSACQDAMRGSIASMRAALADPARN
FT                   VAVEDAFPRPDDRVACRRCPFRRPCGRL"
FT   gene            complement(130694..131188)
FT                   /locus_tag="AnaeK_0112"
FT   CDS_pept        complement(130694..131188)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0112"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   ade:Adeh_0105 acetyltransferase, GNAT family"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71355"
FT                   /db_xref="GOA:B4ULA8"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:B4ULA8"
FT                   /protein_id="ACG71355.1"
FT                   /translation="MRGRRPGAFRVRAARGADAAAVARVMRAAVRGVAAGALAPSLRAA
FT                   WASLPPLYHLWAMSAGGERYLVAERGGRLAGYAAWRGAELTAVFVRPSAGGRGVGAALV
FT                   AAVERQAGKAGVRSLRVLAAAPAIGFYARLGFRPGRAARAPLPGGLALPARWMRKPVAR
FT                   G"
FT   gene            complement(131188..132567)
FT                   /locus_tag="AnaeK_0113"
FT   CDS_pept        complement(131188..132567)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0113"
FT                   /product="two component, sigma54 specific, transcriptional
FT                   regulator, Fis family"
FT                   /note="PFAM: response regulator receiver; sigma-54 factor
FT                   interaction domain-containing protein; helix-turn-helix
FT                   Fis-type; ATPase associated with various cellular
FT                   activities AAA_5; SMART: AAA ATPase; KEGG: ade:Adeh_0106
FT                   two component, sigma54 specific, transcriptional regulator,
FT                   fis family"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71356"
FT                   /db_xref="GOA:B4ULA9"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B4ULA9"
FT                   /protein_id="ACG71356.1"
FT                   /translation="MASAKKPSLMVIDDLDSARQMMKRTLARSYDVYDFASVADAVPAV
FT                   ERADFDCIVTDLRMPGIDGIEGLRRFQAKVPEIPVILVTAFATVETAVEAMKAGAFDYL
FT                   KKPFEPEELELVVARAVEHARVKKENARLRSALAGQFSVHGIVGKSQAMKDLVSMLERI
FT                   APSDVPILIEGESGTGKDLLARAAHALSSRAQGPYVALNMSAIPENLAESELFGHEKGA
FT                   FTGADQPRAGFFAEAEGGTLFLDELGLLPPALQPKLLRVLQDGEFIPVGSRKPRKANVR
FT                   VVAATNEDLQRRVKEGKFREDLWFRLRVVPLRLPPLRERREDIPLLVEHLVQKHALRLS
FT                   RPPLQPDAEAMRALLDHPWPGNIRELEHAIERGLLLARGDAITLADLPPELTPPAEAAG
FT                   GADEGRYRRARDAWERRFLEDVLREAGGQVARAAELSGLHRSTFYEKLARHGLADKDAK
FT                   P"
FT   gene            complement(132570..134066)
FT                   /locus_tag="AnaeK_0114"
FT   CDS_pept        complement(132570..134066)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0114"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase HAMP region domain protein; histidine
FT                   kinase A domain protein; KEGG: ade:Adeh_0107 periplasmic
FT                   sensor signal transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71357"
FT                   /db_xref="GOA:B4ULB0"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B4ULB0"
FT                   /protein_id="ACG71357.1"
FT                   /translation="MTLRLKLFVLIAGVIIFAMSGVTAVALWRELVRGQELLLREGVAL
FT                   ASTTATGASHWVREGGLDPGGPEALPALLERLVSSAPLDRAWIVDSAGKVLACVSRTGE
FT                   PCPEGVPPSEFQAPDWPLQTLSRLVRPEGIVASAPIVRAGAVVGAVRVDFTHEEVVGAA
FT                   RDLAWGAAAVAAFWIVLGHLLAAIFIRQVTQPLVSLASAAESLAEERGVRLEEPEDREL
FT                   VDLVRAFNHMSARLDERRAENQRLIAELEERVAQKTREVLRADRLATLGGIAAGFAHEL
FT                   GNSLNVIRGYAAVTSRELPDDSPHRSDVEAIRREVTRAAALIERFLVFARARTVHPLVQ
FT                   PVEPILREAVEVLGPAAAHAKVERAVEVQPDLPELLADAELLRQAFLNLGVNAVQAMQD
FT                   RGGGKLTVRALREPGGLVVEFQDTGPGIDAEAAAHVFEPFFTTKATGTGLGLAIVRQAA
FT                   EAHGGTVEVAGVPGAGATFRVHLPAAEAGAAADAAAGGAG"
FT   sig_peptide     complement(133992..134066)
FT                   /locus_tag="AnaeK_0114"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.818 at
FT                   residue 25"
FT   gene            complement(134063..134992)
FT                   /locus_tag="AnaeK_0115"
FT   CDS_pept        complement(134063..134992)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0115"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ade:Adeh_0108 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71358"
FT                   /db_xref="GOA:B4ULB1"
FT                   /db_xref="InterPro:IPR011031"
FT                   /db_xref="InterPro:IPR012286"
FT                   /db_xref="InterPro:IPR036280"
FT                   /db_xref="InterPro:IPR038266"
FT                   /db_xref="UniProtKB/TrEMBL:B4ULB1"
FT                   /protein_id="ACG71358.1"
FT                   /translation="MRLSRNAKTILAGLAALALVGLVAGFLRFKEFVDEDPRLCATCHR
FT                   ASPEFALWMGGTHRSVSCQRCHHSTPEQGLAMLRAFLAGQKPKGKHAEVEVGACAQCHF
FT                   SHDPRWPQVGNSRGHRIHYQERGIACVRCHAASMHGFEPVAKKCEECHPKHAVGVEKMA
FT                   ALHCFACHEFLGSEQGLRPTRRDCMRCHTAQGIHAPMNEHGAPHGAPMEMSCSACHRPH
FT                   RPAGQTLAACAECHGSDAMARGGLHANRGHRTCLECHKPHTWTAEQADCLRCHPSGKAH
FT                   AEGTACTTCHAFVGAPLPTFPTEEGGAR"
FT   sig_peptide     complement(134891..134992)
FT                   /locus_tag="AnaeK_0115"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.992) with cleavage site probability 0.246 at
FT                   residue 34"
FT   gene            complement(135109..136809)
FT                   /locus_tag="AnaeK_0116"
FT   CDS_pept        complement(135109..136809)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0116"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ade:Adeh_0109 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71359"
FT                   /db_xref="GOA:B4ULB2"
FT                   /db_xref="InterPro:IPR011031"
FT                   /db_xref="InterPro:IPR036280"
FT                   /db_xref="UniProtKB/TrEMBL:B4ULB2"
FT                   /protein_id="ACG71359.1"
FT                   /translation="MRATLLAIALLLSTAARAEEAKPAPALPADAESCLMCHDKGGGAP
FT                   EVDFKAFPGSVHGQNEVGCTDCHAGYKEGPHEGELPALSAAEQATVARLAKGAWGEGEA
FT                   KHGVTAPRAYLACQNCHTTEAEAFAKSVHGKWLAGDTKAPGATCASCHGSPHAIPAKLA
FT                   EYAPKDGKRVPVPADRREMTKRCEACHGNEAFAEAAGLDPEAVITYHDSIHGRLTRVGN
FT                   AAAPTCVSCHAAAKDAGGTHAILAKTDPASTVSAANKKQACARCHAGATDTFAGLVAHK
FT                   PLHETGGSVIPHIVHVAFSWLTTLTLLFFAFHVLVDFIYELRSRLAKKAGHGPSADAVR
FT                   SVIRFDLHQRIQHWFMLSGVILLGITGWPLRGAGDAEAATYSRAFMKVFGGAEGAATWH
FT                   RVGAVLIIISAAYHLFYLTFLASKKRLPLSMLPVPKDALDMRDNILFMMGVKKERPKFD
FT                   RYMYLEKFDYWAVFWGIVMMVGTGFIFWFPVWFASWAPGWLITAAQIIHGEEATLAILF
FT                   LFTVHFYNVHLKPSIFPMNWAWLNGRISIEAMKHEHPLEYDRLKDEQNG"
FT   sig_peptide     complement(136753..136809)
FT                   /locus_tag="AnaeK_0116"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.994 at
FT                   residue 19"
FT   gene            complement(137062..137370)
FT                   /locus_tag="AnaeK_0117"
FT   CDS_pept        complement(137062..137370)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0117"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ade:Adeh_0110 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71360"
FT                   /db_xref="GOA:B4ULB3"
FT                   /db_xref="UniProtKB/TrEMBL:B4ULB3"
FT                   /protein_id="ACG71360.1"
FT                   /translation="MAQNKLPSLIGAGIGLALFLAVALLPALLYGGYAGLLLAGGIVGT
FT                   PVQPTLIVRGLIVFGMGLGVVGVASLFAVAGAAAGAAVGAILSIAGRRPVAEEQASR"
FT   sig_peptide     complement(137251..137370)
FT                   /locus_tag="AnaeK_0117"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.981) with cleavage site probability 0.531 at
FT                   residue 40"
FT   gene            complement(137587..139332)
FT                   /locus_tag="AnaeK_0118"
FT   CDS_pept        complement(137587..139332)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0118"
FT                   /product="peptidase M14 carboxypeptidase A"
FT                   /note="PFAM: peptidase M14 carboxypeptidase A; KEGG:
FT                   ade:Adeh_0111 peptidase M14, carboxypeptidase A"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71361"
FT                   /db_xref="GOA:B4ULB4"
FT                   /db_xref="InterPro:IPR000834"
FT                   /db_xref="UniProtKB/TrEMBL:B4ULB4"
FT                   /protein_id="ACG71361.1"
FT                   /translation="MLAPILAPLLALQLSAGPDLTTTAERTGFRETGRYDEAVRLCRGL
FT                   AAAYPARARCLTFGETPEGRPLVALVASAGGGLDARAARAARRPVVLLQGGIHAAEIDG
FT                   KDAGFLVLRELLASRDGGPLAKVTAVFVPVLNADGHERFGPNHRPNQRGPEASGWRTTA
FT                   QNLNLNRDYVAAQAPETQAVLRLMDAWDPIALGDLHVTDGAQFQHDLAVMVEPRQGYSP
FT                   AMREEGAALSAALVERLAAAGHLPLDFYPSLREYGDPASGFAPYPAPIRFGHGYWAARN
FT                   RFGILLETHSWRPYPHRVKATAHFVRALLDLAAERGGRWRAAADRADREGAAARGREVE
FT                   LGWAPGSRTRPLAFQGYAYVREDSPVLGKKVPRYDETRPEVWNVPVVDERVVTARARVP
FT                   MGGWIVPAAHAGWVAGKLRLHGIAFERMASRRAAAQVEAFRATAVEVKAQSFEGRHQTA
FT                   LTGAWAPEARDLAAGWLWIPSAQPLAPLAAMLLDPAGPDAFVAWGAFATAFEKKEYIED
FT                   YVLEPWARALLARDPAVKAEFERRLADPAFAKDPAARLDFFWRRHPAHDEAYRLYPVLR
FT                   ADRRP"
FT   gene            complement(139427..140461)
FT                   /locus_tag="AnaeK_0119"
FT   CDS_pept        complement(139427..140461)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0119"
FT                   /product="cell shape determining protein, MreB/Mrl family"
FT                   /note="TIGRFAM: cell shape determining protein, MreB/Mrl
FT                   family; PFAM: cell shape determining protein MreB/Mrl;
FT                   KEGG: ade:Adeh_0112 rod shape-determining protein MreB"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71362"
FT                   /db_xref="GOA:B4ULB5"
FT                   /db_xref="InterPro:IPR004753"
FT                   /db_xref="UniProtKB/TrEMBL:B4ULB5"
FT                   /protein_id="ACG71362.1"
FT                   /translation="MLNFVHNILSRDLAIDLGTANTLIYIRGMGIVSNEPSVVAVQADG
FT                   RGSRRVLAVGKEAKEMLGRTPGNIVAIRPMKDGVIADFEVTAAMLKHFIQTAHNRKSFV
FT                   KPRIIIGIPSGITEVEKRAVREAAESAGAREVYLIEQPMAAAIGAGLPITEPSGNMIVD
FT                   IGGGTSDVAVISLGGIVYSRSVRVAGDKMDEAIIQHVKRKYNLLIGERTAELIKMGIGT
FT                   AYPTEEELTMDIKGRDLVAGVPRTLTVTSSEIREALAEPINGVVEAVKVTLERTPPELA
FT                   GDIADRGIVLAGGGALLKNLDVLLREETGLPVFLAEDPLSAVVIGAGKALEELDILRQV
FT                   TAQG"
FT   gene            complement(140594..141628)
FT                   /locus_tag="AnaeK_0120"
FT   CDS_pept        complement(140594..141628)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0120"
FT                   /product="cell shape determining protein, MreB/Mrl family"
FT                   /note="TIGRFAM: cell shape determining protein, MreB/Mrl
FT                   family; PFAM: cell shape determining protein MreB/Mrl;
FT                   KEGG: ade:Adeh_0113 rod shape-determining protein MreB"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71363"
FT                   /db_xref="GOA:B4ULB6"
FT                   /db_xref="InterPro:IPR004753"
FT                   /db_xref="UniProtKB/TrEMBL:B4ULB6"
FT                   /protein_id="ACG71363.1"
FT                   /translation="MLDWLHNMMSRDLAIDLGTANTLIYIRGMGIVSNEPSVVAVQQES
FT                   RSGRKVLAVGKEAKEMLGRTPGNIVAIRPMKDGVIADFEVTAAMLKYFIQAAHNRKSFV
FT                   KPRIIIGIPSGITEVEKRAVREAAESAGAREVYLIEQPMAAAIGAGLPITEPSGNMIVD
FT                   IGGGTSDVAVISLGGIVYSRSVRVAGDKMDEAIIQHVKRKYNLLIGERTAELIKMGIGT
FT                   AYPTEEELTMDIKGRDLVAGVPRTLTVTSSEIREALAEPINGVVEAVKVTLERTPPELA
FT                   GDIADRGIVLAGGGALLKNLDVLLREETGLPVFLAEDPLSAVVIGAGKALEELDILRQV
FT                   TAQG"
FT   gene            complement(141679..143703)
FT                   /locus_tag="AnaeK_0121"
FT   CDS_pept        complement(141679..143703)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0121"
FT                   /product="peptidase S9 prolyl oligopeptidase active site
FT                   domain protein"
FT                   /note="PFAM: peptidase S9 prolyl oligopeptidase active site
FT                   domain protein; peptidase S9B dipeptidylpeptidase IV domain
FT                   protein; WD40 domain protein beta Propeller; KEGG:
FT                   ade:Adeh_0114 peptidase S9, prolyl oligopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71364"
FT                   /db_xref="GOA:B4ULB7"
FT                   /db_xref="InterPro:IPR001375"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR011659"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B4ULB7"
FT                   /protein_id="ACG71364.1"
FT                   /translation="MLTAALVALALASVPRPFTVDDLLALERAGDASLSPDGASVAYTV
FT                   ATSSPGGEKLVSALHLVPAAGGAARRLTFAEERVTAPAFSPDGRRLAFLSNRKGGTQAW
FT                   VLDLQGGEARRVTDLPGGVSELRFTPDGAALLVASDVDPACGADAACNRKADAAAEVRP
FT                   HLADRLLFRHWNEWRERVRTHLLRVPLDGGPAVDLTPGDRDAPPVQRGSGDDLAFSPDG
FT                   KTLYYVAVSDPVEATSTNGDVYAVPLAGGTPRRVTTAPGWDGSPRPSPDGKRLAWLAQP
FT                   RAGYEADRFHVMVAAADGSGARDLTAGFDRSAADLEWARGGKALRFTAESEGVHAVYEV
FT                   DLAGKVTELYRGRNLARVSWSRDGARLAALVDGLAAPPEVAVLEPGARGAQPRLLTGFG
FT                   AKGLAGVALGEVRPLAATGKDGQALHGWMVLPPGHRDGERHPAVVLVHGGPQGAWNDAW
FT                   SFRWNPMLYAARGWTVVLPNPRGSTGFGQAYTDAVRGNWGGTPYDDIMRLTDAAVATGA
FT                   ADGGRMCAAGASYGGYMVNWINGQTDRFRCLVAHAGNFDLRMAYYDTEELWFPEWELGR
FT                   PWEAPEAFERWSPSAFVERWRTPTLISHGEKDFRVTVTQGFAAFTALQRRGVPSRLMVF
FT                   PDEGHWVLKPRNAKVFHDEVLGWIGRWLESPAPQASAPR"
FT   sig_peptide     complement(143644..143703)
FT                   /locus_tag="AnaeK_0121"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.734) with cleavage site probability 0.732 at
FT                   residue 20"
FT   gene            143799..145577
FT                   /locus_tag="AnaeK_0122"
FT   CDS_pept        143799..145577
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0122"
FT                   /product="serine/threonine protein kinase"
FT                   /note="PFAM: Serine/threonine protein kinase-related;
FT                   SMART: tyrosine protein kinase; serine/threonine protein
FT                   kinase; KEGG: ade:Adeh_0115 serine/threonine protein
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71365"
FT                   /db_xref="GOA:B4ULB8"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:B4ULB8"
FT                   /protein_id="ACG71365.1"
FT                   /translation="MPGPLAIPDLRAPCPGCGHLAEPGGAGPANFCPRCGLDLRATARR
FT                   APPPDPLVGRVIADRYRLVSLLGEGGMGAVYRAEHVQMGKALAVKVLRGDFARDPSAGE
FT                   RFRAEARIVSRLSHPHTIAVFDFGELPERGFYLAMEYVPGQDLARALRDGGAFSEARAV
FT                   GIAQQVLGSLAEAHEAGVVHRDMKPANVMLMQARPGEDFAKVLDFGIAKLRDEAGGGAT
FT                   TGAGAVVGTPSCLAPEQARGGPVDARADLYAMGCLLYELVSGRPPFTAASPVAVITAHL
FT                   HDPPPPLQQVAPGVSRRLAEVVHRALRKDPAERFPSADAMRAALSGPGRPARPARRPAP
FT                   APAAGELELASREDFRDGLEQGALERQVGVLRPPRLVTPARAALAIAAALAAGAAWRWD
FT                   DLYAALAAAAPAIAAQVPAALRPDAAAWVEREPNDGAGEATPLPLLPRADGVPAGEVRG
FT                   AIGAPRRPDEGDLDVYRLVVPDGAGRRVLRARWHAAGAAPDQGIAGLAVTLSLNRAPAG
FT                   AERAPLVAAAGEGGPGAAEALSAEVDPGTYWLSVRERHAAGAAPAARPEAPYALEVELA
FT                   PLAPGGAAGEGDEPRK"
FT   gene            complement(145629..146078)
FT                   /locus_tag="AnaeK_0123"
FT   CDS_pept        complement(145629..146078)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0123"
FT                   /product="ribosomal protein L9"
FT                   /note="PFAM: ribosomal protein L9; KEGG: ade:Adeh_0116 LSU
FT                   ribosomal protein L9P"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71366"
FT                   /db_xref="GOA:B4ULB9"
FT                   /db_xref="InterPro:IPR000244"
FT                   /db_xref="InterPro:IPR009027"
FT                   /db_xref="InterPro:IPR020069"
FT                   /db_xref="InterPro:IPR020070"
FT                   /db_xref="InterPro:IPR020594"
FT                   /db_xref="InterPro:IPR036791"
FT                   /db_xref="InterPro:IPR036935"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4ULB9"
FT                   /protein_id="ACG71366.1"
FT                   /translation="MKLILREDVENLGKGGDLVDVKPGYGRNFLLPRGLAVTANPKNVK
FT                   ELEHQKAVAAAKAAKLKASAQAVAKRLSETPVTLKRKVGEQDKLYGSVTALDVAEALAA
FT                   RGVQLDRRSIVLDEPIKTVGEFEVPVKLHSEVAGKVKVTVEAEAE"
FT   gene            complement(146091..146498)
FT                   /locus_tag="AnaeK_0124"
FT   CDS_pept        complement(146091..146498)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0124"
FT                   /product="ribosomal protein S18"
FT                   /note="PFAM: ribosomal protein S18; KEGG: ade:Adeh_0117 SSU
FT                   ribosomal protein S18P"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71367"
FT                   /db_xref="GOA:B4ULC0"
FT                   /db_xref="InterPro:IPR001648"
FT                   /db_xref="InterPro:IPR036870"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4ULC0"
FT                   /protein_id="ACG71367.1"
FT                   /translation="MARPDMGGPKTGGFGGPRSGGFGGGGGGGGGFGGGGFGGGRGGDR
FT                   GDRGDRDDRGGDEGGGRRGFGRRKVCRFCADKALKVDYKDQGQMKYFLTERGKIIPRRI
FT                   SGNCAKHQREVATAIKRGRMLAILPYTVGQM"
FT   gene            complement(146501..146947)
FT                   /locus_tag="AnaeK_0125"
FT   CDS_pept        complement(146501..146947)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0125"
FT                   /product="ribosomal protein S6"
FT                   /note="PFAM: ribosomal protein S6; KEGG: ade:Adeh_0118 SSU
FT                   ribosomal protein S6P"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71368"
FT                   /db_xref="GOA:B4ULC1"
FT                   /db_xref="InterPro:IPR000529"
FT                   /db_xref="InterPro:IPR014717"
FT                   /db_xref="InterPro:IPR020814"
FT                   /db_xref="InterPro:IPR035980"
FT                   /db_xref="UniProtKB/TrEMBL:B4ULC1"
FT                   /protein_id="ACG71368.1"
FT                   /translation="MAETKQLVREYETIYLLKAETPDEQVDEIKERLRGVVSRQGGKVI
FT                   RFTNQGKRKTAFPVAKNAKALYMHCLYVGKPGLVTELERNLKMIDVVTKFQSVKLADGV
FT                   DFDARQVEADVKVQAVEDEQKPREERPEGGEEPFEAEAPEGQEE"
FT   gene            complement(147054..147632)
FT                   /locus_tag="AnaeK_0126"
FT   CDS_pept        complement(147054..147632)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0126"
FT                   /product="Aminoacyl-tRNA hydrolase"
FT                   /EC_number="3.1.1.29"
FT                   /note="PFAM: peptidyl-tRNA hydrolase; KEGG: ade:Adeh_0119
FT                   peptidyl-tRNA hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71369"
FT                   /db_xref="GOA:B4ULC2"
FT                   /db_xref="InterPro:IPR001328"
FT                   /db_xref="InterPro:IPR018171"
FT                   /db_xref="InterPro:IPR036416"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4ULC2"
FT                   /protein_id="ACG71369.1"
FT                   /translation="MKLVVGLGNPGEEYARTRHNVGFVVADRLAQLAGASFSAKKFAAE
FT                   LAEARLGPERVWIMKPQTYMNHSGEAVGAALRFWKLGLDDLVVVHDDLELDPYRVQLKV
FT                   GGGHGGHNGVKSVNAHVGSPEYARVRVGVGRPPPRMDPADYVLGKFAKGEDAELDLCVE
FT                   QAVEATRLAVELGAARAMNQVNRRSRAAE"
FT   gene            complement(147642..148364)
FT                   /locus_tag="AnaeK_0127"
FT   CDS_pept        complement(147642..148364)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0127"
FT                   /product="ribosomal 5S rRNA E-loop binding protein
FT                   Ctc/L25/TL5"
FT                   /note="TIGRFAM: ribosomal 5S rRNA E-loop binding protein
FT                   Ctc/L25/TL5; PFAM: ribosomal protein L25; KEGG:
FT                   ade:Adeh_0120 50S ribosomal protein L25/general stress
FT                   protein Ctc"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71370"
FT                   /db_xref="GOA:B4ULC3"
FT                   /db_xref="InterPro:IPR001021"
FT                   /db_xref="InterPro:IPR011035"
FT                   /db_xref="InterPro:IPR020056"
FT                   /db_xref="InterPro:IPR020057"
FT                   /db_xref="InterPro:IPR029751"
FT                   /db_xref="InterPro:IPR037121"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4ULC3"
FT                   /protein_id="ACG71370.1"
FT                   /translation="MAENVLSAQKRTEQGKGPARRLRQQGLIPAVVYGGKREPTHVALD
FT                   PATLLKAIETPHKFNTLLELQVDGASKHVLFKDYTVDPVTRKLLHADFLEVSLDQPVRV
FT                   EVPVATVGRAAGVAEGGILSVATHEVVVEALPNKIPVRIEVDVTELKIGRSLHVSELKP
FT                   PEGCKFKFQTDYVVVFVAVPEKEEVAAPVAAAVPGAAPAEGAAPAAGAAAPAGGAAPAA
FT                   GAAPAKGGEAKGGDKAKK"
FT   gene            complement(148624..149589)
FT                   /locus_tag="AnaeK_0128"
FT   CDS_pept        complement(148624..149589)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0128"
FT                   /product="ribose-phosphate pyrophosphokinase"
FT                   /EC_number="2.7.6.1"
FT                   /note="TIGRFAM: ribose-phosphate pyrophosphokinase; PFAM:
FT                   phosphoribosyltransferase; KEGG: ade:Adeh_0121
FT                   ribose-phosphate pyrophosphokinase"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71371"
FT                   /db_xref="GOA:B4ULC4"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR000842"
FT                   /db_xref="InterPro:IPR005946"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR029099"
FT                   /db_xref="InterPro:IPR037515"
FT                   /db_xref="UniProtKB/TrEMBL:B4ULC4"
FT                   /protein_id="ACG71371.1"
FT                   /translation="MASNGHYPDYRVFCGNANRPLAEAIAKELGRPLARATVGRFSDGE
FT                   IQVEIGENVRGLDTFIIQSTSPDANTNLMELLIMIDALKRASAGSINAVLPYYGYARQD
FT                   RKVAPRVPITAKLIADLIEAAGATRVVSMDMHAGQIQGFFNVPFDHLYAAPVLLEHMRK
FT                   RFDGSAHDLVIVSPDAGGVERARAYSKRLGAGLGIVDKRRTKPNVAEIMNVIGDVNGKV
FT                   AVLLDDMIDTAGTLTQAANALVDKGATRVFAYATHAVLSGPAVDRIMKSPIEEVVVTDS
FT                   IQLAPPAAACPKIRTLSVAGLLAEAIRRIHSADSLSSLFV"
FT   gene            complement(149737..150042)
FT                   /locus_tag="AnaeK_0129"
FT   CDS_pept        complement(149737..150042)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0129"
FT                   /product="SpoVG family protein"
FT                   /note="PFAM: SpoVG family protein; KEGG: ade:Adeh_0122
FT                   regulatory protein SpoVG"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71372"
FT                   /db_xref="GOA:B4ULC5"
FT                   /db_xref="InterPro:IPR007170"
FT                   /db_xref="InterPro:IPR036751"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4ULC5"
FT                   /protein_id="ACG71372.1"
FT                   /translation="MEITEVRVFPVNEEKLKAYVTITLDHCFVIRDLKVIHGNTGLFIA
FT                   MPAKRRKDGTFKDIAHPLNSDTREKMERTILAEYDRELKKGGAAPARATGTDPHED"
FT   gene            complement(149982..150923)
FT                   /locus_tag="AnaeK_0130"
FT   CDS_pept        complement(149982..150923)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0130"
FT                   /product="4-diphosphocytidyl-2C-methyl-D-erythritol kinase"
FT                   /EC_number="2.7.1.148"
FT                   /note="TIGRFAM: 4-diphosphocytidyl-2C-methyl-D-erythritol
FT                   kinase; PFAM: GHMP kinase; GHMP kinase domain protein;
FT                   KEGG: ade:Adeh_0123
FT                   4-diphosphocytidyl-2-C-methyl-D-erythritol kinase"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71373"
FT                   /db_xref="GOA:B4ULC6"
FT                   /db_xref="InterPro:IPR004424"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4ULC6"
FT                   /protein_id="ACG71373.1"
FT                   /translation="MRLVTLAPAKVNLVLRVGPVRADGYHDLRTLMVPLDLGDRVDVRV
FT                   SARPGPVRCTVPGRPELDGPENLAARAAEAFRRRFGVDRAVSIRIEKRTPVTAGLGGGS
FT                   SDAAAVLRCLARALRVRDGAALAALALEIGSDVPFFLGPGPAWAAGRGERLSRAEVPPL
FT                   DLVLVYPADPSLAIRAGDAYRWLDEARASGSQAPRRLGRPGRWRPTLLGNDLQAPCVAR
FT                   KPALQALLGLLVGAGATAAIMSGSGPTVFGIFPGRGAARGAALAIQGRAKGGAAGVQVL
FT                   LARTVRRHPRVSPWRSPRSASSRSTRRSSRPT"
FT   gene            151073..151426
FT                   /locus_tag="AnaeK_0131"
FT   CDS_pept        151073..151426
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0131"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ade:Adeh_0124 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71374"
FT                   /db_xref="InterPro:IPR003646"
FT                   /db_xref="UniProtKB/TrEMBL:B4ULC7"
FT                   /protein_id="ACG71374.1"
FT                   /translation="MNPTFVRAAACAALLAAAGCRSAFAPEPVLKLSSAPAAEHPATVV
FT                   QAAELRSGPDGLAKVLGTVAAGTTVTASDKPIRGFLRVRTADGKSGYVPQAAVSATAAA
FT                   SAPASAPTGAAAP"
FT   sig_peptide     151073..151144
FT                   /locus_tag="AnaeK_0131"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.914 at
FT                   residue 24"
FT   gene            151588..151935
FT                   /locus_tag="AnaeK_0132"
FT   CDS_pept        151588..151935
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0132"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ade:Adeh_0125 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71375"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR028096"
FT                   /db_xref="UniProtKB/TrEMBL:B4ULC8"
FT                   /protein_id="ACG71375.1"
FT                   /translation="MSRTAILPLAALAAVLALAPACKGDDAKEQVVKITVTKNGYEPWR
FT                   IEAKAGRPLTLVMTRVTDQTCATEIVIPDLGMNVPLPLNETVMVRVVPQKTGELRFSCG
FT                   MKMFQGVIDVR"
FT   sig_peptide     151588..151662
FT                   /locus_tag="AnaeK_0132"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.709 at
FT                   residue 25"
FT   gene            152028..152843
FT                   /locus_tag="AnaeK_0133"
FT   CDS_pept        152028..152843
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0133"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ade:Adeh_0126 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71376"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:B4ULC9"
FT                   /protein_id="ACG71376.1"
FT                   /translation="MRDLSYDHVPYRMSEIEHRYGENVHIVANPFLLGALATLCSKETR
FT                   QPAINRLVRLLYEDLIRTVMNHEFPRRRVAVPTRMIDSSPQAIFEGEVVDRQVRAVTVN
FT                   IARAGAVPSQLVYDLLNETLEPSLVRQDHIIMSRMLGENEEVVGAGIGGMKIGGDVDDA
FT                   FLLFPDPMGATGSSLATAIETYKKKVPGKARRIVNIHLIVTPEYLRNMTKAHPDVRIYA
FT                   IRLDRGLSPPDVLATVPGTRWDEERGLDDHQYIVPGGGGFGEIMNNAYV"
FT   gene            152836..153363
FT                   /locus_tag="AnaeK_0134"
FT   CDS_pept        152836..153363
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0134"
FT                   /product="hypoxanthine phosphoribosyltransferase"
FT                   /EC_number="2.4.2.8"
FT                   /note="TIGRFAM: hypoxanthine phosphoribosyltransferase;
FT                   PFAM: phosphoribosyltransferase; KEGG: ade:Adeh_0127
FT                   hypoxanthine phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71377"
FT                   /db_xref="GOA:B4ULD0"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005904"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:B4ULD0"
FT                   /protein_id="ACG71377.1"
FT                   /translation="MSSSRAGLDVLISEADLRARVAQMGADITRDYAGKNLVVIGVLKG
FT                   SFIFLADLVRAVDLPLSVDFIGISSYQGTRTTGVVQITSDLTRPIDGKDVLLVEDIIDT
FT                   GLTMRYLLENLSTRKPASVRIAALLEKPARAQVKIPIDYRGFVIGDEFVVGYGLDWDGK
FT                   MRNLPFIGVPRT"
FT   gene            153431..154237
FT                   /locus_tag="AnaeK_0135"
FT   CDS_pept        153431..154237
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0135"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ade:Adeh_0128 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71378"
FT                   /db_xref="GOA:B4ULD1"
FT                   /db_xref="UniProtKB/TrEMBL:B4ULD1"
FT                   /protein_id="ACG71378.1"
FT                   /translation="MADETTRARAGSGAKALLAWVAILGLAGVVAWLASERNARTWYLV
FT                   PDEGRLVVMKGLMLPMGRQAFSTDDPALAAAYAPLVPPPGKPLPAERAFEERSLLDQGL
FT                   FDLLAGWAREEVATGDPARLERGLGYLGRAERLAGISSAQRDELGAIRAESGYHEARRL
FT                   LERAAAELRDAAEKLRVTAGSRSSRAMDAQLLLKQLEPAVDATLGAIRTAARSEPAAAE
FT                   KGAGPPPAAGEPAPAAAPEPGQAPAAQPSAAPAAPAGQPPPPGDGR"
FT   gene            154327..157170
FT                   /locus_tag="AnaeK_0136"
FT   CDS_pept        154327..157170
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0136"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: Methyltransferase type 11; KEGG: ade:Adeh_0129
FT                   methyltransferase type 11"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71379"
FT                   /db_xref="GOA:B4ULD2"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B4ULD2"
FT                   /protein_id="ACG71379.1"
FT                   /translation="MASFHARNGTGELLARYAFVEPLLEGRRILEIGAAAATEGATAAF
FT                   LAERGAAEVLSIEEDGAALAAAVRGPHEPYVQFRAARPEDLPAGAFDVVLLADGAALAA
FT                   EPARAAALARLLAPGGRLVTAVDAGGPGLAELAGEPRRAAPPAYEAFVGALLGRFPQVE
FT                   VAAQSATLGWVFGMGGGGDAEPELAMDGSLAGTAETAAYVAVCGDAPCGLSGFTLVALP
FT                   AGPLLEEGAAGAASAAARGLAADALRERAEALAARDLALGERDAAAEAREQFRAERDAA
FT                   AADALDAARARDRVLADAAADRDRAACAEQAAAAAAEARDEALAARDGLARELEALRAG
FT                   VDDLRRSRQAVEAEVDRLRAGAELSAARARELEATLDAERGGAADARAELERAEVVIAE
FT                   RTHELAEARAALATQAAAVAQADEARARADAALAERREAAAEAVAALQAARSEAQAAKA
FT                   ALEAALERASVGEARLPELEEAVEARAHEAAEAQAALREARDRIAALEAEAERGRETLA
FT                   EARAAEEVARLDAGSARAEADRALVDAEAAREEAARRAAELRTLDAARAQVAAEAETLR
FT                   AEADAARARAERLAGEAEAARARAAELEGADAARDAEQREAAEARAEALAARAGEVEKL
FT                   TAELAGASAAAGEAAALREALEARVAELEARLESEAERARLVEARAAEALARLESLEEA
FT                   GAAREAEQAAAVRAVTARAEAAEAAAREAEARAAAAEARPAAPAPDAGLEAELAAARSA
FT                   ADVAGAQAAELEAELQAVRWEKDEIEQRLQSLTASGALGGAGEVSRLRDELAARAGDGA
FT                   LLRKEIQRLEAQVAELTARPLAAPAPAEEAEAVRRAAAHAAELEERLAEALRRAADAEA
FT                   AAEAARAAPAPIPAVAAGEALKRVAQEKDAIAAQVAERDQKIARLQREVADKTERLGRL
FT                   AKEMGELKARGFGKIFR"
FT   gene            157183..157719
FT                   /locus_tag="AnaeK_0137"
FT   CDS_pept        157183..157719
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0137"
FT                   /product="type IV pilus assembly PilZ"
FT                   /note="PFAM: type IV pilus assembly PilZ; KEGG:
FT                   ade:Adeh_0130 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71380"
FT                   /db_xref="GOA:B4ULD3"
FT                   /db_xref="InterPro:IPR009875"
FT                   /db_xref="UniProtKB/TrEMBL:B4ULD3"
FT                   /protein_id="ACG71380.1"
FT                   /translation="MTEPRRYERIDVELPCRLYVPGERGLKFEAHCTSRNLGLGGVFLS
FT                   SSFLLREGLELFVELGLPGGPLAIRARVAHTVPGDHPELEGGFGVEFLDVDAAGRETLL
FT                   RYFTPLRYHEFYRAFAGEFPHLRDRVPVADVALLLNLWEEWKAVGEGGPAFTASGAPPA
FT                   PARAGAGPARRGRRS"
FT   gene            157972..160152
FT                   /locus_tag="AnaeK_0138"
FT   CDS_pept        157972..160152
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0138"
FT                   /product="glycoside hydrolase family 57"
FT                   /note="PFAM: glycoside hydrolase family 57; KEGG:
FT                   ade:Adeh_0131 glycoside hydrolase, family 57"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71381"
FT                   /db_xref="GOA:B4ULD4"
FT                   /db_xref="InterPro:IPR004300"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:B4ULD4"
FT                   /protein_id="ACG71381.1"
FT                   /translation="MTPVRLAFLWHMHQPPYREPETGAYLMPWVRLHATRAYHDMAWML
FT                   ERHPGVRCTVNFTPVLLEQLEDYAQGTAQDRLLELSARPPADLGAEDRQQILRSFFMVG
FT                   WETNVKPLPRYWELLQKRGRELRGVDLARLAQSFGDQELQDLQALFNLAWMGFAAQADE
FT                   PAVRALREKGRGYTRADVDALLEVQRRIAAGVVPRWRALQDRGQVELSTTPYYHPILPL
FT                   LCDTDAAHRALPGIPLPPRFAHPEDARWHVREAIASHARRFGRPPAGMWPAEGSVSPEA
FT                   LEILASEGVGWAASDEGVLLQSLPAAAPRLRSVYRPWRVAAGAGREVRMLFRDRALSDV
FT                   IGFTYAKVPARDAVADFTAHVRAVADAWARDGQPGAPTLGVFLDGENAWEHYPSSGHEF
FT                   LDRLYDALERSDRVQTVTLSEATAAAEGPPIARVHTGSWIEASFRIWIGHREDREAWAA
FT                   LGRVRDALAQAEERGEVPAERLALARQHLYAAEASDWYWWYGEDFTTEQAAEFDALFRA
FT                   HVNRAALLCGVDPPPETQAPIKRAGAPAPGALEAKPLREPVMLLTPTLDGRETTYFEWQ
FT                   GAGLYRPGQHRGSMYGGAQAFHVLRFGFDLAALYLRLDPAESAARAAEVATHVRVSVRS
FT                   RDGQRWVDFPLEPDGAPRPGAWRGKALGRLAFAQVAELELPFAALGLAPGDRVDLAVHA
FT                   LRGEVEVERLPRYGYLTLTVPDQDFERIHWRV"
FT   gene            160201..161070
FT                   /locus_tag="AnaeK_0139"
FT   CDS_pept        160201..161070
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0139"
FT                   /product="diguanylate cyclase"
FT                   /note="TIGRFAM: diguanylate cyclase; PFAM: GGDEF domain
FT                   containing protein; Forkhead-associated protein; KEGG:
FT                   ade:Adeh_0132 diguanylate cyclase (GGDEF domain)"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71382"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:B4ULD5"
FT                   /protein_id="ACG71382.1"
FT                   /translation="MGDDPTRVRTPEERAAAAAGHCLVFVAGDGALGLRVPLDGEVVLG
FT                   RDPSCAVALPASDVSRRHARVVPDGDGHLVLDLGSTNGTWVNGREVAVHRLAPGDRVQV
FT                   GAFVARYLRAGDAEESELAALADLALRDPLTGLPNRRAFEESLRREVARARRGGDRLAV
FT                   AVLDVDRFKDVNDRHGHAAGDVALAEVARRAAAALRAGDLLARIGGEELAAILPGADVA
FT                   AAAEVAERVRCAVGKEPVQAGGQAIRVTVSLGCAELAPEDAEGADLFARADAQLYRAKH
FT                   AGRDRVEF"
FT   gene            161201..162397
FT                   /locus_tag="AnaeK_0140"
FT   CDS_pept        161201..162397
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0140"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   ade:Adeh_0133 major facilitator superfamily MFS_1
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71383"
FT                   /db_xref="GOA:B4ULD6"
FT                   /db_xref="InterPro:IPR001958"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B4ULD6"
FT                   /protein_id="ACG71383.1"
FT                   /translation="MKNRSALAILFVIVFIDLLGFGMVIPVMALYAERLGAPDAQIGWL
FT                   MTGYSAMQFVFTPIWGRLSDRHGRRPLLLLSIVMTAVGFLGYALAPSFAWLLVSRLFAG
FT                   AATANIAIAQAYIADVTPPEGRARGMGLIGAAFGLGFVLGPAIGGLLSAISLSAPGYAA
FT                   AALAAANGVAAFFVLPEPAAHVQAERRPHLEALLGGVSRPGIRRLILIYFIAILAFSGM
FT                   EATFALLAVHRYGLDQRQVSYVFALIGVVATVVQGGLIGPLSRRFGERALLVAGLLLQA
FT                   VALAALPYAGSVAGLLVATVPLAFGSSLTTPSLTSLISRSARAEDQGGTLGIGQSAAAL
FT                   GRIAGPISATHAYSQLWFAAPYLGGAALMLAGAAVGSTLRRPPRHEPVEPGAAPAEEG"
FT   sig_peptide     161201..161290
FT                   /locus_tag="AnaeK_0140"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.740) with cleavage site probability 0.540 at
FT                   residue 30"
FT   gene            162404..163405
FT                   /locus_tag="AnaeK_0141"
FT   CDS_pept        162404..163405
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0141"
FT                   /product="galactose-1-phosphate uridylyltransferase"
FT                   /EC_number="2.7.7.12"
FT                   /note="TIGRFAM: galactose-1-phosphate uridylyltransferase;
FT                   KEGG: ade:Adeh_0134 galactose-1-phosphate
FT                   uridylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71384"
FT                   /db_xref="GOA:B4ULD7"
FT                   /db_xref="InterPro:IPR001937"
FT                   /db_xref="InterPro:IPR005849"
FT                   /db_xref="InterPro:IPR036265"
FT                   /db_xref="UniProtKB/TrEMBL:B4ULD7"
FT                   /protein_id="ACG71384.1"
FT                   /translation="MPDLRRDPIVGRWVIIATERARRPSDMQRTAPAPQGGLCPFDPGN
FT                   EGMTPREVYVAGRPPSAPPNAPGWKVRVVPNRFPALKIEGELDRQAEGIYDRMNGIGAH
FT                   EVIVETPDHDRAMEDLTPAELTEVLFAFKARILDLRNDLRFKYILLFKNHGHLAGASLE
FT                   HAHSQLIALPVVPRQVIEEIEGARRHFDLKERCIFCDIVGQERKERARLVLENDEFVVF
FT                   APWAPRSPFETWIMPKRHQSNYEAEPKERLALCAEALGSTLRRLGGALGKPAYNFMVHS
FT                   NPLRDAQSPSYHWHIEVMPALTQVAGFEWGSGFHINPVPPEEAAEFLRKMPG"
FT   gene            163434..164861
FT                   /locus_tag="AnaeK_0142"
FT   CDS_pept        163434..164861
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0142"
FT                   /product="glycogen/starch synthase, ADP-glucose type"
FT                   /EC_number="2.4.1.21"
FT                   /note="TIGRFAM: glycogen/starch synthase, ADP-glucose type;
FT                   PFAM: glycosyl transferase group 1; Starch synthase
FT                   catalytic domain protein; KEGG: ade:Adeh_0135
FT                   glycogen/starch synthase, ADP-glucose type"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71385"
FT                   /db_xref="GOA:B4ULD8"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR011835"
FT                   /db_xref="InterPro:IPR013534"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4ULD8"
FT                   /protein_id="ACG71385.1"
FT                   /translation="MQILFVASEVGPWSKTGGLGDVAGALPQALAERGNEVAVVTPRHG
FT                   SIDPRAAGLQPVRTALQVRGEPVSLWVKRGPAPVYFVEHPHLFGNRRGLYGEGGRDHGD
FT                   NAERFAFLTRAALALPGALGLRPRILHLNDWQCGLGPWLLRHEHARDPALAGARTVFTI
FT                   HNLAYQGLFPKQVLPALGLPWEVFRWEAMEFFDQLSFMKAGLAFADALTTVSPTYAREI
FT                   LTPEGGASLDALLRHRARDLHGILNGIDVHAWDPARDPHLPAHFTAGDLAGKAACKAAL
FT                   QREVGLPVRPEVPVAGLVTRLAEQKGIDLVAAALPALLARDVQVVLLGSGDPAYQETFA
FT                   RAAREHPDRVAARIGFDEGLAHRIEAGADLFLMPSRFEPCGLNQMYSLRYGTVPVVRAV
FT                   GGLADTVEDFDGVARGTGFRFSEYTPQALLTATRRALDVFRDRRAWRGLVERGMAEDNS
FT                   WERSAARYEALYRTLAP"
FT   gene            164908..165243
FT                   /locus_tag="AnaeK_0143"
FT   CDS_pept        164908..165243
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0143"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ade:Adeh_0136 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71386"
FT                   /db_xref="UniProtKB/TrEMBL:B4ULD9"
FT                   /protein_id="ACG71386.1"
FT                   /translation="MATAPHDDPEPTARPTDRLPRELLEEEDEKLVPASNVGGAAPTAL
FT                   GADSGGDLPGSEDDLANMSEPEPPEPPEVGAVHVRRGAAGEEEEEGEGGEAGDDEEAGP
FT                   GAPRTRH"
FT   gene            complement(165262..166503)
FT                   /locus_tag="AnaeK_0144"
FT   CDS_pept        complement(165262..166503)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0144"
FT                   /product="Tetratricopeptide TPR_2 repeat protein"
FT                   /note="PFAM: TPR repeat-containing protein;
FT                   Tetratricopeptide TPR_2 repeat protein; SMART:
FT                   Tetratricopeptide domain protein; KEGG: ade:Adeh_0137
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71387"
FT                   /db_xref="InterPro:IPR010428"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR038555"
FT                   /db_xref="UniProtKB/TrEMBL:B4ULE0"
FT                   /protein_id="ACG71387.1"
FT                   /translation="MSLPFRRAAVLLLAAACTPSTAPAPAPAAPQANHAARGTITPARY
FT                   VPPPARGSRARPEACLPGEPFAAPSALAEEAVAALDAGARERALACADEALRLAPRMVP
FT                   ALTARGAALAALDRLDEARLAFARALAVDPDEPEALLGAAELHVRRLGAARDALEAGLE
FT                   YAVRGARSATRPPRKDKDLAARLELVAGMAENDLGRSHLALAHLERALAARPRDPDALY
FT                   ERGVALFELCRFGEARRAFERALAIAPDDAWAIHQLGLVAERSGDGRRAAALLARARTL
FT                   APDDFRDELAVDAGAFRAEVEAAVAALPAAEREALKLAPVEIQDLPDTEDLTAVEPPLS
FT                   PSILGLYRGPPADEACTEADGPRCRSIVFYRKNLLRFARDRAELTEQVRVTLLHELGHL
FT                   HGESDDELRDRGLE"
FT   sig_peptide     complement(166396..166503)
FT                   /locus_tag="AnaeK_0144"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.992) with cleavage site probability 0.441 at
FT                   residue 36"
FT   gene            complement(166710..167630)
FT                   /locus_tag="AnaeK_0145"
FT   CDS_pept        complement(166710..167630)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0145"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ade:Adeh_0138 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71388"
FT                   /db_xref="InterPro:IPR026590"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR039444"
FT                   /db_xref="UniProtKB/TrEMBL:B4ULE1"
FT                   /protein_id="ACG71388.1"
FT                   /translation="MRGAPDIREVQDHLFDRLARGQLLLLVGAGASRWAGLPSWREAVA
FT                   ALARDLVPVLRERLPDAPARFSPPGPDDPVALETLLRVPEAHRALCGEARLVERLAALF
FT                   DTSRIDPAALPLHRLLVRLAAFVPALYTTNFDDLLERTFAWAGRACQVVAAADDLQRWR
FT                   LDRAGGRFVSRFPVYKLHGTLDRPATLVVSETDFQRRASLAANAIDLRFCSDAVGRELL
FT                   LVGYGFNDPNLRWIWTKLRDLEVLPVAWFLELGTSTDLDLATFELDRIARVDLRASDPV
FT                   HPPELLAFLGALADRCEAALGPFPR"
FT   gene            complement(167688..168818)
FT                   /locus_tag="AnaeK_0146"
FT   CDS_pept        complement(167688..168818)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0146"
FT                   /product="glycine oxidase ThiO"
FT                   /note="TIGRFAM: glycine oxidase ThiO; PFAM: FAD dependent
FT                   oxidoreductase; KEGG: ade:Adeh_0139 glycine oxidase ThiO"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71389"
FT                   /db_xref="GOA:B4ULE2"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR012727"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B4ULE2"
FT                   /protein_id="ACG71389.1"
FT                   /translation="MKTDVVVVGAGLQGASVALRLAQAGKQVVVLERAVPGAEASYAAG
FT                   GILSPGVEALEPGPFYALCAASLARYPGFAREVEAASGMWVGLRGGGTLEIAVDDPEAR
FT                   LLAGRAEKLHKAGLPVEVLDDAEVRRLEPGVSPETRGALYFADEASVDPRLLGRAVYVA
FT                   AARAGARFVTGKVERIVHAGGRAVGVDHDAGRIEADAVVLAAGSWSMQVEGNGLPPGAV
FT                   RPVRGQIALLDTRPPLLSRVVFSANGYVVPRADGRILCGSTMEEVGHEKAVTAGGLRRV
FT                   LDIALEIAPALAAAPVVETWSNFRPASPDGSPILGAGTVPGLYYATGHTRNGILLAPVT
FT                   ADAVAAAVLGTPPPVDLAPFSPARLGAGRPQAAGRK"
FT   gene            complement(168912..169535)
FT                   /locus_tag="AnaeK_0147"
FT   CDS_pept        complement(168912..169535)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0147"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: ade:Adeh_0140
FT                   transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71390"
FT                   /db_xref="GOA:B4ULE3"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:B4ULE3"
FT                   /protein_id="ACG71390.1"
FT                   /translation="MDGSVATRRIGPPRAGIAERIWDAARAEFSKRGYHGARVQGIARG
FT                   ASCNVALIYRHWASKRALYLDILRAVWLSAANELSRFVENGSGGPEAVIAAYLDAMMHD
FT                   AMGAQILVREYLDGAPYLSQLTTAEPALLDPLRRAAAVIAEGTDGGVDPVLAVVTVGGL
FT                   AALVASSREAMLPMVGQQLAPEAWRAHVLHVLANGLAPRAGPRG"
FT   gene            169615..170871
FT                   /locus_tag="AnaeK_0148"
FT   CDS_pept        169615..170871
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0148"
FT                   /product="DNA-directed DNA polymerase"
FT                   /EC_number="2.7.7.7"
FT                   /note="PFAM: UMUC domain protein DNA-repair protein; KEGG:
FT                   ade:Adeh_0141 DNA-directed DNA polymerase"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71391"
FT                   /db_xref="GOA:B4ULE4"
FT                   /db_xref="InterPro:IPR001126"
FT                   /db_xref="InterPro:IPR017961"
FT                   /db_xref="InterPro:IPR022880"
FT                   /db_xref="InterPro:IPR024728"
FT                   /db_xref="InterPro:IPR036775"
FT                   /db_xref="UniProtKB/TrEMBL:B4ULE4"
FT                   /protein_id="ACG71391.1"
FT                   /translation="MYRAMDPGPRTILHLDLDAFYASVEQLDHPELRGRPVIVGGTGNR
FT                   GVVCAASYEARKFGVRSALPTARARRLCPDGVFLPPRFGRYSELSRRVFDVYRRYTPLV
FT                   EPLSLDEAFLDVSASRALHGTGPDIARAIKAAVRGECGLAVSAGVAEVKMAAKIATDLG
FT                   KPDGLVVVPAGGVAAFLAPLPVGRLWGVGEVTEATLRRIGVATIGDLARMPESALAAAL
FT                   GPTHARGLRALARGEDAREVVPDEEAKSVGAEDTFDHDLLGRPALERELLAQAGTVGRR
FT                   LRAAGLAGHVVTLKVKYADFTLVTRRVTLERATDDDRAIFEAARAQLERVDLRRPVRLT
FT                   GISVSGFAGDEERGQLGLFGGAPAPPPPEASRRKALNAALDALAGRFGEGAVTRADLAG
FT                   RPPRRRHGDPGDGGEEPDG"
FT   gene            170868..171782
FT                   /locus_tag="AnaeK_0149"
FT   CDS_pept        170868..171782
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0149"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ade:Adeh_0142 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71392"
FT                   /db_xref="InterPro:IPR039498"
FT                   /db_xref="UniProtKB/TrEMBL:B4ULE5"
FT                   /protein_id="ACG71392.1"
FT                   /translation="MREPRFAPWRAAPQVDGMAAAIRPGEDLAIRERSQGELDARATAL
FT                   RALAGSGVPFLVAGAYAFFEYTGIFRDTKDLDLFLREKDLEAAFRVLEEAGFRTELTDP
FT                   GWIGKAWQGEWFVDLIFSSGNGVAVVDDLWFTHARPGRVMDVEVLLAPPEEIIWSKSFV
FT                   LERERYDGADVNHLLHVCGPGMDWDRLLQRFDRYWEVLFSHLLLFQFAYPGARSTVPDW
FT                   VTEELVGRTLENLRSGDHPVAMCRGSLMSRVQYQHDVERLGLHDGRRWDEAERGPAGRA
FT                   GHGGAAGTGAAAGGADVSPGGGG"
FT   gene            171832..172470
FT                   /locus_tag="AnaeK_0150"
FT   CDS_pept        171832..172470
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0150"
FT                   /product="metallophosphoesterase"
FT                   /note="KEGG: ade:Adeh_0143 metallophosphoesterase"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71393"
FT                   /db_xref="GOA:B4ULE6"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:B4ULE6"
FT                   /protein_id="ACG71393.1"
FT                   /translation="MVNGEAEGLVLAGDLTDHGTLDEAKTLAEVLSQLRVPCAAVLGNH
FT                   DYEGGVVREICRVLTEAKVTLLDGDHAVFDRRLGIAGVKGFAGGFERGMLQAFGEPAIK
FT                   AFVQESVNEALKLEAALAQLEIQKKVVLMHYAPLVETTEGEDLQLRPFLGSSRLLGPCD
FT                   AFGARAVFHGHSHHGTLEARTPKGVPVYNVAMPLLRKLMDDRRFRVFEL"
FT   gene            complement(172657..173037)
FT                   /locus_tag="AnaeK_0151"
FT   CDS_pept        complement(172657..173037)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0151"
FT                   /product="response regulator receiver protein"
FT                   /note="PFAM: response regulator receiver; KEGG:
FT                   ade:Adeh_0144 response regulator receiver domain protein
FT                   (CheY-like)"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71394"
FT                   /db_xref="GOA:B4ULE7"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:B4ULE7"
FT                   /protein_id="ACG71394.1"
FT                   /translation="MTPGQYILVVDDDDDFREALSEVLVDAGYPVQQAENGEVALAKVD
FT                   EEAPGIVLLDLKMPVLDGWGVMERMRGDAKSAAIPILILSAYGFEWEAELLGAQGYIPK
FT                   SVGMDEILERVRKAAGPPPMRH"
FT   gene            complement(173034..173999)
FT                   /locus_tag="AnaeK_0152"
FT   CDS_pept        complement(173034..173999)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0152"
FT                   /product="phosphoesterase DHHA1"
FT                   /note="PFAM: phosphoesterase DHHA1; KEGG: ade:Adeh_0145
FT                   phosphoesterase, DHHA1"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71395"
FT                   /db_xref="InterPro:IPR038763"
FT                   /db_xref="UniProtKB/TrEMBL:B4ULE8"
FT                   /protein_id="ACG71395.1"
FT                   /translation="MQLELLYHGNCFDGCASAALFGRWFQEREGARLAGVRYRPVQHQQ
FT                   GDAFPADAFGADVNACVDFRYSPRLDWWFDHHASAFPTPADRASFERDATGQKFWDPAA
FT                   PSCTGFIARTLANRFGWRAAELDELVRWADVIDAARFESAAVAVRLEAPALRIMTLLEA
FT                   TKDPALPTRLIGAMQRLPLAEIAAQDWVTGPLAPILERHRGAIDVVRRQARVRDGVVEI
FT                   DLGDTGLEAANKFIAYDLFPEARYTVVVSKDPKRTKVSVGSNPWAREQRTHDISKLCER
FT                   YGGGGHPVVGAVSLAPDRLADARRIAAEIASALRGEPNAP"
FT   gene            174298..175263
FT                   /locus_tag="AnaeK_0153"
FT   CDS_pept        174298..175263
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0153"
FT                   /product="HPr kinase"
FT                   /note="TIGRFAM: HPr(Ser) kinase/phosphatase; PFAM: HPr
FT                   serine kinase domain protein; KEGG: ade:Adeh_0146 HPr
FT                   kinase/phosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71396"
FT                   /db_xref="GOA:B4ULE9"
FT                   /db_xref="InterPro:IPR003755"
FT                   /db_xref="InterPro:IPR011104"
FT                   /db_xref="InterPro:IPR011126"
FT                   /db_xref="InterPro:IPR028979"
FT                   /db_xref="UniProtKB/TrEMBL:B4ULE9"
FT                   /protein_id="ACG71396.1"
FT                   /translation="MDAIRVGALLDDTKFDLRLTLVAGKQGLSRRISSSRIQKPGLVLA
FT                   GFTEYLHKERVQVFGNTEMSYLATLPRERSVEVLRSFFGQDVSCLVVTKGLQPPPEMMA
FT                   AADEAGVPLLRTSHLSSNFIESVQNCLEDVLTAQTSMHGVLLDVFGVGILLLGKSGIGK
FT                   SEIALDLIMRGHRLVADDIVDVKRKTPESVFGAGSEIIKHHMEIRGLGIINIKDLFGVA
FT                   AIRERKKIEIVLELVEWDPNVEYDRLGVEERKFRILDVEIPMLVVPVRPGRNMTTIVEV
FT                   AARNHLLKLQGHHSAREFQERLNRAIALAPGGRVGEIDVE"
FT   gene            175260..176144
FT                   /locus_tag="AnaeK_0154"
FT   CDS_pept        175260..176144
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0154"
FT                   /product="conserved hypothetical protein"
FT                   /note="PFAM: conserved hypothetical protein; KEGG:
FT                   ade:Adeh_0147 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71397"
FT                   /db_xref="GOA:B4ULF0"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005337"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4ULF0"
FT                   /protein_id="ACG71397.1"
FT                   /translation="MTATVSHAGPQVVILTGVSGSGKSTALRALEDAGFYCVDNLPIVF
FT                   LEKLLELSGHTAGEVSRMALVVDAREGRFLVEAPRIIRELRQKGADVEVLFLDASDEAL
FT                   VRRYSETRRRHPLAGEGGTVPDGIAAERLALADVRGIADEVIDTTTLNVHELKRLVTRR
FT                   FVAGEGAKLGVTLVSFGFRFGIPTHADLVLDVRFLPNPFFVPELKPHPGTDPRVAEFVL
FT                   GQADAKAFLERLTDLLGFLLPRYRNEGKSYLTIAIGCTGGKHRSVALAAALAERLEGSG
FT                   QPVRLWHRDVEKE"
FT   gene            176257..176673
FT                   /locus_tag="AnaeK_0155"
FT   CDS_pept        176257..176673
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0155"
FT                   /product="PTS system fructose subfamily IIA component"
FT                   /note="PFAM: PTS system fructose subfamily IIA component;
FT                   KEGG: ade:Adeh_0148 phosphotransferase system, fructose
FT                   subfamily IIA component"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71398"
FT                   /db_xref="GOA:B4ULF1"
FT                   /db_xref="InterPro:IPR004701"
FT                   /db_xref="InterPro:IPR033887"
FT                   /db_xref="InterPro:IPR036662"
FT                   /db_xref="UniProtKB/TrEMBL:B4ULF1"
FT                   /protein_id="ACG71398.1"
FT                   /translation="MVGLVVATHGRLAEELLLTAEGIVGRLERCEAVSIVAGASMDEAR
FT                   QHIAEAVKRVDQGSGVLVLTDMFGGTPANLALTFLGDKLEVVTGVNLPMIMKLATARGE
FT                   DVSLHSVAELVTAYGQKNITLASELLRTRARSRT"
FT   gene            176717..177211
FT                   /locus_tag="AnaeK_0156"
FT   CDS_pept        176717..177211
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0156"
FT                   /product="PTS system sorbose subfamily IIB component"
FT                   /note="PFAM: PTS system sorbose subfamily IIB component;
FT                   KEGG: ade:Adeh_0149 phosphotransferase system, sorbose
FT                   subfamily IIB component"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71399"
FT                   /db_xref="GOA:B4ULF2"
FT                   /db_xref="InterPro:IPR004720"
FT                   /db_xref="InterPro:IPR036667"
FT                   /db_xref="UniProtKB/TrEMBL:B4ULF2"
FT                   /protein_id="ACG71399.1"
FT                   /translation="MIPLVRVDNRLLHGQILETWVPRLRIDQVMVADDEAAASSLAQAA
FT                   MTLCVPPELPVRIRRVAEVDYAGLAAGGAKVLLLVRDVPGLAAARDAGLGAALAPRVNL
FT                   GNLHFGPGRRLVTPSVFVSEEDLSVLRRLAAEGFEVEARAIPSESPTGLAEIERRYAAG
FT                   H"
FT   gene            177228..177923
FT                   /locus_tag="AnaeK_0157"
FT   CDS_pept        177228..177923
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0157"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ade:Adeh_0150 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71400"
FT                   /db_xref="GOA:B4ULF3"
FT                   /db_xref="InterPro:IPR004700"
FT                   /db_xref="UniProtKB/TrEMBL:B4ULF3"
FT                   /protein_id="ACG71400.1"
FT                   /translation="MGLLFLGLVAGLAAVERKGFLQAMLSRPIALAPVAGWVLGDAAGG
FT                   LVVAAPLELLWLGAVNLGAAVPVHEALGAAAIAGGAVLAGRAAGSGVTPEIAVLAVLLA
FT                   APVALLGRRADKAVEGWNERLARHAEAALARHRVAEAARSNLYGLAAPFAIAAVLAPLS
FT                   AWLAEALIPRFLAAAPGAAAPLRVGWFAFAALACAAGAKALRSRAAPRLFFAAFAAAFA
FT                   ALLTWRLLG"
FT   gene            177920..178687
FT                   /locus_tag="AnaeK_0158"
FT   CDS_pept        177920..178687
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0158"
FT                   /product="PTS system mannose/fructose/sorbose family IID
FT                   component"
FT                   /note="PFAM: PTS system mannose/fructose/sorbose family IID
FT                   component; KEGG: ade:Adeh_0151 phosphotransferase system,
FT                   mannose/fructose/sorbose family IID component"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71401"
FT                   /db_xref="GOA:B4ULF4"
FT                   /db_xref="InterPro:IPR004704"
FT                   /db_xref="UniProtKB/TrEMBL:B4ULF4"
FT                   /protein_id="ACG71401.1"
FT                   /translation="MSARVPRATLVRVFWRCLFLQAAWNRRGMQNLGFAYAIDPALRAL
FT                   YPDPARREEALGRHLGFFNCHPYMAAAIVGGAIHHEERVAAGAEPGQAPLAYKATLQGP
FT                   LAALGDGFFWTALRPFFGALAVVGALLLGVPALVAALLVYNAIHLALRIGLFRAGYLRG
FT                   DALVGTIAHLNLPVVADRLRAGGAALCGVAGAVFLMRGAAVGGPPAAALAAAAAAGGYA
FT                   ALARGARLLPTAYVATLAGVGAALLLGHLHGSS"
FT   gene            178690..178962
FT                   /locus_tag="AnaeK_0159"
FT   CDS_pept        178690..178962
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0159"
FT                   /product="phosphotransferase system, phosphocarrier protein
FT                   HPr"
FT                   /note="TIGRFAM: phosphocarrier, HPr family; PFAM:
FT                   phosphocarrier HPr protein; KEGG: ade:Adeh_0152 HPrNtr"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71402"
FT                   /db_xref="GOA:B4ULF5"
FT                   /db_xref="InterPro:IPR000032"
FT                   /db_xref="InterPro:IPR001020"
FT                   /db_xref="InterPro:IPR035895"
FT                   /db_xref="UniProtKB/TrEMBL:B4ULF5"
FT                   /protein_id="ACG71402.1"
FT                   /translation="MPHQERTFVIVNTLGLHARAAAQLVQTSNRYRSEIHVEKDGMQVN
FT                   GKSIMGVLTLAAAKGSQITVTCDGDDADQAMTALAKVIENGFGET"
FT   gene            178959..180755
FT                   /locus_tag="AnaeK_0160"
FT   CDS_pept        178959..180755
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0160"
FT                   /product="phosphoenolpyruvate-protein phosphotransferase"
FT                   /note="TIGRFAM: phosphoenolpyruvate-protein
FT                   phosphotransferase; PFAM: PEP-utilizing protein;
FT                   PEP-utilising protein mobile region; PEP-utilising protein
FT                   domain protein; KEGG: ade:Adeh_0153
FT                   phosphoenolpyruvate--protein phosphotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71403"
FT                   /db_xref="GOA:B4ULF6"
FT                   /db_xref="InterPro:IPR000121"
FT                   /db_xref="InterPro:IPR006318"
FT                   /db_xref="InterPro:IPR008279"
FT                   /db_xref="InterPro:IPR008731"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018274"
FT                   /db_xref="InterPro:IPR023151"
FT                   /db_xref="InterPro:IPR024692"
FT                   /db_xref="InterPro:IPR036618"
FT                   /db_xref="InterPro:IPR036637"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:B4ULF6"
FT                   /protein_id="ACG71403.1"
FT                   /translation="MSRSSATTLVGIGASPGIAIGRCWTIERRRVRTPKRRLTPDEVEA
FT                   ELARLRTSLEISDVQLAEVRGKVEESQAPGSAEHTAIIDMHRMMLKDEMLVLEAQRQIR
FT                   EERLNAEWAVKRATRKIKNAFHEQADDYFKERRADVDFVGERIIKNLLGQAPDVEDVPP
FT                   EGVIVVAHDLSPADTALLLHEHKVAAFVTDAGAKTSHTAIVARALEVPAVVGVGRVTAV
FT                   ADRGDWIVVDGGRGLVVINPSPGERAGYEAAREKQLAGEQALLATRDLPARTLDDLTVR
FT                   LAGNIEFAEEVPSLLAHGGQAVGLYRTEFLFMGRSDLPGEEEHYQNYRRILEALAPRPV
FT                   TIRTFDLGGDKLPAGMRVTAENPALGLRAIRYCLRQPEMFRAQLRALLRASVHGNLRIM
FT                   FPMISGVAELRAAKHALRQAADELRAEGVAFRQVPVGIMVELPSAAMIADRLAAECDFF
FT                   SIGTNDLIQYTIGIDRQDKDVAYLYKPLHLAVLRLLKLICDAGRAAGVPVSMCGEMAGE
FT                   PVNALVLLGLGVAELSMNGPSIPLVKRVVRAARAEDGRALVDRLLALTTADDIEHEVQA
FT                   EMARRFPGLLDGDHDAEPAGQG"
FT   gene            180913..182079
FT                   /locus_tag="AnaeK_0161"
FT   CDS_pept        180913..182079
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0161"
FT                   /product="Methionine adenosyltransferase"
FT                   /EC_number="2.5.1.6"
FT                   /note="PFAM: S-adenosylmethionine synthetase; KEGG:
FT                   ade:Adeh_0154 S-adenosylmethionine synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71404"
FT                   /db_xref="GOA:B4ULF7"
FT                   /db_xref="InterPro:IPR002133"
FT                   /db_xref="InterPro:IPR022628"
FT                   /db_xref="InterPro:IPR022629"
FT                   /db_xref="InterPro:IPR022630"
FT                   /db_xref="InterPro:IPR022631"
FT                   /db_xref="InterPro:IPR022636"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4ULF7"
FT                   /protein_id="ACG71404.1"
FT                   /translation="MPLQDFLFTSESVTEGHPDKMADQISDAVLDAVLRQDPKGRVACE
FT                   TLLKTGYVMIAGEITTKARIDYPKLARETVRRIGYTSGDMGFDANTCAVLVAVDQQSPD
FT                   IGQGVDTGGAGDQGMMFGYACDETPELMPAPIQYAHAVTKQLAKARRAGLDLLRPDGKS
FT                   QVSVEYRDGRPVRIDTVVVSTQHAESVSNKRLHEAVREQVIAKALPKRLLDRKTRILIN
FT                   PTGRFVIGGPMGDTGVTGRKIIVDTYGGMGRHGGGAFSGKDPSKVDRSAAYMGRYIAKN
FT                   VVAAGLASRCEVQVAYAIGVAEPVSVMVDTFGTAKVPEGKIARAVREVFGLTPRAIIEG
FT                   LDLLRPVYEKTAAYGHFGRTEKTFTWERTDKKEALADAAGLSKIRAVI"
FT   gene            182224..183204
FT                   /locus_tag="AnaeK_0162"
FT   CDS_pept        182224..183204
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0162"
FT                   /product="transcriptional regulator, ArsR family"
FT                   /note="PFAM: regulatory protein ArsR; UbiE/COQ5
FT                   methyltransferase; protein of unknown function DUF691
FT                   methyltransferase-related; methyltransferase small;
FT                   Methyltransferase type 11; Methyltransferase type 12; KEGG:
FT                   ade:Adeh_0155 transcriptional regulator, ArsR family"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71405"
FT                   /db_xref="GOA:B4ULF8"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B4ULF8"
FT                   /protein_id="ACG71405.1"
FT                   /translation="MPRPAPARLPAPSRRPEALLGWMELLSDPIRLRALRALEPRELSV
FT                   LELREVLALPQSTVSRHLKTLSDAGWLSARREGTQSLYGWAAELDPGARKLWQLARAES
FT                   DGWAVVRADAARLRAVRARRDEAQRFFAGAAGAWDGLRARVYGRGVAAEALLALVPPAW
FT                   TVADLGCGTGAVAAELAPRVRRVIAVDRSAAMLRAARRRTARFDNVELHEADLAALPLE
FT                   DGGCDAALLVLVLAYLDDPAPALAEAVRVLRPGGRLVVLDAARHQDEALRRRMGQAHPG
FT                   FEPDALAALVRRAGAAGVTARALPPEPGARGPGLVACTGERPARP"
FT   gene            183257..184732
FT                   /locus_tag="AnaeK_0163"
FT   CDS_pept        183257..184732
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0163"
FT                   /product="adenosylhomocysteinase"
FT                   /EC_number="3.3.1.1"
FT                   /note="TIGRFAM: adenosylhomocysteinase; PFAM:
FT                   S-adenosyl-L-homocysteine hydrolase; TrkA-N domain protein;
FT                   S-adenosyl-L-homocysteine hydrolase, NAD binding; KEGG:
FT                   ade:Adeh_0156 S-adenosyl-L-homocysteine hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71406"
FT                   /db_xref="GOA:B4ULF9"
FT                   /db_xref="InterPro:IPR000043"
FT                   /db_xref="InterPro:IPR015878"
FT                   /db_xref="InterPro:IPR020082"
FT                   /db_xref="InterPro:IPR034373"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR042172"
FT                   /db_xref="UniProtKB/TrEMBL:B4ULF9"
FT                   /protein_id="ACG71406.1"
FT                   /translation="MAVSAAKKKPAPSAPAPLEHKVKDLSLAGWGRKEIELAEKEMPGL
FT                   MALRREHARQRPLAGQRITGSLHMTIQTAVLIETLVDLGADVRWASCNIFSTQDHAAAA
FT                   IVVGREGTPEAPRGVPVFAWKGETLEEYWDCTERALDFGGGKGPTQIVDDGGDATLLIH
FT                   KGVEYEKAGKVPPPSSADSEELEVVLRLLAREQKKDPRRWTRVAKACAGVTEETTTGVH
FT                   RLYEMQKAGTLLFPAINVNDSVTKSKFDNLYGCRHSLVDGLNRATDVMLAGKLCVVCGY
FT                   GDVGKGCAQALRGQGARVVVTEIDPINALQASMEGYQVVRLEDVVKDADVFVTATGNLD
FT                   VVTVEHMKAMKDCAIVGNIGHFDNEIDMAGLRKLTTRVNIKPQYDAFVFPDGHRVLVLA
FT                   EGRLLNLGCATGHPSFVMSNSFTNQTLAQIELAVNRAAYAKQVYVLPKHLDEKVAALHL
FT                   EQIGARLTKLTKKQAAYIGVPQSGPFKPDHYRY"
FT   gene            184745..185623
FT                   /locus_tag="AnaeK_0164"
FT   CDS_pept        184745..185623
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0164"
FT                   /product="Undecaprenyl-diphosphatase"
FT                   /EC_number="3.6.1.27"
FT                   /note="PFAM: Bacitracin resistance protein BacA; KEGG:
FT                   ade:Adeh_0157 undecaprenyl-diphosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71407"
FT                   /db_xref="GOA:B4ULG0"
FT                   /db_xref="InterPro:IPR003824"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4ULG0"
FT                   /protein_id="ACG71407.1"
FT                   /translation="MSLVSAALFGLLQALTEFLPVSSTAHLLVFGELLGHSLDDRRFRA
FT                   FVTIIQAGTTLAVLVYFRADIARLVAASARGLARGRPFGTPEARLGWYIVLGTLPAALA
FT                   GKLLEHRIEALGNWVIAGSLVALGLVLLAAERLASHRRRVEDVGAGDALLIGVAQALAL
FT                   VPGSSRSGTTITGGMLLGFTREAAARFSFLLSVPITLAAGAYKLWSTVPDLRGEAAWTV
FT                   ATVVGTVVSAVAGYLVIDWLLAWLRTRTTYVFVVWRLAAGAAIAALILSGVLPAGAEAP
FT                   PPPPPALHAAP"
FT   gene            185620..186210
FT                   /locus_tag="AnaeK_0165"
FT   CDS_pept        185620..186210
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0165"
FT                   /product="NUDIX hydrolase"
FT                   /note="PFAM: NUDIX hydrolase; KEGG: ade:Adeh_0158 NUDIX
FT                   hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71408"
FT                   /db_xref="GOA:B4ULG1"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="UniProtKB/TrEMBL:B4ULG1"
FT                   /protein_id="ACG71408.1"
FT                   /translation="MTLDDLAAALVAREPGIAPVDRIAHEHLPRGGFASAAVLVPLHVL
FT                   DGEVHVLMIRRPMKMSRHAGQIAFPGGKIDPGEESLAAALREAHEEVGLEPARADVMGQ
FT                   LSETLVLASAFRLTPWVASVPYPYPYAAAPHEVDEILHVPLSALSRPGAHRVEWREVYG
FT                   LRLDVHFFSVGKDVIWGATGRVLAELLSIWRAS"
FT   gene            186207..187295
FT                   /locus_tag="AnaeK_0166"
FT   CDS_pept        186207..187295
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0166"
FT                   /product="Mannose-1-phosphate guanylyltransferase (GDP)"
FT                   /EC_number="2.7.7.22"
FT                   /note="PFAM: Nucleotidyl transferase; KEGG: ade:Adeh_0159
FT                   mannose-1-phosphate guanylyltransferase (GDP)"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71409"
FT                   /db_xref="GOA:B4ULG2"
FT                   /db_xref="InterPro:IPR001538"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:B4ULG2"
FT                   /protein_id="ACG71409.1"
FT                   /translation="MKIYPVIMAGGSGTRFWPLSRRNRPKQFLALAGDAPLLAATVSRL
FT                   PPLSRPRDTFVVCGPKHAAAARRMVAQLPKENFIVEPCARNTAPCVGLAAIHVAAKDPR
FT                   GVIAMLPADHHIGRPPAFRDALAAAAQLAEAGSIATIGIRPSRPETGYGYLKLGPRLAA
FT                   RAKGKKRLVAHKVERFVEKPDVVTAARYLADGSYLWNSGIFVFRADVILDEIRRAMPVL
FT                   GEQLEAIRRTLGTPNYARTLKRVFPDCPSISIDYGVMEKSQRIAVVPAEFGWSDVGSFA
FT                   ALSDVRVTDDLGNVAEGDALVIDGRNNVVLAGKDRPIALIGLDDVIVVDSGDALLVCRR
FT                   DRAQDVRKAVEELGRRGREELL"
FT   gene            187467..188837
FT                   /locus_tag="AnaeK_0167"
FT   CDS_pept        187467..188837
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0167"
FT                   /product="phosphomannomutase"
FT                   /EC_number="5.4.2.8"
FT                   /note="PFAM: phosphoglucomutase/phosphomannomutase ;
FT                   phosphoglucomutase/phosphomannomutase alpha/beta/alpha
FT                   domain I; phosphoglucomutase/phosphomannomutase
FT                   alpha/beta/alpha domain II;
FT                   phosphoglucomutase/phosphomannomutase alpha/beta/alpha
FT                   domain III; KEGG: ade:Adeh_0160 phosphomannomutase"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71410"
FT                   /db_xref="GOA:B4ULG3"
FT                   /db_xref="InterPro:IPR005841"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="UniProtKB/TrEMBL:B4ULG3"
FT                   /protein_id="ACG71410.1"
FT                   /translation="MAKLSPTIFREYDIRGLVDQDLTEEAVSLVGKALGSRIRGAGGKR
FT                   AAVGWDARLSGPKFAKAMIEALTSTGVDVVSLGVVPTPLTYFAAHTLDVDGICMITGSH
FT                   NPPEYNGLKVGLGSATYYGEEIQALRREAEAGRFATGQGTVRAHDIVTPYREHVRQNLR
FT                   LGKRRLKVVVDAGNGTGGVVAVPLFESLGFEVVPLFIEMDGNFPNHHPDPTVEKNLEHL
FT                   RRKVLETGADVGIAYDGDADRVGAVDEKGNVLWGDQIMILFSRALLAEEPGAAIVGEVK
FT                   CSFTLYDDIAARGGRAIMWKAGHSLIKAKMKEEHALLAGEMSGHIFFGHRWFGFDDGIY
FT                   SSARLLELLTHEDRPMSALLADVPRTFSTPELRVDCPEEKKFEVVRRAQEFFAARYDAV
FT                   TVDGVRVVFPDGWGLVRASNTQPLLVLRFEAKTEARLAEIQALVRGKVDELLRELGA"
FT   gene            188841..189803
FT                   /locus_tag="AnaeK_0168"
FT   CDS_pept        188841..189803
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0168"
FT                   /product="ROK family protein"
FT                   /note="PFAM: ROK family protein; KEGG: ade:Adeh_0161
FT                   glucokinase"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71411"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="UniProtKB/TrEMBL:B4ULG4"
FT                   /protein_id="ACG71411.1"
FT                   /translation="MKGLALGVDLGGTNARAAVVDRATGEIVASHKEPLRERGPEAVVA
FT                   TVLHALGQAAGAAGIAPASAGRVGVGVAGQVLGATGVVMNAPNLGWRDVAFGTLLEKAL
FT                   GVPVRVANDLSVAAWGEKRFGAARGIEDVVLVFVGSGVGSGLILGGRLHDGAQGVAGEL
FT                   GHIKVRLPRPGFTPRRCGCGQLGCLEAYTSGVNVAARVREEIAAGAATRVLELVEGDLA
FT                   RVTASVVEEAHALGDAYAVALWDEVAELLGLSVANLVTLLNPARLILGGGVLLGAPRLA
FT                   DLTLRRFDEAVSRSATRGLTVERAWLGDDAGVIGAAVLE"
FT   gene            190166..190276
FT                   /locus_tag="AnaeK_0169"
FT   CDS_pept        190166..190276
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0169"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71412"
FT                   /db_xref="UniProtKB/TrEMBL:B4ULG5"
FT                   /protein_id="ACG71412.1"
FT                   /translation="MDVPRREQMAAKKKTAKKTAAKKPAAKKKVAKKGKK"
FT   gene            190353..191837
FT                   /locus_tag="AnaeK_0170"
FT   CDS_pept        190353..191837
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0170"
FT                   /product="protein of unknown function DUF814"
FT                   /note="PFAM: protein of unknown function DUF814;
FT                   Fibronectin-binding A domain protein; KEGG: ade:Adeh_0162
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71413"
FT                   /db_xref="InterPro:IPR008532"
FT                   /db_xref="UniProtKB/TrEMBL:B4ULG6"
FT                   /protein_id="ACG71413.1"
FT                   /translation="MSLTARELAEVVAELAPLAGAHVDAVRMHAERALTLSLRGRAGDA
FT                   LLLLSAEPDVTRLHAVGRRPPQPDTPYAAQAVLRRELEGARLAGLETLPGDRVVALSFD
FT                   RAPARGGPVRLVAELTGRHGNLFLVDAAGVIRAAAARNLSQRRDLAVGRPYQAPSLPPG
FT                   AGTDAGQGALRFPPVPGAPFPLSAAIEAAYLAREEERRLAEGRRRLREPVRAALARAGR
FT                   ALVKLADEAARVPAAEADRRAADLLKTHLRAVRRGATEVTVTEWTEEGPREVRVAVDPA
FT                   LTPQANLERYYRRYRRIVESAARVEARAAEVRAREAALRALLARIDAAGAADLPRLERE
FT                   ARRLAAGPRPAAPPRRKHDEPAPPYRTFRSLSGATVLVGRGAAENDALTLRVARGNDLW
FT                   LHARGLPGAHVVVRLDKGKAPDAETLVDAAHLAVHFSDARGAPQADVAYTRARFVKKPK
FT                   GSAPGAVTYSQEKVMLLRTEPGRVERLLAEEEGGQG"
FT   gene            191936..192679
FT                   /locus_tag="AnaeK_0171"
FT   CDS_pept        191936..192679
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0171"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ade:Adeh_0163 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71414"
FT                   /db_xref="UniProtKB/TrEMBL:B4ULG7"
FT                   /protein_id="ACG71414.1"
FT                   /translation="MRPKESSRQLTLFSPEARRSAAHLLADALSGILTERVRLTVHDNR
FT                   STMVSFRRRPGEIHYRVHHMFLEAPGEVVSALAAFAVAGRGAAAARRRQAGSRIDAYVK
FT                   EHRARIAAPRADRLQPRGRVHDLQALFDRLNAEHFGGAIEARIGWGPVRLGRRRRTVKT
FT                   GVYVQDARLIRIHPTLDRPEVPEFYVAAVVFHEMLHQAVPAVEVNGRRVVHGAAFRRRE
FT                   RAYPDHERAKAWEDRNLALLLSSPA"
FT   gene            192794..194827
FT                   /locus_tag="AnaeK_0172"
FT   CDS_pept        192794..194827
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0172"
FT                   /product="surface antigen (D15)"
FT                   /note="PFAM: surface antigen (D15); surface antigen
FT                   variable number repeat protein; KEGG: ade:Adeh_0164 surface
FT                   antigen variable number"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71415"
FT                   /db_xref="GOA:B4ULG8"
FT                   /db_xref="InterPro:IPR000184"
FT                   /db_xref="InterPro:IPR010827"
FT                   /db_xref="InterPro:IPR023707"
FT                   /db_xref="InterPro:IPR034746"
FT                   /db_xref="InterPro:IPR039910"
FT                   /db_xref="UniProtKB/TrEMBL:B4ULG8"
FT                   /protein_id="ACG71415.1"
FT                   /translation="MPRRLALPLVALLALSAAGCMAARAKPGEEPVLYGLEIQGTHALD
FT                   ADDIAEKLATQPSDRWAWQEARRLDADALAVDRKRVEAYYRERGFYDAKVVDVQVRPDG
FT                   PGRAKVVMRVEEGEPILVRSVEVSGLDAAPEAKARVGALPIRPGERFTERDYDGARGAL
FT                   LHALRNTGWADGAVTQRAQILPAEHAAEVRYEVTPGTRYRFGPVFVAGTAAVPRDRVRE
FT                   QAGIEIHPGDWFEEDRLAKAQARVFDLGVFGAVRVTRGAPDPQRAVVPIVVAVREVPFR
FT                   TLRAGPGVGVQANTRWDVNGTVGWSHRNFMGDLRKLQLELRAGYAWLVARPRKEGPIAL
FT                   ATAEFSQPGAISRRIDATARLEIERGLEQAYDFWSERLRVGFPFRLARRLTLVPSWNLE
FT                   VYQLQNAVSTFDPTQPAKQGPELQNCQGSVCLLSYLEQRVGWDGRNDPLNPRRGVWVMV
FT                   AVQEGFNVGGYGYRYLRFLPEARGFVPLGQKLVLAARARVGALVPVNQAGEPPIVARFT
FT                   AGGPQSMRGYYTGRLAPMVLRDGDWVPVGGNGLADGSLELRLDLTRSWGAALFVDGGNV
FT                   SRPSGVPTAYRDVLDPTQVQWAGGLGLRYRTPFGPVRFDVGVQLPTNLAAGVPFHQRFP
FT                   TVPSVENAGAPIYDKAGNLVGTVPATHREPWIAFHLSIGEAF"
FT   sig_peptide     192794..192871
FT                   /locus_tag="AnaeK_0172"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.821 at
FT                   residue 26"
FT   gene            194827..199350
FT                   /locus_tag="AnaeK_0173"
FT   CDS_pept        194827..199350
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0173"
FT                   /product="protein of unknown function DUF490"
FT                   /note="PFAM: protein of unknown function DUF490; KEGG:
FT                   ade:Adeh_0165 protein of unknown function DUF490"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71416"
FT                   /db_xref="InterPro:IPR007452"
FT                   /db_xref="UniProtKB/TrEMBL:B4ULG9"
FT                   /protein_id="ACG71416.1"
FT                   /translation="MRRGASIAAAIGAVAGAVGWLLLGLAAFAGVALSAAILYASWGVG
FT                   RPVVANALVRIADDALAGSFQLDRITVLPQGGIELHGLRVFDPEGRLVLEVGRAAVFAD
FT                   LTRLRNRVIGVTAELDRPSVLVEEGEGGLSIARAFAPSHPSPPRPPGAPAPRDDGSGWT
FT                   LRVERLTLRGGDLWWVDGEGATRLEAQALDLDARGVIGPRRARVQLRLRGAADVPVPGA
FT                   LALDVRLARDGDVLRVSVLRARHGDTVLEAIGEGDLARRSGRLAITRLGVDSEKLRALA
FT                   PEVALGGDLAAAGYAESDGDVATAALHVAPRAGESRGGGDAAVAVRLDGSRSLGAEVAL
FT                   DALDPSRIWSGLPRGAVTLRARGGLSGTTLDDLRGRAQVSLSRSTVRGGELGPGELTAR
FT                   ADRGSWEVERLTLQAPGVALLGSGRWREGAGVSGRVSADAGDLARLAANLERLLGQALP
FT                   PLAGRARVEATLSGTSRAPVLDGTVEGPHLAVGSFALDGAKGSGHVAGPFRAVTGRLHL
FT                   TADRVRSGGAELARALLLDAELAAADARLDASADVPALGREPVAVQARALRTERGDEVI
FT                   LRELAIAYPGTRYALTAPARLSLTGPRVDRLELASGAQRIRLEGGIGARGALDARAEVE
FT                   ALRLEGLPVGVLPSGAGLAGELSAQASVSGTTRRPVAQAHLTLAGGRFRGLDGLRAVAD
FT                   AAWDGGARRARLDLSAARGAGGTADVRLDLPLPLQGRPGEPVSARVRGEALPLGPILQA
FT                   AGAALPASGEVALEVALEGAIGAPSLRAEASLTGGAWDDLSAIGLGLTAEAPGERLTAR
FT                   LEATLEGRPAVSVRGEAPLDLSDLLTRPAAAIRALRAGHAAVDARVPGLDLAALAGRLG
FT                   LPDDLAGRLSGDARLEGTLSAPRGRAAFQVEGGAASGVSGLGVALEAEAGAHRVGATVR
FT                   LAMGGEEVLRGEGSLAAAPERLLARGGLRSAPLSVVLVVPHASLARTSTSTLLVEGTVD
FT                   ARLTADGTLAAPRLALEAEGRGLQIEGRPLGDVTSQARWADGRGSARVTLAARAGGTLE
FT                   ATAAVDAPLGLDTRAADLRRAPAELALRARDLDLGFLPAVLSGWVRTASGKLQADVTAR
FT                   GPLARPSPRGTVRLADGRLAVSEYGDWTQIEVDASVTDDAVEIRRVAARRAHGSFEAHG
FT                   ALRGMGGPDARLEGRIVSRELPIMRAGMELATLDLQVDATGGYQPGALQVKLTVPRGTI
FT                   RLPKRAPRALQPLERRRDIVVGRQPEPKRAPLPVPRGPGERPFTLTAQLVAPGRLMVVS
FT                   DNPRIRVELKANVTYELSGANDFATGTIEVVRGEVEPIGGRNFQIERGKVTFTGGPPRA
FT                   ALLDVEATYDNPVAKVTVAVAGPVSDPEIRLSSQPPMDDGQIALLIATGRTELKPGSGG
FT                   VGTLTGEEAGRAALGAVATQAFKNLVADKLPLDTVAVDAGALRAGKYVTDKIYVGYTRR
FT                   FDVQLEQGQNVNEVRVEYQITRRWTFESRYGDAQSGGASLIWSRDY"
FT   sig_peptide     194827..194916
FT                   /locus_tag="AnaeK_0173"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.476 at
FT                   residue 30"
FT   gene            complement(199328..200518)
FT                   /locus_tag="AnaeK_0174"
FT   CDS_pept        complement(199328..200518)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0174"
FT                   /product="integral membrane protein-like protein"
FT                   /note="KEGG: ade:Adeh_0166 integral membrane protein-like"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71417"
FT                   /db_xref="GOA:B4ULH0"
FT                   /db_xref="UniProtKB/TrEMBL:B4ULH0"
FT                   /protein_id="ACG71417.1"
FT                   /translation="MTSRARLLTFGLAAAWLAIGYLNVARGASHAGAGYRFWSFQHHCY
FT                   SDVIALHGDRYLGGGRPLPYLEDRIEYPVLLGIALWLPSFAPGGALGHFTVSYALLALC
FT                   LFAALLALERLPGARPFWLGATPALVFYAGLNWDLLPIALLCGALLALARDRPGAGGAL
FT                   TALGTSAKLFPGVLAPPALLALAGDGARAPLLRFGAGLAAALLAVNLPFALAAPAGWSW
FT                   FFRFNAGRGAENSIWDALGVGRGPLLEVLSTGPMLLAVALACAAAWRAARSGGDAGRAV
FT                   RLGVALALTAWIATNKVWSPQYALYGFLAGALAAAPAGLFLVLCAASVADFHIAFEVRA
FT                   RRWEPWFRDHVFHPDGVVRSLLWLALAAWIARELWRCARPAPAEARAGAVSSPSTR"
FT   sig_peptide     complement(200423..200518)
FT                   /locus_tag="AnaeK_0174"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.982) with cleavage site probability 0.675 at
FT                   residue 32"
FT   gene            200620..200772
FT                   /locus_tag="AnaeK_0175"
FT   CDS_pept        200620..200772
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0175"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: nar:Saro_1105 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71418"
FT                   /db_xref="GOA:B4ULH1"
FT                   /db_xref="UniProtKB/TrEMBL:B4ULH1"
FT                   /protein_id="ACG71418.1"
FT                   /translation="MLWLLASVLLLVWIVSLAFKVTVGAIHLLLVAALVLYVLGFVRGR
FT                   HRTVT"
FT   sig_peptide     200620..200682
FT                   /locus_tag="AnaeK_0175"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.960) with cleavage site probability 0.694 at
FT                   residue 21"
FT   gene            200844..201506
FT                   /locus_tag="AnaeK_0176"
FT   CDS_pept        200844..201506
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0176"
FT                   /product="DedA"
FT                   /note="KEGG: ade:Adeh_0167 DedA"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71419"
FT                   /db_xref="GOA:B4ULH2"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="UniProtKB/TrEMBL:B4ULH2"
FT                   /protein_id="ACG71419.1"
FT                   /translation="MTPLQRLADALAALVSTTGPYAPGILFFATLVEYVFPPFPGDLLV
FT                   VLGAWYAVEGAISWPVTFVSVTAGGLAGAWLDHRVGAALGRRLDARAARHGALSLQARR
FT                   LARFEASYRRWGGWLLVANRFLPGVRAFIFIGAGASRIPLRRVLLLGGLSAALWNAVLL
FT                   AAGAFLAHNQEELIQLVQRYTNAAWAALAACALLWVLGLAWRRAARRRAAADREEEA"
FT   gene            201503..202486
FT                   /locus_tag="AnaeK_0177"
FT   CDS_pept        201503..202486
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0177"
FT                   /product="transglutaminase domain protein"
FT                   /note="PFAM: transglutaminase domain protein; KEGG:
FT                   ade:Adeh_0168 transglutaminase-like"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71420"
FT                   /db_xref="InterPro:IPR002931"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:B4ULH3"
FT                   /protein_id="ACG71420.1"
FT                   /translation="MIALAAAALLAALPEGQARYRVELSGEPVGAAELRVACAGARCVL
FT                   SFGTWLRAPEEAGGAVRVRRIEAEVDREGRLVGAVRRTEDGAPRAASAPRGRVPASAAE
FT                   LALLAPSAGAARGTAACLAAFDEEGGRAGLACAGPALADGAVVLDVLGEREEVRPGPDG
FT                   FPDEVRLPEQGARFVRDPAAAPPARAPRLPVRVAGPADPGRARAFCGRAVDAPAPAPPP
FT                   ATAPPARPGPGDCRAQAAAWIAAARRAGLEARQAVGVAHDGAGFTWHAWAEVRGPSGWI
FT                   AIDPAFGEAPARGPRFTVARFTMGDEAARAAAGREILACWGRGRVR"
FT   gene            202554..203225
FT                   /locus_tag="AnaeK_0178"
FT   CDS_pept        202554..203225
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0178"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ade:Adeh_0169 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71421"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:B4ULH4"
FT                   /protein_id="ACG71421.1"
FT                   /translation="MRSRTAHRPARKAPPTIDRTATLALADRARARGRRRKAVALYQRV
FT                   LAQHPDDLAVHGKVAPLLAARGDRDGALRSFRAAIDGHRRAGFVDRALAVLAQATEAFP
FT                   RDDALWDEMANLELSRGRRADAVAALVRGGRTLLAARALGPAERLLHTAGRLEPWHGEA
FT                   TLLLARAWARSGRRRDAVRLLEGLAERTGGRTRAAARALALRLSPTPSRLWRWLRRGAA
FT                   A"
FT   gene            complement(203328..204476)
FT                   /locus_tag="AnaeK_0179"
FT   CDS_pept        complement(203328..204476)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0179"
FT                   /product="peptidase dimerisation domain protein"
FT                   /note="PFAM: peptidase M20; peptidase dimerisation domain
FT                   protein; KEGG: ade:Adeh_0170 glutamate carboxypeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71422"
FT                   /db_xref="GOA:B4ULH5"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR017150"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:B4ULH5"
FT                   /protein_id="ACG71422.1"
FT                   /translation="MAARIEDALTWLQGQRGAMEALLERLVAQNSFTQNRAGVEAVANV
FT                   VAGQLRTLALDVELRPSHHYGPHVLFTGRAAGAPVFLLGHTDTVFPPGTFEGFRRDGDR
FT                   ARGPGAFDMKGGIVAMLFGLAAAKRAGLLERVAVRGVLVSEEEVGSPESQAVIRAHAAG
FT                   AACALGFESGRPGDLVVTRRKGVASVRVEARGVAAHSGNEHEKGRSAIWSLARFVDRAQ
FT                   SLTDYARGLTVNVGTIAGGTTKNTVPASASCEVDLRFETVADGQALREAVEAAAREAAI
FT                   PGTELEVTAGAWRDPLERTPASSALAKEYGDCQRECGLGQGEAPLAGGGSDACTTGALG
FT                   IPTIDALGPRGKAFHTPGEEVDLGSLVPKASALARFLARRAG"
FT   gene            204592..205656
FT                   /locus_tag="AnaeK_0180"
FT   CDS_pept        204592..205656
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0180"
FT                   /product="N-acetyl-gamma-glutamyl-phosphate reductase"
FT                   /EC_number="1.2.1.38"
FT                   /note="TIGRFAM: N-acetyl-gamma-glutamyl-phosphate
FT                   reductase; PFAM: Semialdehyde dehydrogenase NAD - binding;
FT                   Semialdehyde dehydrogenase dimerisation region; KEGG:
FT                   ade:Adeh_0171 N-acetyl-gamma-glutamyl-phosphate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71423"
FT                   /db_xref="GOA:B4ULH6"
FT                   /db_xref="InterPro:IPR000534"
FT                   /db_xref="InterPro:IPR000706"
FT                   /db_xref="InterPro:IPR012280"
FT                   /db_xref="InterPro:IPR023013"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B4ULH6"
FT                   /protein_id="ACG71423.1"
FT                   /translation="MATGKRFKAAVIGGSGYGGAEMIRRLLVHPDVELVRVASIDFVGE
FT                   PLSAADPALEAVTDLTFEGIPPAQAAAGMDVVLLGLPHTVAASKVPELAALPGVKVVDM
FT                   SGDFRLKDAAAYERWYKHVHPCPERLADFVYGLPELNRERIRSARFVASPGCFATTIEL
FT                   ALLPLARAGLLEGVVHVQGITGSSGSGVAPSAGTHHPVRAGNLKTYKPLEHQHVPEITE
FT                   TLAAAGARDLALRFVPVSAPLSRGILATAFLELPEEWTQDRLDRLYREAYAGEPFVRVP
FT                   RRRLPEVAAVSGSNYAEVGVAVGPALRGRRTVTLFGATDNLVKGGAGQAIQNMNLVLGL
FT                   DEKASLADPGPWPP"
FT   gene            205653..206471
FT                   /locus_tag="AnaeK_0181"
FT   CDS_pept        205653..206471
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0181"
FT                   /product="acetylglutamate kinase"
FT                   /note="TIGRFAM: acetylglutamate kinase; PFAM:
FT                   aspartate/glutamate/uridylate kinase; KEGG: ade:Adeh_0172
FT                   N-acetylglutamate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71424"
FT                   /db_xref="GOA:B4ULH7"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR004662"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR037528"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4ULH7"
FT                   /protein_id="ACG71424.1"
FT                   /translation="MKTIVLKLGGEIVHSPELDLVARDLRTLVDGWNRVAIVHGGGPQA
FT                   TALQKRLGLETRMVAGRRFTDEATLEVMKYVVAGRLNVDLCGRLLANGVMPVGLHGASG
FT                   HAIQATRRPPRVMQGAGPEPVDLGLVGDVVGFNLPLLGDLFERRYVPVLACLGCDDAGQ
FT                   ALNINGDTVASQLAGALRADALVLVTSTPGVLRDVKDPSSRIPRITRAEFERLVADGTI
FT                   SGGMIPKLEESFEVLRGGARSVVILGKLAPGDLEAAVLEPGSAGTVLVGE"
FT   gene            complement(206513..207046)
FT                   /locus_tag="AnaeK_0182"
FT   CDS_pept        complement(206513..207046)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0182"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ade:Adeh_0173 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71425"
FT                   /db_xref="UniProtKB/TrEMBL:B4ULH8"
FT                   /protein_id="ACG71425.1"
FT                   /translation="MRRLALAALALSLASACASREGLWRYREEGTFGDGAPPLHAEPIG
FT                   GGAEYRLVSASLGEADLSLERSVAALGDAPVRVDLGRVRLRSASGEELPLVRACLLEAT
FT                   PRCAAGGASRGFVATLSPGEVVRFRADFGPVDGLGPDRAPNAEVLKVTLSEEGVYVGGR
FT                   LQPVTVVLERVPAR"
FT   sig_peptide     complement(206987..207046)
FT                   /locus_tag="AnaeK_0182"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.520 at
FT                   residue 20"
FT   gene            complement(207129..208994)
FT                   /locus_tag="AnaeK_0183"
FT   CDS_pept        complement(207129..208994)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0183"
FT                   /product="sulfatase"
FT                   /note="PFAM: sulfatase; KEGG: ade:Adeh_0174 sulfatase"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71426"
FT                   /db_xref="GOA:B4ULH9"
FT                   /db_xref="InterPro:IPR000917"
FT                   /db_xref="InterPro:IPR012159"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR024588"
FT                   /db_xref="UniProtKB/TrEMBL:B4ULH9"
FT                   /protein_id="ACG71426.1"
FT                   /translation="MLLHPAGAPRGGPSGLRFPAFLWALLHVPVFLALYATSIGQAVQA
FT                   TPAPYRAWLWPTFLPQALLLALVAFALALPFSLAPRAYRFAVGAAAGLLTGGLAVDAKV
FT                   LQSVGFHLNGFFLRVMLQPNALRETGVPLSDVLLFLGGALALVAVDVLAGAWFVRRFAA
FT                   PARRAWPWALALVLLSAAERVYGGGLTYFAGSSVFAASTTLPLQVPIRMQGLARSVFGD
FT                   RTNDPFEGANASKRLPAGVDPAELRFEHRPDVLFVVAESLPAEHLDARTMPRLWARAEH
FT                   GARFTRHYAAASSTNYTLFSLVYGLQAQKLEAVVGAGRQPTLFPALQENGYQVKVSAAS
FT                   CVDWMDLQKTVFGGVSDLETWCDGNDPSTRDAQMLRSARAFTARADPARPVFLFLFFFG
FT                   THFNYFHDPEDQVFAPAWDGAGGLKATRAPGVEIEHRARNAAHALDRALDAFLDDFART
FT                   RGREPLVVFTGDHGEEFRQKGHLGHGSAVTDEQIHVPAVWLGPGVPAGVRDAVTSHVDV
FT                   VPTLFSLLGERHPASLYADGLSMFEAPEDRFVVSTVGWEPRYAAIGKDLKVTMYAGMGG
FT                   AQITDPDDRPLPDGPARMARQAGRILRALRGEAEPAPRAAAAPAP"
FT   gene            complement(209007..210158)
FT                   /locus_tag="AnaeK_0184"
FT   CDS_pept        complement(209007..210158)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0184"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase A domain protein; KEGG: ade:Adeh_0175
FT                   periplasmic sensor signal transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71427"
FT                   /db_xref="GOA:B4ULI0"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B4ULI0"
FT                   /protein_id="ACG71427.1"
FT                   /translation="MISSAASRGPVRPETVEPGRGNGEDGEAVPGRQITTPRAVAAAVR
FT                   PEAWPALAMFGLCALFAAETALLAAFGLGGGETLLPGGDHDGVLFGASLAAAVLGGALA
FT                   SVTLVRAIRASRADRDGRAQAEAALRARDEFLGLAAHELKTPLTALFLELGAAGREATR
FT                   RGDEPVQGHLTRADRAARRLAELVSRLLVDARAAAEPLALEEVELGSLANDAVDARREL
FT                   FDRARCDVTVRAEGPVSGRWDRTRVDRALASLLANAAKYGQGRPIEVTVRAEGAQARLS
FT                   VRDHGIGIPPERRAAIFDRYARAVSARHYGGLGLGLWIARREALALGGTVTVESRPGHG
FT                   AEFTLRLPAGAAPPLRRLPRAAGGLARAPARALRWLAWRSRRC"
FT   gene            complement(210341..210769)
FT                   /locus_tag="AnaeK_0185"
FT   CDS_pept        complement(210341..210769)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0185"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ade:Adeh_0176 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71428"
FT                   /db_xref="UniProtKB/TrEMBL:B4ULI1"
FT                   /protein_id="ACG71428.1"
FT                   /translation="MPFEPAFMSRLEAFQAELAEVRAPAEWMAFRARWFTDLPWPRRTP
FT                   EALAAARGDGAPWVVAGRTFRRAPLPDDLTPEARYAYFSALARGFAAMYPHDAPGTGGS
FT                   AVRHHCPACELFSDEPGDPTCPGCGRPLLAMRLAPPPR"
FT   gene            210847..211440
FT                   /locus_tag="AnaeK_0186"
FT   CDS_pept        210847..211440
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0186"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: thiopurine S-methyltransferase;
FT                   Methyltransferase type 11; Methyltransferase type 12; KEGG:
FT                   mem:Memar_1121 methyltransferase type 11"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71429"
FT                   /db_xref="GOA:B4ULI2"
FT                   /db_xref="InterPro:IPR008854"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:B4ULI2"
FT                   /protein_id="ACG71429.1"
FT                   /translation="MADSQRRVFDDRYREGTPPWDIGRPQAELVALAEAGEIVGDVLDV
FT                   GCGTGENALHLAALGKRVMGVDGSPTAIARALEKAAARGLQVPFLVADALDLKALHRRF
FT                   ETAVDCGLFHVFDRADRRTYAQSLTEVLSPGSTLHLLCFSDEEPPGPGPHRISESDVRD
FT                   AFRSIFALTRLREARFERLGAEPARAWLATLVRI"
FT   gene            complement(211675..212472)
FT                   /locus_tag="AnaeK_0187"
FT   CDS_pept        complement(211675..212472)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0187"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ade:Adeh_0177 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71430"
FT                   /db_xref="GOA:B4ULI3"
FT                   /db_xref="InterPro:IPR036777"
FT                   /db_xref="UniProtKB/TrEMBL:B4ULI3"
FT                   /protein_id="ACG71430.1"
FT                   /translation="MTLRSLLRASFLLALVAAAPAARAGGFSTTNVQLLQGWNFDKAID
FT                   TSFAGKLKDGTKTTLTLNHFSTWEYGDNFAFFDLSRGRFEADDTQWTDAYVEWHPRLFV
FT                   NQLLGQKEPLFGVIRNWGFAGEVNQGAGFYAYMGGLGLDFAVPAGWVLGLNAYYRYDNF
FT                   NRHGWQVSPFWTVPFTVGKVPFLFTGFIDVNGLKDEGGFYTGSDNGVEIWSQPQLLVDA
FT                   LAPFGGKAGKLYVGVEWWLHYYSLGSFEETSSAPQAMVQWTVF"
FT   sig_peptide     complement(212398..212472)
FT                   /locus_tag="AnaeK_0187"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.991 at
FT                   residue 25"
FT   gene            complement(212518..213564)
FT                   /locus_tag="AnaeK_0188"
FT   CDS_pept        complement(212518..213564)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0188"
FT                   /product="Arginine N-succinyltransferase"
FT                   /EC_number="2.3.1.109"
FT                   /note="PFAM: arginine N-succinyltransferase beta subunit;
FT                   KEGG: ade:Adeh_0178 arginine succinyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71431"
FT                   /db_xref="GOA:B4ULI4"
FT                   /db_xref="InterPro:IPR007041"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:B4ULI4"
FT                   /protein_id="ACG71431.1"
FT                   /translation="MLLLRDAQKTDLAGLAALAKVLNTVNLPYDERALSGIVDRSVRSF
FT                   AGKIRDPLERAYVFVAEEPRTRRIVGTSMIIAQHGTRESPCTFFDVSEREHYSSTIDRH
FT                   FKHQVLSIGYHFDGPTEIGGLVVHPGLRGGEARAGKQLAFVRFLYMAMFRDRFRERVLA
FT                   ELMPPLTKDGRSLFWEAFGKRFTDLDYQEADKKSRENKEFIQQLFPPSDVYATLFPPAV
FT                   RRLLGKVGPDTEPVRRMLEKIGFRYVDRIDPFDGGPHYEATLADITLVRAYRRARLAPE
FT                   PLDGELHGGEDCLIAVTRGEGRTRFRAVRTGARLDGTNVWIPQRAREVLDGRPGERVHV
FT                   VPFDGGAR"
FT   gene            213708..214169
FT                   /locus_tag="AnaeK_0189"
FT   CDS_pept        213708..214169
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0189"
FT                   /product="D-tyrosyl-tRNA(Tyr) deacylase"
FT                   /note="PFAM: D-tyrosyl-tRNA(Tyr) deacylase; KEGG:
FT                   ade:Adeh_0179 D-tyrosyl-tRNA deacylase"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71432"
FT                   /db_xref="GOA:B4ULI5"
FT                   /db_xref="InterPro:IPR003732"
FT                   /db_xref="InterPro:IPR023509"
FT                   /db_xref="UniProtKB/TrEMBL:B4ULI5"
FT                   /protein_id="ACG71432.1"
FT                   /translation="MEGRVRAVIQRVSRAEVRVGGAATGAIGRGLLVLLGVARDDGAPD
FT                   ARLLADKIAALRIFEDAAGKMNLAVAEVGGALLVVSQFTLLGDARRGNRPGFSDAAPPE
FT                   AANALYESVCGMLREKGLRVETGVFRAEMEVELVNDGPVTILLDSRRLF"
FT   gene            214182..214526
FT                   /locus_tag="AnaeK_0190"
FT   CDS_pept        214182..214526
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0190"
FT                   /product="histidine triad (HIT) protein"
FT                   /note="PFAM: histidine triad (HIT) protein; KEGG:
FT                   ade:Adeh_0180 histidine triad (HIT) protein"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71433"
FT                   /db_xref="GOA:B4ULI6"
FT                   /db_xref="InterPro:IPR001310"
FT                   /db_xref="InterPro:IPR011146"
FT                   /db_xref="InterPro:IPR019808"
FT                   /db_xref="InterPro:IPR036265"
FT                   /db_xref="UniProtKB/TrEMBL:B4ULI6"
FT                   /protein_id="ACG71433.1"
FT                   /translation="MSECLFCKIVRGEIPAKLVHQDAETVAFVDINPQAPTHLLVIPRK
FT                   HIPTVNELAAEDEALMGKLYRVAAALAKERGIDGSGWRAVVNTHGDAGQTVFHVHLHLL
FT                   GGRRMGWPPG"
FT   gene            complement(214543..215388)
FT                   /locus_tag="AnaeK_0191"
FT   CDS_pept        complement(214543..215388)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0191"
FT                   /product="SNF2 superfamily protein"
FT                   /note="KEGG: cre:CHLREDRAFT_6783 SNF2 superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71434"
FT                   /db_xref="UniProtKB/TrEMBL:B4ULI7"
FT                   /protein_id="ACG71434.1"
FT                   /translation="MTALPAIALGLGLALGQAAPERGGDAGQAASPAPPAASAAQGTAP
FT                   PAAGPRPYEGTEEPGAAGNGDAQRRSDAPARDDAAGRAERAAAAAQAERAAAAAQAERA
FT                   TVAAQAERAAIAAQAEMDQLRTQVEALRAEVEALRASGAEAEAHTAAVEQELAEARARR
FT                   AAEADAAARSPEERAQATGGALQRMDGALRALAAGDASGVDAALAGDAAALEAARAEAG
FT                   RRGSAEEAAQAEAGARSLAAAREALARGDLYQARLLLGSAARSAAAANRLARQGAAPAP
FT                   "
FT   sig_peptide     complement(215332..215388)
FT                   /locus_tag="AnaeK_0191"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.830) with cleavage site probability 0.488 at
FT                   residue 19"
FT   gene            215496..216389
FT                   /locus_tag="AnaeK_0192"
FT   CDS_pept        215496..216389
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0192"
FT                   /product="Citryl-CoA lyase"
FT                   /EC_number="4.1.3.34"
FT                   /note="PFAM: HpcH/HpaI aldolase; KEGG: ade:Adeh_0181
FT                   citryl-CoA lyase"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71435"
FT                   /db_xref="GOA:B4ULI8"
FT                   /db_xref="InterPro:IPR005000"
FT                   /db_xref="InterPro:IPR011206"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:B4ULI8"
FT                   /protein_id="ACG71435.1"
FT                   /translation="MPVVRPRRSALYLPGSNARALEKARTLPADALILDLEDAVAPAAK
FT                   DAARAQVVAALAQGGFGRRERVVRVNGLGTPWGAADLAALARAGADAICLPKVERAAEV
FT                   HAAVQALAAGHAPAGLALWCMVETPRGVLAADEIAGASPRVACLVAGTSDLVKDLGARH
FT                   TAGRAEVLTSLSLVLLAARAHGLAALDGVFLDLEDAAGLEAACRQGRDLGFDGKTLIHP
FT                   KQLEAANRAFAPDDAELERARRVIAAHAEAEAAGLGVTVVDGRLVEALHVAAARRTVAL
FT                   AEAVAAGHGGPDPHGR"
FT   gene            216462..216815
FT                   /locus_tag="AnaeK_0193"
FT   CDS_pept        216462..216815
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0193"
FT                   /product="chorismate mutase"
FT                   /note="TIGRFAM: chorismate mutase; PFAM: Chorismate mutase
FT                   of the AroH class; KEGG: ade:Adeh_0182 chorismate mutase"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71436"
FT                   /db_xref="GOA:B4ULI9"
FT                   /db_xref="InterPro:IPR008243"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:B4ULI9"
FT                   /protein_id="ACG71436.1"
FT                   /translation="MRGIRGATQCSANTVEAIEDAVKELCREITSRNQLEPQQIVWAIF
FT                   TVTHDLDADFPARAARVQGWNAVPMICSQEIPVPGSMPRIVRVLLHVDSDGPRNHVYLR
FT                   GAQALRPDLHVRP"
FT   gene            216844..217710
FT                   /locus_tag="AnaeK_0194"
FT   CDS_pept        216844..217710
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0194"
FT                   /product="Prephenate dehydrogenase"
FT                   /note="PFAM: Prephenate dehydrogenase; 6-phosphogluconate
FT                   dehydrogenase NAD-binding; KEGG: ade:Adeh_0183 prephenate
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71437"
FT                   /db_xref="GOA:B4ULJ0"
FT                   /db_xref="InterPro:IPR003099"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B4ULJ0"
FT                   /protein_id="ACG71437.1"
FT                   /translation="MNAQTNRPLPALPGHLGVVGLGLMGASLARAARRVDRGVRITAVE
FT                   PRAEVRARALADGVADHVAAAPDAALAGCGVVVLCTPVATIEALLAPVSALLADGAVLT
FT                   DVGGAKERVVALARERVRPGVAFVGAHPMFGGHGGYDGATAEKWSAGGTVAICTDGDPG
FT                   AVDRVAALHLALGAKVERCTAAEHDAAVAMVSHLPYLVASALSVAVREAGPLAMHLAGP
FT                   GLKDATRLAEFPFDIQGEVARRNAHLPEAARRLERHLARLLAAIAESPESARSALEAAR
FT                   AAREELF"
FT   sig_peptide     216844..216939
FT                   /locus_tag="AnaeK_0194"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.609) with cleavage site probability 0.538 at
FT                   residue 32"
FT   gene            217707..219029
FT                   /locus_tag="AnaeK_0195"
FT   CDS_pept        217707..219029
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0195"
FT                   /product="3-phosphoshikimate 1-carboxyvinyltransferase"
FT                   /note="TIGRFAM: 3-phosphoshikimate
FT                   1-carboxyvinyltransferase; PFAM: EPSP synthase
FT                   (3-phosphoshikimate 1-carboxyvinyltransferase); KEGG:
FT                   ade:Adeh_0184 3-phosphoshikimate 1-carboxyvinyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71438"
FT                   /db_xref="GOA:B4ULJ1"
FT                   /db_xref="InterPro:IPR001986"
FT                   /db_xref="InterPro:IPR006264"
FT                   /db_xref="InterPro:IPR013792"
FT                   /db_xref="InterPro:IPR023193"
FT                   /db_xref="InterPro:IPR036968"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4ULJ1"
FT                   /protein_id="ACG71438.1"
FT                   /translation="MSAAPTSGPLTCRRAGPLRGAIEVPGDKSISHRSLLFGALSTGET
FT                   RVTGLLDAEDVHSTRRAVEALGATVRDEGAEVVVTPPATLREPGDVIDCGNSGTSLRLL
FT                   TGVLSGVPGLSVLTGDASLRRRPVRRVIDPLRVMGADLSARDGDRLPPVVVRGGPLRGA
FT                   RHLLPVASAQVKSALLLAGLFADGETAVVEPEKSRDHTERMLRGMGVPVRVSGLEVSVS
FT                   AARPAGGRVDVPGDISSAAFFLCGAAALPGSEVTVRNLGVNETRTGLLDVLRAMGADVR
FT                   LADLREVAGEPRADVTVRADRLEGTEIRGATIPRLIDELPAVMVMATQARGRTVIRDAK
FT                   ELRVKESDRLAAMGETLARAGARIELFEDGCAIDGPTPLRGVEVRTRLDHRIAMAMAVA
FT                   QLFCGGEPVVLDDVACVATSFPGFFRLLDQVSGPASGGGAP"
FT   gene            219026..219862
FT                   /locus_tag="AnaeK_0196"
FT   CDS_pept        219026..219862
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0196"
FT                   /product="shikimate 5-dehydrogenase"
FT                   /note="TIGRFAM: shikimate 5-dehydrogenase; PFAM:
FT                   Shikimate/quinate 5-dehydrogenase; Shikimate dehydrogenase
FT                   substrate binding domain protein; KEGG: ade:Adeh_0185
FT                   shikimate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71439"
FT                   /db_xref="GOA:B4ULJ2"
FT                   /db_xref="InterPro:IPR013708"
FT                   /db_xref="InterPro:IPR022893"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR041121"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4ULJ2"
FT                   /protein_id="ACG71439.1"
FT                   /translation="MITGRTALYGVVGHPVAHSRSPEMQNAAFARLGVDAIYVALPVAP
FT                   ERIDEALRGAHALGFQGLNVTVPHKPRAASLCHALDPVATAVGAANTLRRTRDGWEGFN
FT                   TDAPACRSLLEAAGVARGSRALLVGAGGAARAAAWALVQLGTELRVAARREEAAAELCR
FT                   DLAAAVPGADLAAADFEDLEAEADAAAVVVNGTSVGLPGHEGRLPPLRFRADQVVLDFV
FT                   YGDTDLARAARAAGARLVSGEQVLVRQGALAFTIWTGQPAPEADMARALEAREGAR"
FT   gene            219859..221004
FT                   /locus_tag="AnaeK_0197"
FT   CDS_pept        219859..221004
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0197"
FT                   /product="Chorismate synthase"
FT                   /EC_number="4.2.3.5"
FT                   /note="PFAM: chorismate synthase; KEGG: ade:Adeh_0186
FT                   chorismate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71440"
FT                   /db_xref="GOA:B4ULJ3"
FT                   /db_xref="InterPro:IPR000453"
FT                   /db_xref="InterPro:IPR020541"
FT                   /db_xref="InterPro:IPR035904"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4ULJ3"
FT                   /protein_id="ACG71440.1"
FT                   /translation="MTLRYLTAGESHGPALVAIAEGFPAGLAVDFEAVDRDLRRRQKGY
FT                   GRGGRMKIETDAAQFLAGLRGGLTTGAPIALAVWNKDHENWKDLVSPYARGGRKFTQVR
FT                   PGHADLAGALKYGLDDARDVLERASARSTAVTVALGALAKALLSTLGVEVCSRVVAIGP
FT                   REIRPDAPPTPAQRDAIEASDLHVDDEALAAEWRALIDAEKARGGSIGGAFDVYATGLP
FT                   IGVGSHVHPDRRLDARLAGALCGVQAIRAVEIGDGTQVGRPGYEFHDAIHHDPARGFWR
FT                   ETNRAGGLEGGMTDGMPLRVRAYMKPIPTMLHPLATVDLATRAATQARYERSDVCAVPA
FT                   AAVVGEAVVAWELANALLEKFGGDAVEDVRRAVEAYAARIR"
FT   gene            220985..221473
FT                   /locus_tag="AnaeK_0198"
FT   CDS_pept        220985..221473
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0198"
FT                   /product="Shikimate kinase"
FT                   /EC_number="2.7.1.71"
FT                   /note="PFAM: shikimate kinase; KEGG: ade:Adeh_0187
FT                   shikimate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71441"
FT                   /db_xref="GOA:B4ULJ4"
FT                   /db_xref="InterPro:IPR000623"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031322"
FT                   /db_xref="UniProtKB/TrEMBL:B4ULJ4"
FT                   /protein_id="ACG71441.1"
FT                   /translation="MPLGSAETLALTGMMGSGKSTVAPLLARWLGRRLVRLDDEIVRAA
FT                   GKPIARVFAEDGEGRFRALERAAVAALPPGAVADLGGGAFCDPHGAARLLATARVVFLD
FT                   VSAQEAARRIGEDPARPLAARWEALLARRLPLYRRAHLTVHVDGLTPEAVARRVLESL"
FT   gene            221470..222633
FT                   /locus_tag="AnaeK_0199"
FT   CDS_pept        221470..222633
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0199"
FT                   /product="3-dehydroquinate synthase"
FT                   /EC_number="4.2.3.4"
FT                   /note="PFAM: 3-dehydroquinate synthase; KEGG: ade:Adeh_0188
FT                   3-dehydroquinate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71442"
FT                   /db_xref="GOA:B4ULJ5"
FT                   /db_xref="InterPro:IPR030960"
FT                   /db_xref="InterPro:IPR030963"
FT                   /db_xref="UniProtKB/TrEMBL:B4ULJ5"
FT                   /protein_id="ACG71442.1"
FT                   /translation="MSPTRKPAAASEEHEAGAAVTEIIPARQGEHAYEVRVGPGAAAAL
FT                   PALADEHDAVALVSCRKVLSTPFGKDVLARLRREAPLALVHALPDGEAGKTLAELERAA
FT                   AKLLRAGATRRTLVVALGGGAVSDAAGFLAATYMRGVPWVAVPTTLLAMVDAAIGGKTA
FT                   VNLPTAKNAVGAFHPPDAVLADPAALRTLPRRELASGLGEVLKYGALQPALLDAFAALG
FT                   AAAPDPAVIATCARMKVDVVAEDPTEHGPRKLLNLGHTFGHGVEAAGRFSRYTHGEAVA
FT                   VGLAFAFRLAARMGRVDGAAVARVEGAVAGAGLPVRVPPAIARAAARLMAYDKKRAAGG
FT                   LRWVLPAAVEDGWRVEWDVEAEPAAVEAAVAEISEARAGGRAARRAR"
FT   gene            222630..223100
FT                   /locus_tag="AnaeK_0200"
FT   CDS_pept        222630..223100
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0200"
FT                   /product="3-dehydroquinate dehydratase, type II"
FT                   /EC_number="4.2.1.10"
FT                   /note="TIGRFAM: 3-dehydroquinate dehydratase, type II;
FT                   PFAM: dehydroquinase class II; KEGG: ade:Adeh_0189
FT                   3-dehydroquinate dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71443"
FT                   /db_xref="GOA:B4ULJ6"
FT                   /db_xref="InterPro:IPR001874"
FT                   /db_xref="InterPro:IPR018509"
FT                   /db_xref="InterPro:IPR036441"
FT                   /db_xref="UniProtKB/TrEMBL:B4ULJ6"
FT                   /protein_id="ACG71443.1"
FT                   /translation="MILVVNGPNLNLLGEREPDVYGRSTLGDVELLVRDACAAWDVEVK
FT                   AFQSNHEGAIIDFLQEHRKQARGIILNAGALTHTSYALHDCLKAMPAPAVEVHISNIHQ
FT                   REAFRHVSVIAPACRGQIVGLGIRGYLLAAEWLCAEIGAQPRVAADRKKPSP"
FT   gene            223110..224114
FT                   /locus_tag="AnaeK_0201"
FT   CDS_pept        223110..224114
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0201"
FT                   /product="glycosyl transferase family 2"
FT                   /note="PFAM: glycosyl transferase family 2; KEGG:
FT                   ade:Adeh_0190 glycosyl transferase, family 2"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71444"
FT                   /db_xref="GOA:B4ULJ7"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:B4ULJ7"
FT                   /protein_id="ACG71444.1"
FT                   /translation="MPRVAVLLPARDAARTVRAAAVSILRQTERDLSLVCVDDGSRDAT
FT                   AEVLERLAARDRRVRLLRGPGEGIAGALQRGLAACDAEVVARMDADDVAHPRRLALQLD
FT                   ALRADPSLAALGGRVRLFPRTAVRPGMARYAAWLNGLVTPALVERDLLVEAPLVHPAAA
FT                   IRRDALERAGGWRDGPFPEDYDLWLRLSAAGGRLGNLSAPVLAWRESAGRLTRTDPRYA
FT                   LARHVALKCAHLARHVLGGAREVALWGAGETGRAFSDALRAEGIATAAFVEVDRRKIGR
FT                   TVRGARVVSYEEVGRLRGLPLLVAVGAPGARELIRAELARAGFEELADFRCVA"
FT   gene            complement(224280..224759)
FT                   /locus_tag="AnaeK_0202"
FT   CDS_pept        complement(224280..224759)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0202"
FT                   /product="bacterioferritin"
FT                   /note="TIGRFAM: bacterioferritin; PFAM: Ferritin Dps family
FT                   protein; KEGG: ade:Adeh_0191 bacterioferritin"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71445"
FT                   /db_xref="GOA:B4ULJ8"
FT                   /db_xref="InterPro:IPR002024"
FT                   /db_xref="InterPro:IPR008331"
FT                   /db_xref="InterPro:IPR009040"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="UniProtKB/TrEMBL:B4ULJ8"
FT                   /protein_id="ACG71445.1"
FT                   /translation="MKGDAKVLDVLSEVLMNELTAINQYFLHARICENWGYDRLYAKFR
FT                   AESIDEMKDADHLIERILYLEGMPNVQKLSKVNIGENVPEILAADLDLEKHAIGALNRG
FT                   IETCRNAGDNGSADLLEDILEGEEEHANWLETQLTAIDQIGVQNYLAEQLKKDGG"
FT   gene            complement(224880..225428)
FT                   /pseudo
FT                   /locus_tag="AnaeK_0203"
FT   gene            complement(225089..225328)
FT                   /locus_tag="AnaeK_0204"
FT   CDS_pept        complement(225089..225328)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0204"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bbr:BB0215 ferric uptake regulation protein"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71446"
FT                   /db_xref="UniProtKB/TrEMBL:B4UM38"
FT                   /protein_id="ACG71446.1"
FT                   /translation="MHPPRDPVPSSATPEPSCALVCTRCGAVVAIDPDLRALAASAASR
FT                   NGFEVRAPRLRLFGCCAACRAGAAGPLPRGWGRA"
FT   gene            225503..226555
FT                   /locus_tag="AnaeK_0205"
FT   CDS_pept        225503..226555
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0205"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ade:Adeh_0193 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71447"
FT                   /db_xref="InterPro:IPR025409"
FT                   /db_xref="UniProtKB/TrEMBL:B4UM39"
FT                   /protein_id="ACG71447.1"
FT                   /translation="MPDSFDLGAFRRDLTRRTADAVHALRSRIGSETLYGFALFTSGER
FT                   DFAWVRASANTEDALTRRAAAAAALDPRFRGEAGRRLLRWSAPDWEYHDFAPEVRGLAV
FT                   PPPEGRRPTLDPALYDAFVGALKAVDRAGLFGRGADRAFLTVNILCDHASPAFFRRGLR
FT                   VLNPVPTAERHLHETAAAPFVRCVNRAPRRERMRIWLALYEDLYMEWRTPIAEEARARG
FT                   LSPWEVEEELARFGPKVVPALIDLLAHYGFAAPIDHNRGFETREVWLAGSALFLVRRIG
FT                   MVAEAEIARLQRLVGDFAERDRRLRVASTLAENTARVLHELRPRRFPPSEMDPLTCKLT
FT                   NPEPFLLRRP"
FT   gene            226590..227405
FT                   /locus_tag="AnaeK_0206"
FT   CDS_pept        226590..227405
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0206"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ade:Adeh_0194 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71448"
FT                   /db_xref="GOA:B4UM40"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B4UM40"
FT                   /protein_id="ACG71448.1"
FT                   /translation="MTDRRRRARPAAPRPPPHDRHVLYERAVQHADSELDLVDRAVRRG
FT                   GGTPRRLREDFSGTALLSAAWVRRGRGRSAVAVDLDAAVHDWARAHRVPGLGAAAARLR
FT                   LVEADVREGPPGPFDAVIAFNFSYGVLQTREALGAYLAAAAGALAPRGALLLDAYGGWD
FT                   AEKELVERRRIGGGVSYVWEQESFDPITRRVRCAIHFELPGGRRLRRAFTYDWRLWTVP
FT                   ELTELVREAGLEPEVLWDVAPRGATRYVPRRSASNQGGWIAYVVGRRRP"
FT   gene            complement(227402..228310)
FT                   /locus_tag="AnaeK_0207"
FT   CDS_pept        complement(227402..228310)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0207"
FT                   /product="pseudouridine synthase, RluA family"
FT                   /note="TIGRFAM: pseudouridine synthase, RluA family; PFAM:
FT                   RNA-binding S4 domain protein; pseudouridine synthase;
FT                   KEGG: ade:Adeh_0195 pseudouridine synthase, RluD"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71449"
FT                   /db_xref="GOA:B4UM41"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR006225"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:B4UM41"
FT                   /protein_id="ACG71449.1"
FT                   /translation="MRRLTLLVPDADRYERIDRFIAARGGISRGLARRAIEAGGVFVDG
FT                   RRCKVAGRTLTPGQQVVVNLEEGGRAAPALAALGRERLLYADADLCAVDKPAGVPAQPT
FT                   LTTDRGALPELVSALLGAPVTLVHRLDRETSGVTVFARTRDAAAALAEAFRTGTPEKTY
FT                   LALCARAPSPAEGRVALALGKDPARPGLRRVDPAGDPAATRYRTLREAPGGARVEARPE
FT                   TGRTHQIRVHLAALGAPLLGDARYGGPRRVGEVAVPRVMLHATRLELPHPATGARMVFE
FT                   AEPPEDFRAIEAALVGPPPER"
FT   gene            complement(228328..228603)
FT                   /locus_tag="AnaeK_0208"
FT   CDS_pept        complement(228328..228603)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0208"
FT                   /product="regulatory protein, FmdB family"
FT                   /note="TIGRFAM: regulatory protein, FmdB family; PFAM:
FT                   Putative regulatory protein FmdB; KEGG: ade:Adeh_0196
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71450"
FT                   /db_xref="InterPro:IPR013429"
FT                   /db_xref="UniProtKB/TrEMBL:B4UM42"
FT                   /protein_id="ACG71450.1"
FT                   /translation="MPIYEYECPKCGRFDALQKMSDPALQVHEVCGSKVRKLMSASAFA
FT                   FKGSGFYITDYGGKSAAAITPDRKPEKKAEPKSEACASCPANKSAA"
FT   gene            228781..230160
FT                   /locus_tag="AnaeK_0209"
FT   CDS_pept        228781..230160
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0209"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ade:Adeh_0197 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71451"
FT                   /db_xref="UniProtKB/TrEMBL:B4UM43"
FT                   /protein_id="ACG71451.1"
FT                   /translation="MDAQERDRLAGELDALATALEEARGRHAAGLDAEPSLAPLFAAHS
FT                   EAAHRRTVDALREAGEEALAARVAALRAGRAAAAGEEAWRAAEAAARGRGPDGEAPLAT
FT                   LELAALRERDRERRLALARAAAAALEPAAAHREAACEAAARARAEVGHAPDWRVVVEGD
FT                   QLLAASDDAWRDVLAYRARAELALAPLPSGDLARADLLHLAALARWDGLFRAGMLPVAL
FT                   KLTLEPLGLDGRARVDAAERPAQWPGVHVHGARISFRPRGGAGDWQDLAEGVGRALGAA
FT                   AAPPHRRDPVLGAALGWLLGSLLFEPRWLADRAGVERRQAADVVRDLALRRLLALRARA
FT                   GALRVATEVERGLSGARWREAYVEAMEGATGARWEGVRAARDADAAAHAAALRGADAGE
FT                   RLRRDLRERLDEDWWRNPRAAALLAGLLAAGALPPEPGDATPAPGDAARALAARLEGKA
FT                   P"
FT   gene            complement(230157..230510)
FT                   /locus_tag="AnaeK_0210"
FT   CDS_pept        complement(230157..230510)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0210"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ade:Adeh_0198 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71452"
FT                   /db_xref="UniProtKB/TrEMBL:B4UM44"
FT                   /protein_id="ACG71452.1"
FT                   /translation="MARMETKKKGTTAVVTEGSAQAALRRGPARELTPEEERVMRMRLG
FT                   AAPPRAAPLERSAEGLSDLEIEVLSYEIEAYMKWRAREQAAAPATAPVRAPAAAAPSRA
FT                   KEKIIRALRKKGF"
FT   gene            230755..231207
FT                   /locus_tag="AnaeK_0211"
FT   CDS_pept        230755..231207
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0211"
FT                   /product="CoA-binding protein"
FT                   /note="KEGG: ade:Adeh_0199 CoA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71453"
FT                   /db_xref="GOA:B4UM45"
FT                   /db_xref="InterPro:IPR003781"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B4UM45"
FT                   /protein_id="ACG71453.1"
FT                   /translation="MADWRENLIERDEDIRRLLAPVRRVAVLGIKTEAQSDQAAFYVPR
FT                   YLKDAGVEVVPVPVYYPEVKTILGAPVYRTVAAIPGTVDLVNVFRRPADVPAHVDDLVA
FT                   KRPAVVWLQLGIRNDVAAEALARAGIRVVQDRCLMVEWRRLGPAEH"
FT   gene            complement(231232..231402)
FT                   /locus_tag="AnaeK_0212"
FT   CDS_pept        complement(231232..231402)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0212"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71454"
FT                   /db_xref="UniProtKB/TrEMBL:B4UM46"
FT                   /protein_id="ACG71454.1"
FT                   /translation="MAKLESVEGYGVLVLAVALLAAFTLRMSNPPADVVRAASAPRAVT
FT                   VLEEISIPLAP"
FT   gene            complement(231579..232535)
FT                   /locus_tag="AnaeK_0213"
FT   CDS_pept        complement(231579..232535)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0213"
FT                   /product="cytochrome oxidase assembly"
FT                   /note="PFAM: cytochrome oxidase assembly; KEGG:
FT                   ade:Adeh_0200 cytochrome oxidase assembly protein"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71455"
FT                   /db_xref="GOA:B4UM47"
FT                   /db_xref="InterPro:IPR003780"
FT                   /db_xref="UniProtKB/TrEMBL:B4UM47"
FT                   /protein_id="ACG71455.1"
FT                   /translation="MKAFARFAWSVLAYNLAVVVWGAFVRATGSGAGCGKHWPMCNGEV
FT                   VPRSPALETVIEFTHRATSGVALLLVVALVVAARRTFPAGHPARRWAWASLGLVLVEAL
FT                   VGAGLVLFGWVAKDDSAARGWVVAVHLTNTFLLVGAIALTAALAGRARGLALRGHPGLT
FT                   GALGLAAGALVLTGASGAIAALGDTLFPATSFAEGLRQELSEEAHVLLRLRVLHPFVAV
FT                   FSTLALGWAARSALRARPDADTRAASFAVLLLAGLQLFAGVLNVALLAPVWMQLVHLLV
FT                   ADLLWVALVVLAATALSPPAGAASPAGARSGDAPALG"
FT   gene            complement(232596..233285)
FT                   /locus_tag="AnaeK_0214"
FT   CDS_pept        complement(232596..233285)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0214"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ade:Adeh_0201 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71456"
FT                   /db_xref="UniProtKB/TrEMBL:B4UM48"
FT                   /protein_id="ACG71456.1"
FT                   /translation="MRTAFAAGMALAVLASCRTVQTRQEFTPVSDADFGRLGPDQLGPV
FT                   QPARADAAAAHDAVARAKLRLQEAKREQGYAEADRTAAEADLQRAATEAKGANSAGDTA
FT                   WKARAQALADTAGLRRQAADAHLAFAKKLAEARQADVDAAEAHADAAQARLEQAKLQAL
FT                   ARAGIPAAGKYDARRFDAHLAKAVAAEREAQARAGEAGRAAVAAEDGWRALQRQWEARS
FT                   QGRGGTG"
FT   sig_peptide     complement(233217..233285)
FT                   /locus_tag="AnaeK_0214"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.984) with cleavage site probability 0.822 at
FT                   residue 23"
FT   gene            complement(233344..234321)
FT                   /locus_tag="AnaeK_0215"
FT   CDS_pept        complement(233344..234321)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0215"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ade:Adeh_0202 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71457"
FT                   /db_xref="UniProtKB/TrEMBL:B4UM49"
FT                   /protein_id="ACG71457.1"
FT                   /translation="MRRAPLALCLVALACSRSDPEARARVLGREDRPHEPAPAAFDPEH
FT                   PEAALALDADEAARRLGAFDWTAAAEWTVAAPGDEARQVHVTEHHQLRQSATGEFEVRA
FT                   EIDPGLGPGSSGGKQVIWTGGTTYARALPAPFRERPTDRGRDARRFRDDSFRLAGTVAA
FT                   LVGPALRLEPAGEARLLGRAARRYRLSLAPPAPGVKPPAPQPPPPGTPAPDPDTARRLG
FT                   FLQGRVPVAADGELLADAETGVPLRVRLSGAFEVPNAPGVKARIELLAEVKALGAAVGA
FT                   VTAPAGALPDERKPAGPSTALEAAGLKKRGEEPARPGEPADEGE"
FT   sig_peptide     complement(234265..234321)
FT                   /locus_tag="AnaeK_0215"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.837) with cleavage site probability 0.632 at
FT                   residue 19"
FT   gene            complement(234365..236188)
FT                   /locus_tag="AnaeK_0216"
FT   CDS_pept        complement(234365..236188)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0216"
FT                   /product="GTP-binding proten HflX"
FT                   /note="TIGRFAM: GTP-binding proten HflX; PFAM: GTP-binding
FT                   protein HSR1-related; KEGG: ade:Adeh_0203 GTP-binding
FT                   protein, HSR1-related"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71458"
FT                   /db_xref="GOA:B4UM50"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR016496"
FT                   /db_xref="InterPro:IPR025121"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030394"
FT                   /db_xref="InterPro:IPR032305"
FT                   /db_xref="InterPro:IPR042108"
FT                   /db_xref="UniProtKB/TrEMBL:B4UM50"
FT                   /protein_id="ACG71458.1"
FT                   /translation="MQEVHGNTLGLKPSQLHALRRTYRRRVDAQSIVTPELARHLAEVS
FT                   RETNRQVGVLLDRKGDVQAVVVGDARKLDLPDVGRGRAGESRLRGLRLVHTHLNGEPLT
FT                   RDDHTDLALLRLDLVAAIEVREDGLPGRVHYAHLLPENPQGAMWKDEEAPTVHDLAYDA
FT                   LSGALALEDEFARARAARRTGGRERAILVGFGGKGRGRAEAEASLEELKELARTAGVEV
FT                   LEATLQLRRDPDPRYLIGKGKLEDIVLRSMQRMATVIVFDAELSPSQARHIAEATSLKI
FT                   LDRTQLILDIFAQRAQSADGKLQVELAQLKYLYPRLVGRDDSLSRLAGGIGGRGPGETK
FT                   LEIDRRRVRDRITALERRIEALGADRHLRRKQRNARGLPVLSIVGYTNAGKSTLLNALT
FT                   DSAVLAEDKLFATLDPTSRRLRFPRDREVIITDTVGFIRDLPPDLVNAFRATLEELGDA
FT                   DLLLHVVDASDPRQDEQIAAVEEILRGLGLDGKRRLLVLNKVDRLPPETRAALAQRRDA
FT                   AAVSAVTRAGLAGLLSRCEQLLWTDGRVALGDVIAAPAGEEGAGAAEPLADVAAPEPLA
FT                   PEPPAPAAASVPGPGEPGPPRLLPSSLRRVS"
FT   gene            complement(236311..236586)
FT                   /locus_tag="AnaeK_0217"
FT   CDS_pept        complement(236311..236586)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0217"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ade:Adeh_0204 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71459"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:B4UM51"
FT                   /protein_id="ACG71459.1"
FT                   /translation="MELAIALDANAIRMDGVLDVPTARRLAAQLAIAPAGSLVRIDLTH
FT                   VRELHDFGLAVLAQALSARGIRVSFRGLGQHQLRLLRYLGLDAVAA"
FT   gene            236892..237182
FT                   /locus_tag="AnaeK_0218"
FT   CDS_pept        236892..237182
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0218"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ade:Adeh_0205 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71460"
FT                   /db_xref="GOA:B4UM52"
FT                   /db_xref="UniProtKB/TrEMBL:B4UM52"
FT                   /protein_id="ACG71460.1"
FT                   /translation="MNRFIVRRRADGVVHLRRRSFRHLLVDRIAWTMALLFVATAAGMT
FT                   ALVAALVEFPLVVILLAPVVGLGIWAGRLARGDGLQPAPAPVDPRPPRRVA"
FT   sig_peptide     236892..237041
FT                   /locus_tag="AnaeK_0218"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.981) with cleavage site probability 0.758 at
FT                   residue 50"
FT   gene            237376..238623
FT                   /locus_tag="AnaeK_0219"
FT   CDS_pept        237376..238623
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0219"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: General substrate transporter; major
FT                   facilitator superfamily MFS_1; KEGG: ade:Adeh_0206 major
FT                   facilitator superfamily transporter"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71461"
FT                   /db_xref="GOA:B4UM53"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B4UM53"
FT                   /protein_id="ACG71461.1"
FT                   /translation="MDSPAQSARAGAGTVLNAAVVVAALGYFVDIYDLILFNIVRIPSL
FT                   TAIGVSGDALVSEGLSVLNWQMVGMLLGGIVFGIVGDKLGRLHILFGSITLYSIATIAN
FT                   GFVHDLATYKALRFVAGLGLAGELGAGVTLVAEILPARLRGYGTMLVASVGVSGAIVGN
FT                   VVAKTLDWRVAYWVGGGLGLLLLVLRIKVSESGMFQALRHTAVRRGDFLAVFRGGERFR
FT                   RYLSSILIGVPIWCSNAILVALAPEFGRTLGVTGPVTAGDAVMFFYGGLVLGDLSSGFL
FT                   SQAWRSRRKVVLLFVALLAAANVFYFVAGRGASPALFLGACGLLGIAGGYWAIFVTVAA
FT                   EQFGTNLRATVATTVPNFVRGLVPVCTLSFQWARPHLGLVGAAAAVSALWFGLALVSAF
FT                   GLRETFGVDLDYVEAD"
FT   gene            238626..239144
FT                   /locus_tag="AnaeK_0220"
FT   CDS_pept        238626..239144
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0220"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ade:Adeh_0207 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71462"
FT                   /db_xref="GOA:B4UM54"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:B4UM54"
FT                   /protein_id="ACG71462.1"
FT                   /translation="MSAYVVDVEADGPIPGKYSMVSFGAVRVEPGLSRTFRGEVRPISD
FT                   LWLPEALAISAVTREQHLRFGEPGEVMAAFERWIQETTKGKPVLFSDNLSFDWQWMNWY
FT                   FHTYLGRNPFGWSGRRIGDLYCGMVKDGHAQWKHLRPTAHDHDPVNDAKANAGVLLQLV
FT                   DMGLKLNLK"
FT   gene            239152..239760
FT                   /locus_tag="AnaeK_0221"
FT   CDS_pept        239152..239760
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0221"
FT                   /product="Lysine exporter protein (LYSE/YGGA)"
FT                   /note="PFAM: Lysine exporter protein (LYSE/YGGA); KEGG:
FT                   ade:Adeh_0208 lysine exporter protein (LysE/YggA)"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71463"
FT                   /db_xref="GOA:B4UM55"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:B4UM55"
FT                   /protein_id="ACG71463.1"
FT                   /translation="MTLFAQGALLGLSAAAQPGPYQAYLLAQSLRNGAVRTLPVVLVPL
FT                   TSDPPVIAAVLVALAQVPAGLLRALQLAGGAVVLWLALSALRGLRAPLAAPEAKAPPRG
FT                   FWRAVLLNFTNPNAWIFWSAVGGPVLAAAWRDGPADAGGFLAGFYAFLVGGNAGLVAAA
FT                   GGLGRLGPRTQRALTAISGLALLAFGLWQVAKGLSGPRA"
FT   sig_peptide     239152..239223
FT                   /locus_tag="AnaeK_0221"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.944) with cleavage site probability 0.702 at
FT                   residue 24"
FT   gene            complement(239767..240636)
FT                   /locus_tag="AnaeK_0222"
FT   CDS_pept        complement(239767..240636)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0222"
FT                   /product="peptidase M48 Ste24p"
FT                   /note="PFAM: peptidase M48 Ste24p; KEGG: ade:Adeh_0209
FT                   peptidase M48, Ste24p"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71464"
FT                   /db_xref="GOA:B4UM56"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="UniProtKB/TrEMBL:B4UM56"
FT                   /protein_id="ACG71464.1"
FT                   /translation="MHRPSRTPLAALAVLALAAACTGKQRVATETRLASVLIPTEQEKQ
FT                   LGLQVKEQLETKEHVQYLEDPAVNAYVQGVTGKILASAKKDRPDVDWSVKVINDPKTVN
FT                   AFATPGGFLYVYSGLLLAADDTAEVAGVLGHEAGHVVARHSARQMVNAMGLETVMGIAL
FT                   GKNPNGAAQLAAGLAGKGALLAYGRADESEADEYGARYAAAAGYDPHGIATFFQKLEKG
FT                   EGKQPGWTTYLSTHPATPDRIEKVDRYIAEHHLTGTGGRGGAELAKVKERLKAIPPPPA
FT                   PPAQGAGR"
FT   sig_peptide     complement(240553..240636)
FT                   /locus_tag="AnaeK_0222"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.365 at
FT                   residue 28"
FT   gene            240830..241609
FT                   /locus_tag="AnaeK_0223"
FT   CDS_pept        240830..241609
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0223"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ade:Adeh_0210 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71465"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="UniProtKB/TrEMBL:B4UM57"
FT                   /protein_id="ACG71465.1"
FT                   /translation="MSRTRVAVLSTAFAVVAAGVFGLGFLRGAAEASAAPAPPPLSSEY
FT                   PGGAPIDAARIQTGRLTFDRMPAEVSGALELHSAEIVKQAEVLATKQARITGTCAPGSA
FT                   IRVVGQDGTVVCQRFPRGVVSVSSLAGLPRVSTTATTQLSVPGGVGRYQSAGEDDFLVV
FT                   PVDLPDGAVVTGFSFVFWDSDARIDGAAYLYRSDDTAMAALVTKEAADEVRVVSTQDVA
FT                   AQKVDNAAFAYFVYMQLSAAAGPRLVPIAASVAYKLP"
FT   sig_peptide     240830..240928
FT                   /locus_tag="AnaeK_0223"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.541 at
FT                   residue 33"
FT   gene            241675..242826
FT                   /locus_tag="AnaeK_0224"
FT   CDS_pept        241675..242826
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0224"
FT                   /product="glutamate 5-kinase"
FT                   /EC_number="2.7.2.11"
FT                   /note="TIGRFAM: glutamate 5-kinase; PFAM:
FT                   aspartate/glutamate/uridylate kinase; PUA domain containing
FT                   protein; KEGG: ade:Adeh_0211 glutamate 5-kinase"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71466"
FT                   /db_xref="GOA:B4UM58"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001057"
FT                   /db_xref="InterPro:IPR002478"
FT                   /db_xref="InterPro:IPR005715"
FT                   /db_xref="InterPro:IPR011529"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR019797"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR036974"
FT                   /db_xref="InterPro:IPR041739"
FT                   /db_xref="UniProtKB/TrEMBL:B4UM58"
FT                   /protein_id="ACG71466.1"
FT                   /translation="MPLPMSRSALRRVKRLVVKVGTGTLTDRAGRFDRDNCARLASELA
FT                   EVARGRKVVLVSSGAVALGAERLGLARSRGKPWDIPTKQACAAAGQPHLMAAWGEALGR
FT                   HGLVTAQVLLTADDLASRKRFLNARRTFERLLDAGAVPVVNENDTVAVDEIKVGDNDTL
FT                   AALVAGCVEADAVAMLTDVDGLYDRNPAEPGARLLRDVPRVTAEIERSAGGAGSERSVG
FT                   GMITKVKAARRLGAQGVVTALLSGRRARALPALLAGEPVGTVFAPGVHRLSSRQGWLAA
FT                   AARGKGVILVDAGARRALVEQGRSLLPSGVRGVQGQFGVGDPVDVAVDPARPFARGLAG
FT                   YGADEVRRIAGLKTGEIERALGYKYLDEIVHRNDLVVLETGRE"
FT   gene            242829..244112
FT                   /locus_tag="AnaeK_0225"
FT   CDS_pept        242829..244112
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0225"
FT                   /product="gamma-glutamyl phosphate reductase"
FT                   /EC_number="1.2.1.41"
FT                   /note="TIGRFAM: gamma-glutamyl phosphate reductase; KEGG:
FT                   ade:Adeh_0212 glutamate-5-semialdehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71467"
FT                   /db_xref="GOA:B4UM59"
FT                   /db_xref="InterPro:IPR000965"
FT                   /db_xref="InterPro:IPR012134"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR020593"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4UM59"
FT                   /protein_id="ACG71467.1"
FT                   /translation="MRKEKSLGLAAEMRTLAEASREAARALSHADPRRKDAALRAAAEA
FT                   IGRREKRILSENARDVAAARAAGQNAAYLDRLKLDPKRLAGIAAALHEIAGLRDPVGEV
FT                   TASWRRPNGLEIRKVRIPLGVVLMVYEARPNVTVDAAALCLKSGNAAILRPGSDALRSS
FT                   LALAAAFAEGLEKAGLPAASAQVVPTPDREATYELLALDDLIDLAIPRGGPSLIRAVAE
FT                   RSRVPVLKHYQGVCHLYLDASAPPQQAVDLALNGKVQRPGVCNATECLLVHRGAAGKLL
FT                   PPVGRALADAGVELRCDPTALTILKRAGVAAVPARPDDFGKEFLDRILAVRVVADLDGA
FT                   LDHIARYGSLHTEAIVTRDLASARRFQREVDASAVMVNASTRFNDGGELGLGAEIGIST
FT                   TKLHAFGPMGLAELTTQKFLVEGEGHVR"
FT   gene            244126..244722
FT                   /locus_tag="AnaeK_0226"
FT   CDS_pept        244126..244722
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0226"
FT                   /product="iojap-like protein"
FT                   /note="TIGRFAM: iojap-like protein; PFAM: Iojap-related
FT                   protein; KEGG: ade:Adeh_0213 iojap-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71468"
FT                   /db_xref="GOA:B4UM60"
FT                   /db_xref="InterPro:IPR004394"
FT                   /db_xref="UniProtKB/TrEMBL:B4UM60"
FT                   /protein_id="ACG71468.1"
FT                   /translation="MATKKKAAGKKPFAKKTPSKRAPARRGPPMKAPGKKKGGPAKAPG
FT                   KKGAPKERVLRARRPPRAAAPAAAAIEAPAPARPAADRPDPARPTAMAIAAAALDKKAE
FT                   DVTVLDVRGLTSYADYFVLMTADSDRQASAIADHVEQTMKAQGVTKVGVEGYQGGRWIL
FT                   VDYGDVVAHVMGREARGFYDLEGLWADAPRVAVEA"
FT   gene            complement(244719..245486)
FT                   /locus_tag="AnaeK_0227"
FT   CDS_pept        complement(244719..245486)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0227"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: Methyltransferase type 11; Methyltransferase
FT                   type 12; KEGG: ade:Adeh_0214 methyltransferase type 11"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71469"
FT                   /db_xref="GOA:B4UM61"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B4UM61"
FT                   /protein_id="ACG71469.1"
FT                   /translation="MLRQAFSFCAELIGGRPPEPGDGFRDELAFWDRELSGRGEYAEDI
FT                   RRRSTPALMTLVYPHYLEPLLEELRARTGAPPRVLDAGSGPLSMWADGAEQGRIALTCS
FT                   DALADGYRELLARHGLHPRYPLVQCGGEALSGRFGEAAFDLAWMHNALDHTQDPGAVMR
FT                   ELVRVLAPGGYLVVQGWCREGTAERFIGLHRHDLWVEPPGRLMLRTRSPGRRRLSAPVA
FT                   LCDGLGLELLEASAPSRTPRTWMKLVWRKPAAA"
FT   gene            complement(245596..246486)
FT                   /locus_tag="AnaeK_0228"
FT   CDS_pept        complement(245596..246486)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0228"
FT                   /product="protein of unknown function DUF6 transmembrane"
FT                   /note="PFAM: protein of unknown function DUF6
FT                   transmembrane; KEGG: ade:Adeh_0216 protein of unknown
FT                   function DUF6, transmembrane"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71470"
FT                   /db_xref="GOA:B4UM62"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:B4UM62"
FT                   /protein_id="ACG71470.1"
FT                   /translation="MRPAVRTRIVATYLAVAALWGSTWMAIRIGLEDLPPLRFAGVRMA
FT                   IAALVLAPFALRGGAWREVVGPARAQLALVAVLQIALPYGLMFVAQQWVPSGLAAVLFA
FT                   SFPVWIALLARALAPDESLTPARVASALLGIAGVAVLQLPHLGDLEGSGRLLLGGALVV
FT                   LSSMIVALANVLVRRHLAAVSPLAMTAGQTAFGAALLLAAAGLLEHGRPAAFTPSAIAA
FT                   LAWLAVFGTALTYVGLYWLVPRVPMAAIGALPLLDTTVAVTLGALVLHEPVGWNLALGG
FT                   GMVLAAAALTIPRRR"
FT   gene            complement(246543..247604)
FT                   /locus_tag="AnaeK_0229"
FT   CDS_pept        complement(246543..247604)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0229"
FT                   /product="serine/threonine protein kinase"
FT                   /note="PFAM: Serine/threonine protein kinase-related;
FT                   SMART: tyrosine protein kinase; serine/threonine protein
FT                   kinase; KEGG: ade:Adeh_0217 serine/threonine protein
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71471"
FT                   /db_xref="GOA:B4UM63"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:B4UM63"
FT                   /protein_id="ACG71471.1"
FT                   /translation="MVRKVGTSRIVREIGRGGMGVVYEAFQEGLERPVAVKALDQKLVR
FT                   SSEVVERFRREGRAYAQLRHEAIVAVHDLVEKDDQLYLVTDLVDGADLARVLAQGGALP
FT                   ADCVAVIGARLAEALDYVHWSGLLHRDVKPANVMISRLGEVKLMDFGIAKGAEDPSLTR
FT                   VGMLVGSPSYMAPEVLAGDEGGPAADVWALGVTLYELVCGEKPFRGANADELFRLVRRG
FT                   RFRRVRSLAPGCPARVAAAIERCLARTPERRWKSAGALARHLDAFAAKKLARLHPRARL
FT                   VALLANRGFATEEVALSRMDVATLNATRLADEKGTATVAEFPVRRRRRATALQAALALA
FT                   AAAAVWLAPLTLP"
FT   gene            247873..251475
FT                   /locus_tag="AnaeK_0230"
FT   CDS_pept        247873..251475
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0230"
FT                   /product="pyruvate flavodoxin/ferredoxin oxidoreductase
FT                   domain protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein; pyruvate ferredoxin/flavodoxin oxidoreductase;
FT                   pyruvate flavodoxin/ferredoxin oxidoreductase domain
FT                   protein; KEGG: ade:Adeh_0218 pyruvate-ferredoxin
FT                   (flavodoxin) oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71472"
FT                   /db_xref="GOA:B4UM64"
FT                   /db_xref="InterPro:IPR002869"
FT                   /db_xref="InterPro:IPR002880"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR011895"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR019456"
FT                   /db_xref="InterPro:IPR019752"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033412"
FT                   /db_xref="InterPro:IPR037112"
FT                   /db_xref="UniProtKB/TrEMBL:B4UM64"
FT                   /protein_id="ACG71472.1"
FT                   /translation="MASRRMVTMDGNEAVASVAHRVSEVIAIYPITPSSNMGEWADEWS
FT                   AKGRKNVWGTVPSVAEMQSEGGAAGAVHGALQAGSLTTTFTASQGLLLMIPNMYKIAGE
FT                   LTAFCMHVSARAVATHALSIFGDHSDVMAVRQTGFGLLSSASVQEAHDMAAIAHRATLL
FT                   SRVPFLHFFDGFRTSHEVAKIEELTDDDLRAMIPEELVAAHRARALTPDRPTLRGSAQN
FT                   PDAFFQAREACNPYYLDAAGHVQAAMDHFGKLTGRKYKLFEYFGHPEAERVVVAMGSAC
FT                   DTAQETVEHLIARGEKVGLLKVRLYRPFDLGAFMTALPRTVQALAVLDRTKEPGALGEP
FT                   LYQDVVTALREAEQAHIDRFHHQITVIGGRYGLSSKEFTPGQVKAALDELLNARPKRHF
FT                   TVGINDDVTHLSLRPDPTFDTEGKDVVRALFFGLGADGTVGANKNSIKIIGEDTPNFAQ
FT                   GYFVYDSKKSGSVTISHLRFGPRPIHSAYLIEKANFVACHQFGFLEKYEMAEMTVPGAT
FT                   LLLNSPYGPDEVWGHLPREVQEQILTKGLRLYVIDAYKVARDTGMGVRINTIMQTCFFA
FT                   ISGVLPRDEAIGHIKKTIEKTYARKGAEVVQKNFAAVDHTLAHLYQVKVEGRAATGAPR
FT                   PPTVSEAAPDFVKRVTALMLAGKGDQLPVSAFPVDGTWPTGTSKWEKRSIALEIPVWEP
FT                   SLCIQCNKCALICPHAAIRPKFYGAEALGSAPKGFLAMDYKSADVKGAKYSLQVAPDDC
FT                   TGCTLCVEICPAESKTEKGKKAINMAEAMPLKEKERANFEFFLSIPDADRKKVKLDVKG
FT                   TQFLEPLFEFSGACTGCGETPYLKLLTQLYGDRAVIANATGCSSIFGGNLPTTPYTQNC
FT                   EGRGPAWANSLFEDNAEFGFGMRLAIDKQAEQARELLAVLGPKLGDALVDELLKADQSD
FT                   ETGIEKQRARVAELKAKLQMMDGLEARWLLRIADYLVRKSVWIVGGDGWAYDIGYGGLD
FT                   HVIAQGRDVNILVLDTEVYSNTGGQASKATPMGAAAKFAVAGKNLPKKDLAMLAMSYGH
FT                   PYVARVAMGAKDAQTIAAFKEADSYTGTSVIVAYAHCIAHGYEMSEALGQQEKAVDSGY
FT                   WPLFRYDPRRVAAGDSPLKLDSAAPKIELARFTEGETRFRQVEQANPQAFARMLEQAQK
FT                   DVREKYALYEQLAKAMNPVNLVPGAAGGNGKPRA"
FT   gene            complement(251845..252741)
FT                   /locus_tag="AnaeK_0231"
FT   CDS_pept        complement(251845..252741)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0231"
FT                   /product="protein of unknown function DUF1568"
FT                   /note="PFAM: protein of unknown function DUF1568; KEGG:
FT                   ade:Adeh_0220 protein of unknown function DUF1568"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71473"
FT                   /db_xref="GOA:B4UM65"
FT                   /db_xref="InterPro:IPR002686"
FT                   /db_xref="InterPro:IPR036515"
FT                   /db_xref="UniProtKB/TrEMBL:B4UM65"
FT                   /protein_id="ACG71473.1"
FT                   /translation="MTAPRQVLPGVTYLVTRRCFQRMFLLRPSPATNAIFLYVLAVAAR
FT                   RYGILVHAFCVMSNHFHLVVTDVNARLPEFEQYLNALVARAVNASLGRWESFWAPGSYS
FT                   AVALSSPQDVLEKVAYVLTNPVKAGLVASAEEWPGLWSAPESIGAGALRVTRPDRFFRR
FT                   SGPMPEVAELALVPPPGFESADAFRTFLVDAIAAREREVAQAHALAGTGFLGARRVLAQ
FT                   RPTARPPTPPPMRGLRPRVAARDRWKRIEAIGRLVGFLRAYREAWRARRAGRSGVIFPA
FT                   GTYLLRVLHSVPCASFG"
FT   gene            252890..253864
FT                   /locus_tag="AnaeK_0232"
FT   CDS_pept        252890..253864
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0232"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase;
FT                   short-chain dehydrogenase/reductase SDR; 3-beta
FT                   hydroxysteroid dehydrogenase/isomerase; polysaccharide
FT                   biosynthesis protein CapD; dTDP-4-dehydrorhamnose
FT                   reductase; Male sterility domain; KEGG: ade:Adeh_0221
FT                   NAD-dependent epimerase/dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71474"
FT                   /db_xref="GOA:B4UM66"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B4UM66"
FT                   /protein_id="ACG71474.1"
FT                   /translation="MPPTLVTGAAGFIGFHLAKALLDRGDEVLGVDSMVPYYDVRLKEA
FT                   RLAQLSGRPGFTFERLDLADREATSRLFERGGFGAVVHLAAQPGVRYSLENPHAYVDAN
FT                   VTGFLDVLEGCRRHPVRHLVYASSSSVYGGNTKVPFAVADNVDHPVSLYAATKKANELM
FT                   AYTYSHLFAIPATGLRFFTVYGPWGRPDMAPMLFARAILEGHPIKVFNHGQMRRDFTYV
FT                   DDIVEGVIRVLDRPPAAGVVPPHRLYNIGNSQPVELLRFIEVMEEALGKKAVRELLPMQ
FT                   PGDVPATFADVSELERDVGFRPATSIEEGVRRFVAWYRAYHRA"
FT   gene            254046..254915
FT                   /locus_tag="AnaeK_0233"
FT   CDS_pept        254046..254915
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0233"
FT                   /product="glycosyl transferase, WecB/TagA/CpsF family"
FT                   /note="TIGRFAM: glycosyl transferase, WecB/TagA/CpsF
FT                   family; PFAM: glycosyl transferase WecB/TagA/CpsF; KEGG:
FT                   ade:Adeh_0222 glycosyl transferase, WecB/TagA/CpsF family"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71475"
FT                   /db_xref="GOA:B4UM67"
FT                   /db_xref="InterPro:IPR004629"
FT                   /db_xref="UniProtKB/TrEMBL:B4UM67"
FT                   /protein_id="ACG71475.1"
FT                   /translation="MKVARLEWPDLLEWFLRRLDAPAPVRCGTLVLANAHTLNVASANP
FT                   AAREAIRAATLVLNDGVGLDVYARLRTGAPFPYNFAGTDLVPRLLGECARRGLPLRVFL
FT                   YGARPGRAAEAARRIERAYAPVKVVGALDGHETTGDEARRAIDAAHPDLLLVGLGNPRQ
FT                   EEWLAANAPGLRARIAIGVGALFDFMSGSVVRAPRAVRAMRLEWLFRLALEPRRLFRRY
FT                   VVGVPLFLWRTLTYRPEPVPSHPTQSHLSAGKPRIGPRNDSGFGAVLARTGTDAKDSGS
FT                   GVRVGSAG"
FT   gene            254981..255913
FT                   /locus_tag="AnaeK_0234"
FT   CDS_pept        254981..255913
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0234"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ade:Adeh_0223 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71476"
FT                   /db_xref="UniProtKB/TrEMBL:B4UM68"
FT                   /protein_id="ACG71476.1"
FT                   /translation="MIRPLTVRVSAALLVTLGCASAADAAEPLLVPGRMGYNALPALRN
FT                   VDPVVGNRTELELSATAQLAGLGAQDAAGTPYVRLTVPFREVAALELDGTPFELFRTSA
FT                   ATGQRIGARVRSGASPGDLRAGARFLVLEERGKRPALGLRLVVKSTSGKDRGARRFTNA
FT                   PGYVFDVLAGKDVAAAGPVRLRALAKLGFLAWQVADGRQDDALDYGATLRAAFASGVAL
FT                   SGEWRGYAGWRGDDRPMVLGLTADVPAGSRVLLRASADRGLTADAPPLDVRLGVVLFLD
FT                   APMARDRAAGQADPRLASGARPRRQPGPR"
FT   sig_peptide     254981..255058
FT                   /locus_tag="AnaeK_0234"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.962 at
FT                   residue 26"
FT   gene            complement(255914..257083)
FT                   /locus_tag="AnaeK_0235"
FT   CDS_pept        complement(255914..257083)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0235"
FT                   /product="Endonuclease/exonuclease/phosphatase"
FT                   /note="PFAM: Endonuclease/exonuclease/phosphatase; KEGG:
FT                   ade:Adeh_0224 endonuclease/exonuclease/phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71477"
FT                   /db_xref="GOA:B4UM69"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/TrEMBL:B4UM69"
FT                   /protein_id="ACG71477.1"
FT                   /translation="MSRTRLAVLALALSPLALAACSSGDGTSATASDAVRAPPAAGSPG
FT                   ARAAGMDPHSMAGGKKILGVTTRNLYLGADLGPVMAAATPAAFVAATTAVWATVQANDF
FT                   HVRAEAIADELAATRPGLVGLQEAYLWRVQDPGDFLAGGTTPATTVAFDYVQDLLDALA
FT                   ARDLHYVVAAEVTLFDFEAPVATGQDVRMTDRGVILARSDLTTALPAGGVYATLLPVSV
FT                   LGNPVQVKRGWVSVDAKYRGEWLRFVSTHLEAYHAGVRTAQAAELAGALAAEARPVVLV
FT                   GDLNSQPGTEGEAVLAAAGFRDVWAAVEGDAPGLTCCFPEDLRIGPGDPGFADLSTRID
FT                   YVLVRGPVEPWSAEVVGETADERVGGLWPSDHAGVAAEVRVTDGRHAGE"
FT   sig_peptide     complement(256988..257083)
FT                   /locus_tag="AnaeK_0235"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.479 at
FT                   residue 32"
FT   gene            257326..258465
FT                   /locus_tag="AnaeK_0236"
FT   CDS_pept        257326..258465
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0236"
FT                   /product="efflux transporter, RND family, MFP subunit"
FT                   /note="TIGRFAM: efflux transporter, RND family, MFP
FT                   subunit; PFAM: secretion protein HlyD family protein; KEGG:
FT                   ade:Adeh_0225 secretion protein HlyD"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71478"
FT                   /db_xref="GOA:B4UM70"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:B4UM70"
FT                   /protein_id="ACG71478.1"
FT                   /translation="MPRATGPRHGCRLLALAAAVALAAGCKRDGGRAAEAAQEQPPVAL
FT                   APENVAVVSSRRLQSGPEVAGTLHARRAATLRAEVGGAVAEVRVEAGERVKAGQLLARI
FT                   DASALQDAVRAARSAVTSAQNALRVAESGARRAHTLAREGAMAEQDAERADAQLEAARA
FT                   QVEDAKARLAAAEQQAGKTAVRAPFAGVVSERSVSSGDVVSSGAALYTVIDPSRLQFEG
FT                   SVPAASVGALAPGAPVDFSVTGFGGRRFDGHIERVNPAVDPSTGQVRVYVDVPNADGRL
FT                   LAGLYAQGRVASQASEALAAPAAAVDATSTPPTVMKVQDGKVQKVAVEIALRDDVAGAV
FT                   GFRSGVKQGDVLVLGSARGALADGTPVRVVEDPRAQKSN"
FT   sig_peptide     257326..257397
FT                   /locus_tag="AnaeK_0236"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.803) with cleavage site probability 0.763 at
FT                   residue 24"
FT   gene            258484..261648
FT                   /locus_tag="AnaeK_0237"
FT   CDS_pept        258484..261648
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0237"
FT                   /product="acriflavin resistance protein"
FT                   /note="PFAM: acriflavin resistance protein; KEGG:
FT                   ade:Adeh_0226 acriflavin resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71479"
FT                   /db_xref="GOA:B4UM71"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:B4UM71"
FT                   /protein_id="ACG71479.1"
FT                   /translation="MFISDFAIKRPIVTITVMLALVIFGLLALVTLKTDEFPDVQPPVV
FT                   AVTIVYPGASPETVEREVIDPIEDAIFSISGIDGKQTTASATDGLAQFIVFFDFEKNLM
FT                   EATQDIRDAISSKRQDLPTEMEEPVLVRFDPSQEPIVTLTLTSKTLPVPALTRLADEVV
FT                   SRDLRSVQGVADVRLVGGQKRELTVQLDPEAMAAASVSAAEVVGALQAQNLAAPVGRVN
FT                   TPLGEQSIRLSGRLGTPEEFEQVAVASRGGQVVRLGQVAKVLDGAEEARTLALFNSGEA
FT                   VGLEVLKTKGYSTTAVADAVKERARALEPRMEGAKLAIVQDSGTRVRQSVDDVQRTLVE
FT                   GALLTVLVVFLFLNSWRSTVITGLALPVSVLAAFVSVWAFGFTLNTMSLLGLSLAIGIL
FT                   IDDAIVVRENIVRHIELGEDHTTASHKGTDEIGLAVTATTFSIVAVFVPVAFMYGVAGQ
FT                   WFKPFALTIAAAVLVSLFVSFSLDPMMSAYWPDPQVEKGERRGPVGRALGAFNRWFDRQ
FT                   ASNYRRVVAWALDHRWLVVAFATLSLVGSFALQGAFGGAGFVPVSDRSEVSLIVQTPPG
FT                   SSIEYTRRKVEETDRILRSHPEVAYTYASIGTPIPLQAPGVDQALIYARLTPKRERDLS
FT                   QDALGAVLRRELSRVAGAEISVFTSGFGGAFKSIQLELRGPDSRVLTELAEKVKAVAAG
FT                   VPGAVDVGLSTRGQKPELAVEVDRGLAGRLGVTVGQVAQSLRIAFAGLDSGDWVDPTGE
FT                   TRKVMVRLAPEARERASDLRQLPLILPSREGAPRILPVGQVARITEGLGPAQISHLDRQ
FT                   RVVSVQGNVAGRSLSEVVNEIERRLAGEVKLPPGYTLRQGGESADQAEVFTRIGVALLL
FT                   AVMLMYLVLVLQFGSFLDPFAILLSLPLSLIGVVLALLVTGDTINLMSLIGVILLFGIV
FT                   AKNAILLIDFAKWAREERGLSIRDALVEAGGIRLRPIMMTSVAVIAGMVPVASGLGEGG
FT                   DFRAPLGRAVIGGVITSTLLTLLVIPTVYEIMDGWRTRLGRLFRRAFARGGERHAREAA
FT                   QRREEP"
FT   sig_peptide     258484..258570
FT                   /locus_tag="AnaeK_0237"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.750) with cleavage site probability 0.461 at
FT                   residue 29"
FT   gene            complement(261673..262188)
FT                   /locus_tag="AnaeK_0238"
FT   CDS_pept        complement(261673..262188)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0238"
FT                   /product="Domain of unknown function DUF1791"
FT                   /note="PFAM: Domain of unknown function DUF1791; KEGG:
FT                   ade:Adeh_0227 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71480"
FT                   /db_xref="InterPro:IPR003787"
FT                   /db_xref="InterPro:IPR027396"
FT                   /db_xref="UniProtKB/TrEMBL:B4UM72"
FT                   /protein_id="ACG71480.1"
FT                   /translation="MTPHRPLPLLALAALLALTAGTPLAARASAAPGNPDALRGVTSGK
FT                   GLFLVDLADGPKIAMYLKLIAGSHDGLRAQGVAPDFKVVFIGPTVRFLTGAAPAPNRAA
FT                   DRAAAAEIAAAVRELKRRGAALEVCAIATKVFQVEDARLLPELTVVADGFVSLIGYQAQ
FT                   GYHLVPIY"
FT   sig_peptide     complement(262102..262188)
FT                   /locus_tag="AnaeK_0238"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.486 at
FT                   residue 29"
FT   gene            262380..262985
FT                   /locus_tag="AnaeK_0239"
FT   CDS_pept        262380..262985
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0239"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: ade:Adeh_0228
FT                   transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71481"
FT                   /db_xref="GOA:B4UM73"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:B4UM73"
FT                   /protein_id="ACG71481.1"
FT                   /translation="MSPREKLVETAAALFYRHGCHAVGIDTVLAEAGVAKMTLYRHFRS
FT                   KDELVLAALRRMDERFRNAFMAAVERASDTPAGRLDALFDVVRDWVRGKDFYGCPFINV
FT                   TAEFAAHDDPVHVAAAEHKRLALEYIERLAAEAGAADARGLARALKVLLEGCTVLAQVT
FT                   GQPGFVDDAQQAARLVLQEGLRGAVPPRAPRRPRRART"
FT   gene            complement(263190..264614)
FT                   /locus_tag="AnaeK_0240"
FT   CDS_pept        complement(263190..264614)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0240"
FT                   /product="FAD dependent oxidoreductase"
FT                   /note="KEGG: ade:Adeh_0229 FAD dependent oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71482"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B4UM74"
FT                   /protein_id="ACG71482.1"
FT                   /translation="MRTPDAVVVGSGPNGLAAAVALAGAGLRVRVREAAATAGGGARTL
FT                   PLTLPGFLHDHCSAVHPLAVASPFLRTLPLAAHGLRWISPPAAVAHPLDDGTAALLGPG
FT                   FEATDATLGEDARAWRALFAPLARELPALLEEVLGPVLHRPRRPLLLARFGLPALLPAA
FT                   RLARARFRGPRAQALFAGLAAHANRPLEAAASAAFALVLGAAGHAVGWPFPEGGAGAIA
FT                   AALAGELRSRGGELETSAEVHRLEDLPPARAVLLDLAPRQVLRVAGARLPARYARRLAA
FT                   FRYGPGAFKLDWALAGPIPWRAAACAVAGTVHLGGTLEEIAAAEAAVERGEVPARPYVL
FT                   LAQPTRFDPSRAPPGGHVAWAYCHVPRGFDGDVTAAVEAQVERFAPGFRELVLARAVRG
FT                   PAALEQDDANLVGGDVGGGEASLAQLVARPVLSPDPWSTPVPGLYLCSASTPPGGGVHG
FT                   MCGWHAARAALRDLGL"
FT   sig_peptide     complement(264543..264614)
FT                   /locus_tag="AnaeK_0240"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.650) with cleavage site probability 0.607 at
FT                   residue 24"
FT   gene            264782..265390
FT                   /locus_tag="AnaeK_0241"
FT   CDS_pept        264782..265390
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0241"
FT                   /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
FT                   /note="TIGRFAM: RNA polymerase sigma factor, sigma-70
FT                   family; PFAM: sigma-70 region 2 domain protein; sigma-70
FT                   region 4 domain protein; Sigma-70 region 4 type 2; KEGG:
FT                   ade:Adeh_0230 RNA polymerase sigma factor"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71483"
FT                   /db_xref="GOA:B4UM75"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:B4UM75"
FT                   /protein_id="ACG71483.1"
FT                   /translation="MPDESDERLMLRFRDGDARAFEALVRRHRTPVFSFLLRLTRDRAR
FT                   AEDLCQETFLRVVKASGAWEPRARFRTWLYAMARNLAVDESRRMAFRRASSLEADPAAC
FT                   ALAADDPAPDRAADAALVRPLLEAALASLPEAQREVFLLREHAGLRFPEIAEVTGAPEP
FT                   TVKSRMRYALEALRERLAAMGVEPEAAAGGPASARSAAP"
FT   gene            265387..266784
FT                   /locus_tag="AnaeK_0242"
FT   CDS_pept        265387..266784
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0242"
FT                   /product="Fe-S oxidoreductase"
FT                   /note="KEGG: ade:Adeh_0231 Fe-S oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71484"
FT                   /db_xref="GOA:B4UM76"
FT                   /db_xref="UniProtKB/TrEMBL:B4UM76"
FT                   /protein_id="ACG71484.1"
FT                   /translation="MSDERFHERLGARLHDAILEHAYGELPAGEARALERHLEACDACR
FT                   AELGRIRGTRALMSGLEEAPAPERGEAVLLAAAREAAGARGRRRRLPAWTWGAALSAAA
FT                   LVAVGAVSYRLLALHPGPALRDDPEALLGRAAAPAPQAATEAATPAAPEAPAAAAAPAA
FT                   GPDDVRAERTRPAAPPAPERRREPPPRLGAAKSAPAAAPSAVRAGEPEADAPVAPRTFL
FT                   APAPAQAPAPSPSTAERTFAPPTPAPTTERTVAPPPPAPSPSTAERTFAPPAPETAPAP
FT                   KSTPAPKPTPAPAPRALRAEATEAAPAAAGSAPAAALEAVPAPEHAPGARRAATAARGQ
FT                   DQDAAAAPAGSDALARWRALRQAGALRGEVVTFTDCDGEAWRKVERDAQGRVVRYVRHG
FT                   RLAGRAFEADLYYGEDGALALVRYREEGGPWREARPPGTDGAIPEAALRPARAADARAD
FT                   APPRCGP"
FT   gene            267010..268113
FT                   /locus_tag="AnaeK_0243"
FT   CDS_pept        267010..268113
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0243"
FT                   /product="teichoic acid biosynthesis related protein"
FT                   /note="KEGG: ade:Adeh_0232 teichoic acid biosynthesis
FT                   related protein"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71485"
FT                   /db_xref="UniProtKB/TrEMBL:B4UM77"
FT                   /protein_id="ACG71485.1"
FT                   /translation="MARILYGVAGEGMGHAVRSRVVIDHLARTHDVQVVVSGRAHDYLK
FT                   ARERDRLGVNRIWGLSIVYEDNEVRNFRTVLKNVGGAVAGGWPRNVKAYFDLTESFRPE
FT                   VVVSDFETWSYLYARTHGLPCISVDNNQAVNRCDHPPEILAGHEAEYLVAKGVVKAKLP
FT                   GCFHYLIATFFQAPVAKPRTSLHPPVLRPEILAARAEPGAHLLVYQTSTSNEALPEILR
FT                   GAGVECRVYGLRRELTADLREGNLVHRPFSEARFVEDLRTARAVISGGSFTLMTEAVYL
FT                   HKPMLAIPVKRQFEQVLNARYLQALGYGATADDLDARVLEDFLARLPELERGLARYRQD
FT                   GNRELLAKLDDVLARALDGGAPGEPRA"
FT   gene            268110..268571
FT                   /locus_tag="AnaeK_0244"
FT   CDS_pept        268110..268571
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0244"
FT                   /product="protein of unknown function DUF163"
FT                   /note="PFAM: protein of unknown function DUF163; KEGG:
FT                   ade:Adeh_0233 protein of unknown function DUF163"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71486"
FT                   /db_xref="GOA:B4UM78"
FT                   /db_xref="InterPro:IPR003742"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4UM78"
FT                   /protein_id="ACG71486.1"
FT                   /translation="MKVRVVAVGRDRSGLYAPAVEEYAKRLGRYLRFELVEVPEARKLA
FT                   GTAGAKGEEGATLLAKIGPRERVVVLDERGDELTSVAFAERVRRWMERGQDVALLIGGS
FT                   DGLAPEVLARADERLAVSRFTLAHRLARLVLVEQLYRAMTILRGEPYHK"
FT   gene            268684..271332
FT                   /locus_tag="AnaeK_0245"
FT   CDS_pept        268684..271332
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0245"
FT                   /product="peptidase S8 and S53 subtilisin kexin sedolisin"
FT                   /note="PFAM: peptidase S8 and S53 subtilisin kexin
FT                   sedolisin; peptidase domain protein; KEGG: ade:Adeh_0234
FT                   peptidase S8 and S53, subtilisin, kexin, sedolisin"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71487"
FT                   /db_xref="GOA:B4UM79"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR015500"
FT                   /db_xref="InterPro:IPR017309"
FT                   /db_xref="InterPro:IPR022398"
FT                   /db_xref="InterPro:IPR023827"
FT                   /db_xref="InterPro:IPR023828"
FT                   /db_xref="InterPro:IPR034176"
FT                   /db_xref="InterPro:IPR036852"
FT                   /db_xref="UniProtKB/TrEMBL:B4UM79"
FT                   /protein_id="ACG71487.1"
FT                   /translation="MTRLRTPAALALSLAALACGGGGSDSPPLPTTFTLSGHIAATAGQ
FT                   DVDGDVADPVAPKTPNDTRDEAQQLAPVTTLGGFADAGTDPQDWYRATLEAGQTVVMDV
FT                   ADTAASFELCLLASDGATVNCATAGANQVIPVAAAGQYYLRVTAAAGVSNYALTLGVNG
FT                   AAASAGAAPHLALPFVPGEIVVRFRDDALGVASAGDLPQRAAALGLTALAGARGRAALL
FT                   SMSGPEARARALAALGVEPLAPDALGAGADPVLAEKWDTLRAIAALRRRADVESADPNF
FT                   VFQPARVPTDTYYKYQWHYPLISLPQAWDVTRGATEAGTAAIVAVVDTGVFLAHPDLSG
FT                   QLVTGYDFIRDPTMANDGNGIDPNPDDPGDAATPGGSSWHGTHVAGTVAAKADGSGVVG
FT                   VAWDARVMPLRALGVGGGTSYDIVQAVSYAAGLANDSGTVPATRAAVVNLSLGCQGCFS
FT                   STEQAVYTAARNAGVIVVAAAGNEASSAPGYPAAYAGVLSVSAVDMKGAKAPYSNTGST
FT                   VDLAAPGGNTAVDLDGNGYADGVLSTLVKDTTGTREPIYAFYQGTSMAAPHVAGVMALM
FT                   KSVCPSLAPAAIDQLLQAGQLTRDLGPAGRDDTFGWGLVDALKAVQAAATSCGAPLPPS
FT                   LSVTPGRLDFGPADATLQLQAAKVGEGALTVTAVSDDATWLTVTAPGVDASGLGAYAAA
FT                   VDRTGLADGRYAAKITFTPSVGDPVVIPVTLQVGAAAAAGDAGYLYALLVREGVSGPEL
FT                   VKQWSGAASGGSYAFRFDGVSAGTYYLVAGSDMNNDGYICDAGESCGAWPTLGVLTPLG
FT                   ASGPRSDLDFSVAFDPAVAPVGAAAGAPVGVRGLARQPATKGVAGLRERQAGAFPGPGG
FT                   VASGAARGDVP"
FT   sig_peptide     268684..268758
FT                   /locus_tag="AnaeK_0245"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.439 at
FT                   residue 25"
FT   gene            271388..272938
FT                   /locus_tag="AnaeK_0246"
FT   CDS_pept        271388..272938
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0246"
FT                   /product="phosphoglycerate mutase,
FT                   2,3-bisphosphoglycerate-independent"
FT                   /EC_number="5.4.2.-"
FT                   /note="TIGRFAM: phosphoglycerate mutase,
FT                   2,3-bisphosphoglycerate-independent; PFAM: metalloenzyme
FT                   domain protein; BPG-independent PGAM domain protein; KEGG:
FT                   ade:Adeh_0235 phosphoglyceromutase"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71488"
FT                   /db_xref="GOA:B4UM80"
FT                   /db_xref="InterPro:IPR005995"
FT                   /db_xref="InterPro:IPR006124"
FT                   /db_xref="InterPro:IPR011258"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR036646"
FT                   /db_xref="UniProtKB/TrEMBL:B4UM80"
FT                   /protein_id="ACG71488.1"
FT                   /translation="MPKTKPVLLVVLDGWGIRAAREANAIAIAGTPNMDALQREFPHAA
FT                   LETSGLSVGLPEGQMGNSEVGHTNLGAGRIVYQDLVRINRAVEDGSFYKNDALLLACRR
FT                   AREAGGALHLLGLVSDGGVHSHVEHLHACLELARREGVARAYVHAFMDGRDTPPKSGLD
FT                   YLAAVERRLAATGYGKVATVTGRYWAMDRDKRWDRVAQAYAALVSGEGFKAASGTAAME
FT                   AAYARGETDEFVKPTVVVNGDGKPVGAIRDGDAILFFNFRADRAREITRAFTQEGFHDF
FT                   ERKAVPRLSAYVCMTQYDETFTLPVAYAPQDLTEIFPEIVARAGLRQLRTAETEKYAHV
FT                   TFFFNGGRETVYQNEDRILVPSPRDVKTYDEKPEMSAREVTDKLVQALGTGQYGFTLVN
FT                   YANPDMVGHTGLLDAAVKAVRVVDECVGRLWQAARKQGMAMLVTADHGNCELMTDPVTG
FT                   QPHTAHTLNPVPFILADPDLRGAKLREKGVLADVAPTALQVMGLPQPKEMKGLGLVIR"
FT   gene            273012..273698
FT                   /locus_tag="AnaeK_0247"
FT   CDS_pept        273012..273698
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0247"
FT                   /product="phosphoribosyltransferase"
FT                   /note="PFAM: phosphoribosyltransferase; KEGG: ade:Adeh_0236
FT                   phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71489"
FT                   /db_xref="GOA:B4UM81"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:B4UM81"
FT                   /protein_id="ACG71489.1"
FT                   /translation="MLRAAVRALLDLVYPPRCAACGEPVTEEPFCDVCAGALEPVPPGC
FT                   DRCGAPGPGPACGACLAAPPAFDAVRAGGLFGGPLADAVHALKYGGRPDLARPLGAWLA
FT                   ARISLPPGAAVVSVPLGRARRIERGYDQAALLADALARAAGARGRRLRGALRRARETAP
FT                   QVGLGRAERARNVEGAFLAGPAVAGRDLVLVDDVVTTGATADAAARALRAAGARSVTVV
FT                   ALARAE"
FT   gene            273759..277529
FT                   /locus_tag="AnaeK_0248"
FT   CDS_pept        273759..277529
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0248"
FT                   /product="Tetratricopeptide TPR_2 repeat protein"
FT                   /note="PFAM: TPR repeat-containing protein;
FT                   Tetratricopeptide TPR_4; Tetratricopeptide TPR_2 repeat
FT                   protein; SMART: Tetratricopeptide domain protein; KEGG:
FT                   ade:Adeh_0237 tetratricopeptide protein"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71490"
FT                   /db_xref="InterPro:IPR002931"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR024618"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:B4UM82"
FT                   /protein_id="ACG71490.1"
FT                   /translation="MLARLAALLALCLASTGSARALSPLPPPTGLDPEAERAAAAVAAL
FT                   DRERRGPRGLAALAELDALADDLPELAHLAAAYARAADDREAHPEVRALARFRLAEVER
FT                   ARGNLQKEAASLQRLGFVGRWRVLGPFDDEGKRGLAEAFPPEKAVDLAARYPGKVREVA
FT                   WRALPEDAVVDGFVHLGAALRPAREVVAYALAEVEAPRDLDARLWLGASGAARIWVNGA
FT                   VVLTDADYHPARLDQRGVVVTLRRGANRILVKLCHQDGRMGFYLRLADARGEGLELAAA
FT                   DPRGAALQEVPAPGPAAPVPPAVAALEQRVKAARGPRAEAEARLELARVLAARQGGDVQ
FT                   ERRAAAEARRAALLAPGWVEAQLEAAALEEDHGRRRQRIEAALAVAPEDPRALRALGQE
FT                   ELDQGRPQAAARLLERAVRAAPGWAAPRVELAEALSRAGLEARGALLAEATASAFATVP
FT                   SAVRAAARSARRLGRTEEASARSRTLVALRFDDAQTRAALAQILADRGDVAGARALLEE
FT                   ALRLDPSDVYQRLRLGDLLAASGRGEEAERAYAAALALAPDEPDAWERRGRARLSQGRV
FT                   KDAQADLQRALELRPQSPELKLLVRSLEPAREPFERPYLLDARALAAAAPAPEPDEDAL
FT                   VLGELKVTRVLPSGLSSTYTQTVVKVLTPRGADQARRQTVSWSPDRQEVRVERARILKP
FT                   DGTVIEAHDESERSASEPWYRLYYDLTARTLSFPALAPGDVLEVAWRLEDVAGENLLSD
FT                   YFGDLTFVDDTTRKARFEYVLLVPAARAIHANAPAGIAHAQRTLPGEVVEHRWSARDLP
FT                   RVVPEPGMPGWSEVSRHVHVSTYASWDQVARFYWGLVKDAVRPTPEVRAEAERIAAEVL
FT                   RARRGEGTRVARAQAAASALPPPGGWDLETQRALTRAVYDFVVSQTRYVGLEFGIHGYK
FT                   PYRVDQVLQRRFGDCKDKASLLRAMLESIGIDARLVLLRMRRLGRLPEAPASLAVFNHA
FT                   IVYVPALDLWLDGTAAYSGSGDLPGEDRGATVLVVNPDGKPRFATVPEALPEQNRGETR
FT                   FDVALAADGSAAVRGAWRVTGAEAPTYRRAYLVEEQRRAQLEQSFNRSFPGVRVASVTA
FT                   SDLTRLEDDVTMQFALEVPRFARPDGAGLRFSPFGAARGWGESWAALSSRRHDLDLGSP
FT                   TETVFTYRHTLPAGWRIAELPDGDAARTPYASFEVRYRRDGAALVAEARVRLEKGRIPA
FT                   RDYPAFRELTSRIDRAFARKVRIVPAEEAAR"
FT   sig_peptide     273759..273824
FT                   /locus_tag="AnaeK_0248"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.988 at
FT                   residue 22"
FT   gene            277526..281242
FT                   /locus_tag="AnaeK_0249"
FT   CDS_pept        277526..281242
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0249"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ade:Adeh_0238 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71491"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR024618"
FT                   /db_xref="UniProtKB/TrEMBL:B4UM83"
FT                   /protein_id="ACG71491.1"
FT                   /translation="MSRAVRRAAPRFTGVAALAALALACAGPRAEQAEPGRATREGLAA
FT                   LEQNDVTRAEARLGPASRVRDPWARFGASLLARRALDGEAEVQRLLAAVEAGPDEPIAL
FT                   VALRRLSELAERGPALAAQVDAGVLRLGAGGRLRGLAAYRARVARVTAAEVLGDHEAAA
FT                   QARRENGAVPVWSIAGPFAAHHALDFGAPIPPDRGELPVSVPGRAGGPAVPTRALPAPD
FT                   GTVALDGEPSGGDLFALATDVDLARGGRYLVTLGTQLSARLVVDGALVHERRAFAAWLP
FT                   GLVHLPVELARGRHRVVLEVTRGAPSTGIHLAFARADGAASDARFAAPAPGAPPAPAAA
FT                   RSRAEPALTPRALALALEPDVGAATARLLAARDAMVNDREAAKVLLGEALALRPEAAAL
FT                   RAARADAAVDDPSLDEQVARARAEADLREALRLDPGDAEARVELAALLRGAERHDDAEA
FT                   VLAGLAPEAAARPAGIAARARAAQARGLLERAEGLAAEALRSAGSCDAADLAYELAVRR
FT                   GAAAREDEAMAVLSRCRGGRERLAGHLRRRGDPVAERAALDPVVRARPWAVEPGLTRAG
FT                   ALVASGETRRAVAALEAIAAIWPRDARVQRRLADARELSGDAPGARAARERALALDPGD
FT                   LQLRRALALEDGTEVLADVAADPRAAIRAYEAAGRRNGASTVMVLDAAYVDVHPGGAAT
FT                   ERTQQIVHVLDQQGVEQFGEVTVPAGADVLALRTIKPDGTTLEPERAGSAKGSVSLAGL
FT                   APGDYVELDYVRAAQSPPGLEGYVADPFYFQVPGSRLFRSLYVVRAPAGLGLEADAHGM
FT                   PAPVPVRDGGREVLRAERHDVPAIVPEPDAPGGAEYLPFLAVGTGGGRAALQRAIADAL
FT                   PERTRATAELRAFAREIAAGGGGPAQLARAAYARVAQAVLGSGGGMGEDASVALSRGRG
FT                   SRLAVLKAVLAELGMESRVALVRPYSADPAPYRFPALGLYAAPLLRVRAGGATYWLDPT
FT                   ARHAPFGAFPAVLAGCEALVLPEPGEAPEVDRTPESPLVEEGRETTARLVLAADGSAEA
FT                   SGTDRYLGYGGAELKAALERLDAAQRRQAVEGMLGRVLRGVTVTEVAFAGEDDPAAPLE
FT                   IRWKARVPELARAVEGGLVLDQPLFPARLGARLVGVAARRTPLLLPTPERQVQRIEVVP
FT                   PRGLAVTADAPRTASSPSGSFTRTERLDGGALVREERLELRRGRIAPEHYAELAAFAAA
FT                   VDQAQERPLLLAR"
FT   sig_peptide     277526..277627
FT                   /locus_tag="AnaeK_0249"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.483 at
FT                   residue 34"
FT   gene            complement(281607..282218)
FT                   /locus_tag="AnaeK_0250"
FT   CDS_pept        complement(281607..282218)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0250"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ade:Adeh_0239 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71492"
FT                   /db_xref="InterPro:IPR025324"
FT                   /db_xref="UniProtKB/TrEMBL:B4UM84"
FT                   /protein_id="ACG71492.1"
FT                   /translation="MRRLLALLVLGLAAGAGLGLALRLGRAPALPDPPAVATRIREVAR
FT                   LEALDVTLYKKVAFSPEPVEAGSLWGDVAGWLRHVFRTPHGKAIVFADAHLGLDLARLD
FT                   ASRVRVTGRTAEIALPPVEVRIALRPGETEVIGSNLDSAETARLLELARAAFEREVQAD
FT                   AALRARARASAERAIRGLLLGLGFAEVRFVDALPAAAPSS"
FT   sig_peptide     complement(282153..282218)
FT                   /locus_tag="AnaeK_0250"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.997) with cleavage site probability 0.676 at
FT                   residue 22"
FT   gene            complement(282228..282839)
FT                   /locus_tag="AnaeK_0251"
FT   CDS_pept        complement(282228..282839)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0251"
FT                   /product="TfoX domain protein"
FT                   /note="PFAM: TfoX domain protein; KEGG: ade:Adeh_0240
FT                   TfoX-like"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71493"
FT                   /db_xref="InterPro:IPR007076"
FT                   /db_xref="UniProtKB/TrEMBL:B4UM85"
FT                   /protein_id="ACG71493.1"
FT                   /translation="MPISPSFVEHAVDLLSALGPVQARRLFGGVGLYCDGLMFGLLDDD
FT                   ELFLKTDGETRPWFLEAGCQMWIYPGMYETSYYRPPDEAHEDAEAMLPWARLALDAAVR
FT                   AQAARAAKARAPRRAGAKAGGARGAAAKAAKAKARAGTGARPGRKGARPSKPRPARKAA
FT                   PSAAARRSRAPSPKARRAGVRPGGRGSARGRGAPSARRPR"
FT   gene            complement(282873..284012)
FT                   /locus_tag="AnaeK_0252"
FT   CDS_pept        complement(282873..284012)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0252"
FT                   /product="oxygen-independent coproporphyrinogen III
FT                   oxidase"
FT                   /EC_number="1.3.99.22"
FT                   /note="KEGG: ade:Adeh_0241 coproporphyrinogen III oxidase,
FT                   anaerobic; TIGRFAM: oxygen-independent coproporphyrinogen
FT                   III oxidase; PFAM: Radical SAM domain protein; HemN domain
FT                   protein; SMART: Elongator protein 3/MiaB/NifB"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71494"
FT                   /db_xref="GOA:B4UM86"
FT                   /db_xref="InterPro:IPR004559"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR034505"
FT                   /db_xref="UniProtKB/TrEMBL:B4UM86"
FT                   /protein_id="ACG71494.1"
FT                   /translation="MARPFGVYVHYPYCTHRCPYCDFAVTTERPPGAGRYARAVRAELG
FT                   LRAPAFEGLSLRSVYLGGGTPSLWDADEIGDVLAAVRDRFGLAEDAEVTLEVNPESSDP
FT                   ARLEAWRAAGVNRISVGVQSFDPGVLAKLGRRHGPERAERAIREAAAALGNVSVDLIYG
FT                   ARRSSVETARRDAERAVEAGAVHVSAYALTLDPDVMAEEVPLARMRREGRLPLPSDEDA
FT                   LAQAAALRAALRRLGLRRYEISNFARPGRESVHNGLYWRHESYLGLGAGAYGCRRGEAG
FT                   SVRYGNLRDAGAWLAAVEAGRLPTAEEDRIDARADRNERLMLALRTRDGAPLAALGPAQ
FT                   AREAADLVRHRLAVRRDGALVLTRRGLDLHSAISERLFE"
FT   gene            complement(284058..285143)
FT                   /locus_tag="AnaeK_0253"
FT   CDS_pept        complement(284058..285143)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0253"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ade:Adeh_0242 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71495"
FT                   /db_xref="UniProtKB/TrEMBL:B4UM87"
FT                   /protein_id="ACG71495.1"
FT                   /translation="MTVRPSRALACAAAALALSAARPAAAQHAPPPAGAPGEPPCVPVK
FT                   PCEIPDEPAAAAVEPAAELGAEVRRLFDLVACRGAAPAGLDAQVVGAFCAEQRRALEAF
FT                   RAGPRAKALEALAPLRPAGLPSTAVVPGGTDLLTALGAFPDLKNVTTFSAAPAGDPRVL
FT                   AGLAPERLRQGLAAVRAGAQALLRGEGATARGAARAGEFPVQLALFLTALAAEGYEPTG
FT                   LRYFTVQPDGTLRYLGRADLGGGRAPLASSELTFVRRGDDPRTRTRTHRHVAADLSDAA
FT                   LARGPGVLAHLAGKGELSVALGAAGASPWRDDHARVRKLLLERAAMIVSAGPRLPAALA
FT                   RQAGLSAEERGPFQVARRDRR"
FT   sig_peptide     complement(285063..285143)
FT                   /locus_tag="AnaeK_0253"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.987 at
FT                   residue 27"
FT   gene            285345..287417
FT                   /locus_tag="AnaeK_0254"
FT   CDS_pept        285345..287417
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0254"
FT                   /product="oligopeptide transporter, OPT family"
FT                   /note="TIGRFAM: oligopeptide transporters, OPT superfamily;
FT                   oligopeptide transporter, OPT family; PFAM: Oligopeptide
FT                   transporter OPT superfamily protein; KEGG: ade:Adeh_0243
FT                   oligopeptide transporter OPT"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71496"
FT                   /db_xref="GOA:B4UM88"
FT                   /db_xref="InterPro:IPR004813"
FT                   /db_xref="InterPro:IPR004814"
FT                   /db_xref="UniProtKB/TrEMBL:B4UM88"
FT                   /protein_id="ACG71496.1"
FT                   /translation="MAEPSTVVKPEVEQKEFRPYIGADRTLPEFTPKAVLLGALFGILF
FT                   GAATVYLALKAGLTVSASIPIAVIAISLGRKVFKTSILENNIIQTTGSAGESIAAGVVF
FT                   TLPGFLFLSAGPGGSSVGAGYFSYVTLFTLSMVGGILGVLMMIPLRRSLIVKEHGQLVY
FT                   PEGTACASVLIAGDKGGDFAKTAFQGVGFALGYALLQKVFHVIAETPAWVTKQTNKWLP
FT                   NATVNGEITPEYLGVGYIIGPRIAGVLVAGGVLAWLGLIPLLSVLVPGEVIARQLVKVG
FT                   ASPEGFGFDAAAGTFANLPRAVYLAYIRQIGAGAVAAAGFITLLKTFPTIVSSLRDSIR
FT                   SLGDKAGAASVSRTERDLSFVTVIVGSIALVVLLVALPQVPGDTVLNKLLTAVLIIAFG
FT                   FIFVTVSSRIVGIIGSSSNPISGMTIATLMATAMVFVSVGWTGAAYEPMALVVGGMVCI
FT                   AAANGGATSQDLKTGYLVGATPRAQQLALFVGAIASATVIGVTVKVLDTPTARMISEGI
FT                   TDHAIGSSYFPAPQATLMATLIKGLLSLNLDWHFVLVGAFIAITMELCGVKSLSFAVGL
FT                   YLPLSTTLPIFVGGALKGVADFASRRKGGAGEEGELGSGSLFATGLVAGGALFGVIVAF
FT                   LQVFAEGTMKRLDLQESIVHAIGSTGYAVLGVVFFAGLAAVLYRAARKPQPGLEA"
FT   gene            complement(287563..290145)
FT                   /locus_tag="AnaeK_0255"
FT   CDS_pept        complement(287563..290145)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0255"
FT                   /product="response regulator receiver protein"
FT                   /note="PFAM: response regulator receiver; KEGG:
FT                   ade:Adeh_2705 response regulator receiver"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71497"
FT                   /db_xref="GOA:B4UM89"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:B4UM89"
FT                   /protein_id="ACG71497.1"
FT                   /translation="MALNVLLVEPDPGLAEEIRRALGPAGFSVSAVASGEPALARCREL
FT                   APDLILLAAELPDMSGFSVCNRLKRAAASVPLLLYTGEATDAAIAAHRATRTRADDYLK
FT                   KPFELAELLGRAAALLHGDAPAPPPPPAPPPAATPASRAPRAGEGEPPPVLQRVESGVV
FT                   AARGLAGALAAATPPPGAGARPGPAAAPRPPPPPPPPPPRGAPLGKVKVAGASPRPDPA
FT                   DVLAEWPRDPAPPKGTPEEKLEYFRDRLRARDAFLARVRDAIAAMKAEVAELAGERDLL
FT                   ARDLAGERDRAAGLEARLAEGAQDAAAQAARLEDLRRQLEESESTRRSLSEVLNETMQQ
FT                   QESAEQEASARIAGAEEARARLEAELAEAVEAHARAMAAVEADRADERAALEAARAQAE
FT                   ADAARGLEQVEAERVRERDEAAERLGMAEARATAAAAERDALEAELAALRGELGERDRA
FT                   LAEGEARAGEARRAAEAEAQALRAAADEAEGRAQAAAGEHAEARERIAALEAELAEAAG
FT                   TREALEEALRQAQAEARAYDQKAVAAEHAFQAKAAELAAAAQRIADLGAALDEGRASVE
FT                   GTRGELARVEAGRAEAERKGAQAAAERDQLAREVEAARREGEAERERARRLDAEVKRLA
FT                   QLEPVAEEAARLRKEVGSLREMVQQRTQAAEAASRSAQAAAAERARAEERAAVEAGKLQ
FT                   GSAARLESELGAVRRKLAELDAERSARAAELEKVRAELQTAQAEADRRRQGAAAEAGEA
FT                   ERRHAAEAARLKAAMVELEKHLEARARADLVMKKRIQELEKAAAAPRPPPVPAADPAEV
FT                   AKLKAAVARLDEELGDLRGENDFLNGEVARYQQKNRDLQAQLDSLREV"
FT   gene            290430..291293
FT                   /locus_tag="AnaeK_0256"
FT   CDS_pept        290430..291293
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0256"
FT                   /product="ribosomal protein L11 methyltransferase"
FT                   /note="TIGRFAM: ribosomal protein L11 methyltransferase;
FT                   PFAM: methyltransferase small; ribosomal L11
FT                   methyltransferase; Methyltransferase type 11;
FT                   Methyltransferase type 12; KEGG: ade:Adeh_0246 LSU
FT                   ribosomal protein L11P methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71498"
FT                   /db_xref="GOA:B4UM90"
FT                   /db_xref="InterPro:IPR004498"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B4UM90"
FT                   /protein_id="ACG71498.1"
FT                   /translation="MSTHSLTLDVPRARAEDLSAELWELGASGVEVRDGEGTPMPGLPQ
FT                   PAPGRALLVAWFADRASAEAAAASAGGGEVAEVPDEDWGETWKKGLGPMVIGRAFVRPS
FT                   WVDAPVPPGLAEVVLDPGMAFGTGTHPTTSLCLAGLSELLAARPGASVLDVGTGSGLLA
FT                   IAARKLGAGRVTGNDNDPVAVAVARENAARNGVPEVALTEDALPAIGGAFDVVVANILA
FT                   NTLVELAPEIAARLAPGGAVLLSGILGPQEDEVRAAYLALGLRPLAGGDRREGEWSLLA
FT                   LEKPRA"
FT   gene            291290..292012
FT                   /locus_tag="AnaeK_0257"
FT   CDS_pept        291290..292012
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0257"
FT                   /product="protein of unknown function DUF558"
FT                   /note="PFAM: protein of unknown function DUF558; KEGG:
FT                   ade:Adeh_0247 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71499"
FT                   /db_xref="GOA:B4UM91"
FT                   /db_xref="InterPro:IPR006700"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:B4UM91"
FT                   /protein_id="ACG71499.1"
FT                   /translation="MSLRRVHLPPERIGEGRAALTDEARHYLRDVLRLAPGAAVELFDG
FT                   RGGAWEATVLDGFEALALGARRAAPGGGAPVWLLVALAKGEKIDLVVQKATELGAARIA
FT                   PFAAERSVVRLEPEKGEARAARWRRIAEEAARQCGRADVPEVRAPAPLGAALAEVPAGF
FT                   GAFVFHPGGASLSEAAPSPAGGYAAVVGPEGGLTDAEREACARAGARDTSLGPRVLRAE
FT                   TAAIVAVALLQARFGDLR"
FT   gene            292111..293115
FT                   /locus_tag="AnaeK_0258"
FT   CDS_pept        292111..293115
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0258"
FT                   /product="RDD domain containing protein"
FT                   /note="PFAM: RDD domain containing protein; KEGG:
FT                   ade:Adeh_0248 RDD"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71500"
FT                   /db_xref="GOA:B4UM92"
FT                   /db_xref="InterPro:IPR010432"
FT                   /db_xref="UniProtKB/TrEMBL:B4UM92"
FT                   /protein_id="ACG71500.1"
FT                   /translation="MVFCAGCGAPLALAPEPPPRALDASLSIDRRGDARPPGTPPPLRG
FT                   APPPPASAADTFVFGLPAMPAPAVPAPAAPARSGRAREVDRSGWDLGPPLGVRQPDAPP
FT                   PQAAVPAADTAEDDFEFGPLPDLRPEPARSLPPPAAAFARALEVDREDLGAPAAPGAVP
FT                   AAEAAPDEAIEVDVDAVEVHLRRPATWRRAASWAIDVLPFAALAIWALQAIAGAVPLAP
FT                   GEPGGPAHALDLALRDGGAIALPLAAGAVILGLVYQTLGHALAGATLGKLALGLRVVGP
FT                   DGRRPSLARSAARAALSAASVLLLGLGLLAALFTRSGRSLHDLAAGTWVVEAP"
FT   gene            293148..295673
FT                   /locus_tag="AnaeK_0259"
FT   CDS_pept        293148..295673
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0259"
FT                   /product="General secretory system II protein E domain
FT                   protein"
FT                   /note="PFAM: PBS lyase HEAT domain protein
FT                   repeat-containing protein; General secretory system II
FT                   protein E domain protein; KEGG: ade:Adeh_0249 PBS lyase
FT                   heat-like repeat protein"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71501"
FT                   /db_xref="InterPro:IPR004155"
FT                   /db_xref="InterPro:IPR007831"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR037257"
FT                   /db_xref="UniProtKB/TrEMBL:B4UM93"
FT                   /protein_id="ACG71501.1"
FT                   /translation="MRRDLAQLLVEEGAIPAAAAERAAARQAEAGGALDTALLELGLAG
FT                   EDVVLRALERASGLPAAPDWAWDASDARARRVFPSRVAERHGLAPFALDGRELSLVATH
FT                   PVDLALLDEISFMLSLHLTPHVGPEWRVRALIHRLYGGALPPRLAALAAGGAAAAAPGA
FT                   EAAAPEPAGAEPEAPDEGAPPPAAVADPEPPAPPPPAPAAAGFDEPGQLEPLAAAVAQV
FT                   LESADFSFLDAAPPSPAPEPSEAADAVDPAPAARPSTGAGRASAAGAARVERAEPPAEP
FT                   ASRPAPRRMGEAAAPPPAPAPGAQGRWTRAQAQAALAAAGERDEVLRVVLRYAREFFAF
FT                   AAVFAVSRDAVAGHDALGEEEGEDARALCRSVAIYTSDPGVFHTAIETHAPHLGPISPE
FT                   PEGNRAILDGLGRGTPRTVLVHPVVLRQRTACLLYADNGKSAVSPRRLADLVLFLAGLA
FT                   PALERVIQARKRARSGVGGAGEVAAAAPAAPTPVAAPAPAPAPSPTRAASPAAPARPTP
FT                   APVPAPTGEPWQAHEPAAALADLEVDIDLFEEELGAAAPPSGAVRFDPEAEVTALLETD
FT                   AGSLDRIAGLARLAAFPEAALPVVWARLPGPIESDEDGASPTALGPLAAALAALGPAAV
FT                   PAMVEVLRDRDPVRRRIAATVLGAAGDPSTFPALAERVLDPDPRVAGAAIAALAAHRRH
FT                   PEMRAVPEKLRRALLSGVAARTTSAARALGAIRDAESVPLLVQVLESSEREPAEAAAAA
FT                   LAEITLQRLGTDARRWLAWWKQNRGRGRAEWLLSGLTSAERDVRAAAAEELARAAPPPV
FT                   SYQVDAPAPEREAAARLWAGWWARSGLVL"
FT   gene            295808..297367
FT                   /locus_tag="AnaeK_0260"
FT   CDS_pept        295808..297367
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0260"
FT                   /product="carboxyl transferase"
FT                   /note="PFAM: carboxyl transferase; KEGG: ade:Adeh_0250
FT                   carboxyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71502"
FT                   /db_xref="GOA:B4UM94"
FT                   /db_xref="InterPro:IPR000438"
FT                   /db_xref="InterPro:IPR011762"
FT                   /db_xref="InterPro:IPR011763"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR034733"
FT                   /db_xref="UniProtKB/TrEMBL:B4UM94"
FT                   /protein_id="ACG71502.1"
FT                   /translation="MPHSDPDPRRALLDQLDAEAEKGGGDERVARQHREGKLTARERID
FT                   AFLDPGTFVEMDRFKTHRCADFGMAEHKVLGDGVVTGYGLVEGRQVFVFAQDFTVFGGS
FT                   ISGAVAEKICKVMDRAMEVGCPVVGLNDSGGARIQEGVVSLAGYAEIFLRNTLASGVIP
FT                   QLSVIMGPCAGGAVYSPAITDFIFMVKDTSYMFITGPDVIRAVTHAEVTKEDLGGARTH
FT                   AARSGVAHFALDTEEAALRAVRELLSFLPLNNVDDPPVQPCADDPGRRDELLKTIAPEN
FT                   PGKAYDMKEVVRAVADDRHFFEVAEQFAPNIVIGFARLNGRPVGVVANQPAVLAGVLDI
FT                   DASVKAARFVRFCDAFNVPLLTFVDVPGFLPGTDQEWNGIIVHGAKLLYAYAEATVPKI
FT                   TVITRKAYGGAYDVMASKHIRADVNLAWPGAEIAVMGPEGAVNVIFRKELLAAKDPVAE
FT                   RARLVQEYRDRFASPYKAAELGYVDEVIRPEDTRPRVIRALEMLRTKRQELPAKKHGNI
FT                   PL"
FT   gene            complement(297462..298121)
FT                   /locus_tag="AnaeK_0261"
FT   CDS_pept        complement(297462..298121)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0261"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ade:Adeh_0251 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71503"
FT                   /db_xref="GOA:B4UM95"
FT                   /db_xref="InterPro:IPR019251"
FT                   /db_xref="UniProtKB/TrEMBL:B4UM95"
FT                   /protein_id="ACG71503.1"
FT                   /translation="MPMRTHELHPAIVHAPLALLPAAAIADLVATARPRDRALDAVGRT
FT                   LWWSAAAGGLAAGLAGMAASQEIEVRGEHARDAMFLHGIGNLGLVVAAFGVAAWRSRNR
FT                   ACLTTALSGLAASAAATYTAYLGGELVYGHGAGIRALGGAASEAPALFSAAAPGRLARD
FT                   AVRGLRWLLSRGARAVTGRERVDRTALGPLAEAGTGAVPPAPGARTDGSGMGAPLS"
FT   gene            complement(298309..298512)
FT                   /locus_tag="AnaeK_0262"
FT   CDS_pept        complement(298309..298512)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0262"
FT                   /product="cold-shock DNA-binding domain protein"
FT                   /note="PFAM: Cold-shock protein DNA-binding; SMART: Cold
FT                   shock protein; KEGG: ade:Adeh_0252 cold-shock DNA-binding
FT                   protein family"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71504"
FT                   /db_xref="GOA:B4UM96"
FT                   /db_xref="InterPro:IPR002059"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012156"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019844"
FT                   /db_xref="UniProtKB/TrEMBL:B4UM96"
FT                   /protein_id="ACG71504.1"
FT                   /translation="MATGTVKWFNDAKGFGFITQDDGGEDVFCHYSAISGDGFKSLAEG
FT                   QKVEFDVVKGPKGLQAANVRKV"
FT   gene            complement(298664..299839)
FT                   /locus_tag="AnaeK_0263"
FT   CDS_pept        complement(298664..299839)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0263"
FT                   /product="2-nitropropane dioxygenase NPD"
FT                   /note="PFAM: 2-nitropropane dioxygenase NPD; KEGG:
FT                   ade:Adeh_0253 2-nitropropane dioxygenase, NPD"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71505"
FT                   /db_xref="GOA:B4UM97"
FT                   /db_xref="InterPro:IPR004136"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:B4UM97"
FT                   /protein_id="ACG71505.1"
FT                   /translation="MTADATPVHPEETPAPFPRLDRAAIEALVRAGKRLLVQGGMGIHA
FT                   SDGLAGKVARHRGARLVGVGTISAVLKTPEQLRGEIRRARAEAPGGFVGVNLMAAINKD
FT                   DFEALARVSIEEKVSFLVQGAGISREIVRWCREGGVPFCGIVSSGRLAAMYEKWGADFV
FT                   VAEGAEAGGHIGDIGHPLPMLVDEVIAATSLPVIAAGGVDAADVSRFLAAGAAGVQMAT
FT                   RFLACSDGDVHPAFKQMHLAKREDDVVIITSCVKGMKARAVRNAFTERLARGEAVPPRS
FT                   KLWWFGKDGYRGRRGACIQCLGEGLCKARASGFKESFCITDALLEAAVHGDTEAGLFYT
FT                   GQSITRIGERDASDLPRAAEILTDLEQRLADEARPSDAGSQAGTAAVGAAA"
FT   gene            300077..301390
FT                   /locus_tag="AnaeK_0264"
FT   CDS_pept        300077..301390
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0264"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ade:Adeh_0254 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71506"
FT                   /db_xref="UniProtKB/TrEMBL:B4UM98"
FT                   /protein_id="ACG71506.1"
FT                   /translation="MTAPSPAPIVVAVDMGYGHLRAATALADALGTEVLKVDRAPVAGP
FT                   DEERLWQRVRRGYEAISRLSQVPGVGRPLGWMLDSITDIPRLHPRRDLSAPTRGVRALE
FT                   RLARGDLGAGLVARLRDEGAPLLTTFYSPAIIADRAGVERVYCVATDTDLNRIWAPLEP
FT                   ARTRIQYLVPTRRAARRLLAYGVPANRITFTGFPLPDALLGGPSLPALRRNLAARLVRL
FT                   DPTGEFRRSMPEELAVFLGALPREEEGRPAQLTFAVGGAGAQAAMADAFLPGLRPALES
FT                   GAMRLALVAGTRPEVEARFREAVRRAGVEPLLGGAVEILRAPSFGEYYARFNALLARTD
FT                   VLWTKPSELTFYGALGLPLVLAPPVGVHERYNRRWARESGAGLKQRDARFAAEWLSDWL
FT                   ADGLLAAAAWAGYLHLPKFGLYRVLEAVGRAPTANIAP"
FT   gene            301630..302364
FT                   /locus_tag="AnaeK_0265"
FT   CDS_pept        301630..302364
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0265"
FT                   /product="1-acyl-sn-glycerol-3-phosphate acyltransferase"
FT                   /note="TIGRFAM: 1-acyl-sn-glycerol-3-phosphate
FT                   acyltransferase; PFAM: phospholipid/glycerol
FT                   acyltransferase; KEGG: ade:Adeh_0255
FT                   1-acyl-sn-glycerol-3-phosphate acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71507"
FT                   /db_xref="GOA:B4UM99"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="InterPro:IPR004552"
FT                   /db_xref="UniProtKB/TrEMBL:B4UM99"
FT                   /protein_id="ACG71507.1"
FT                   /translation="MLAVFSFVYWIFFVLTLPFLFAVALVLYVLTAPFDRRRVVLQLWS
FT                   CAWASFYVVVNPLWRARVVGREKLPWNGAAVLVANHLSMLDILVLYGLFRPFKWVSKAE
FT                   LFRVPFVGWNMWLNDCVPVWRGDRESVRRMMAHCRAHLARGAPVMIFPEGTRSQDGRLQ
FT                   AFKDGAFRLAVDANVPVIPIAVSGTSEALPKHGLVLRQRMRAEVRVLDPIHPSAFDGPA
FT                   ALREAVRDAIAAALPPEHRPDP"
FT   sig_peptide     301630..301725
FT                   /locus_tag="AnaeK_0265"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.748) with cleavage site probability 0.657 at
FT                   residue 32"
FT   gene            302589..303116
FT                   /locus_tag="AnaeK_0266"
FT   CDS_pept        302589..303116
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0266"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: nfa:nfa25710 putative transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71508"
FT                   /db_xref="InterPro:IPR018727"
FT                   /db_xref="InterPro:IPR038282"
FT                   /db_xref="UniProtKB/TrEMBL:B4UMA0"
FT                   /protein_id="ACG71508.1"
FT                   /translation="MITHTYEVAGGVGARTPGAIGPDELDGRADWVEIPARGEGELMER
FT                   LEARLGSEARTRKVLLAVLAPVRGALEGPALAAILAHLPHRFARELREAEWNLDAPVRE
FT                   AATGAEYLGEVSRLLQRPPRHAAAYVLAVLAAAHEVMGPAAREVAGQLPPDLADLWRGV
FT                   REPGSAIAEAEP"
FT   gene            complement(303076..304293)
FT                   /locus_tag="AnaeK_0267"
FT   CDS_pept        complement(303076..304293)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0267"
FT                   /product="histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase A domain protein; KEGG: ade:Adeh_0256
FT                   histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71509"
FT                   /db_xref="GOA:B4UMA1"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B4UMA1"
FT                   /protein_id="ACG71509.1"
FT                   /translation="MAPHDAPGQEAGQAAQAQGRVDLLRALDRLLAIEPEEHALRRILS
FT                   ALADAVPAVHAAVLLVPGDEGRLAIAAEVGGDGRPPPPADGGAGLAAGAPWVRHDPGWP
FT                   LAAGARAGAAAPAGGGALLVMGTRGEGGFDPEALALLRVAADRAGLALERGRLRRAHES
FT                   AEEAARRALAEVDSRRRAVDYILGIVGHDLRNPLGAVHMSAALLQKRGGLEGWQARAIE
FT                   RMRSSAGRMARIIADLLSYTRTRLGNGMPIDRRPARLDEIARRPVDELGAVNPGREITV
FT                   EVRGDVSGSWDPDRLEQVISNLVSNAVDHGDPASPVRVELVGEPDACVLRVRNTGPPVP
FT                   PEVLEHLFEPFSRPPDEKSRKGSGLGLGLYISREIVRGHGGEISIASDGETVITARLPR
FT                   SQSPAP"
FT   gene            304509..306041
FT                   /locus_tag="AnaeK_0268"
FT   CDS_pept        304509..306041
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0268"
FT                   /product="Carbamoyl-phosphate synthase L chain ATP-binding"
FT                   /note="PFAM: Carbamoyl-phosphate synthase L chain
FT                   ATP-binding; Carbamoyl-phosphate synthetase large chain
FT                   domain protein; biotin carboxylase domain protein; KEGG:
FT                   ade:Adeh_0257 carbamoyl-phosphate synthase L chain,
FT                   ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71510"
FT                   /db_xref="GOA:B4UMA2"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005481"
FT                   /db_xref="InterPro:IPR005482"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR011764"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:B4UMA2"
FT                   /protein_id="ACG71510.1"
FT                   /translation="MSPTRPIEKVLVANRGEIAVRVMRTCREMRIPTVAVYSEADRGAL
FT                   HVRKADEAVFIGPAPARESYLSIERILDACRRTGADAVHPGYGFLSENAELARALDRAG
FT                   IALVGPPAAAMDAMGVKTTARRNMAAAGVPVVPGSEEPFAEEAEARAFAERIGFPVMIK
FT                   AAAGGGGKGMKKCDRAEDFAALWQSARREATAAFGDDRLYLEKFLEKPRHVEIQIFADQ
FT                   HGNCVWLGERECSVQRRQQKVIEETPSAVLDDRLREAMGEVAVRAARAVGYVGAGTVEL
FT                   LVDAHRNFYFLEMNTRLQVEHPVTEMVTGLDLVRMQLEVARGAPILAQEQVQRRGHAIE
FT                   ARVYAEDPARGFLPQPGKITYLRVPGGPGIRDDSGVYAGWVVPQWYDPMISKLVAWAPT
FT                   RAQAIDRLIRALGEYVVHGIGTNLGWLAAALDHPEFRSGDYDTGFCARNAKALIRPPDP
FT                   SLERVALIAAAVAAFKRERDAAEAHAARAGQGAARSGWARAGRLRALRGGGR"
FT   gene            306038..306550
FT                   /locus_tag="AnaeK_0269"
FT   CDS_pept        306038..306550
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0269"
FT                   /product="biotin/lipoyl attachment domain-containing
FT                   protein"
FT                   /note="PFAM: biotin/lipoyl attachment domain-containing
FT                   protein; KEGG: ade:Adeh_0258 biotin/lipoyl attachment
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71511"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001882"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="UniProtKB/TrEMBL:B4UMA3"
FT                   /protein_id="ACG71511.1"
FT                   /translation="MKTYVALLDGGKREVTLGVTRLATGQYEVRIGDEVHRVDAYPHDY
FT                   GTLSLLVDTRSYSAMLDERGAKVHVQVDGSVFPLELLDERKLRMRRASPRASVEGRRAV
FT                   TAPMPGRVVKVLVSPGDAVRAGQPLVVVEAMKMENEMRSPKDGKVVEVRVVEGQAVEGS
FT                   ALLCAVE"
FT   gene            306623..308272
FT                   /locus_tag="AnaeK_0270"
FT   CDS_pept        306623..308272
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0270"
FT                   /product="methylmalonyl-CoA mutase, large subunit"
FT                   /EC_number="5.4.99.2"
FT                   /note="TIGRFAM: methylmalonyl-CoA mutase, large subunit;
FT                   PFAM: methylmalonyl-CoA mutase; KEGG: ade:Adeh_0259
FT                   methylmalonyl-CoA mutase"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71512"
FT                   /db_xref="GOA:B4UMA4"
FT                   /db_xref="InterPro:IPR006098"
FT                   /db_xref="InterPro:IPR006099"
FT                   /db_xref="InterPro:IPR016176"
FT                   /db_xref="UniProtKB/TrEMBL:B4UMA4"
FT                   /protein_id="ACG71512.1"
FT                   /translation="MADEKKQRWLEGTYAKAVKKGPERRPRFETSSGIREEPVYGAADV
FT                   RPGLDERLGLPGEYPFTRGVQPTMYRGRFWTMRQYAGFGTAEESNKRYRYLLESGQTGL
FT                   SVAFDLPTQMGRDSDHPRARGEVGKVGVAIDSIRDMEVLFDRIPLGEVSTSMTINATAG
FT                   MLLAMYQAVGEKQGAAPAVLQGTIQNDILKEYAARGTYIYPPEPSLRIITDIFAYTAKV
FT                   MPRWNPISISGYHIREAGSTAVQEVAFTLADGIQYVDAAVKAGLDVDAFAGRLSFFFNA
FT                   HNDLLEEVAKFRAARRLWARIMKERFKAKDPRSMMLRFHTQTAGSMLTAQQPDNNIVRV
FT                   TIQALAAVLGGTQSLHTNSRDEALGLPTEDSVRIALRTQQIIANESGVADVIDPLGGSW
FT                   AIEAMTDEIEGRAQEYIRKIDELGGMVHAISKGYVQREIQEAAYAWQRQVEAKDQVVVG
FT                   VNAFRSDDPPVPVMKVDPALEAQQVERLKALRAARSASAARGALDAVRAGARGTDNLMP
FT                   LILAAVKAECTLGEISDALREVYGEYRETVVL"
FT   gene            308396..310093
FT                   /locus_tag="AnaeK_0271"
FT   CDS_pept        308396..310093
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0271"
FT                   /product="heat shock protein DnaJ domain protein"
FT                   /note="PFAM: heat shock protein DnaJ domain protein;
FT                   Tetratricopeptide TPR_2 repeat protein; KEGG: ade:Adeh_0260
FT                   DnaJ like heat shock protein with tetratricopeptide
FT                   repeats"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71513"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="InterPro:IPR037257"
FT                   /db_xref="UniProtKB/TrEMBL:B4UMA5"
FT                   /protein_id="ACG71513.1"
FT                   /translation="MPRAVAPAAARPPPPPPPAPTYGLAAREVGADAAIAAGLAHQGAL
FT                   TADSALRLYGLAAATRASGRLTLAPAGRSYALVFRRGAVEHAASSDPTDDLGRFLLRKG
FT                   VLRPEQLVQAEAARAAAGGDLAAALVGARLVPPGDVAALLAEHGLALVARALAVEDGTW
FT                   AWEPGVAPPPSGFPLGPPFAALCAAVRALELAAVKRRLGDREERAASRMAGRVRIEDLR
FT                   LTPQEARAAALLDGERSPAEIAAASPADAAAVLRLSLLLGELDLLAFGARRGRAPASGP
FT                   TSAPTPTPTPRPAPTPAPTPVPRAAPAVPAAAAPRPPAASHPPAPPAAAARPPSAPVRR
FT                   ATALEPAALKATLASLEGSDHFQVLGVKRDAPAAQVKVAYFQLAKLYHPDAIPSDAPAD
FT                   VRKLCADLFARVSAAWAELGDEARRAQYLEELRSGGAPEVDVMGILQAENLFQAGTQLV
FT                   KARRYDEAHARFLEALQLNPEEPEFGIWKAWCDFLRADDKKRQQAQSAAAIEAGLKKNP
FT                   RCAPGYLFLGQMAKVLGDLAIAERHLRRGLAAAPDNADLARELKYLRK"
FT   gene            310106..310618
FT                   /locus_tag="AnaeK_0272"
FT   CDS_pept        310106..310618
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0272"
FT                   /product="protein of unknown function UPF0044"
FT                   /note="PFAM: protein of unknown function UPF0044; KEGG:
FT                   ade:Adeh_0261 protein of unknown function UPF0044"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71514"
FT                   /db_xref="GOA:B4UMA6"
FT                   /db_xref="InterPro:IPR001890"
FT                   /db_xref="InterPro:IPR035920"
FT                   /db_xref="UniProtKB/TrEMBL:B4UMA6"
FT                   /protein_id="ACG71514.1"
FT                   /translation="MPAPTNPKKRALMPSSPLRRALRAAGHHLSPVVQVGKEGLTEAVL
FT                   RQLDEALLAHELVKLKVGTESPEDRLEIADRLLAEDVQVAQVLGRTVLAYRRHPERPRY
FT                   EPAPAGARAERPEPKRAAAKGRRAPVKEKRAPARGQRAPARERRAPAKGQRPAGRRPAP
FT                   RAKRTKR"
FT   gene            complement(310646..310957)
FT                   /locus_tag="AnaeK_0273"
FT   CDS_pept        complement(310646..310957)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0273"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ade:Adeh_0262 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71515"
FT                   /db_xref="UniProtKB/TrEMBL:B4UMA7"
FT                   /protein_id="ACG71515.1"
FT                   /translation="MFALLAAAALLLAVASWIRFRRLEQALVGELAGLTARVKDLAERV
FT                   DAAEADVGHAVTQTEIAESLLLDKGIAEPEELEALRRRVDEDDAPAPAYQPERDGALH"
FT   sig_peptide     complement(310910..310957)
FT                   /locus_tag="AnaeK_0273"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.759) with cleavage site probability 0.307 at
FT                   residue 16"
FT   gene            311087..311686
FT                   /locus_tag="AnaeK_0274"
FT   CDS_pept        311087..311686
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0274"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ade:Adeh_0263 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71516"
FT                   /db_xref="UniProtKB/TrEMBL:B4UMA8"
FT                   /protein_id="ACG71516.1"
FT                   /translation="MTRAVKRLIRDLALRVPELGHVRASRVLVVAGEARRSSRATIRPA
FT                   HFGATRRRAGEGGAVKPLVRVKGRKILYVVTLRPLWFLASTPEERIGTIVHELYHASNR
FT                   FDGTLHRGRRHSRFPRARYNRKVRALLRAYLARAPEEVVAPFAHQGVVRARMWLERPGS
FT                   FRDGEYSGRRLYTEKQLFYGLVRMRSGARRRGPSAG"
FT   gene            complement(311683..312258)
FT                   /locus_tag="AnaeK_0275"
FT   CDS_pept        complement(311683..312258)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0275"
FT                   /product="Fe-S type hydro-lyase tartrate/fumarate beta
FT                   region"
FT                   /note="PFAM: Fe-S type hydro-lyase tartrate/fumarate beta
FT                   region; KEGG: ade:Adeh_0264 Fe-S type hydro-lyase
FT                   tartrate/fumarate beta region"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71517"
FT                   /db_xref="GOA:B4UMA9"
FT                   /db_xref="InterPro:IPR004647"
FT                   /db_xref="InterPro:IPR036660"
FT                   /db_xref="UniProtKB/TrEMBL:B4UMA9"
FT                   /protein_id="ACG71517.1"
FT                   /translation="MPKTLTLPALPEDVRGLAAGDEVLLRGRIVTGREAAHRYLATHDD
FT                   PQVRRWTEGAVLYHCGPVVARAPGGGWRFVAAGPSASGRQEAWEAEVIARYGLRGVLGK
FT                   GGMGPRTLEALRAHGAVYLHAAGGLAVSLARHVTRVLDVARLDALGVTEAIWLAEVEDF
FT                   PAVVTMDAHGETLHARGAEAPETTPAPG"
FT   gene            312459..313397
FT                   /locus_tag="AnaeK_0276"
FT   CDS_pept        312459..313397
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0276"
FT                   /product="pseudouridine synthase, RluA family"
FT                   /note="TIGRFAM: pseudouridine synthase, RluA family; PFAM:
FT                   pseudouridine synthase; KEGG: ade:Adeh_0265 pseudouridine
FT                   synthase, RluD"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71518"
FT                   /db_xref="GOA:B4UMB0"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR006224"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:B4UMB0"
FT                   /protein_id="ACG71518.1"
FT                   /translation="MRREIRLPLTASGRLDRALADALGLGRAAVKRAFALGEVRVRGRR
FT                   ARASDPAAPGALVELDVEVPAGPPEPQPDAPLSVLLERPRYLVVEKPAGVAVHPLAPGE
FT                   GGTLANAVAARHPECAEASPEPREGGAVQRLDLETSGCVLFARDPEAWEALHAQLGAHT
FT                   VDKVYLALAVGRLPAGGVCSVPLAQRGGRVVPAPDLEAEERLQARGLRPRPAETHYEPE
FT                   RRFADHTLLRVRIVTGVMHQIRAHLALLGHPVAGDALYGGAAAGLPGLERQFLHAWRLA
FT                   FDDPDGAGRVAVESPLPPELEAVLARLPAAR"
FT   gene            complement(313519..313965)
FT                   /locus_tag="AnaeK_0277"
FT   CDS_pept        complement(313519..313965)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0277"
FT                   /product="Biopolymer transport protein ExbD/TolR"
FT                   /note="PFAM: Biopolymer transport protein ExbD/TolR; KEGG:
FT                   ade:Adeh_0266 biopolymer transport protein ExbD/TolR"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71519"
FT                   /db_xref="GOA:B4UMB1"
FT                   /db_xref="InterPro:IPR003400"
FT                   /db_xref="UniProtKB/TrEMBL:B4UMB1"
FT                   /protein_id="ACG71519.1"
FT                   /translation="MAMGLGSKRPVTDINVTPLIDVVLVLLIIFMVLTPLAEKQKFIRV
FT                   PEYQPEMQPVPPDSVPPDQTVLTALGNGNVLLNKQEMTINDAMQRLHVAYDGRPSKVMF
FT                   FNAEDSVRYEQAVKVLDAAHGAGVNTIGMMTDPPLAGGAAGEQQ"
FT   gene            complement(313968..314387)
FT                   /locus_tag="AnaeK_0278"
FT   CDS_pept        complement(313968..314387)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0278"
FT                   /product="Biopolymer transport protein ExbD/TolR"
FT                   /note="PFAM: Biopolymer transport protein ExbD/TolR; KEGG:
FT                   ade:Adeh_0267 biopolymer transport protein ExbD/TolR"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71520"
FT                   /db_xref="GOA:B4UMB2"
FT                   /db_xref="InterPro:IPR003400"
FT                   /db_xref="UniProtKB/TrEMBL:B4UMB2"
FT                   /protein_id="ACG71520.1"
FT                   /translation="MSMDVGGKGVKSEINVTPLVDVVLVLLIIFMVITPMLQRGKPVVL
FT                   PDAKHVSALKQGGDPILVSVTKDGKIWIDKEEVQKADLSQMLTIAMQMQPGAPVLVKGD
FT                   RDVTYKTIREMIFEISKTHIMGVSLAASQIKDKEK"
FT   gene            complement(314420..315178)
FT                   /locus_tag="AnaeK_0279"
FT   CDS_pept        complement(314420..315178)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0279"
FT                   /product="MotA/TolQ/ExbB proton channel"
FT                   /note="PFAM: MotA/TolQ/ExbB proton channel; KEGG:
FT                   ade:Adeh_0268 MotA/TolQ/ExbB proton channel"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71521"
FT                   /db_xref="GOA:B4UMB3"
FT                   /db_xref="InterPro:IPR002898"
FT                   /db_xref="UniProtKB/TrEMBL:B4UMB3"
FT                   /protein_id="ACG71521.1"
FT                   /translation="MSLQVIQTLQQLAAAQATPEVSFDLLHMWKTMGPFAKFIAGVLAV
FT                   MSIYSLGVMAERLVTFARAQKASRQFAAALRDLLPAAKFGEAVELSRKLKRGHLPKVLG
FT                   LAIEEYSHGVEALKTHGPRDVGNFDVIAAVNRAVERSSLRTVNDLRRGLGALATVGSTA
FT                   PFVGLLGTVAGIITAFQAMAATGSGGLGSVSAGIAEALVTTAFGLLVAIPAVMMFNYLT
FT                   NRVEDMQVDITDSATELMDFFMKEGRSEVK"
FT   gene            complement(315231..315977)
FT                   /locus_tag="AnaeK_0280"
FT   CDS_pept        complement(315231..315977)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0280"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ade:Adeh_0269 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71522"
FT                   /db_xref="GOA:B4UMB4"
FT                   /db_xref="UniProtKB/TrEMBL:B4UMB4"
FT                   /protein_id="ACG71522.1"
FT                   /translation="MFDEVTKQEGGKNAAKRAGYVFGSTLFQVLLVFAIITASAAIKAK
FT                   VIDEPVVDVKFVKAVPPPPPPPPAPPPPAARKRPPDEKPRTDLPKPPPPTALLQPKDVQ
FT                   AEMKPPDPNEPPEPEYDYGDAAAGEGVVGGVVGAAPQQNQIEDAPAYATAGYKKPQMAQ
FT                   PNCVQQSVRLPRELLGYISGPITVKFAIGRDGAPSRFEAMTAVPDKRIADAIWNAVQTC
FT                   KWVPGADAQGRPTAIWVILPLRFTAG"
FT   gene            316491..319853
FT                   /locus_tag="AnaeK_0281"
FT   CDS_pept        316491..319853
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0281"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ade:Adeh_0270 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71523"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR008969"
FT                   /db_xref="InterPro:IPR039426"
FT                   /db_xref="UniProtKB/TrEMBL:B4UMB5"
FT                   /protein_id="ACG71523.1"
FT                   /translation="MRKKLLRLLRIAPLALLFAGVAFAQTTGTIIGVVTDASTGKPVAG
FT                   AVIVARSPNLQGEQTAVTDANGNYRITLLPPGAYSLAVQLEGFKPAERADITMRTDKTI
FT                   RANIAVVPEAVQMEEQVVRTGAAPVVNIGAAESGAVVSREFMANIPVGRSVENVATVVP
FT                   TAQTDSYGVSFAGAQSPENSYIVDGLNVTDPVYGTFAGNPNSQTLTPTLQNNFVQEIDV
FT                   KTGGFQPEYGRTTGGVLNVVTRSGSNEYHGSVFTDFTPRMLIDPTGKTAGTNGEAIGWR
FT                   RKPDEGAYDLDFGFEVGGPIMKDKLWFYAGFAPIVTRTYTERFLQLNRMEQDPTTHAWS
FT                   PALNESTGLIEQDRVPGTEQVYRSGRTTYQYVGKLTYLLDENNNLTLSAVGMPTSATSI
FT                   SMPGGPSRRTFDETGNTFDGSLRYAGKFLEKRLIVEAQAGWHYNKSAPKDKTQAGVDQL
FT                   NTPTLQFRFRTPVTNFEQLPECVGRAADPTTPGDTGYSATDVCGVNLYNTGGLGYLSDA
FT                   VSNRLATRVSASYLSELLGSHNTKVGVDFERSTFAQDKRYAGGYYYATTGNGLIYARRG
FT                   YGYVSTANGRIPATTPGTNTIPSEVNFATRIQNTAGTNSTSVYAQDSWQLPQNVTLNYG
FT                   IRWEGQSLNNVSNPESNGFTINNSWAPRVQAIWDFTGSGRGKVAGSWGRFFYAMPLDLG
FT                   DRTFGAERSLIFYMPTSAIGTAPGCAIPGGASEAGMANPTNQSLVTYDTRQLSPSNCGV
FT                   TNSGGGTGPDRSYLFRTSGTSASPVSPDISQAYVDQFGGQIEYEVLSDLSVGLEYAGRR
FT                   QGDIIEDMSPNDGEGYYIGNPTKGGEFVGSDGVTYNPSAPTATDTATGRLMVIPFPKPE
FT                   RSYDGVTVSVRKNFSRGWQASASYTYSVLRGNYAGPYRPEDDQLDPGITSQYDIPSIMT
FT                   NQKGYLYGDRPHQVKLFGSYTWAASPRFSLTGGAAYTGQSGNPISALAGYNDIYDVSQT
FT                   FVVPRGMAGRSPWTNKVDLRGALEYVIKPPYALKFTVDVFNVLNSEETILIDQDYTYDM
FT                   TQPISGAKCSSQSAVGKANPVQALQSACPDLKYLKTIDGRNVTVNPNWGRPASGTASFM
FT                   APLSLRLGLSLSF"
FT   sig_peptide     316491..316565
FT                   /locus_tag="AnaeK_0281"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 25"
FT   gene            319876..320661
FT                   /locus_tag="AnaeK_0282"
FT   CDS_pept        319876..320661
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0282"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ade:Adeh_0271 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71524"
FT                   /db_xref="UniProtKB/TrEMBL:B4UMB6"
FT                   /protein_id="ACG71524.1"
FT                   /translation="MKTLTKLALTLIAVAGLQACDPYEDENKGTPSVTNVIATDGGAAF
FT                   EGTNTGTSWTVATTSGTVVFVKANPGKLLDGASIQVTPEDCTPAGGWLSVNGAGPGNWM
FT                   SCYYPQSPASFEGASVVLYPGPSITATDSWFNLTELAAGIFNLKGTVSDKQGHPLDIDV
FT                   NVLVNDLAAAQSDTAGTEITVDFSDAGDNMTNVQLWEAPDNNGAPGTWAVVATTSPYVK
FT                   TGVTVGATWWYKVTADTNGFPTTAASFETAPVSVTTEAP"
FT   sig_peptide     319876..319935
FT                   /locus_tag="AnaeK_0282"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.996) with cleavage site probability 0.993 at
FT                   residue 20"
FT   gene            complement(320882..321541)
FT                   /locus_tag="AnaeK_0283"
FT   CDS_pept        complement(320882..321541)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0283"
FT                   /product="translation elongation factor Ts"
FT                   /note="TIGRFAM: translation elongation factor Ts; PFAM:
FT                   ubiquitin-associated- domain-containing protein;
FT                   Translation elongation factor EFTs/EF1B dimerisation; KEGG:
FT                   ade:Adeh_0272 translation elongation factor Ts (EF-Ts)"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71525"
FT                   /db_xref="GOA:B4UMB7"
FT                   /db_xref="InterPro:IPR001816"
FT                   /db_xref="InterPro:IPR009060"
FT                   /db_xref="InterPro:IPR014039"
FT                   /db_xref="InterPro:IPR018101"
FT                   /db_xref="InterPro:IPR036402"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4UMB7"
FT                   /protein_id="ACG71525.1"
FT                   /translation="MAEISAKMVQELREKTGAGMMDCKKALTEAGGDLAKAEEVLRKKG
FT                   LSAAAKKTGRAATEGAVASYIHMGGKIGVLVEVNCETDFVARTEGFQGLVKEIAMQIAA
FT                   ASPRWVRREEVPADVVAKELEIAKAQAREQKKPEAILEKIATGKVEKFYSEFCLMEQAW
FT                   VKDDKKKIQDVLTDAVAKIGENIQIRRFARFVLGEGLEKKQENLAEEVAKAAGLQK"
FT   gene            complement(321651..322595)
FT                   /locus_tag="AnaeK_0284"
FT   CDS_pept        complement(321651..322595)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0284"
FT                   /product="ribosomal protein S2"
FT                   /note="PFAM: ribosomal protein S2; KEGG: ade:Adeh_0273 SSU
FT                   ribosomal protein S2P"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71526"
FT                   /db_xref="GOA:B4UMB8"
FT                   /db_xref="InterPro:IPR001865"
FT                   /db_xref="InterPro:IPR005706"
FT                   /db_xref="InterPro:IPR018130"
FT                   /db_xref="InterPro:IPR023591"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4UMB8"
FT                   /protein_id="ACG71526.1"
FT                   /translation="MAAALSQGGTAITMKALLEAGVHFGHQTKRWNPKMKPFIFGARNG
FT                   IYIIDLQKTVGLARNALRFVSDSVAKGGSVLFVGTKKQAQDAIREEASRSGQFFVTNRW
FT                   LGGTLTNFKTVKQGIDRLKTIEKMAADGTYERLPKKEVAQLEREREKLEKNLGGIKELS
FT                   RLPSALFVIDTKKEHIAVHEANRLGIPVVAVVDTNCDPEGIDYVIPGNDDAIRSIRLFT
FT                   GKVAEACIEGKGRYSAWVAEHGGHDERREQEDRDAASERGHKDRRDRRDRRGGPRERRE
FT                   PREDRAAASANVEVVRKGEVAPAAAPEAAPAKE"
FT   gene            complement(322957..324018)
FT                   /locus_tag="AnaeK_0285"
FT   CDS_pept        complement(322957..324018)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0285"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ade:Adeh_0274 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71527"
FT                   /db_xref="InterPro:IPR010330"
FT                   /db_xref="UniProtKB/TrEMBL:B4UMB9"
FT                   /protein_id="ACG71527.1"
FT                   /translation="MPRRRPASPRPRPGHPAAAGKVRAPVRAGARGDVLLAWALDRDGR
FT                   KVNAGRLDPADRRRLAPFTCLGCGEPLVPHLGRVRARHFAHAPGSACPLTAPETALHLD
FT                   AKERLLALCADAFGRRRTVTVLARCPSCRRLAPRGLAAEGDAAAAEGAVGPLRADVLVL
FT                   RAGRPALALEVLVTHAVDVEKEAALAAAGVPAVEIDARDEWERAEPDGAVAIVPVRSLG
FT                   FPACPACAAGARADADRALGGEAAEIAELEAYRARGLLGPAPSAPVPAGEPGDEPGAAG
FT                   GPDAPFTGAERADLAARFTCPDCGGAAIAFGARIARHPCPGRPSRPIAWRGYDGARIEL
FT                   TWWKRPAGPPPRR"
FT   gene            324144..324599
FT                   /locus_tag="AnaeK_0286"
FT   CDS_pept        324144..324599
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /transl_except=(pos:324276..324278,aa:Sec)
FT                   /locus_tag="AnaeK_0286"
FT                   /product="alkyl hydroperoxide reductase/ Thiol specific
FT                   antioxidant/ Mal allergen"
FT                   /note="PFAM: alkyl hydroperoxide reductase/ Thiol specific
FT                   antioxidant/ Mal allergen; Redoxin domain protein; KEGG:
FT                   sus:Acid_7719 redoxin domain protein; Contains
FT                   selenocysteine"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71528"
FT                   /db_xref="GOA:B4UMC0"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR024706"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B4UMC0"
FT                   /protein_id="ACG71528.1"
FT                   /translation="MALEVGKKAPDFALPDEDGNVVKLSSFKGKRVVVFFYPKANTSGU
FT                   TQEASDFRDEVDAFTKQKVAVVGISKDAPAAQKKWKEKLGLPFPLLSDADTAVQQAWGV
FT                   WKEKNMYGKKVMGTERTTVVIGPDGKVEKVFPKVKVDGHVASVLESL"
FT   gene            324662..325972
FT                   /locus_tag="AnaeK_0287"
FT   CDS_pept        324662..325972
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0287"
FT                   /product="Fmu (Sun) domain protein"
FT                   /note="PFAM: Fmu (Sun) domain protein; KEGG: ade:Adeh_0276
FT                   methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71529"
FT                   /db_xref="GOA:B4UMC1"
FT                   /db_xref="InterPro:IPR001678"
FT                   /db_xref="InterPro:IPR023267"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B4UMC1"
FT                   /protein_id="ACG71529.1"
FT                   /translation="MTRKPHPQRPPRNDLVDALVLEVHGLVHDQGWLADRALERVLRRE
FT                   RALWANERRAVAEAVYGILRAQGQLDFLLGGSPPLATRYAAWLVRSAGVAPAQAAARLG
FT                   AAPRALAGLAEADARIAAIPDPLDRFAVEASLPRWIAERLVSELGEAEARALAAVLNRR
FT                   APLTVRANALAGDREALRAALAAEGVPAEPTHFSPWGLTLDGHQNAFALEAFRTGGFEI
FT                   QDEGSQLIALACGARPGQVVVDACAGAGGKSLALAAEMHNKGSLHALDSDAGRLEDARR
FT                   RARRAHVHNLRTRVVPAGPEAEAAVADLAGKADVVLVDAPCSGLGTLRRKPDARWRLQP
FT                   GDPERFAAIQRELLGRFARLARPGGRVVYATCAMGRTENDEVADFAERELGLAPAPLAP
FT                   FLGAERARALGAGESRCALYPHRHGTDGFFFAAFRKV"
FT   gene            326034..326876
FT                   /locus_tag="AnaeK_0288"
FT   CDS_pept        326034..326876
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0288"
FT                   /product="DNA-(apurinic or apyrimidinic site) lyase"
FT                   /EC_number="4.2.99.18"
FT                   /note="PFAM: zinc finger Fpg domain protein;
FT                   Formamidopyrimidine-DNA glycosylase catalytic domain
FT                   protein; DNA glycosylase/AP lyase, H2TH DNA-binding; KEGG:
FT                   ade:Adeh_0277 DNA-(apurinic or apyrimidinic site) lyase /
FT                   formamidopyrimidine-DNA glycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71530"
FT                   /db_xref="GOA:B4UMC2"
FT                   /db_xref="InterPro:IPR000214"
FT                   /db_xref="InterPro:IPR010663"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR012319"
FT                   /db_xref="InterPro:IPR015886"
FT                   /db_xref="InterPro:IPR035937"
FT                   /db_xref="UniProtKB/TrEMBL:B4UMC2"
FT                   /protein_id="ACG71530.1"
FT                   /translation="MPELPEVEIAARNLRRWAEGRRVEEVGWDPRARRIFRPATPAAFA
FT                   RALEGARFAGIRRIGKHLLVSLERGGAPVGLLAHLGMTGKWVLRGAEEPAPRHARAWLR
FT                   LEGGGVLHFQDSRLFGRLRTVPGARFEDVPEVAALGPDPLEHGIQPAALAGALAKSRLP
FT                   VKVKLLDQRLLPGVGNIHASEACFRARVDPRRPSRALSRAGAKALAAGILASFRMTLDA
FT                   EDGPEITYVEEPGAENPFLVYAREGEPCPRCRRAGRTSPILRVVQAQRSTFFCPRCQR"
FT   gene            326887..327738
FT                   /locus_tag="AnaeK_0289"
FT   CDS_pept        326887..327738
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0289"
FT                   /product="Ribonuclease H"
FT                   /EC_number="3.1.26.4"
FT                   /note="PFAM: ribonuclease HII/HIII; KEGG: ade:Adeh_0278
FT                   ribonuclease H"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71531"
FT                   /db_xref="GOA:B4UMC3"
FT                   /db_xref="InterPro:IPR001352"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR022898"
FT                   /db_xref="InterPro:IPR024567"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:B4UMC3"
FT                   /protein_id="ACG71531.1"
FT                   /translation="MRPEDLPRLSVADLRARLLDRGEALGDACEAALEADPRAGAREVL
FT                   RLVRKRRRENRAEGQRLRHLLRYEAELWERGLVHVAGVDEAGMAPLAGPVVAGACVLPL
FT                   DYRPRGIDDSKQLDRAERERLAEDIKRNAVCWAVARAEVEEIDRLNVYWAGMLALRRAV
FT                   DGLSARPEHLLVDARKLPDLPFPQTPIVHGDALSLTIAAASILAKTARDALMAELDLVH
FT                   PGYGFARHKGYPTAEHFEALGRLGACPIHRRSFTPVRVALGLEPAQGDLFALADAAVAD
FT                   DE"
FT   gene            327876..329546
FT                   /locus_tag="AnaeK_0290"
FT   CDS_pept        327876..329546
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0290"
FT                   /product="poly(A) polymerase"
FT                   /EC_number="2.7.7.19"
FT                   /note="TIGRFAM: poly(A) polymerase; PFAM: Polynucleotide
FT                   adenylyltransferase region; KEGG: ade:Adeh_0279
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71532"
FT                   /db_xref="GOA:B4UMC4"
FT                   /db_xref="InterPro:IPR002646"
FT                   /db_xref="InterPro:IPR010206"
FT                   /db_xref="InterPro:IPR025866"
FT                   /db_xref="InterPro:IPR032828"
FT                   /db_xref="UniProtKB/TrEMBL:B4UMC4"
FT                   /protein_id="ACG71532.1"
FT                   /translation="MHEPSTKNDLSRPAYPAEDLEENRDRRPPPGLALDPPEAPPPEHP
FT                   PEIPVDRLDGDALKVIARLRHMHHQAYLVGGCVRDLLLGATPKDFDVATDAHPGEVRAI
FT                   FRNCRLIGRRFRLAHVYFRAGKVIEVATFRKNPTDVAEDVGEGEGDLLITRDNVFGTAE
FT                   EDSVRRDFTVNGLFYDVATGEVIDYVGGRADLEAHRISTIGDPEIRMREDPVRALRAVR
FT                   FAARLGFTIAPDTFEAMRRTSGELARCAPARVLEETFKLLRCGGSARAFELLRACGALP
FT                   VILPALGAALETWDDGRRRAFFAHLAALDRLVRSGAEVSEAVLLGALLMHLGADAPRAG
FT                   RGDAARADEDAGAPRWDEADAFLASLVQTARLPRKVAERIRLALHAQRQLEEPGKRRRR
FT                   RGRGPAGQTYFQDALQLLEIRVRATGRGAEVLERWSAEAPQPHAPSERPGRAGPRDDRH
FT                   ERRDRREGSAPHRAERDEGAVREVVIPTEAAEAADEADPEVREVDSSAAGEAGEGEASQ
FT                   GGRRRRRRRGGKRRRRRGTGASGPDGGAQVPPAEAGGQG"
FT   gene            329618..330373
FT                   /locus_tag="AnaeK_0291"
FT   CDS_pept        329618..330373
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0291"
FT                   /product="uridylate kinase"
FT                   /note="TIGRFAM: uridylate kinase; PFAM:
FT                   aspartate/glutamate/uridylate kinase; KEGG: ade:Adeh_0280
FT                   uridylate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71533"
FT                   /db_xref="GOA:B4UMC5"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR011817"
FT                   /db_xref="InterPro:IPR015963"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="UniProtKB/TrEMBL:B4UMC5"
FT                   /protein_id="ACG71533.1"
FT                   /translation="MASEKASNAKARYQRILLKLSGEALMGDGKYGISPKTLTSIAHDV
FT                   KDVVDLGVEVALTIGGGNIFRGVSGATEGMDRSSADYMGMLATVINSMALQDALEKIGV
FT                   PTRVQSAIEMHQVAEPYIRRRAIRHLEKGRVVIFAAGTGNPYFTTDTAASLRAMEIHAD
FT                   VLLKATKVDGVYTDDPKKNPAATKFKQLSYIDVLKKNLKVMDSTAISLCMDNDLPIVVF
FT                   DLTQRGNVRKVVLGEEIGTTVGRPSARNA"
FT   gene            330393..330959
FT                   /locus_tag="AnaeK_0292"
FT   CDS_pept        330393..330959
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0292"
FT                   /product="ribosome recycling factor"
FT                   /note="PFAM: ribosome recycling factor; KEGG: ade:Adeh_0281
FT                   ribosome recycling factor"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71534"
FT                   /db_xref="GOA:B4UMC6"
FT                   /db_xref="InterPro:IPR002661"
FT                   /db_xref="InterPro:IPR023584"
FT                   /db_xref="InterPro:IPR036191"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4UMC6"
FT                   /protein_id="ACG71534.1"
FT                   /translation="MGTIADDILDDLHGRILKTLDQLRTELAAVRTGRASLHLLDNVRV
FT                   DYYGTPTPLNQVATLSVPEARLIVVKPWEKSMIPPIEKAIRDGNLGLNPMSDKDLVRVP
FT                   IPALTEERRKEIVKQVKHKGEEHKIAVRNVRREAKELIEVAEKDGDISGDDAEKALEKM
FT                   QKETDEGVKKIDEIVAAKEKDVLQV"
FT   gene            330959..331174
FT                   /locus_tag="AnaeK_0293"
FT   CDS_pept        330959..331174
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0293"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ade:Adeh_0282 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71535"
FT                   /db_xref="GOA:B4UMC7"
FT                   /db_xref="UniProtKB/TrEMBL:B4UMC7"
FT                   /protein_id="ACG71535.1"
FT                   /translation="MGGPVARSPAALLLLLGPLLALGFAAGAVRALAARPDLPARRRRA
FT                   LSAAWVLLLLAGTPLWLIAAALLGFW"
FT   sig_peptide     330959..331060
FT                   /locus_tag="AnaeK_0293"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.857 at
FT                   residue 34"
FT   gene            complement(331194..331622)
FT                   /locus_tag="AnaeK_0294"
FT   CDS_pept        complement(331194..331622)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0294"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ade:Adeh_0283 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71536"
FT                   /db_xref="GOA:B4UMC8"
FT                   /db_xref="UniProtKB/TrEMBL:B4UMC8"
FT                   /protein_id="ACG71536.1"
FT                   /translation="MRELLVFLHILSAATWIGAALWVPGDVKRTVALGRPFVEQLAARA
FT                   RPALKLDLYAGIAVLVTGVLLIGVDGGHPRTGILVGFAATLARLLVVGFASMPAWRRVE
FT                   AAVASGELAAATAPARRLAMFGGIGHALWAIALAGMIF"
FT   gene            complement(331796..332299)
FT                   /locus_tag="AnaeK_0295"
FT   CDS_pept        complement(331796..332299)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0295"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ade:Adeh_0284 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71537"
FT                   /db_xref="UniProtKB/TrEMBL:B4UMC9"
FT                   /protein_id="ACG71537.1"
FT                   /translation="MTKFAWSVLALALLGAPAAARAGGLLELSVGSGARIDPSPTERIP
FT                   TNVMLTAGYGFADMLKLELGAVANLGDVEDSKFDIDLRPMLVVSPPLFPVYLRGIMTVN
FT                   SLVEEPVKIGYGGALGVRLGVLGLGAFVEAGVLARIVEVPDAAGVTHDKTFTIVEGRVG
FT                   GYWD"
FT   sig_peptide     complement(332231..332299)
FT                   /locus_tag="AnaeK_0295"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.947 at
FT                   residue 23"
FT   gene            complement(332434..334143)
FT                   /locus_tag="AnaeK_0296"
FT   CDS_pept        complement(332434..334143)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0296"
FT                   /product="NAD+ synthetase"
FT                   /EC_number="6.3.5.1"
FT                   /note="TIGRFAM: NAD+ synthetase; PFAM: Nitrilase/cyanide
FT                   hydratase and apolipoprotein N-acyltransferase; NAD
FT                   synthase; KEGG: ade:Adeh_0285 NH(3)-dependent NAD(+)
FT                   synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71538"
FT                   /db_xref="GOA:B4UMD0"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR003694"
FT                   /db_xref="InterPro:IPR014445"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR022310"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/TrEMBL:B4UMD0"
FT                   /protein_id="ACG71538.1"
FT                   /translation="MARSGRIALAQVNTTVGDFAGNAARVRAAAEVAREAGAALAVFPE
FT                   LTVCGYPPRDLLDLPDFLERARQALEELARPAAWSKGIALVVGFPEAPAGAPPPGVYNA
FT                   AALISDGRVVAVGRKSLLPTYDVFDETRYFLPAGASTTAAAPEGLGVPLGLSVCEDIWN
FT                   DQRFWERPRYARDPIADLVRAGAGLVVNVSASPYAMGKAPLRERMLSASARDHGAPIAY
FT                   VNQVGGNDALLFDGGSMLLARDGAVLARAPLFQEAVLVCDLEGGAPLALGLDGRPLPPP
FT                   APPPADPQADEVLRALVMGVRDYVRKCGFRQAVVGLSGGIDSALTACIAAEALGAENVL
FT                   GVAMPSRYSSGHSREDAAELARNLGVRFREIGIEPMHAAFLAALAADGAPPLCDLADQN
FT                   VQARVRGQILMAISNDTGALVLTTGNKSEIAVGYCTLYGDMAGGLAAIGDVPKTLVYRV
FT                   ARAANARAGRTLVPERTFTKPPSAELKPGQLDQDSLPPYDVLDDILQAYVEERRPLEAI
FT                   VARGHDEATVRRVLRMVVQSEYKRRQAAPVLKVSEKAFGEGRRFPIAQGYRY"
FT   gene            334172..335077
FT                   /locus_tag="AnaeK_0297"
FT   CDS_pept        334172..335077
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0297"
FT                   /product="diguanylate cyclase"
FT                   /note="TIGRFAM: diguanylate cyclase; PFAM: GGDEF domain
FT                   containing protein; KEGG: ade:Adeh_0286 response regulator
FT                   receiver modulated diguanylate cyclase"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71539"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:B4UMD1"
FT                   /protein_id="ACG71539.1"
FT                   /translation="MPRRILVAEASAPLLAPLRRPLRAAGVELDAISPAAASGRLGPAS
FT                   HVAAIVPGGAGGAEAVRAVRAADPLLPVIALFADEAEAAAAAQGEALGADGALVAPVGP
FT                   AAVVGACRLAERLRAATARAVEADARRLAAEAPRHAADLEFLKRLLPLEVKRSRRYGYP
FT                   VSVALVAVDRFAEVAGRLGPHGRAALMAEVLGLLAASVRDIDLAAPFTGERFVVLMPHT
FT                   RAEGALQVARRLCARIRERGAGEGITVSAGVAGHDGGGTVSFGGLVKRAAEALTRARAA
FT                   GGDRAEPAEPPRRRDRIVMG"
FT   gene            335082..336146
FT                   /locus_tag="AnaeK_0298"
FT   CDS_pept        335082..336146
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0298"
FT                   /product="ABC-type Fe3+ transporter, periplasmic ligand
FT                   binding protein"
FT                   /note="KEGG: ade:Adeh_0287 ABC-type Fe3+ transporter,
FT                   periplasmic ligand binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71540"
FT                   /db_xref="UniProtKB/TrEMBL:B4UMD2"
FT                   /protein_id="ACG71540.1"
FT                   /translation="MRRSLAAAAPALVVATALVAAGGLAACRRAAPALPEVRLHASPDL
FT                   PAEVVRDLAARFAVARVVLVPRAEEAEVAWASDPAALLALAPRLVPGSAAPEPATVQFA
FT                   DPQGRFAPVAARARVLLVARDARLPVDPTNLRDLADPRLRGRVALAHPARGAGPAACAA
FT                   LSLVYGEASLGRFLRLVAANAPVVVGSDAEVRAAVAAGRAAVGLAGSVDGAAGAASAAA
FT                   LRVVYPDQAGRGAVVLPTAAAALAPAAGGAPSPAAVRLVAWLAGADAERILVARAPGLL
FT                   PLRPEVPVPVGVEPAGNLRALPLDWDGLAAEAARLAPLLERWPDAFAAAGPGRGAAREA
FT                   AAPEGRPGRLEHAP"
FT   sig_peptide     335082..335144
FT                   /locus_tag="AnaeK_0298"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.582 at
FT                   residue 21"
FT   gene            336501..336845
FT                   /locus_tag="AnaeK_0299"
FT   CDS_pept        336501..336845
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0299"
FT                   /product="transcriptional regulator, LuxR family"
FT                   /note="PFAM: regulatory protein LuxR; KEGG: ade:Adeh_0288
FT                   transcriptional regulator, LuxR family"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71541"
FT                   /db_xref="GOA:B4UMD3"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:B4UMD3"
FT                   /protein_id="ACG71541.1"
FT                   /translation="MAQIDIEILTPFAAKFMEGTSLTPAERAEVLRIAQGFACKDSAAA
FT                   AGVSPETIRARRKRIYRKLDVPGSGELLASLLSLSLKMLAKGERIEPRPVAPAQPQQAA
FT                   ATTSGAVMAR"
FT   gene            complement(336978..338975)
FT                   /locus_tag="AnaeK_0300"
FT   CDS_pept        complement(336978..338975)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0300"
FT                   /product="transketolase"
FT                   /note="TIGRFAM: transketolase; PFAM: Transketolase domain
FT                   protein; Transketolase central region; KEGG: ade:Adeh_0289
FT                   transketolase"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71542"
FT                   /db_xref="GOA:B4UA62"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR005478"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR020826"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033247"
FT                   /db_xref="UniProtKB/TrEMBL:B4UA62"
FT                   /protein_id="ACG71542.1"
FT                   /translation="MPNARPELVEKAVNTIRMLAADGVQQANSGHPGMPMGAADMAFVL
FT                   WTRHLRFDPAEPRWLGRDRFLLSAGHGSMLLYSLLNLAGFDCTLEDLKHFRQLHSRTPG
FT                   HPEYGFLPGVEITSGPLGQGFANGVGFALGHAMLAAKLGPGNPVSDAYVYAIVSDGDLM
FT                   EGVSAEAASFAGHHKLGRLVYLYDDNGITIDGKTSITFSGEDVTRRFEAYGWHVQSVDG
FT                   RDHDGIDRAIQAAKAELGRPSLIRVHTTIGFGSPAKAGKSSVHGAPLGEAELEATKKAL
FT                   GWPLEPRFLVPDDVRAYWAEVRAEKAAQKRAWRAAEQAWRAANPEQAALLDAHVERWVP
FT                   ERILDRARAELPAPDATRKVSQAILQKIAPLVPCLVGGSADLAESNLTEIKGAGSVAPG
FT                   SFAGRNLHFGIREHAMGAIANGLAYDGLFVPFVGTFLQFADYMRPPVRLAALSKLQAIY
FT                   VWTHDSIFLGEDGPTHQPIEHLTALRAIPNLHVCRPADPEETAAAWAHALQRRDGPTAL
FT                   VLTRQKLAPVKRSVPLDPEAILRGGYLVDAPAGATFTLVATGSEVPLAQAALEALAKQG
FT                   VVGRLASIPCLECFLAQPKAWRDEVVPPGQRVAVVEAARGTEWWQLAGRDGLVLGIERF
FT                   GSSAPEKALAEEYGFTPAQVAARVTRWLAG"
FT   gene            complement(339046..339645)
FT                   /locus_tag="AnaeK_0301"
FT   CDS_pept        complement(339046..339645)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0301"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ade:Adeh_0290 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71543"
FT                   /db_xref="UniProtKB/TrEMBL:B4UA63"
FT                   /protein_id="ACG71543.1"
FT                   /translation="MASRLRRFLHLERPRDGAPAPDPAAPGTADRAARFGAVQRPGLAP
FT                   AETPATGARLERFGAEPEPALQLLDRGDRLPFTRCLRCGMDGHALAVECAGCGAALDTP
FT                   EQRAADERLRVERARQAEVEAREAAARREALAREEAGEAGSRRALAEALAREVGERERR
FT                   RLEAEGLGGGPGPLELGARVLRALGARWGRGGGGRG"
FT   gene            complement(339661..341199)
FT                   /locus_tag="AnaeK_0302"
FT   CDS_pept        complement(339661..341199)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0302"
FT                   /product="AAA ATPase central domain protein"
FT                   /note="PFAM: AAA ATPase central domain protein; SMART: AAA
FT                   ATPase; KEGG: ade:Adeh_0291 AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71544"
FT                   /db_xref="GOA:B4UA64"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B4UA64"
FT                   /protein_id="ACG71544.1"
FT                   /translation="MSAPGAAPRPQPAFVQELDTLVRARYPLVYLVTSEEQRLEAILDG
FT                   LADRHGKALLGWSIARGFRRLGGTRGPAPEGAKDPLEALAAIERLAEPALVVLKDFHPF
FT                   LADPAVVRGLRELGHALKSTYTTVLLLSPTLAIPPEIEKEISVLDVPLPGYRDLLDLLK
FT                   EIVGVVRQNGRAQVELNQDDADQLIQAALGLTLSEAESAFAKAIATDGRLSRDDVPLVL
FT                   EEKRQVIRKSGLLEYFATDARLAGVGGMASLKAWLGRRGAAFSEAARRFGLPEPKGLLL
FT                   LGVQGCGKSLTAKAIAAQWRLPLLRLDMGRIFSGLVGSSEENLRRAIRVAESVAPVVLW
FT                   VDEIEKGLSGTQSSGVSDGGVTARVFGALLTWLQEKTAPVFVVATANRIEQLPPELLRK
FT                   GRFDEIFFIDLPLAPERREIFQIHLARRRRDPARFDLDALAAASEGFSGAEIEQAVVSG
FT                   LYDAFAEGVDLAQGHVERAVRESLPLSTTMREDIARLREWARARTRPASAPAAG"
FT   gene            complement(341239..341679)
FT                   /locus_tag="AnaeK_0303"
FT   CDS_pept        complement(341239..341679)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0303"
FT                   /product="putative phosphohistidine phosphatase, SixA"
FT                   /note="PFAM: Phosphoglycerate mutase; KEGG: ade:Adeh_0292
FT                   putative phosphohistidine phosphatase, SixA"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71545"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:B4UA65"
FT                   /protein_id="ACG71545.1"
FT                   /translation="MPPIRVYLVRHAKAEARAGDDADRRLTPDGRDGFAALVARLRGRL
FT                   AIRGVIASPYARARETAELLAAATGAPLEVDPRLAAGTCGGAELLALARAAGDGAALVG
FT                   HNPEVAEAVALAAGRGLEVRPGTVAAVDLGAGSAGLAWLDAP"
FT   gene            complement(341694..344717)
FT                   /locus_tag="AnaeK_0304"
FT   CDS_pept        complement(341694..344717)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0304"
FT                   /product="malto-oligosyltrehalose synthase"
FT                   /note="TIGRFAM: malto-oligosyltrehalose synthase; PFAM:
FT                   alpha amylase catalytic region; SMART: alpha amylase
FT                   catalytic sub domain; KEGG: ade:Adeh_0293
FT                   malto-oligosyltrehalose synthase"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71546"
FT                   /db_xref="GOA:B4UA66"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR012767"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:B4UA66"
FT                   /protein_id="ACG71546.1"
FT                   /translation="MGAAENGANAAKVEELLGALAEALARGEGVTPRPASTYRLQLHPG
FT                   FGFDAAAALVPYLDALGVSDLYLSPVLASAPGSTHGYDVVDHARLDPELGGEEGYARLA
FT                   AACRARGMGILLDYVPNHMGIGPWNAWWMDLLENGPSSVHAPAFDVDWTPLKSELANKV
FT                   LVPVLGDQFGRVLERGELRLAREGGALAIRYFDHAFPVAPRSVPLVLRHGIERLREALG
FT                   PEDPSLQELESICTSLDKLAPRSETRPEAVAERAREKEVAKRRLAALCDASPAVRAFVD
FT                   ENVAAFNGTPGDPRSFDLLQRLLDAQAYRLAFWRVAGEEINYRRFFDVNALAALRMEEP
FT                   RVFAEAHRRVLALLRDGAATGLRIDHPDGLYAPAAYFRRLQACYLAERARVLAQARGTA
FT                   LENGAEALLLERLFAELEAGRLPARPLYVVAEKVLAAGERLPEGWDVDGTTGYELLAAV
FT                   NGLFVDPAAERALDALYARVAGGRQDYRRTVEEKKRQVMSSSMASEINMLAHRLSRISE
FT                   TDRRTRDFTLNELTRALVEYVALFPVYRTYVTRRGEVDARDRAYVEATIARARRRSPLV
FT                   DPSIYDFLRDVLLQRYPDGLPEAARGAWLELALKLQQVTGPVTAKAVEDTAFYCYVRLV
FT                   SLNEVGSDPGRFGTSAEALHALLAERRARFPGSLSASSTHDTKRSEDVRARISALSELP
FT                   GELRAAVSRWGRVNRAHVRRLEGRTAPDRRDEYLLYQTLLGTFPDGGLTPGTPAHAEYV
FT                   ERIQRYLEKALREAKIHTSWTHPDEDYEGGVRAFVAGALASRTFLRDLGALAERAARAG
FT                   RISSLAQVALKLAAPGIPDVYQGTELWDLSLVDPDNRRPVDWAHRARALEAIQAELARG
FT                   PEARRALARRLSAPDALAGGEAKLLLLAEGLRLRRRERALLLEGDHRPLAAEGPLAGHV
FT                   VAFARTLAGRAVACAVPRLVVRLQDQGGGAPRWEGRLPLGGLAARWVDVVTGTVHRGEA
FT                   PALAELFADFPVALLASE"
FT   gene            complement(344756..346315)
FT                   /locus_tag="AnaeK_0305"
FT   CDS_pept        complement(344756..346315)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0305"
FT                   /product="4-alpha-glucanotransferase"
FT                   /EC_number="2.4.1.25"
FT                   /note="TIGRFAM: 4-alpha-glucanotransferase; PFAM: glycoside
FT                   hydrolase family 77; KEGG: ade:Adeh_0294
FT                   4-alpha-glucanotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71547"
FT                   /db_xref="GOA:B4UA67"
FT                   /db_xref="InterPro:IPR003385"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:B4UA67"
FT                   /protein_id="ACG71547.1"
FT                   /translation="MARQAGVLLPLFSLRSQADWGVGEIPDLVPFARWCADAGFSLALL
FT                   LPVNEASRGQNSPYGAISAFALDPVYLAPSALPDFQAAGGLDALSPDERARLAAVRAAP
FT                   AVRWDEVRRLKRRALEIAFARFEREEWNRRTERARALEAFARQEAGWLDDYALFVALHD
FT                   EAGGRAWTDWPAPLRDRDPAALATARARHAREILFHAWVQWQAEEQWRRARAAANGAGV
FT                   ELGGDLPFMVAPDSADVWARRGDFRLDARVGVPPDAFSATGQDWGLPVYRWDVMDREGY
FT                   PWLTARARRMADLFDLYRVDHVVGLYRTYYFPNDGAPPAFVPSEEGAQIANGERVLGIF
FT                   SEGARVVAEDLGVVPDFVRASLERLRIPGYRVQRWEKNWEAGGNAFRDPARWPPVSVAT
FT                   TGTHDSESVADWYEGLAKEERAQLLALPALEPLRARAPERWDDGVRDALLALVYGAASD
FT                   LALLPFQDALGMRDRVNVPGTVTGENWTFRIPMDLGALAADAATRTRLRELAVRAGRAP
FT                   PG"
FT   sig_peptide     complement(346259..346315)
FT                   /locus_tag="AnaeK_0305"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.961) with cleavage site probability 0.960 at
FT                   residue 19"
FT   gene            346427..347398
FT                   /locus_tag="AnaeK_0306"
FT   CDS_pept        346427..347398
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0306"
FT                   /product="Glutamate--tRNA ligase"
FT                   /EC_number="6.1.1.17"
FT                   /note="PFAM: glutamyl-tRNA synthetase class Ic; KEGG:
FT                   ade:Adeh_0295 glutamate--tRNA ligase"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71548"
FT                   /db_xref="GOA:B4UA68"
FT                   /db_xref="InterPro:IPR000924"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020058"
FT                   /db_xref="InterPro:IPR022380"
FT                   /db_xref="UniProtKB/TrEMBL:B4UA68"
FT                   /protein_id="ACG71548.1"
FT                   /translation="MSSRGRFAPSPTGPLHLGNARTALLSWLAARTAGAAYVMRVEDLD
FT                   GPRVRPGLEAQILEELRWLGLDWDEGPDVGGPLGPYRQSERLPRYGAALDRLRAAGLAY
FT                   PCFCSRAEIAAASQAPHGASDEGPRYPGTCRTLSPAEVARRSATRRPAWRLRVAAGPVG
FT                   FEDGVHGPVAHDVAAEVGDFVIARADGVPAYQLAVVVDDAAMQVGEVVRGDDLLPSTAR
FT                   QLLLYRALGVVPPRFAHVPLVVGPDGARLAKRHGALSLGELRARGADPRAVVALLAGLS
FT                   GLAAADPHAACTPRELVGRFSMARLPRGPAVLSPERIAALLP"
FT   gene            347395..347988
FT                   /locus_tag="AnaeK_0307"
FT   CDS_pept        347395..347988
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0307"
FT                   /product="tRNA-hydroxylase"
FT                   /note="PFAM: tRNA-hydroxylase; KEGG: ade:Adeh_0296
FT                   tRNA-(MS(2)IO(6)A)-hydroxylase-like"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71549"
FT                   /db_xref="GOA:B4UA69"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR010386"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="UniProtKB/TrEMBL:B4UA69"
FT                   /protein_id="ACG71549.1"
FT                   /translation="MIAYTARVRLLRSPTDPRWIDVALAELDRTLQDHAHCEKKAAASA
FT                   LKLVADHPERAAMVRALAKLAQEELQHFLGVLAELGRRGTALPPDDGDPYAQTLLRHVR
FT                   GGPRPEDRLVDRLLVAALIEARSCERLWLLAGALPDARLRELYARLAQSEAGHERLFVD
FT                   LAREVDAAADARLEVLAEEEARVVAALPLLPRIH"
FT   gene            347988..350111
FT                   /locus_tag="AnaeK_0308"
FT   CDS_pept        347988..350111
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0308"
FT                   /product="histidine kinase"
FT                   /note="PFAM: response regulator receiver; ATP-binding
FT                   region ATPase domain protein; histidine kinase A domain
FT                   protein; CHASE domain protein; KEGG: ade:Adeh_0297
FT                   periplasmic sensor hybrid histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71550"
FT                   /db_xref="GOA:B4UA70"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR006189"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B4UA70"
FT                   /protein_id="ACG71550.1"
FT                   /translation="MAPEASAPPAAPGPGDAPRPGRRAPWGGVAAAAAVLVLGGAVLQQ
FT                   HEVAEGRGRRRAVLERADLAARAIEDDLSRSLAAAHALAALVRHADVDRFEQIADELLS
FT                   HYGGISSLQLAPGGVLTRIHPLAGNEAALGLDLLADPEHRDSAERTLESRQLTAEGPFE
FT                   LRQGGQGVVGRIAVFRAAPGGGEAFWGFVAVAVRLQDVVSRTRVAALSAGGLDWALRRD
FT                   GAARPFASSGGALPRDAVAVKVRLPGEAWELDVAPREGWVRWGGLVMPAALLLLVAAAS
FT                   GLLAHRLLRLPEELRRAVDERTAALALANRRLAAELVERQRAEEARQAAEAQARHGQKM
FT                   EAVGLLAGGIAHDFNNLLTGILGYAELLGEAGTAADEAAAGIRQAARRGAALTRQLLGF
FT                   ARRGKYQQVPVNVHALVREVSALLERTLDKRIAIRHRLAAGSAVVRGDPDQLQQVVLNL
FT                   AVNARDAMPSGGTLTFEVAEVELDAEGTRARPGLAPGPHVAVMVADTGVGIPAVVRDRV
FT                   FDPFFTTKPAGQGTGMGLAMVYGIVQNHGGWVGFESEEGKGARFTVLLPEAPAPERDEA
FT                   VPAGAPEHGAGRVLVADDERGVRETTARLLRRLGYDALPAASMEEALEVQGRGALDLAL
FT                   VDLAMPAGDGPETLRALRRAQPELPAVLMTGYGLDARVREALEGGFRGILHKPFSLEEL
FT                   AAEVARAVRRRGA"
FT   gene            complement(350295..353000)
FT                   /locus_tag="AnaeK_0309"
FT   CDS_pept        complement(350295..353000)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0309"
FT                   /product="peptidase M16 domain protein"
FT                   /note="PFAM: peptidase M16 domain protein; KEGG:
FT                   ade:Adeh_0298 peptidase M16-like"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71551"
FT                   /db_xref="GOA:B4UA71"
FT                   /db_xref="InterPro:IPR007863"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="InterPro:IPR011765"
FT                   /db_xref="UniProtKB/TrEMBL:B4UA71"
FT                   /protein_id="ACG71551.1"
FT                   /translation="MLAPLVPLAALALAAGPAAPPLELTTFSLPNGLTVVLAPDHRLPQ
FT                   VAVDTWFQVGSKDEAPGRTGFAHLFEHLMFMGTNRVPGNRFDVIMESGGGSNNASTSSD
FT                   RTNYYSVGPSQLLPTLLWLDADRLQALADAMTREKLDLQRGVVRNERRQSYENTPYGAA
FT                   ELVVPEVMYPEGHPYHHPVIGSHADLEAATLEDVKGFFRTWYVPANATLVVAGDFRPDE
FT                   VRPLVEKLFGAVPLRAPPAPARAAPVRLEREVRRILSDRVELPKLILAWHAPAAYAEGS
FT                   AELELLADVLAEGPSSRLDRRLVQELRLAESVTAYLDPGRLGSLFRVEVTGTPGADLER
FT                   VKREALAVLAELQAKGPEARELARVRAQAERRRREEREHLVHRADKLNEYLAYYGEPDG
FT                   FARDLARVTSATAAGLREAARGLGEGRLDLRVLPARAGVAKAEIPDAPPPPLAVRPFDP
FT                   PAPEVFRLANGLEVRVAPRPGTGLFAAHLVLPGGAAAVPAEKAGLAPILAELLTSGAGG
FT                   RSAAEYADAIRALGASVEAEARPASLQVSVSGLSAHLAPALDLFADAVLRPNLARADFE
FT                   REAALALARVEARPDDPRKVAPVVAAAALFGRGDPRGRPVDGWAATVRTVTLDDVRRLA
FT                   PRLLDPRGATLVVAGDVDPAALRRLLAPRLGAWRGTGPAPAAAPAPLTAAPGGRVLLVD
FT                   RPGAPQTRILLARPVAPAAEPARALRELVNVVLGGSFTSRLNQNLREKHGYTYGARSAF
FT                   ETEGGQGLFTAGAAVQTEVTGAALVELRRELDGLAAAGVDAAETAKARETARHRTVEEI
FT                   QTTAGLADALAAAVLEGRPPDALRREAEALAAVEPARAAAEARTGPYAFGGLTVVLVGD
FT                   RKAVLPQLEKAGVPRPVVVDPDGTPVPDPE"
FT   gene            353186..354520
FT                   /locus_tag="AnaeK_0310"
FT   CDS_pept        353186..354520
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0310"
FT                   /product="oxidoreductase FAD/NAD(P)-binding domain protein"
FT                   /note="PFAM: oxidoreductase FAD/NAD(P)-binding domain
FT                   protein; Oxidoreductase FAD-binding domain protein;
FT                   FAD-binding 8 domain protein; Ferric reductase domain
FT                   protein transmembrane component domain; KEGG: ade:Adeh_0299
FT                   oxidoreductase FAD/NAD(P)-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71552"
FT                   /db_xref="GOA:B4UA72"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR013130"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:B4UA72"
FT                   /protein_id="ACG71552.1"
FT                   /translation="MRAVRLQDLTRVGLWIALYVLLALYPLLWLAAVPAPGGGGDLRQE
FT                   LAAALGFLGLSIMAMQFLLTARFQWLAPPFGTDVVYAFHRHVTAVALAFLLLHPLVLLG
FT                   PGLGGLAEWLLPWRAPGPVGAGVWSLYALLVLAVTSYGRRRLRLPYEAWRVLHGAAATA
FT                   AVLLGLWHAAAARRLLAGPVTRVMWIAWTLAWVALLLRVRVAKPLALRARPYRVSEVRP
FT                   ERGDAVTLVLDPDGHEGFRFRAGQFAWLTLGASPFAAREHPFSISGSSQRAPRVELTVK
FT                   ALGDFTQRVQATRPGARAWVDGPYGTMSVDAFPDADGYLFVAGGIGVAPCLSMLRTLAD
FT                   RGDRRPHQLVFGTGRWERTPFREALAELATRLDLTVVHVLEHPPDGWTGEVGVVGEDVL
FT                   RRHLPRGHRGCFVCGPPAMMDAVETALVRLGVPLRDIHSERFDLV"
FT   gene            complement(354597..355034)
FT                   /locus_tag="AnaeK_0311"
FT   CDS_pept        complement(354597..355034)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0311"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ade:Adeh_0300 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71553"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR028096"
FT                   /db_xref="UniProtKB/TrEMBL:B4UA73"
FT                   /protein_id="ACG71553.1"
FT                   /translation="MNLWKLAPAALLAFAAPALASEAEGGCENCPAHKAHAEHGAKAVP
FT                   AAATAASSTVKKGVRTIPVTVTSDGFTPAEVKAKAGETVKLVVTRKVQRTCATEIVMKD
FT                   FGVNEPLPLDKAVTVTVKPKAPGTYRFACGMDMIAGNLVVE"
FT   sig_peptide     complement(354972..355034)
FT                   /locus_tag="AnaeK_0311"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.990 at
FT                   residue 21"
FT   gene            355280..356752
FT                   /locus_tag="AnaeK_0312"
FT   CDS_pept        355280..356752
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0312"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase HAMP region domain protein; histidine
FT                   kinase A domain protein; KEGG: ade:Adeh_0301 periplasmic
FT                   sensor signal transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71554"
FT                   /db_xref="GOA:B4UA74"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B4UA74"
FT                   /protein_id="ACG71554.1"
FT                   /translation="MMHATGTAKRLALGLGALVLLLAIASAAAIIGSARIHRGIAETMR
FT                   REEGVRLSLELASAVRDQYAHQAHTIIIGDGSHLGFYAESRDTVLRLTRALRQAADRPE
FT                   ERSLVDRIEAESGRLDRIFRDSIVPAVLRGERQSVQEEHGRAQLVVTHIQDLTQELVSR
FT                   FEAQIAQARAGADQAERRTLAVLVAILVAAPLVATAVSLAIGRSIAVPVAQLQAGAARI
FT                   AEGDLDTRIEVRGAPELVSLARRWNEMTAAVRDHQEQLVRSEKLAGIGRLAAGVAHEIN
FT                   NPLGVILGYAKLLRKKADGALAEDLAVVEEEALRAKHIVDGLLDLSRPLPPPSEQVDLR
FT                   ALAEDVVARLREARLLEGVSAEVEGEASAPGHAEKLRQVLVNLVRNAGEASGPGGRVAV
FT                   RLRERDGVAELTVQDSGPGIPAAARGKMFEPFFTTKPGGTGLGLAVSRAIARAHGGELA
FT                   VAAAAEGGACFALTLPTAPAAARWRAAGGAKP"
FT   sig_peptide     355280..355366
FT                   /locus_tag="AnaeK_0312"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.455 at
FT                   residue 29"
FT   gene            356749..358146
FT                   /locus_tag="AnaeK_0313"
FT   CDS_pept        356749..358146
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0313"
FT                   /product="two component, sigma54 specific, transcriptional
FT                   regulator, Fis family"
FT                   /note="PFAM: response regulator receiver; sigma-54 factor
FT                   interaction domain-containing protein; helix-turn-helix
FT                   Fis-type; ATPase associated with various cellular
FT                   activities AAA_5; SMART: AAA ATPase; KEGG: ade:Adeh_0302
FT                   two component, sigma54 specific, transcriptional regulator,
FT                   fis family"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71555"
FT                   /db_xref="GOA:B4UA75"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B4UA75"
FT                   /protein_id="ACG71555.1"
FT                   /translation="MTGGPVRVLVADDKENMRKLLAKILADGYAVEEAEDGARALSLVA
FT                   TRPYDVVVTDIRMPGADGFELLGAVKARAPDTEVVMMTGYATIADAVRAMRMGAFDYLE
FT                   KPFDPDAALAVVARAAEHKRLADAARRDDASAGEPSSFHNLVGRSARMRAVYGLLDKAA
FT                   GLDITVLLLGETGTGKELAARAIHYHSARRERRFVPVNCGALPAELVESELFGHARGAF
FT                   TGAAAAKAGLFEEAQGGSLFLDEVGELPLPAQVKLNRALQEREIRRVGDTQPLKVDVRV
FT                   IAATHRDLREEVRAGRFREDLFYRLHVFPVTLPPLRERAEDVPLLAQHFLAKHARALRR
FT                   ELAGGFEPEALRRLAGYPWPGNVRELENAVERAVAVSSGDRVRVADLPAEVAGAAPVGP
FT                   EPADLAKLPYKEAVAEARDRTSREYLVALLAEFGGNVTRAAERAGMERESLHRLLRRYG
FT                   LRSDDFK"
FT   gene            358228..358707
FT                   /locus_tag="AnaeK_0314"
FT   CDS_pept        358228..358707
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0314"
FT                   /product="protein of unknown function DUF456"
FT                   /note="KEGG: ade:Adeh_0303 protein of unknown function
FT                   DUF456"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71556"
FT                   /db_xref="GOA:B4UA76"
FT                   /db_xref="InterPro:IPR007403"
FT                   /db_xref="UniProtKB/TrEMBL:B4UA76"
FT                   /protein_id="ACG71556.1"
FT                   /translation="MEILLYALGAAALVAGVAGVVLPVLPGSLLLVAGAVLVAWAGDFQ
FT                   RVGWGTVAVAAVLSVAIWAVDWLASVLGAKAFGASGWAVAGAGVGLLVGFFLGLPGIVL
FT                   GPAVGAIAFEYARNPDVKRALKAGAGAFLGFVLGSAVKVALAFAVVGAVALALIW"
FT   sig_peptide     358228..358329
FT                   /locus_tag="AnaeK_0314"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.793) with cleavage site probability 0.304 at
FT                   residue 34"
FT   gene            complement(358725..359420)
FT                   /locus_tag="AnaeK_0315"
FT   CDS_pept        complement(358725..359420)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0315"
FT                   /product="Fibronectin type III domain protein"
FT                   /note="PFAM: Fibronectin type III domain protein; KEGG:
FT                   ade:Adeh_0304 fibronectin, type III"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71557"
FT                   /db_xref="InterPro:IPR003961"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR036116"
FT                   /db_xref="UniProtKB/TrEMBL:B4UA77"
FT                   /protein_id="ACG71557.1"
FT                   /translation="MFGSRVAVLASVLAAALACERAAPRPGPSPASVAPAAAPRAPDPP
FT                   RDLDARAVTDRHVVLRWKPGAGATRAAAYEVLVGDRVLHAEAPPLDDREVGPARAYCYA
FT                   VRAVDAAGNRSPASPAACVRTPDLVAPTPPGAPGASALGTESAMVSWSPSHDDVAVAGY
FT                   EVLRDGHVVARASAAATDAVEAGLVPGREHCWSVRARDAAGNASAAAGPVCARTSDASR
FT                   AGRLGAPRP"
FT   sig_peptide     complement(359364..359420)
FT                   /locus_tag="AnaeK_0315"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.982) with cleavage site probability 0.559 at
FT                   residue 19"
FT   gene            359566..360765
FT                   /locus_tag="AnaeK_0316"
FT   CDS_pept        359566..360765
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0316"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ade:Adeh_0305 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71558"
FT                   /db_xref="UniProtKB/TrEMBL:B4UA78"
FT                   /protein_id="ACG71558.1"
FT                   /translation="MCPSDAGPGRPHRLGYHLRPMRRRPRLAGPRAVALALLAALAPGA
FT                   RAAAPAPDAPLGAWTPGPLRGLSLDMPLDDARGAASPNVDVRWLAANAWSVPTVLERGG
FT                   DRVVVRLDAQTDVLQAAVAIPWPRAWAGALRERLTTRVEARLLRTWGGWTDRPIEAWHG
FT                   AIGSWNFQREAWPRDAVDVRLGREDGRGIGVAGPRTALGDVAVRTALRIAGDGAGGPGR
FT                   LALALRLDVKLPTGAPSRLGGSGSPDAGVGLAATWAPVRWLTGHGMASLRAVGPLPRGA
FT                   RLRLRPLQAGIEASLVARLGEGVAVVVEDRLLAPAFGRHGWTLSPEVERPQASAWYALF
FT                   RAHNQVSAGLRVGELTVYASEDFTPGTQHARDARGGGQRWFYDSNAPDLALGVAWTRRL
FT                   "
FT   sig_peptide     359566..359709
FT                   /locus_tag="AnaeK_0316"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.957) with cleavage site probability 0.699 at
FT                   residue 48"
FT   gene            complement(360760..361383)
FT                   /locus_tag="AnaeK_0317"
FT   CDS_pept        complement(360760..361383)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0317"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ade:Adeh_0306 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71559"
FT                   /db_xref="InterPro:IPR025877"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:B4UA79"
FT                   /protein_id="ACG71559.1"
FT                   /translation="MTETAETLGFGGLVLAAGPSVRMGEPKQLLLWRGEPLVHRAARAA
FT                   VEAGLWPVVVVVGACAEEVRAALAGLPVATVLNRDHAAGVSGSLRRGLARLGECAPSLA
FT                   GAVILACDQPGVDAAHVAALAGALRVSGRPVAASTDGGALLVPALFSAALFPELRALDG
FT                   DEGAERLLSRDPARVAPVPLAHGGCHVDTPEDWRRARLMGGGGS"
FT   gene            361630..362613
FT                   /locus_tag="AnaeK_0318"
FT   CDS_pept        361630..362613
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0318"
FT                   /product="protein of unknown function DUF1028"
FT                   /note="PFAM: protein of unknown function DUF1028;
FT                   Tetratricopeptide TPR_2 repeat protein; KEGG: ade:Adeh_0307
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71560"
FT                   /db_xref="InterPro:IPR010430"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:B4UA80"
FT                   /protein_id="ACG71560.1"
FT                   /translation="MSHLPACRLVLALACALAAGAARGGTPREPVATFSIAARDPATGE
FT                   LGVAVASRFFAVGTVVPWARAGVGAVATQAFCNTSYGPRGLDLLAKGATPVEALEILLR
FT                   SDPERELRQVGIVSAGGASVTYTGKGTNAWAGGRSGPDYAIQGNILTGEAVVAAMERAF
FT                   VAGKGSLADRLYAALAAGDAAGGDSRGRQSAALLVVKEGAGYGGFDDREIDVRVDDHPR
FT                   PFEELKRLLDYAQMNAAWNEGWTAFRRKQFPAALAAQERAAARAPVNGEVLYDLAVIRL
FT                   AAGQRAGALEALRRALEANPKLAAQARTDADLAALRGDAGFEKLVR"
FT   sig_peptide     361630..361704
FT                   /locus_tag="AnaeK_0318"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.911 at
FT                   residue 25"
FT   gene            362613..363821
FT                   /locus_tag="AnaeK_0319"
FT   CDS_pept        362613..363821
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0319"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: protein of unknown function DUF1228; major
FT                   facilitator superfamily MFS_1; KEGG: ade:Adeh_0308
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71561"
FT                   /db_xref="GOA:B4UA81"
FT                   /db_xref="InterPro:IPR010645"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B4UA81"
FT                   /protein_id="ACG71561.1"
FT                   /translation="MSAATRRAVAGALALAAAMGIGRFAYTALLPGVQHGLGFDDAAGG
FT                   AIASANLVGYLAGVLWARRLAGSPRRGGALRLGLAATAVLTAAVTGVGSEAGWAAVRFG
FT                   SGVASGLVFVLASAAALEVPPDHLPRPLPRPLPRPLPRPGVLYGGVGVGIALAAVVAAL
FT                   APPGGGWRVPWWVLGGAAAALGAPAWGALSGPLANDSGSGGGVAVGRGRAPVGFGRLAT
FT                   AYFLEGLGYIVSGTFAVAAVRRTPGLEGLAPWTWALAGLAAAPSALLWAALGRRVGVRS
FT                   ALITAHLVQAAGMALPSLFSAAWAALAGAALFGGTFIGITTLTVAAAREIRPQALGRAV
FT                   GTLTAIYGVGQIVGPLAAGAVAQRLGDPRPAVLGASAAVAIGALVLLIPSRASLASRTE
FT                   PNA"
FT   sig_peptide     362613..362696
FT                   /locus_tag="AnaeK_0319"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.515 at
FT                   residue 28"
FT   gene            complement(363840..364733)
FT                   /locus_tag="AnaeK_0320"
FT   CDS_pept        complement(363840..364733)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0320"
FT                   /product="protein of unknown function DUF1568"
FT                   /note="KEGG: ade:Adeh_0309 protein of unknown function
FT                   DUF1568"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71562"
FT                   /db_xref="GOA:B4UA82"
FT                   /db_xref="InterPro:IPR002686"
FT                   /db_xref="InterPro:IPR036515"
FT                   /db_xref="UniProtKB/TrEMBL:B4UA82"
FT                   /protein_id="ACG71562.1"
FT                   /translation="MTAPRQILSGVTYHVTRRCAQRELLLRPSELVNETFLYVLGVALR
FT                   RYGLLLHGFCVLSNHFHLVVTDPGARLPAFEQYLDSLVARSLNAALGRWEAFWASGSYS
FT                   AVTLATPEDVIDRLAYSLANPVAAGLVPKASEWPGLWSSPERIGGERIVARRPEHFFRP
FT                   GGSMPESVELQLTLPPGFDDVQQFRERLAQALADREQLAAERMRAERRSFLGVRRVLAQ
FT                   EPTARPASVAPRRGLRPRVGARDKWKRIEALGRLRSFLNEYREALKALRAGLRDVVFPN
FT                   GTYWLRVAHGVRCAPG"
FT   gene            364871..365074
FT                   /locus_tag="AnaeK_0321"
FT   CDS_pept        364871..365074
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0321"
FT                   /product="4-oxalocrotonate tautomerase family enzyme"
FT                   /note="TIGRFAM: 4-oxalocrotonate tautomerase family enzyme;
FT                   PFAM: 4-oxalocrotonate tautomerase; KEGG: ade:Adeh_0310
FT                   4-oxalocrotonate tautomerase family enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71563"
FT                   /db_xref="GOA:B4UA83"
FT                   /db_xref="InterPro:IPR004370"
FT                   /db_xref="InterPro:IPR014347"
FT                   /db_xref="InterPro:IPR018191"
FT                   /db_xref="UniProtKB/TrEMBL:B4UA83"
FT                   /protein_id="ACG71563.1"
FT                   /translation="MPYVNIKITREGATAEQKATLIRKVTELLRDELGKNPSTTVVVID
FT                   EVDTDNWGIGGESVTVRRKRGS"
FT   gene            365121..365897
FT                   /locus_tag="AnaeK_0322"
FT   CDS_pept        365121..365897
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0322"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ade:Adeh_0311 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71564"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B4UA84"
FT                   /protein_id="ACG71564.1"
FT                   /translation="MQPWETVERARAPDGTELALARRGDEWVIRAAGHVLMSSRAHGSE
FT                   EALAALALERCARPRAVLLGGVGLGFTLRALLDRLPPDAKVVVAELVPELAAWNRGPVA
FT                   DLAARPLEDPRVRLQLGDVLARIAEARGAYDAILLDVDNGPSALAHGANHRLYGDAGVR
FT                   ACRAALRQGGVLAVWSAGPDERYLSRLERAGLDARAVTVPARGPATQGGGGGVRHVVFL
FT                   ATAPAQGGGARGPGSPPRDGGAGRRTGPHARGARGR"
FT   gene            complement(365870..366841)
FT                   /locus_tag="AnaeK_0323"
FT   CDS_pept        complement(365870..366841)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0323"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: ade:Adeh_0312 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71565"
FT                   /db_xref="GOA:B4UA85"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B4UA85"
FT                   /protein_id="ACG71565.1"
FT                   /translation="MAITRLPPHPFSLRQLQYAVAVAETLSFRRAAERCRVAQPSLSTQ
FT                   IAQLESALGLRLFERDRRRVLVTGAGRPLLEQMRRLLLQADDLLEAARRAGDPLAGALR
FT                   VGVIPTISPYLLPAIAPALRAAYPALHLTWLEDRTAELVRSLHAGTLDAALLAVEAELG
FT                   DVEVAPVARDAFVLATPPGHPLGVARGPASAAELRDASVLLLEDGHCLREQALAFCSRA
FT                   RTRELEFRATSLSTLAQMVAGGAGVTLLPELAVPTETRRADLRLRPFADPAPFRTVALV
FT                   WRRSSPIAEALRRLAGTVKAAYPAPAGRAAGSERQRPRAPRA"
FT   gene            366958..367494
FT                   /locus_tag="AnaeK_0324"
FT   CDS_pept        366958..367494
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0324"
FT                   /product="alkyl hydroperoxide reductase/ Thiol specific
FT                   antioxidant/ Mal allergen"
FT                   /note="PFAM: alkyl hydroperoxide reductase/ Thiol specific
FT                   antioxidant/ Mal allergen; Redoxin domain protein; KEGG:
FT                   ade:Adeh_0313 alkyl hydroperoxide reductase/thiol specific
FT                   antioxidant/Mal allergen"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71566"
FT                   /db_xref="GOA:B4UA86"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR024706"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B4UA86"
FT                   /protein_id="ACG71566.1"
FT                   /translation="MLTVGDRFPEFSLQAVTSLESGNEFETLTQASHPGKWKVVFLWPM
FT                   DFTFICPTEIAEFGRRNGEFQDRDTQVLGASIDTHYVHLAWRKSHPDLKNLPFPMLADT
FT                   RRELSSALGVLHRDGVALRATFIVDPEGVIRHVSVNDLSVGRNVDEVLRTLDALQTDEL
FT                   CPCNWKKGESTLQVA"
FT   gene            367498..368058
FT                   /locus_tag="AnaeK_0325"
FT   CDS_pept        367498..368058
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0325"
FT                   /product="alkylhydroperoxidase like protein, AhpD family"
FT                   /note="TIGRFAM: alkylhydroperoxidase like protein, AhpD
FT                   family; PFAM: Carboxymuconolactone decarboxylase; KEGG:
FT                   ade:Adeh_0314 alkylhydroperoxidase AhpD core"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71567"
FT                   /db_xref="GOA:B4UA87"
FT                   /db_xref="InterPro:IPR003779"
FT                   /db_xref="InterPro:IPR004674"
FT                   /db_xref="InterPro:IPR004675"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4UA87"
FT                   /protein_id="ACG71567.1"
FT                   /translation="MATLDAIREALPEPARDIKLNLQAVLQPGTLTPAQRWGVAVATAA
FT                   AARNERLLAAVLADARAEVEPAVVEDALAAAAVMAMNNVYYRFRHMVGKASYAEKPARL
FT                   RMNRLVKPAASKVDFELFALAVSAVNGCETCVRSHEQVVVAGGLSEDQVHEAVRIAAVL
FT                   HAAAVSLELAGYAAVPSAAAAAG"
FT   gene            complement(368061..370004)
FT                   /locus_tag="AnaeK_0326"
FT   CDS_pept        complement(368061..370004)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0326"
FT                   /product="transcriptional regulator, SARP family"
FT                   /note="PFAM: transcriptional activator domain; KEGG:
FT                   ade:Adeh_0315 transcriptional regulator, SARP family"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71568"
FT                   /db_xref="InterPro:IPR005158"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041664"
FT                   /db_xref="UniProtKB/TrEMBL:B4UA88"
FT                   /protein_id="ACG71568.1"
FT                   /translation="MPASPNWTLHLLGAPRLAGATVPVRLDRRTAALLALLAIDGPQPR
FT                   SRAAGLLWPDSPEKTARANLRQLLRRLREAAAGDLVGAGDPLELSPAVTVDARDPASPD
FT                   AAWPDGRLLDGVDLDEAPELAEWLAGARRSLDAARLDAALAAAARLEAAGQLGAALAQA
FT                   QRALALEPLSEEAHRREIRLRYLGGDRAAALAAYERCRAALRDALGVEPSPETVRLAEE
FT                   VARGRRVPARSGGPAALPLSVTRPPALAGREREWALMEEAWAAGKGIALGGAPGVGKSR
FT                   LMQDFLSTHARPLFFEGRPGDRAVPYGTHARTFRETLGALASAGAALPPWVRTELARML
FT                   PELGPSPGPLATEADRVRFWNAKLEAMRVAFRAGFDALGFDDTQFVDPASAAAGAYVLE
FT                   QLLRDAETPLRTVHCFRTAEMAPEVLAHIRALAEAGRALYLELEPLADDAVEELVRSLD
FT                   VPGIERVAAEVARYAGGSPLFALETVKHLVETGAVERGIPDRTPPRLEALLRARFDRLS
FT                   APALQLARALGVLGTDFTLERAAAVVEARAMDVAVGWSELEAAQLVRGAAFGHDLLAEA
FT                   VVAATPAPLRGFLHGRAAEVLAATGGAPGRIAAHWERAGDPVRADACRREAESVARATL
FT                   LATEAAGYFRAA"
FT   gene            370500..371525
FT                   /locus_tag="AnaeK_0327"
FT   CDS_pept        370500..371525
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0327"
FT                   /product="transcriptional regulator, LuxR family"
FT                   /note="PFAM: regulatory protein LuxR; PAS fold-4 domain
FT                   protein; KEGG: ade:Adeh_0316 transcriptional regulator,
FT                   LuxR family"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71569"
FT                   /db_xref="GOA:B4UA89"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:B4UA89"
FT                   /protein_id="ACG71569.1"
FT                   /translation="MIRSPEAHPCRALPAQGATPARRSLLRLLSADAPDATASAGRAPA
FT                   GPAPAAVARAIADAERRPLAWVDRDGVLRLVNAAFAALLGAEPAALEGRSACDLLCDDA
FT                   PGRAQALLRAAFRGALHRTELTALRGGREYGLKVELAAVGRGASAALCIDVHEVVERAP
FT                   PPVACGAAGDLDYRISAGASDFGRLLALSGAGAEAALRVGRRCHEVLHGRPSPCPGCPA
FT                   LRGGGEAWPRVEVRRAARTGGFEVATATALPGDEVLVAVRRVDDAALAAVREARTAELV
FT                   RRFELSPREEEVLRLLLIGRQAADIGTALGITPRTAKFHQTNVLRKLGASSRRDLLGLA
FT                   S"
FT   gene            371522..372379
FT                   /locus_tag="AnaeK_0328"
FT   CDS_pept        371522..372379
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0328"
FT                   /product="transcriptional regulator, LuxR family"
FT                   /note="PFAM: regulatory protein LuxR; KEGG: ade:Adeh_0317
FT                   transcriptional regulator, LuxR family"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71570"
FT                   /db_xref="GOA:B4UA90"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:B4UA90"
FT                   /protein_id="ACG71570.1"
FT                   /translation="MTRARTEPDWGAVALAMLERGREPAAWVDAGGTVRLATASLERLL
FT                   GAAPRALEGRPVAAVLAGAPAPAEGRVEREVTTAAGRRLRVALEPGCEPAAEPGALLRV
FT                   LEVLGDLPGLGAGELDYAIETGPGAFGLLAWVRPLGGAALDPVPAARCHEALHGRSEPC
FT                   IDCPVRGGGVWPRVHARTLAPAPGYEVVTAAPEGAERVRLTVRRLAEAAVHGLVGARAR
FT                   ALARGAGLSDREEAVLNRLLQGEGLADIGRALGITLRTVKFHQANLLRKLGAESRADLA
FT                   RVLM"
FT   gene            372495..373274
FT                   /locus_tag="AnaeK_0329"
FT   CDS_pept        372495..373274
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0329"
FT                   /product="split soret cytochrome c precursor"
FT                   /note="KEGG: ade:Adeh_0318 split soret cytochrome c
FT                   precursor"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71571"
FT                   /db_xref="GOA:B4UA91"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR010181"
FT                   /db_xref="InterPro:IPR011031"
FT                   /db_xref="InterPro:IPR036280"
FT                   /db_xref="UniProtKB/TrEMBL:B4UA91"
FT                   /protein_id="ACG71571.1"
FT                   /translation="MHDDSIGRRGWIKLVGGAAGAGAALAVARQAGAAPPAAGKGMQAI
FT                   PWPYAPLDPDATAERAFKGYLEGHCMYGAFDALAGQVADKLGAPYTSFPTKLFTYGAGG
FT                   VAGWATLCGALNGAAAAFQLLSAKPEPLVDALFRQYEQASLPDWVPASAKFPNVKSVAG
FT                   SVLCHASVSAWCKASGKKAYSPERKERCGVLTASVARHAAIILNAQHAGKAFPVLEDKA
FT                   TAECASCHEKGGTLENTRAKMACGGCHFNLGTKHPAI"
FT   sig_peptide     372495..372596
FT                   /locus_tag="AnaeK_0329"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.990) with cleavage site probability 0.908 at
FT                   residue 34"
FT   gene            373298..374431
FT                   /locus_tag="AnaeK_0330"
FT   CDS_pept        373298..374431
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0330"
FT                   /product="phosphate-selective porin O and P"
FT                   /note="PFAM: phosphate-selective porin O and P; KEGG:
FT                   ade:Adeh_0319 phosphate-selective porin O and P"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71572"
FT                   /db_xref="InterPro:IPR010870"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="UniProtKB/TrEMBL:B4UA92"
FT                   /protein_id="ACG71572.1"
FT                   /translation="MTLTPFLIALSLAQTTPAADPAAAAAQPAPAPVKAAPTLAGALAN
FT                   APKPTFWGFVNAQYSRTEGLNGADDTSTFELRRARIGARGKVHELVGYSILFDGADSKL
FT                   KDGYVSLLALPGVEVRMGQWKTPFGYEQYESDTKLLWVNTSYVVGALARGPDARDLGAG
FT                   LLVQTPKVGPVSAEVLGSFVNGAGPNKKDDLETKNFWGRAGLTLKQGTITLKAGGSYGT
FT                   GQQVQGTGGNGAFDGVGTPVDDTYFYFHTYGVDATLDTPWLFAAAELIQSERDQSRYAT
FT                   AAAVTTVTRSSRTARGWYAGAYGKTPWNLGPIFRAERFDADRTAPGGRLERYTIGAYVD
FT                   VIPVNARLILNHELDQGQTGAAGRTGDRTTLFAQVIF"
FT   sig_peptide     373298..373378
FT                   /locus_tag="AnaeK_0330"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.982) with cleavage site probability 0.516 at
FT                   residue 27"
FT   gene            complement(374421..375191)
FT                   /locus_tag="AnaeK_0331"
FT   CDS_pept        complement(374421..375191)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0331"
FT                   /product="BioH protein, putative"
FT                   /note="KEGG: ade:Adeh_0320 BioH protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71573"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B4UA93"
FT                   /protein_id="ACG71573.1"
FT                   /translation="MTASDGPLLTLLLPGLDGTGRLLDRFVAAASGRLELRTLSYPPDR
FT                   ALSYAELAELVRAELPRGRRFALVGESFGGPLALRVAAGRPPGLVGVVLAASFHRRPAA
FT                   RLVSALRPLSPAFFRLPLPAHAVRVLLAGHDAPDALVADVQAAVASVRPRVMARRAHEA
FT                   LHVDATGWLRDCPAPVLFLGGRQDRLLRTGLAIEIRLVRPDAEIRMLDAPHLVLQRRPA
FT                   EAMRAVEAFLERSPAATAPMRAASADEPELSARR"
FT   gene            375402..376235
FT                   /locus_tag="AnaeK_0332"
FT   CDS_pept        375402..376235
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0332"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ade:Adeh_0321 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71574"
FT                   /db_xref="UniProtKB/TrEMBL:B4UA94"
FT                   /protein_id="ACG71574.1"
FT                   /translation="MIGWITVLALAAGAALVGVRRARFAREIAAEARSLWALREDAPPA
FT                   RLDPGALPAPVRRYLQVAGALEATPLAAARLRHGGSFRPALDGAWRPIRGVQYLAAEPP
FT                   GFVWWGRVRLAAGLEISARDRSAGGEGGMRIALASALVVADLSGPELDAGALQRLVAEL
FT                   VWLPTALLDARHVAWLPRDASSARARLRVRGREVEVTFHFGGDGLPERITALRYRDVKG
FT                   RGVLTPWTGRCADWREVGGVRVPFRLEASWELDGRDRPYARFEVERLEHGVRQPF"
FT   sig_peptide     375402..375479
FT                   /locus_tag="AnaeK_0332"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.936) with cleavage site probability 0.874 at
FT                   residue 26"
FT   gene            376437..378728
FT                   /locus_tag="AnaeK_0333"
FT   CDS_pept        376437..378728
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0333"
FT                   /product="M6 family metalloprotease domain protein"
FT                   /note="TIGRFAM: M6 family metalloprotease domain protein;
FT                   PFAM: peptidase M6 immune inhibitor A; KEGG: ade:Adeh_0322
FT                   peptidase M6, immune inhibitor A"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71575"
FT                   /db_xref="GOA:B4UA95"
FT                   /db_xref="InterPro:IPR008757"
FT                   /db_xref="InterPro:IPR012300"
FT                   /db_xref="UniProtKB/TrEMBL:B4UA95"
FT                   /protein_id="ACG71575.1"
FT                   /translation="MRTTRTTTLALLAALALAPSAASAAADEPQLPDVAPTTDNPSHPL
FT                   GDAQAARKAIAIQAKLSGKTKGKTHQVARGQYVELERQGEDRIWTVVGEFGEQVNATYG
FT                   GTAGPLRNQIPEPDRTVDNVTIWAPDFSRAYYEDLLFSDAPGDVSMRNFYKELSSNRYT
FT                   VNGEVTDWVKVPFNEANYGSNYCGGIVCARTWLFVRDAVNAWYNGQIAAGRTVAEINAY
FT                   LAQYDVWDRYDYDGDGNFNEPDGYIDHFQAIHAGEGEETGGGAQGDDAIWSHRWYAFYN
FT                   NIGATGPAFNKFGGIRIGASNYWIGDYTIEPENGGVGVFAHEFGHDLGLPDLYDTSGNT
FT                   GGAENSTGFWTLYSVGSYGASGLPEDGLGTKPIHMSAYEKIFLGWSNYQVVRAGQYASL
FT                   KLGPAEANTKQAQTLVVLLPDKVVESEIGTPYAGTYFYYSGSGNGLDHSMTRQVTLPAG
FT                   ASLAAKVKFDIELDWDYAYLTVNGAPVATNLSSATNPNGQNFGNGITGSTGGAWVDLTA
FT                   DLSAWAGQTVTLGFRYWTDVAVAEAGLSIDDLAISGQPLDGAETEPGWTYDGFVRTNGT
FT                   LATPFFNAYFAEYRQYRGYDQSLKTGPYTFGYLNDPTLQNWVDHFPYQDGLLVWYYDTS
FT                   FEDNNVGDACASGRCGGLFLPVDAHPGLILRPDNGKAWRPRFQAFDSTFGLEPTDVVCL
FT                   HANSQQGCFGGQPGNPLFDDTQSYWVPPDPSLNHYGWSSVIVPNTGTTIRVVGTSAQGD
FT                   FMQVVVAPKR"
FT   sig_peptide     376437..376517
FT                   /locus_tag="AnaeK_0333"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.368 at
FT                   residue 27"
FT   gene            complement(378797..381877)
FT                   /locus_tag="AnaeK_0334"
FT   CDS_pept        complement(378797..381877)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0334"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mxa:MXAN_4587 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71576"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR032812"
FT                   /db_xref="InterPro:IPR036278"
FT                   /db_xref="UniProtKB/TrEMBL:B4UA96"
FT                   /protein_id="ACG71576.1"
FT                   /translation="MHRTAALHPLALALASALALAGCSGGGGGAGPGGSSCALPAATSL
FT                   QVVESAPGQGADGVSVNAAVRIRFNTCVDTPTLAGAVSFRRGTTPIPFTQAYDATTATL
FT                   VLTPAAPLALSTSYVVMVLPTARGARGEPFSGWVLGFDTRGAPDTTPPTIAADPAGGHF
FT                   NHPVDVVLTCADEPGGSGCAQTVFAVNGGAPQTYVGLVRLEASATLTFFALDGEGNRSA
FT                   TGTGTYVIDVDPPGVASVFPPDGATGVALDAVPAAAFDEDMDPATVTAARLTLAPAQAT
FT                   GAGYEPATRTARFPPDRRLECGTTYTATLDPGVTDLAGNGLPAAVSWTFTTDPDCVEPA
FT                   TTASVTDGVYAAPQQVTLTCTDAGGSGCARVIYTRDGSVPAPGNGTVVEGATAGPIAVG
FT                   EGETVLRYYSVDRAGNREAVRQQRYSVSTSGFTYVATTGGLARGAGAVPARFVALGGAG
FT                   WTYAFHRDPVTGRLWRATERGVAGSDDGAAWSLTRLPSASGDRMLPARAVWGQGSLVLA
FT                   GTEEGLFRSVDGGATFAPLLQRTVDGYDAWVNAIAGDGKDVYVATSLGLAVSHDRARTF
FT                   AWTVADGPVADVALDPGTGDLFAATSTGLLRSTDGGATFARLDTGTVPALPSGDVRAVA
FT                   VTADRVYAATAAGLAILGRDAAGAPASATSIARPCPAGETSILDVAVSGQSVWVVSGQR
FT                   YWSGSTDAFCASVDGGTTFAPRWFVAPDRTSAIASTVYAEGARVYVGYAPGFFLSTDAG
FT                   ATFRSAELPAGGVRDVAAAGGSLYAGLDAGVAVSTDGFRTFVLRTEADGLANPGVVDLA
FT                   AVGTRVYAVTTFGLSISSDGGAHFAPPATLTNASMAACVAAPDASTVYLGQMSWLQVST
FT                   DGGAHFAQRLPPAGSTGYLSDTVGVDARGGTVAVAARDTVFVSTDGGATFTERGAAAGL
FT                   VAPSGYTLSLHGVAVAPSGAIHVASNVGLFSSTDGGATFAAAAGGPAWLEAVSAGGPAL
FT                   YLGGDLLHVSTDDGASFVSRGAPDGLPGRPGPAVYVP"
FT   sig_peptide     complement(381761..381877)
FT                   /locus_tag="AnaeK_0334"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.278 at
FT                   residue 39"
FT   gene            382002..384638
FT                   /locus_tag="AnaeK_0335"
FT   CDS_pept        382002..384638
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0335"
FT                   /product="Peptidase M1 membrane alanine aminopeptidase"
FT                   /note="PFAM: Peptidase M1 membrane alanine aminopeptidase;
FT                   KEGG: ade:Adeh_0324 peptidase M1, membrane alanine
FT                   aminopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71577"
FT                   /db_xref="GOA:B4UA97"
FT                   /db_xref="InterPro:IPR001930"
FT                   /db_xref="InterPro:IPR014782"
FT                   /db_xref="InterPro:IPR024571"
FT                   /db_xref="InterPro:IPR042097"
FT                   /db_xref="UniProtKB/TrEMBL:B4UA97"
FT                   /protein_id="ACG71577.1"
FT                   /translation="MPIPALALTVAALAAAAAADPAPRPPPLPAGEVPPALRLPAGVRP
FT                   IRGEVSLTLDPAAERYRGRVRYPVVLDAPARVVWLHAEGLEIEEAKVGGRPARAVPAAG
FT                   GLLGLVPDAPQPPGEATVEVAFAGTIDRVRSRGVYAAAEEGRWYAYTFFEPADARRAFP
FT                   CFDEPSFKIPWRLSLTVKPGDRAVANTPALREAPDGGGTRVEFAETRPLPSYLVAFVVG
FT                   PFDVVEAGAGGAARVPVRFVVPRGRGGETRYAASVTARLLDLIEAETGVPYPYEKCDVA
FT                   VVPRFWGTMEHPGIVALGQPLTLIPPVAETRERRLRYASIAAHELVHHWFGDLVTMAWW
FT                   DDTWLNESLTSFVDPVITDALEPAWRRTARARAEGRASALAADALAAVKRLREPVGSRH
FT                   EIEGAFDNAITYDKGAAVAAMYERFLGRAAWRAVLRDHLLAHADRTAASEDFLATLAAR
FT                   STPALAASLRGFLERPGVPLVRASVRCDARGAAAVVRQERFLASGAPDPAATWAIPLCV
FT                   RAGAGARVETACALVGGDGPEGELPLPFCPEWLWPNAGGTGYHLTALDAAALPGLWPHL
FT                   APAERLALATDASLLARRGDLPVEAALGRVGPLAASDDRLQVEASLELARLAQPEWLGP
FT                   DDHARWRAFLRETWGPRARSLGWMPRRGEPDDTAALRRLVVPAVADEGEDAPLAGEAAA
FT                   LARRWLADRRSVPAEAAWPALEVAARTGDVALFDGILAAARASRDRTVRARLLAFLGRF
FT                   ERPALADRALGLVASGEEDLRDTSGILRAALAGRETRWRAWALLRGRWDALAPRLRSDE
FT                   ASWLVAQAAGLACDPGRAAEVAAFLRPRAEAFDGAPAALARALEEAGACRAARARNGPA
FT                   VARFLAR"
FT   sig_peptide     382002..382061
FT                   /locus_tag="AnaeK_0335"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.934 at
FT                   residue 20"
FT   gene            complement(384702..385124)
FT                   /locus_tag="AnaeK_0336"
FT   CDS_pept        complement(384702..385124)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0336"
FT                   /product="methionine-R-sulfoxide reductase"
FT                   /EC_number="1.8.4.11"
FT                   /note="TIGRFAM: methionine-R-sulfoxide reductase; PFAM:
FT                   Methionine sulfoxide reductase B; KEGG: ade:Adeh_0325
FT                   methionine-S-oxide reductase"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71578"
FT                   /db_xref="GOA:B4UA98"
FT                   /db_xref="InterPro:IPR002579"
FT                   /db_xref="InterPro:IPR011057"
FT                   /db_xref="InterPro:IPR028427"
FT                   /db_xref="UniProtKB/TrEMBL:B4UA98"
FT                   /protein_id="ACG71578.1"
FT                   /translation="MDKLILSDAEWRARLTPEQYQVLRGHGTEPPGTGCFLGTHEPGTY
FT                   VCAGCGNPLFRSGEKFESGTGWPSFTRPVSADAVVEVHDRSYGMRRTEVRCARCDGHLG
FT                   HVFPDGPPPTGLRYCMNSAAMRHVAEGAPLDPPGAG"
FT   gene            complement(385259..386884)
FT                   /locus_tag="AnaeK_0337"
FT   CDS_pept        complement(385259..386884)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0337"
FT                   /product="putative sigma54 specific transcriptional
FT                   regulator"
FT                   /note="PFAM: sigma-54 factor interaction domain-containing
FT                   protein; helix-turn-helix Fis-type; 4-vinyl reductase 4VR;
FT                   Activator of aromatic catabolism; ATPase associated with
FT                   various cellular activities AAA_5; SMART: AAA ATPase; KEGG:
FT                   glo:Glov_0890 putative sigma54 specific transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71579"
FT                   /db_xref="GOA:B4UA99"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004096"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR010523"
FT                   /db_xref="InterPro:IPR024096"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B4UA99"
FT                   /protein_id="ACG71579.1"
FT                   /translation="MRIEDLDLREILSFDPRGGVIRFMGQRVVLFDAVALGLLRKELTD
FT                   AFGTFAARGVLTRFGYAHGWRVGEALEHEHPDLWKEGKAGPFLPPLKGQFILGENVRTD
FT                   GLGDAPLVETVWHRSYEAEQHLLHIGLSDDPVCWTSAAFASGYLSYKERREVYVIEDRC
FT                   VGKGDSECHITARFKERWGPELERHLPYYHMESIDHALQEVSSKLRRTERRLRERQAEL
FT                   ERLATCSDQDTGLVARSEAMRRVLERARSVARTGSSVVVTGESGVGKEEVARLVHRSSE
FT                   RAGGPFVAVNCGAIPETLLERELFGHVKGAFTGAETDAVGLFEAADGGTLFLDEVGEVS
FT                   PAMQVKLLRALQEREVRPVGDSRSRKVDVRIVAATNRDLAVEVASGRFRQDLFYRLNVI
FT                   ELRVPPLRDRPDDVVPLARCFLAKLSRSAHRPVTGFTAQVADLLVRYPWPGNVRELQNA
FT                   VEYAVALSAGNQVGVDDLPEALRHAPPAPARPGVIRPLHEVEREHVLAALRTAGGNKVA
FT                   TAAGLHIGLATLYRKLKEYGEPAP"
FT   gene            387368..388663
FT                   /locus_tag="AnaeK_0338"
FT   CDS_pept        387368..388663
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0338"
FT                   /product="porin"
FT                   /note="KEGG: mms:mma_1295 porin"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71580"
FT                   /db_xref="GOA:B4UAA0"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="InterPro:IPR033900"
FT                   /db_xref="UniProtKB/TrEMBL:B4UAA0"
FT                   /protein_id="ACG71580.1"
FT                   /translation="MNMTHRRSLALLAALLLPAAASALEGDVTLYGTLMPFFDNARVSD
FT                   PTRPGLSPATGGATQVSDAAYTGVAIPQRFRLTSGTSNIGFKGGFDVLGEDLQVFFQVE
FT                   SAVSPDGDAPNAWASRNSAVGVKGKFGRAFFGNWDTPYKYPVLLVGAVRGLNPFDNTIT
FT                   ANPGFGVPGTTTQSGRVNGKADAAFNRRQGNSVQYWTPELYGFSARLAYSANESRTVAS
FT                   ATAPSISPTIYSGLVSWGHGPLLLRYAYERHQDYFGLSQLGGSPVSLTNRSSTDQGHEA
FT                   IAQLSLPTGTRVSLVGERLSYQNEDRAVGAVREYARLAYYALLQQRFGPHQLFGSFGQS
FT                   DAGECKVVGGGACTVNGLGATQWNAGYSYALTKAADVYVAYYETRNDRSASYGVVGGPG
FT                   AVAPGGDTRGFGLGLLYTFAATANVGAPKGSP"
FT   sig_peptide     387368..387439
FT                   /locus_tag="AnaeK_0338"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.874 at
FT                   residue 24"
FT   gene            389115..389606
FT                   /locus_tag="AnaeK_0339"
FT   CDS_pept        389115..389606
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0339"
FT                   /product="protein of unknown function DUF59"
FT                   /note="PFAM: protein of unknown function DUF59; KEGG:
FT                   ade:Adeh_0327 protein of unknown function DUF59"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71581"
FT                   /db_xref="GOA:B4UAA1"
FT                   /db_xref="InterPro:IPR002744"
FT                   /db_xref="InterPro:IPR034904"
FT                   /db_xref="UniProtKB/TrEMBL:B4UAA1"
FT                   /protein_id="ACG71581.1"
FT                   /translation="MSPGPEPRSRASRALEWIFAALLLGASSAILIAAAVSRADTHYEW
FT                   SRPAGDPARGDVTAAQVRERLHEVLDPELGIDVVDLGLVYEIAEPREGKVALVMTLTVP
FT                   GCPFAKQLVEDVRRALFAHPGVKEVSLTVTLDPPWSWERVAPEVRKRMIEHGAGAEERS
FT                   "
FT   sig_peptide     389115..389234
FT                   /locus_tag="AnaeK_0339"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.939) with cleavage site probability 0.492 at
FT                   residue 40"
FT   gene            389603..390232
FT                   /locus_tag="AnaeK_0340"
FT   CDS_pept        389603..390232
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0340"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ade:Adeh_0328 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71582"
FT                   /db_xref="GOA:B4UAA2"
FT                   /db_xref="InterPro:IPR039447"
FT                   /db_xref="UniProtKB/TrEMBL:B4UAA2"
FT                   /protein_id="ACG71582.1"
FT                   /translation="MTLLGPLSSGFLLGLGTGPLCFIGCIPLALPFALPGPDAGPGSRR
FT                   GGWGFLLKFLAGRLVAYSTVGVLTGLASSLAGPLRRWVTPVWLALSVVLILHGLGRGLG
FT                   HRGLCGATTRLVRSRAFPFLLGLAAALSVCPPFLLAVAYAMDRSGQVLGGVAFFLAFFV
FT                   ATTLYVLPIAMLGYLPRRELWQRVGRVASVIAGAALLAQGLRELLA"
FT   gene            390373..392295
FT                   /locus_tag="AnaeK_0341"
FT   CDS_pept        390373..392295
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0341"
FT                   /product="4Fe-4S ferredoxin, iron-sulfur binding protein"
FT                   /note="KEGG: ade:Adeh_0329 4Fe-4S ferredoxin, iron-sulfur
FT                   binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71583"
FT                   /db_xref="GOA:B4UAA3"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR028894"
FT                   /db_xref="UniProtKB/TrEMBL:B4UAA3"
FT                   /protein_id="ACG71583.1"
FT                   /translation="MTKTDRYVLWGIGAVWALDLATFILSDFHIYAFLALFVIAALGFA
FT                   WWGLRFQVTEPMRRNAALGVTGFWTVAMALLFAPWPIPDKPEYIVGEVHRFSEMEHGFS
FT                   RVLTGVTGPNIAAGGLVYGDPADQQSMMTEWGWPPNFISGYPLARALFGGTILMERLRG
FT                   ATTIGGEPANPLRYSWSNFQGEKRDKKLGWNKGDLLLGEVAKAMGSAKATYTPHENTLM
FT                   VKSIASWLGSPRIAIAAVDPRWFYSHDLSTYGTPLPLKDAKDLKYVIQIFTDQDWTRIH
FT                   NDAGTSWWSVSNSGQAYSTSAWIGIRMAQMLRDMGYVARVGFGGMNYENIETPASVYSG
FT                   IGEYGRLSDAVVPTAGGLRFKSATIFTDFPLEAGDPKQGWGITRMCANCDRCARACPVN
FT                   SVPMGEPTVENGVKIWQVDKDKCTRFRTGNLNGNMCGACLAVCPYNKPDTAFHRVGNYI
FT                   IRHSPIATYLFGNIHGVGLEDWLDFEYSSEASPYNVSRPARWIQEDPGWKARFPYQVGQ
FT                   YIYTERDRSKNEEWASGVDPKMGKVGLSYKGTTWGKIPDRLLDASGRNRNVHWDYEAGE
FT                   LPPNLPLPGKLLTPEEATALLKDGKAFSGASYSPDDEVFPPRDPKYEKQTLTYEQAARM
FT                   WAEEK"
FT   gene            392297..392554
FT                   /locus_tag="AnaeK_0342"
FT   CDS_pept        392297..392554
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0342"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ade:Adeh_0330 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71584"
FT                   /db_xref="GOA:B4UAA4"
FT                   /db_xref="UniProtKB/TrEMBL:B4UAA4"
FT                   /protein_id="ACG71584.1"
FT                   /translation="MTRLKRLKLSIALEWYEILLIGVTAGLLAFGLWALVDTLLIASPV
FT                   AAWRFLALFVVWSLPGIAILAFVRPRPPAAPPAPRQQVTP"
FT   sig_peptide     392297..392401
FT                   /locus_tag="AnaeK_0342"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.946) with cleavage site probability 0.915 at
FT                   residue 35"
FT   gene            392615..394069
FT                   /locus_tag="AnaeK_0343"
FT   CDS_pept        392615..394069
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0343"
FT                   /product="4Fe-4S ferredoxin, iron-sulfur binding protein"
FT                   /note="KEGG: ade:Adeh_0331 4Fe-4S ferredoxin, iron-sulfur
FT                   binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71585"
FT                   /db_xref="GOA:B4UAA5"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:B4UAA5"
FT                   /protein_id="ACG71585.1"
FT                   /translation="MRWKARELGCVALLAVGTAAWTAMTSAALVEREWRATWISLATAL
FT                   GCAALCAGLLLAKRRGALEGARARWTLRGVLGLAALLALALVIPSDRSFPDKRVGAGTP
FT                   TQAYDATTQPGNDVLGKVERSRGPDGRDELTFSVYDVCVGKVAHRAARDGAVAPVAVEV
FT                   TEPAVLAAQIKDEARALGAQVAGITELHPQFVFQKDNDGQPVALHHRYAIVIGTGLDYR
FT                   LASPSAPLPWRDYYSSIPEEVAAVLSGRSTNPAVPIPPETVQEYRDTLEFYAEGGRVAV
FT                   ELAKAIRSLGYPARAHFGRWAEVQVIPLAIAAGLGEVGKNGMLINDRFGPRGSFAVVTT
FT                   DIPLAVDRQRDLGVQEFCRVCNKCADACPVSAVPRGEAGAPAGGVSRWQVDGPKCWTYL
FT                   KVNPKCMACTGACPFNKKDLLAHRWAVALISRKSVVANRLLVWLDDLLGYGRSAFRLRD
FT                   EARKALGAPGEAPRPAGASPGPEARS"
FT   sig_peptide     392615..392698
FT                   /locus_tag="AnaeK_0343"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.517 at
FT                   residue 28"
FT   gene            394066..394233
FT                   /locus_tag="AnaeK_0344"
FT   CDS_pept        394066..394233
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0344"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71586"
FT                   /db_xref="GOA:B4UAA6"
FT                   /db_xref="UniProtKB/TrEMBL:B4UAA6"
FT                   /protein_id="ACG71586.1"
FT                   /translation="MSSRGPSRPVKEWLALIAAGLLVGALFNAAFQAAPWSSGGLLGGV
FT                   AAAALLRLLS"
FT   sig_peptide     394066..394164
FT                   /locus_tag="AnaeK_0344"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.990) with cleavage site probability 0.745 at
FT                   residue 33"
FT   gene            394230..394397
FT                   /locus_tag="AnaeK_0345"
FT   CDS_pept        394230..394397
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0345"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71587"
FT                   /db_xref="UniProtKB/TrEMBL:B4UAA7"
FT                   /protein_id="ACG71587.1"
FT                   /translation="MTEIVTTLLLAVGVYALLRRPGAGCDGRCDGGRGGCEGERAPLVQ
FT                   LGRPRGRVRR"
FT   gene            394394..395848
FT                   /locus_tag="AnaeK_0346"
FT   CDS_pept        394394..395848
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0346"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ade:Adeh_0332 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71588"
FT                   /db_xref="GOA:B4UAA8"
FT                   /db_xref="UniProtKB/TrEMBL:B4UAA8"
FT                   /protein_id="ACG71588.1"
FT                   /translation="MTWAGPAALGLFVGGVIASLRGWIPQRVVTLQALLLAVAALAIGF
FT                   SALAGRPIPWPQLLASANVHPVTSVIAGFLLAGALHAAGAFDAAARLLGRLTRTRLGAP
FT                   FVISLLVNLPTILAMPCGRILVSPLIPLALMLGWALAKERGEPVLVAVTVFGLVVNAAA
FT                   SCGPSVIGGIGMLGEGMGRYPPGSFSNPAQIAILVITVATMALIRWGYGTTLRMRAAPP
FT                   EAAERPVPEHGYLALAIFLAVLLVVVLVRPPVPLQVTLTIGTACVMLVARLGLDDLLGG
FT                   VMLHPLSAMLAGFLVAGALSIAGAFDALLALLVWAAEHTPLGYVGVSVVLAYVPVMLAM
FT                   PCGRIVSLALIPGVLLFGVRLADVTGLERATPALLSAFILAGAASCGPSAIGGIGSIGE
FT                   GRLRIRDAWSGRPQTLGIFLGVPVTALLVSRLPLTSTALDPRYFPAALVLGAVAGGVVN
FT                   LVYGYRVHHLGGLLGGLLTGALLVLL"
FT   gene            395845..396336
FT                   /locus_tag="AnaeK_0347"
FT   CDS_pept        395845..396336
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0347"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ade:Adeh_0333 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71589"
FT                   /db_xref="GOA:B4UAA9"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="UniProtKB/TrEMBL:B4UAA9"
FT                   /protein_id="ACG71589.1"
FT                   /translation="MRRALVTVNAIAVGATLAYLGWLLADALRARQPWAITCYDCKACT
FT                   ARCVLGLDPQGFVSAALAGSGDVYMYATNVRLPVRRALEIDPEMLVTVADRHLTAREAA
FT                   AALGPDAELVTFKMRARDAARVCFRCGACEKGCGLRLPLLRLIAQLRGDAGNEWAAHAP
FT                   "
FT   sig_peptide     395845..395901
FT                   /locus_tag="AnaeK_0347"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.735) with cleavage site probability 0.471 at
FT                   residue 19"
FT   gene            396326..396955
FT                   /locus_tag="AnaeK_0348"
FT   CDS_pept        396326..396955
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0348"
FT                   /product="4Fe-4S ferredoxin, iron-sulfur binding protein"
FT                   /note="KEGG: ade:Adeh_0334 4Fe-4S ferredoxin, iron-sulfur
FT                   binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71590"
FT                   /db_xref="GOA:B4UAB0"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="UniProtKB/TrEMBL:B4UAB0"
FT                   /protein_id="ACG71590.1"
FT                   /translation="MLRSPAFLATLTFLAVALGARVAQAPWTEQFPGSYPRVHAPADAR
FT                   FEFLPDEIRIHLDEETKSGRIIVFAHAADGSLLGLLKPIVDGAVTVRRGDLADYRLAVR
FT                   GRDVGEHRLLKAMDRYVEREDMLERILDARAKGLRFGVQRCLYPICNRCLDGCKSVMRG
FT                   DFPISMRVGERGNVEPVFAKGSCPRCGKCFVWCPSGVIRDSGSLTN"
FT   sig_peptide     396326..396397
FT                   /locus_tag="AnaeK_0348"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.611 at
FT                   residue 24"
FT   gene            396964..397329
FT                   /locus_tag="AnaeK_0349"
FT   CDS_pept        396964..397329
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0349"
FT                   /product="4Fe-4S ferredoxin, iron-sulfur binding protein"
FT                   /note="KEGG: ade:Adeh_0335 4Fe-4S ferredoxin, iron-sulfur
FT                   binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71591"
FT                   /db_xref="GOA:B4UAB1"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:B4UAB1"
FT                   /protein_id="ACG71591.1"
FT                   /translation="MFEAMEIAVVLLPVVLVAGMVVRLVARGHTQVLLCMECELCMGAC
FT                   PLCVKRGEAFPGPKGILAAAKTGKVDAAIAAGALDCTSCGACTHVCPRGLAPQREVERW
FT                   RAEAERVASRHAAEDPA"
FT   gene            397326..399281
FT                   /locus_tag="AnaeK_0350"
FT   CDS_pept        397326..399281
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0350"
FT                   /product="TonB-dependent receptor"
FT                   /note="PFAM: TonB-dependent receptor; TonB-dependent
FT                   receptor plug; KEGG: ade:Adeh_0336 TonB-dependent receptor"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71592"
FT                   /db_xref="GOA:B4UAB2"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039426"
FT                   /db_xref="UniProtKB/TrEMBL:B4UAB2"
FT                   /protein_id="ACG71592.1"
FT                   /translation="MSASARVAARTAIALALACATCPAPAAGADPGPDPDVPLVVLEEQ
FT                   VVRLPRATTEARSLASGTVVDRATFEGEAKDVGQLVSTAPGIAVEEHGGLGQLTTISIR
FT                   GSPPSGVKVLLDSLPLNTAFGGGVDLSTIPRSWVDAVEVVRGPAGARYGSGALGGVLNV
FT                   VTRRPEAGSWSLETGGGSFDTARVAADVATSLGPGAVLLGATAETTSGRFPFRLDPGLP
FT                   GGPTVAATRENAEVRRGGLLAKLVRPQERGRLDALLEVSGGHRGLPGFAAAPTPWAWQD
FT                   DARLLAMGRVARFGALGPATLAARGHLRLDRLDARLTGPDDSPIRQRGAAAGLALEATG
FT                   SHRNGVLSASLETNAELLAADGLGGRRDLYGVAAAVADDLSLADGGLRIAPAARAERAG
FT                   QFGGVSGSLGLSVRLAPALRARAGVGRTFRPPGLAELHLQQGLLVPNPDLRPETAVAAD
FT                   AGLVADGRAGLLAVTGHLTRYEDLVVYEPSDAFGRLKPFNSGRASATGLEVEGASAPVG
FT                   GPLRASASGSYTLLVTELLRGAPAEVGHWIPYRPKQRAFLRVALAPGPLSAHVELHRLG
FT                   RRYRDRRGVNPVPSSTSWNAGLGVRVARRPEVRIHLEVLNLADDRTLTDGVGDPLPPRT
FT                   VMVTLRAGSSAQEYAP"
FT   sig_peptide     397326..397412
FT                   /locus_tag="AnaeK_0350"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.526 at
FT                   residue 29"
FT   gene            399278..400765
FT                   /locus_tag="AnaeK_0351"
FT   CDS_pept        399278..400765
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0351"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ade:Adeh_0337 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71593"
FT                   /db_xref="InterPro:IPR006969"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniProtKB/TrEMBL:B4UAB3"
FT                   /protein_id="ACG71593.1"
FT                   /translation="MRSTFLATLAAAALLACSARSTCPEGQVDCGGRCVALSADPLNCG
FT                   ACGTVCGAGGACRAGACDCGPGTVRCGETCAQLESDPANCGACGKTCPGAQVCGTAGGA
FT                   IACADACAEGLTACERACVDLTSNRYHCGGCGVLCEPGEACDGGTCRSLQVACFATDDV
FT                   RPLAPDLAGAGSPRPAGDGPVALAGLDGDVWAAAALSGSLVRLPLELAAPSVEHALHAA
FT                   DLEGIAAVGDRLLVSNSGGGSVAVVEPGTGRVLDDVILPGPPSANPRGIAVLDGRAYVA
FT                   LYGKDEASGGQAVAVLDVSRVPGCAGAPCATLERTIDLRGAADAGALPFPGHAVALDGN
FT                   VHVTLANLAKDSDPTSWTYGYYVTPAGPGRLVTIDAASGASRVLSLGDGCKNPGALAAH
FT                   GSTLWISCAGAGAAGLLPVDLSNPAAPVVGGLLLTAFDAPGAVAFCRGAGFVSDQYTGR
FT                   VQRFDPVTRNAQEAVEVCPMGAQGWAWAADLLCAPGR"
FT   sig_peptide     399278..399346
FT                   /locus_tag="AnaeK_0351"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.682 at
FT                   residue 23"
FT   gene            400838..402502
FT                   /locus_tag="AnaeK_0352"
FT   CDS_pept        400838..402502
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0352"
FT                   /product="putative sigma54 specific transcriptional
FT                   regulator"
FT                   /note="PFAM: sigma-54 factor interaction domain-containing
FT                   protein; helix-turn-helix Fis-type; 4-vinyl reductase 4VR;
FT                   Activator of aromatic catabolism; ATPase associated with
FT                   various cellular activities AAA_5; SMART: AAA ATPase; KEGG:
FT                   ade:Adeh_0338 sigma54 specific transcriptional regulator
FT                   with PAS sensor, fis family"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71594"
FT                   /db_xref="GOA:B4UAB4"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004096"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR010523"
FT                   /db_xref="InterPro:IPR024096"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B4UAB4"
FT                   /protein_id="ACG71594.1"
FT                   /translation="MKLHDIHLLDLFDVGTEQGWLSMRQQRMVVHSAAAVSIMRAQLIR
FT                   SMGQDAARAIVFRWGFAQGYFDAMMCSDHLASLQPVDRFVFGCTLHTMEGMVRVAPKVI
FT                   EAEGPGKLHMEANWWHCAEADDHARVFGAGMTSSCWATLGYASGFGTYVIGALILFEEV
FT                   ACRCSGAQCCSVVGNDLDGWGERAAEIEARYTLAGETSFSQQWKEIHAECEHARAIRTA
FT                   AASAKSAPTATVTTVNGPDRTTAPLNFVVCSQAMTDLLVLAERVAPLEMNVLIEGESGT
FT                   GKEFLARFIHEKSMRGDAPMVAINCAALTEGLLESELFGHARGAFTGAVRDKPGLFEHA
FT                   GRGTILLDEIGEMPLCLQAKLLRALESREFRRVGSEKVLRLDARVVASTNRDLRQQVQT
FT                   GAFREDLFYRLGGFVLTIPPLRERREEIPALAHYFLHSTARRWNKGVQTISPGAMRCLM
FT                   SYSWPGNVRELQHAIERATVVASQSVLTVKDLNPEVAGRLGDPAPDGDLDVEANERQLI
FT                   EEALRRYHGNRKEAAAALRISPVTLWRRVRKYGLSLS"
FT   gene            complement(402495..403472)
FT                   /locus_tag="AnaeK_0353"
FT   CDS_pept        complement(402495..403472)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0353"
FT                   /product="molybdopterin dehydrogenase FAD-binding"
FT                   /note="PFAM: molybdopterin dehydrogenase FAD-binding; KEGG:
FT                   ade:Adeh_0339 FAD-binding molybdopterin dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71595"
FT                   /db_xref="GOA:B4UAB5"
FT                   /db_xref="InterPro:IPR002346"
FT                   /db_xref="InterPro:IPR005107"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="InterPro:IPR036683"
FT                   /db_xref="UniProtKB/TrEMBL:B4UAB5"
FT                   /protein_id="ACG71595.1"
FT                   /translation="MSRTRAYPEWHLASSLAEATWRAFQGAAVVAGGVDLGERLGLVRR
FT                   APRSIVCIRGLAELRRLDVRPDGLCIGTLVTLQELAQSPLVLERFPALARAAGLAATPA
FT                   VREVATVGGNLMQYPRCWQLRTEGRPCRRSGAGRCRSDGSWRADGALFDRRACASAHPS
FT                   SLAPVLIALGARAEAHSVSGLVRVPLDRLYPPRRSSAGRPVCTTPADILTCIHLRWPAP
FT                   GEVTFFDARRTGDAVTAAVAGSVEVRDQVVEAARIVLGGVAPSPWRARAAEARLLGARL
FT                   CPAALRDAIHAELAIAAAPAGSTAKARDLQAAALTALRAGEGVS"
FT   gene            403692..404267
FT                   /locus_tag="AnaeK_0354"
FT   CDS_pept        403692..404267
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0354"
FT                   /product="alkyl hydroperoxide reductase/ Thiol specific
FT                   antioxidant/ Mal allergen"
FT                   /note="PFAM: alkyl hydroperoxide reductase/ Thiol specific
FT                   antioxidant/ Mal allergen; Redoxin domain protein; KEGG:
FT                   ade:Adeh_0340 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71596"
FT                   /db_xref="GOA:B4UAB6"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B4UAB6"
FT                   /protein_id="ACG71596.1"
FT                   /translation="MDGAGDRRRAAPPARGGARAGLALLAGAALAIGALVVADRRAAAG
FT                   RAPGLDELAPPLVLTAVGGGGAIDLGKLRGRAVAVNFWAPWCGPCRAELPDLAEVKREL
FT                   GDACVELIGVAGDGGREEVAQVAAGQPYPMGFDADGAAMRAWRVDAVPTTYLVDPGGKI
FT                   HAVISGAVGRAELLEALRPIIPATCPRS"
FT   gene            404452..405339
FT                   /locus_tag="AnaeK_0355"
FT   CDS_pept        404452..405339
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0355"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ade:Adeh_0341 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71597"
FT                   /db_xref="InterPro:IPR025737"
FT                   /db_xref="UniProtKB/TrEMBL:B4UAB7"
FT                   /protein_id="ACG71597.1"
FT                   /translation="MKPHPWKPILALVAAITLATPAAAKEGGDQYPVGVDGLAAGALPP
FT                   PGTYLLSMVALVHGEVQDADGHDAGIEASAQFGVLRLVHVTKLRVLGAQYGFGAILPYW
FT                   HQTAKVRTPAGKLEFDADGPGDITLNPVYLNWHFPQNLHLLATVDLNLPTGRFRTDGGL
FT                   SQGVGYYSVSPNVAATWYAPGGFEASGKLLYNLKRENPVTGVRSGDELEVDFAVAKLFG
FT                   PFEAGVGGYYTVQTTDDELDGQEVNDKAEGLALGLQAAYQAPFGTFIGMWHHDVTSDSR
FT                   LQADRVFLKFMLPL"
FT   sig_peptide     404452..404526
FT                   /locus_tag="AnaeK_0355"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.997 at
FT                   residue 25"
FT   gene            complement(405323..407500)
FT                   /locus_tag="AnaeK_0356"
FT   CDS_pept        complement(405323..407500)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0356"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="PFAM: chemotaxis sensory transducer; SMART:
FT                   histidine kinase HAMP region domain protein; KEGG:
FT                   ade:Adeh_0326 methyl-accepting chemotaxis sensory
FT                   transducer"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71598"
FT                   /db_xref="GOA:B4UAB8"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="UniProtKB/TrEMBL:B4UAB8"
FT                   /protein_id="ACG71598.1"
FT                   /translation="MLRSLPVSTKILGSSLLAAGATLAAGMAGWLAARGGLPGGATLAL
FT                   GASAAVAAVIAAGGLFVSLVVGRAIRAMRTESARVRDAVRAGTLTVRGGEGHIDPEFQL
FT                   IIRTLNETLDAFSVPFAATADAVERISRGDLPARITAPFEGDFDRLREAVNAVIEVVEQ
FT                   RNEDIRRLVEAATAGRLDVRADVTRYHGYNGAMIGRINLLLDTVIRPIEVATDRVVRLA
FT                   AGEVPPDVDLAVQGRFLDLKRGVNALLEVVRLRNADLALLLRAAAEGRLDVRADPSRYP
FT                   GQNGELVRGMNALLDAVVAPLRAAAGALERLARGEAPAPIEETYRGEFDTLRRNVNACT
FT                   SAIRALVGEVDVAIEAGRAGDLGRRGDPTRCAGDYRRVLAGVNEILDAISAPVREASEV
FT                   LARLAARDLRARMGGRYLGDHARLQQVVNGTAGALDAALGQVVEAVGGISAAAAQIASS
FT                   SRAVAGGAAEQASAIGRTGASLEAVAGQARATSEHASAADGLTAAARDAAAEGTATVSR
FT                   MTAAMAQVRLAAEQTAQIIKDIDEISFQTNLLALNAAVEAARAGDAGRGFAVVAEEVRS
FT                   LALRSKAAASRTEALIHESVRQAADGDAITRAVAERLEAIHGSSDRLAALAAEISASAR
FT                   EQASGVARITGTVAEIDRVTQQNAASAEQSSAAAAELSARSGMLAELLGEFRLGGAGDR
FT                   AAARAAPRAACEAGRGSDDPTCLAAGATGGA"
FT   sig_peptide     complement(407414..407500)
FT                   /locus_tag="AnaeK_0356"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.352 at
FT                   residue 29"
FT   gene            complement(407761..408672)
FT                   /locus_tag="AnaeK_0357"
FT   CDS_pept        complement(407761..408672)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0357"
FT                   /product="UbiA prenyltransferase"
FT                   /note="PFAM: UbiA prenyltransferase; KEGG: ade:Adeh_0342
FT                   1,4-dihydroxy-2-naphtoate prenyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71599"
FT                   /db_xref="GOA:B4UAB9"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="UniProtKB/TrEMBL:B4UAB9"
FT                   /protein_id="ACG71599.1"
FT                   /translation="MDLLVYPTHSLPTAAQPVLVGLGLAVHFGVLSPWPALVGLFGSWV
FT                   IHVAGLFTDNHELLRLHPKLPEHPELVQAVETGALRLATLRLAIVGCLALALATAPYLY
FT                   RIGGAPVLAFGALGIVTSLSYNGGPWAYARRGQADPLFVVMFGVVGVVGTYFIQAAAVQ
FT                   GAPEPWRLLASLPLAVYLVGLPVGALVTAVLLVDDLRDHEFDRVKGWRTGAVLHGPGFN
FT                   RVEISALLALAYLAPLGSWLLLDLGPWMLLPLASAPMALGALRTLFTVRERARLIPLTP
FT                   RMARVGLVYSALLGAALALAPR"
FT   gene            complement(408850..409227)
FT                   /locus_tag="AnaeK_0358"
FT   CDS_pept        complement(408850..409227)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0358"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sco:SCO4250 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71600"
FT                   /db_xref="GOA:B4UAC0"
FT                   /db_xref="UniProtKB/TrEMBL:B4UAC0"
FT                   /protein_id="ACG71600.1"
FT                   /translation="MKSRASPSTAAPSWGALWLTGGPQALAPRLPPPAPRPAPVGRAGA
FT                   GRLLAPRFARAARGSPDLAVGALLAALWIGLWAVFTVGVAGALGEVAAGSAAGWTASAP
FT                   GTPHASVAAARRPAPTPRVRR"
FT   sig_peptide     complement(409150..409227)
FT                   /locus_tag="AnaeK_0358"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.636) with cleavage site probability 0.571 at
FT                   residue 26"
FT   gene            409284..410225
FT                   /locus_tag="AnaeK_0359"
FT   CDS_pept        409284..410225
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0359"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: ade:Adeh_0343 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71601"
FT                   /db_xref="GOA:B4UAC1"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B4UAC1"
FT                   /protein_id="ACG71601.1"
FT                   /translation="MSKRALNAQGGAGPAQQRAGLDWGHLEFFLELVRTGSHARAARRL
FT                   GVDRNTVARRVAALEGALGLALFERGPQGWACTTTGQELAELALRVEQDVLALARHADT
FT                   RDRALDGTVRLTTASHLATHLFLPAVGVLRERHPGLVLEIAADQRAFDLTRREADLAVR
FT                   MGRPRDAGLVTRKLSDVAYGLYGGREVVGGKPRAVDFAADPFVGLDEGHAAVPQERWLE
FT                   RVAPARRIVFRCNSTTALLQAARLGLGVAVLPRFVADRDPALVRLDGPEPAPHELWLLV
FT                   HGDLRRTPRVRAVIDWLDGLVERARPALAGQP"
FT   gene            complement(410222..410968)
FT                   /locus_tag="AnaeK_0360"
FT   CDS_pept        complement(410222..410968)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0360"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ade:Adeh_0344 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71602"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniProtKB/TrEMBL:B4UAC2"
FT                   /protein_id="ACG71602.1"
FT                   /translation="MSSGARKHAVPAGAPGAEVPCADAEVVREYGPFDGAPVAGVSFDG
FT                   ERVWAATGARLIAFDPASGETVRALDVACDAGTAFDGRHLHQLAGDRILRLDPGTGAVL
FT                   GSIPAPEGAGGSGLCWAEGSLWVGRYGERRILRVDPATGAVLRTIESDRFVTGVTWVDG
FT                   ELWHGTMEGGESELRRVDPAGGAVRARLSMPRGALVSGLESDGAGLFFCGGAASGKVRA
FT                   VRRPAPAGGRTASRARRPGPRGRRPR"
FT   gene            complement(410965..412212)
FT                   /locus_tag="AnaeK_0361"
FT   CDS_pept        complement(410965..412212)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0361"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ade:Adeh_0345 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71603"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B4UAC3"
FT                   /protein_id="ACG71603.1"
FT                   /translation="MPATPPAAAAARALQAGDPLGALREVALRRDATGLALRGIAMAQL
FT                   GDLDAARRLLRRAARAFGPAAPLARARCATAEAEVALAARGPDAPAIDLEDAARALEAG
FT                   GDRANALHARLLAVRRLLLGGRVAEAGAALDRLALRGAPPALAAVAGLAALDVALRSGR
FT                   SAAAAEAHARARRAADRAGIPALVAEVARAGEALASPAARLLSAGAERPLRLGEVEALR
FT                   RSDRLVVDGCRRTAGRGGAAVDLARRPVLFALLRALAEAWPGDAPREVLVRRAFGAARA
FT                   TPSLRGRLRVEVGRLRRAVRALASVHATPAGFALAPRTGAGVAVLAPPAAAGDADGQAA
FT                   ALAALLADGQAWSSSALALALGTSRRTVQRGLTALAERGAVRALGRGRARRWVSAPTSG
FT                   FNPALLLPLPRAIGQG"
FT   gene            412355..413587
FT                   /locus_tag="AnaeK_0362"
FT   CDS_pept        412355..413587
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0362"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ade:Adeh_0346 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71604"
FT                   /db_xref="GOA:B4UAC4"
FT                   /db_xref="UniProtKB/TrEMBL:B4UAC4"
FT                   /protein_id="ACG71604.1"
FT                   /translation="MLCIRRMRSDRNLGTLDRRDGVWPRTYPFARRWRLLFHGLGALGL
FT                   AAAVAGSIAALRGALAGPVLIVPLGFGALGAAAVAAAQRGRLLLHADGVEVIELGRSPR
FT                   RLRNDQIAGRRTIPLQYGMEKLVLERRERGEKPVSMGFLFERDATLDAWLASLPDLDVA
FT                   DRASAEAALLASAELGPDEEARRASLAGSHRVAKVLKGAALAAGGWGLLFPRPYPVAIA
FT                   VLAAIPLATLALVLAGRGRYSVEERRNEVRPGVGVPIFGPGVVLMLRALLDYQVVDVAR
FT                   VLGWTAAAAVALTALLVRGDAALRRRWYVPALILALIAPYPWGALNAADVLLDRTPAEV
FT                   HEVPVLHKHVSSGKHTSYDLRLPPWGPMAEAHEVDVGRELYGEVEVGDVVCTHLRPGAL
FT                   GARWFVVDLCD"
FT   gene            413711..414289
FT                   /locus_tag="AnaeK_0363"
FT   CDS_pept        413711..414289
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0363"
FT                   /product="intracellular protease, PfpI family"
FT                   /note="TIGRFAM: intracellular protease, PfpI family; PFAM:
FT                   ThiJ/PfpI domain protein; KEGG: ade:Adeh_0347 peptidase
FT                   C56, PfpI"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71605"
FT                   /db_xref="GOA:B4UAC5"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR006286"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:B4UAC5"
FT                   /protein_id="ACG71605.1"
FT                   /translation="MAKRILMLVGDYVEDYEVMVPFQALQAVGHTVHAACPGKKAGEKV
FT                   RTAIHDFEGDQTYSEKRGHDFTLNATFDEVRPQDYDALCVPGGRAPEYLRLDARVIEVV
FT                   RNFAEGAKPIAAICHGAQLLAAAGVVKGRLVSAYPACAPEVRLAGGEYAEIAIDKAAVD
FT                   RNLVTAPAWPAHPDWIAKFLQVLGTRIAA"
FT   gene            414396..414767
FT                   /locus_tag="AnaeK_0364"
FT   CDS_pept        414396..414767
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0364"
FT                   /product="transcriptional regulator, PadR-like family"
FT                   /note="PFAM: transcriptional regulator PadR family protein;
FT                   KEGG: mba:Mbar_A0520 transcriptional regulator, PadR
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71606"
FT                   /db_xref="InterPro:IPR005149"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B4UAC6"
FT                   /protein_id="ACG71606.1"
FT                   /translation="MKTPPRKAAASRTPFRRGRHAPAFVLLALSRKPSYGLEILEFLER
FT                   HLPGSGYDSAAVYRTLQALERQGAVAATRDPGGGAARKWYRITRDGGRMLDAFEEDVRR
FT                   RMAYLAFFLDYRGGGGEGR"
FT   gene            414764..415249
FT                   /locus_tag="AnaeK_0365"
FT   CDS_pept        414764..415249
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0365"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: amt:Amet_3237 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71607"
FT                   /db_xref="GOA:B4UAC7"
FT                   /db_xref="UniProtKB/TrEMBL:B4UAC7"
FT                   /protein_id="ACG71607.1"
FT                   /translation="MSASGLWLDGVALAALLLSLARDRRRTAAAVRAALVQLVRILPSV
FT                   AALILLVGLALAVVPQAAIARAIGPGSGVGGVAAALAIGSAAMLPSFVAFPLAGALREA
FT                   GAGYPQIAAFVGTVMSVGVVTLPLEARVLGWRAAALRNALALVTAMLFALAAVEVLG"
FT   gene            415246..415779
FT                   /locus_tag="AnaeK_0366"
FT   CDS_pept        415246..415779
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0366"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: amt:Amet_3236 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71608"
FT                   /db_xref="GOA:B4UAC8"
FT                   /db_xref="UniProtKB/TrEMBL:B4UAC8"
FT                   /protein_id="ACG71608.1"
FT                   /translation="MTRLLKAWRVPLAVAAAVALTAMASPSAGAAALRNAAGSTREMLG
FT                   LLPPVLLLIGLLEVWVPREVIVRNVGAGAGLRGVLIPLALGSVAAGPLYAAFPLAAVLL
FT                   AKGARPANVFFFLGVWSGAKLPILMFEAGVMGAPFTALHVGIGLLGAYAFALVIERLLC
FT                   PDGPGACAGVGAAP"
FT   sig_peptide     415246..415338
FT                   /locus_tag="AnaeK_0366"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.845 at
FT                   residue 31"
FT   gene            complement(415810..416433)
FT                   /locus_tag="AnaeK_0367"
FT   CDS_pept        complement(415810..416433)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0367"
FT                   /product="alpha/beta hydrolase fold"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG: ade:Adeh_0348
FT                   alpha/beta hydrolase fold-1"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71609"
FT                   /db_xref="GOA:B4UAC9"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B4UAC9"
FT                   /protein_id="ACG71609.1"
FT                   /translation="MPSLVFLPGAGGRGAFWAPVAERLADLGPSLRLDYPGFGGCPPDP
FT                   AIRSTGDLFAWVVARLPPGRSHVVAQSMGGALAVRLALEHPERVERLVLVATSGGVDLR
FT                   GTGAADWRPEYLASLPGVPRWFVDDRSDHTARLSDLAAPTLLLWSDADPVSPLAVGRLL
FT                   EARIPGARLRVFPGGTHAFAQEMPDEVAAEIRAHLAGAAAPSRP"
FT   gene            416780..417205
FT                   /locus_tag="AnaeK_0368"
FT   CDS_pept        416780..417205
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0368"
FT                   /product="ribosome-binding factor A"
FT                   /note="PFAM: ribosome-binding factor A; KEGG: ade:Adeh_0350
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71610"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR023799"
FT                   /db_xref="UniProtKB/TrEMBL:B4UAD0"
FT                   /protein_id="ACG71610.1"
FT                   /translation="MTHRSNRPGAPVRAPQPRPQDAAPGADSAALRVERLERILLALFG
FT                   SLVREEVTDPGLRGVDLVALRLSPDGAEARIGYDLEVPEGDGPAAEREAAEALARAAPF
FT                   LRARLGEVIALPDLERLSFARASVREAASAAQRAGAA"
FT   gene            complement(417265..418251)
FT                   /locus_tag="AnaeK_0369"
FT   CDS_pept        complement(417265..418251)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0369"
FT                   /product="conserved hypothetical protein"
FT                   /note="PFAM: conserved hypothetical protein; KEGG:
FT                   ade:Adeh_0351 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71611"
FT                   /db_xref="GOA:B4UAD1"
FT                   /db_xref="InterPro:IPR018383"
FT                   /db_xref="UniProtKB/TrEMBL:B4UAD1"
FT                   /protein_id="ACG71611.1"
FT                   /translation="MERSAPEPRTPSPRSIASFLVPALGLACVALPHVSPALALTAGAA
FT                   LALSTANPYAATTRALARRLLPLSVVALGGAMDLRVVAHVGARGVGYTFVSIAACLALG
FT                   ALLARAARVQARTAALISVGTAICGGSAIAAVAPVVGADEHETSIALGAVFLLNSAALL
FT                   VFPLVGHAAGLAEPAFGLWAALGIHDTSSVVGATLAYGPQALAVGTTVKLARALWIVPV
FT                   TLAIAIVARRARGGAAATAARPPWFILGFVAVAALATFLPALRPAGLLAAEAGRRALVL
FT                   TLFLVGLGLSRQALRSVGAGALAMAVALWLAVATATLAAVRSGLVHL"
FT   sig_peptide     complement(418132..418251)
FT                   /locus_tag="AnaeK_0369"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.942) with cleavage site probability 0.866 at
FT                   residue 40"
FT   gene            complement(418328..419251)
FT                   /locus_tag="AnaeK_0370"
FT   CDS_pept        complement(418328..419251)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0370"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: ade:Adeh_0352 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71612"
FT                   /db_xref="GOA:B4UAD2"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B4UAD2"
FT                   /protein_id="ACG71612.1"
FT                   /translation="MPRLDPRRLQSFREVALAGRISVAARTLHLSPSALSEQVRELERE
FT                   CGRPLLLRTAQGVQLTADGQRLLEHAQRVDEALRAAEASMDREAEEGGPLVLGASQTTA
FT                   AWVVPHLVAELRRARPGVAVRVEVGNTDAVLGWLAKGTVPLGLVEGLSRAPHVRLEPFA
FT                   QDEIVAAASSAAPAELLRLRRVADLDRVPIVWREVGSGTRAVVEKALRRAGVRRTRRNA
FT                   DLELGTNDAVKAAVQLGLGVGFLSRWAIRTELATGALRAIPLDGLRIERAFSWALPAGG
FT                   VSGIAGRFLREAQRLAAGTVRPAWFP"
FT   gene            419375..420157
FT                   /locus_tag="AnaeK_0371"
FT   CDS_pept        419375..420157
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0371"
FT                   /product="Beta-lactamase"
FT                   /EC_number="3.5.2.6"
FT                   /note="PFAM: beta-lactamase domain protein; KEGG:
FT                   ade:Adeh_0354 beta-lactamase"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71613"
FT                   /db_xref="GOA:B4UAD3"
FT                   /db_xref="InterPro:IPR001018"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:B4UAD3"
FT                   /protein_id="ACG71613.1"
FT                   /translation="MRMLLTVALAVLPFASLADAHGHGEAEVDLGQRVWVRPISREAWI
FT                   IRSVSPIDGFGDVESNAVLVAGAAESVLIDTPATEAQTAPVLAWAANTLRQPVRHLVVT
FT                   HWHADRMGGIVLARTNRIRTYALGKTRALARRHGLVVPERELRREERLVLAGVKLETWY
FT                   PGHGHTADNLVVWLPADALLVGGCFVKAADATTLGNLQEIDAVQWAKGAAAAARRYPQP
FT                   RTVVPGHGAAGGPELLRHTAELAQAYVAGRGRVGERGR"
FT   sig_peptide     419375..419431
FT                   /locus_tag="AnaeK_0371"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.567 at
FT                   residue 19"
FT   gene            complement(420324..424025)
FT                   /locus_tag="AnaeK_0372"
FT   CDS_pept        complement(420324..424025)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0372"
FT                   /product="signal transduction histidine kinase with CheB
FT                   and CheR activity"
FT                   /EC_number="3.1.1.61"
FT                   /EC_number="2.1.1.80"
FT                   /note="TIGRFAM: PAS sensor protein; PFAM: CheB
FT                   methylesterase; MCP methyltransferase CheR-type; response
FT                   regulator receiver; ATP-binding region ATPase domain
FT                   protein; histidine kinase A domain protein; PAS fold-4
FT                   domain protein; KEGG: ade:Adeh_3183 signal transduction
FT                   histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71614"
FT                   /db_xref="GOA:B4UAD4"
FT                   /db_xref="InterPro:IPR000673"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR000780"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR022641"
FT                   /db_xref="InterPro:IPR022642"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR035909"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B4UAD4"
FT                   /protein_id="ACG71614.1"
FT                   /translation="MIDEDAKVARDAQEHAWRAAEGQRLLVVGVGASAGGLEAFERFLA
FT                   RLPAASGLAYVLVQHLDPEHESLLAELLGRATDLPVTFAKDGEELRPDHVYVMPRDATL
FT                   LVDGARLHLVAAEARGVRQPINAFLTSLAENLRENAVGVVLSGTGSDGALGIAAVKRNG
FT                   GTTFAQLPADARYEGMPQAAIATGQVDRVLPVEELPAALAEYAARRWQQPGESVRGEAE
FT                   GLRELFELLARHTGHDFSRYKQSTILRRLHRRMEATGAATIRDYVALLARDEGESRRLT
FT                   DDLMINVTAFFRDVEPFHTLESVVIPDVLERQGGDGVRLWVPACASGEEAYSIAMLVRE
FT                   RLDRMRRPPKVQIFATDIDAAALAEARRGRYGVVVEKQVTPERLARFFVQRGDTYTVTR
FT                   DIRDLCIFTAHDLARDPPFSRMDLVCCRNLLIYLEPALQRHVLETLHYALRPGGYLLLG
FT                   RAEMIGSRELELFEVVEKSDRLFRRRDGDRRPAPLPRVDRDAPALPAGIAPLARRSGPD
FT                   VRSAAERSRKIVLEEYAPPSAVVDGRGEIRYLWGRNLALFLPPQPGPPATNVMHLVRPE
FT                   LKVGLGASLHGAARQPGPVVHRDLAVVVDGVEHRLDVVVRRLPPAEQDPDELFLVVFQE
FT                   VQAPAAARGTPLDTPTQEQYRRLQAELASSRERLQFTVDELENANEALRASNEQLQSMN
FT                   EELHSSNEELQTSQEELQSVNEELNTVNAELSKKIDELEVLNGDLHNLLQSTQIATVFL
FT                   DRQFRIARFTPEAMAVFRLADGDVGRPLSDFAARFDAEDVPREVARVLQSLEPVERTVR
FT                   TVEGARWYLMRMHPYRTPSNVIAGVVISFIDVTPLKEAEAALRDAVTERERAEAALRDA
FT                   DRRKDQFLAVLSHELRNPLAPIRNSLHLLERSPPGSEGARRAQKVIARQVGHLARLVDD
FT                   LLDATRVAHGKLQLQRERLDLAEVAQRAAEDHRELFASRGVRFDLELPDRPAWVDGDRI
FT                   RLSQAIGNLLLNAAKFTPRDGAVRLAVTVAEPRAEVRVKDTGVGIEPAMLPRLFQPFSQ
FT                   ADETLDRSAGGLGLGLALVKGLVEAHGGTVEARSAGHGTGTEFVLRLPLAPARADAPES
FT                   EPCAAPRHRRVLVVDDNVDGADSLRALLELDGHAVEVAHDGPHALELGRAFRPEVILCD
FT                   IGLPGMSGYDVARAMRQDGALAGAFLIALTGYTLPADQRRAAEAGFDLHVAKPPTVDTL
FT                   RAAIARAP"
FT   gene            424249..425346
FT                   /locus_tag="AnaeK_0373"
FT   CDS_pept        424249..425346
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0373"
FT                   /product="histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   KEGG: ade:Adeh_2444 histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71615"
FT                   /db_xref="GOA:B4UAD5"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B4UAD5"
FT                   /protein_id="ACG71615.1"
FT                   /translation="MLHDFLTQHRAALVERARAKVAARRVPAASNDELALGVPAFLAQV
FT                   IELLREEERAPAGAAARTSDAAANAAMGPSADRQGDAQLRAGLTVAQVVEGYGDVCQAI
FT                   AEHAAETATPISVEEYRTLNLCIDVATSRAVTAFSAARDRRTESAEVERLGVLAHEMRN
FT                   LLSKALLSYQALQRGAVGVDGATGKLLGGSLRELQALIDRSLSEVRLAAAIRNPERVSL
FT                   AEFIEDMEVGATLAAKEKGLVLEVPAVDRAVAVVADRPLLASAVGNLLQNAIKFTPPGG
FT                   RVTLSTGREAAGVLIHVADGCGGLAEGRAETMFRAFDRQASDHTGLGLGLKISHDAVKA
FT                   NGGALRVRDLPGIGCVFTVALPLGA"
FT   gene            complement(425374..426468)
FT                   /locus_tag="AnaeK_0374"
FT   CDS_pept        complement(425374..426468)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0374"
FT                   /product="Linoleoyl-CoA desaturase"
FT                   /EC_number="1.14.19.3"
FT                   /note="PFAM: fatty acid desaturase; KEGG: ade:Adeh_1021
FT                   linoleoyl-CoA desaturase"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71616"
FT                   /db_xref="GOA:B4UAD6"
FT                   /db_xref="InterPro:IPR005804"
FT                   /db_xref="InterPro:IPR012171"
FT                   /db_xref="UniProtKB/TrEMBL:B4UAD6"
FT                   /protein_id="ACG71616.1"
FT                   /translation="MTASTLRARFPRDDGFHADLKRGVAAHFARTGEPPQGGRAMHAKT
FT                   AVILGWFAVSYGLLLALGGASAWGAVGLTVSLALATAGIGFSVMHDANHGAYSRSPRVN
FT                   HAVGLTLDFIGASSYVWRFKHNVQHHTYANVAGLDADIDAEPFLRLSRAQRRRALHRFQ
FT                   GVYAWPLYGVLSLKWWLVDDAVDLVRGTIGGHAYPRPRGRELATVVAGKATFVGWTLIA
FT                   PLLVFRNAWPVAFFVLGSLVLGVVMAVVFQLAHAVPDAEFRSAPDADGRLPTGWAEHQV
FT                   RSTVDFARSSRVLAWYLGGLNFQIEHHLFPGVCHVHYPALAAIVEETCRGRGIPYRAQP
FT                   SLRAAVAAHHRHLRALGAPAPAEA"
FT   gene            complement(426650..427312)
FT                   /locus_tag="AnaeK_0375"
FT   CDS_pept        complement(426650..427312)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0375"
FT                   /product="ABC-type uncharacterized transport system
FT                   auxiliary component-like protein"
FT                   /note="KEGG: aeh:Mlg_1202 ABC-type uncharacterized
FT                   transport system auxiliary component-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71617"
FT                   /db_xref="InterPro:IPR005586"
FT                   /db_xref="UniProtKB/TrEMBL:B4UAD7"
FT                   /protein_id="ACG71617.1"
FT                   /translation="MSHAPPSRGAALAIALASLTACVSFGPSTPPTRFALQADFEGQPI
FT                   AGPGPALVVAVPTAAAGFDGPRIAYVRRAHELQFFARSEWVDAPARMLAPLLVQALERS
FT                   GGFQAVAGARTPAAAGLRLESELVRLQQEFTVRPSRVRLTLRVQLSDVASRRVLGTREL
FT                   EAVEEARSDDPYGGVEAANRAVRRLLDEVVAYCLEVSREASATRGPASGGPSRIGDR"
FT   sig_peptide     complement(427205..427312)
FT                   /locus_tag="AnaeK_0375"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.989) with cleavage site probability 0.760 at
FT                   residue 36"
FT   gene            complement(427314..428201)
FT                   /locus_tag="AnaeK_0376"
FT   CDS_pept        complement(427314..428201)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0376"
FT                   /product="Mammalian cell entry related domain protein"
FT                   /note="PFAM: Mammalian cell entry related domain protein;
FT                   KEGG: lpc:LPC_1531 ABC transport system periplasmic
FT                   substrate binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71618"
FT                   /db_xref="GOA:B4UAD8"
FT                   /db_xref="InterPro:IPR003399"
FT                   /db_xref="UniProtKB/TrEMBL:B4UAD8"
FT                   /protein_id="ACG71618.1"
FT                   /translation="MRAQPNLAVVGAFVVGLGAAAIVVGLWLAAGGFHLKRQERYIARF
FT                   EESVSGLGRGAPVSFRGVPVGSVRDLSLEPGDPARVRLVLEVAPGTPVTRDTVAVLAFQ
FT                   GLTGIASVELSGGGRGAPPLARAAGDPYPEIRTEPSMKSRLEAVVTALLGDLRQTTADV
FT                   RRVVASLAGRSEDIDTAIADAARSLHHVAEASARLSGVAARAGRGAHAVERAADEVKAV
FT                   GAAARAALADAGRAAQDASRTVRQLDGRSLAEIDRLVAELTEAAAALARVSRELERNRG
FT                   ALLGGQTPPPGPGE"
FT   sig_peptide     complement(428136..428201)
FT                   /locus_tag="AnaeK_0376"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.832) with cleavage site probability 0.425 at
FT                   residue 22"
FT   gene            complement(428198..428983)
FT                   /locus_tag="AnaeK_0377"
FT   CDS_pept        complement(428198..428983)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0377"
FT                   /product="ABC transporter-related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: ppw:PputW619_5086 ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71619"
FT                   /db_xref="GOA:B4UAD9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B4UAD9"
FT                   /protein_id="ACG71619.1"
FT                   /translation="MAPPVPSAPESVIAARDVHTRVGADVVHAGVTLDVRLGKIFALAG
FT                   PSGCGKTLLLREALALHAPDSGSIRVLGREVVGLGEAEALALRRRCGVVFERGALFSSL
FT                   TIAENVSLPLREHSRLGRRVRDELAALKIALVGLPAGAGTKYPSQLSGGMRRRAALARA
FT                   IALDPELLVLDEPSAGLDPASGRELEELVRHLNEVLGLTVLVVTRDLGLLWNLADHVAF
FT                   LAGGRIVAAGSMAEVSRSDEPLVRAYFPRARGAPPEARP"
FT   gene            complement(428987..430099)
FT                   /locus_tag="AnaeK_0378"
FT   CDS_pept        complement(428987..430099)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0378"
FT                   /product="protein of unknown function DUF140"
FT                   /note="PFAM: Sulfate transporter/antisigma-factor
FT                   antagonist STAS; protein of unknown function DUF140; KEGG:
FT                   aeh:Mlg_1205 protein of unknown function DUF140"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71620"
FT                   /db_xref="GOA:B4UAE0"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR030802"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:B4UAE0"
FT                   /protein_id="ACG71620.1"
FT                   /translation="MAIPDSPTVRVEGGAVHCSGAWTVHLVAGLDRALRRLAWPEHVAV
FT                   VIDASGVAAMDTAGAWLLRRAARDLERGGRPVTLTLRPEHEALLALVTSSGEVAPRRAR
FT                   ERARFLSELGRSAWSSALAIGGVLTLVGELAGRVARARAGPLRVRARQAVLHVQSAGFE
FT                   ALPTTALLSFFVGVVLASQGATLLRPFGAGILIADLVGLAMLRELSPLVTAIVVAGRSG
FT                   SAYAAQIGAMKMAGEIESLRAGGVSPVDALVVPRIAALALVVPLLTVAADVLGLAGATL
FT                   VARAELGMHAPEFLGRVAREVHASSYLLGVAKAPVFGVIVAAVGCHQGLRASDDAGSVG
FT                   RRTTGAVVQSMFLVVLADGLVLVVSRQLGI"
FT   gene            430253..430747
FT                   /locus_tag="AnaeK_0379"
FT   CDS_pept        430253..430747
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0379"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dol:Dole_2379 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71621"
FT                   /db_xref="GOA:B4UAE1"
FT                   /db_xref="InterPro:IPR019099"
FT                   /db_xref="UniProtKB/TrEMBL:B4UAE1"
FT                   /protein_id="ACG71621.1"
FT                   /translation="MPAAAHHPGLVTDWIPAWLPDGVGGVAGWMLQPIVLGVLGSTSVA
FT                   LFALTVVALPLILTRMPTDFFSRPERRRLELAERDRPFRFVILRGLKNALGGVLLLLGL
FT                   LMLIVPGQGLVTIFVALFLLDFPGKRRLQRWVISRPVVHRPVNALRRRAGRPALELPSR
FT                   A"
FT   gene            430986..431246
FT                   /locus_tag="AnaeK_0380"
FT   CDS_pept        430986..431246
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0380"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71622"
FT                   /db_xref="UniProtKB/TrEMBL:B4UAE2"
FT                   /protein_id="ACG71622.1"
FT                   /translation="MIRSDGLRPIVEAVDRGLSRLHARGGAPGDDAALFSAWAELVAFL
FT                   ALGPAPELRACPFCGSVGMRAATRCGACWSKLGPPPPSVRA"
FT   gene            431246..431599
FT                   /locus_tag="AnaeK_0381"
FT   CDS_pept        431246..431599
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0381"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ade:Adeh_4342 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71623"
FT                   /db_xref="GOA:B4UAE3"
FT                   /db_xref="InterPro:IPR032820"
FT                   /db_xref="UniProtKB/TrEMBL:B4UAE3"
FT                   /protein_id="ACG71623.1"
FT                   /translation="MPARHPARLGAPTAESERGLSSGAVAYRRAEPYMAAASTLMASVA
FT                   GFTMLGYGLDRWLGHTVHWLLLTGAVIGIVVGFIGFFTQVLRADADAKRLRSGTARGRA
FT                   PARDGSVPAEGRP"
FT   gene            431599..432039
FT                   /locus_tag="AnaeK_0382"
FT   CDS_pept        431599..432039
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0382"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rci:RRC32 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71624"
FT                   /db_xref="GOA:B4UAE4"
FT                   /db_xref="UniProtKB/TrEMBL:B4UAE4"
FT                   /protein_id="ACG71624.1"
FT                   /translation="MRVVHFQRTSDTGHVVPWCGVWGSTDTDWTTAWPGVTCVACRDAM
FT                   RAGLRGGEPSTRGSGSARSQAPGGRSSFALRYAVIALLTWMGAWALRAAGGVLLPPAGS
FT                   RAAAVALGITVGTLALGGAALAALAGMELALGPHRRGARVRG"
FT   gene            complement(432098..433048)
FT                   /locus_tag="AnaeK_0383"
FT   CDS_pept        complement(432098..433048)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0383"
FT                   /product="GAF domain protein"
FT                   /note="PFAM: GAF domain protein; KEGG: fre:Franean1_1241
FT                   putative PAS/PAC sensor protein"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71625"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="UniProtKB/TrEMBL:B4UAE5"
FT                   /protein_id="ACG71625.1"
FT                   /translation="MATPHIAHDDRRPEAHEGTPGAGMGLTPGHLARLLELSRALAGAC
FT                   EHTALAVIAAERARDLTGASWAQVIGLRDDGAAVVLAEASEAAAGSRLEPGGSRATGPA
FT                   PEHVLRAGEPLWLGSRAEAVERWPDLPLDVLAAGPHGAWAFLPLAADDETTGVLALAFD
FT                   RAQPFDAVTRTFLAEVAAACGAALARGSLFTRARARANASDAARAACELRQRRTDAQVV
FT                   HRTHLYERERFARARAEAETAAHAAPSAFLVEYEEIGVDGPVSRLLGVFSSEASARAAV
FT                   HQLDRARSLIIRASISAWTLDAIHPRTSVDIDLSP"
FT   gene            433421..433693
FT                   /locus_tag="AnaeK_0384"
FT   CDS_pept        433421..433693
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0384"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ade:Adeh_3889 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71626"
FT                   /db_xref="UniProtKB/TrEMBL:B4UAE6"
FT                   /protein_id="ACG71626.1"
FT                   /translation="MSRRWMERVRERVALLAPEWTGWARLAWCIRQRRVLAGSAGKVVW
FT                   VRGAELAWASWGARHGLFAIERMDGLPYLHAGPPSGTGPAVRERR"
FT   gene            complement(433849..433924)
FT                   /locus_tag="AnaeK_R0003"
FT                   /note="tRNA-Gly3"
FT   tRNA            complement(433849..433924)
FT                   /locus_tag="AnaeK_R0003"
FT                   /product="tRNA-Gly"
FT   gene            complement(434004..435980)
FT                   /locus_tag="AnaeK_0385"
FT   CDS_pept        complement(434004..435980)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0385"
FT                   /product="proprionate catabolism activator, Fis family"
FT                   /note="TIGRFAM: PAS sensor protein; propionate catabolism
FT                   operon regulatory protein PrpR; PFAM: sigma-54 factor
FT                   interaction domain-containing protein; helix-turn-helix
FT                   Fis-type; Propionate catabolism activator domain protein;
FT                   PAS fold domain protein; SMART: PAS domain containing
FT                   protein; AAA ATPase; KEGG: ade:Adeh_0357 sigma54 specific
FT                   transcriptional regulator with PAS sensor, fis family"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71627"
FT                   /db_xref="GOA:B4UAE7"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR010524"
FT                   /db_xref="InterPro:IPR012704"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:B4UAE7"
FT                   /protein_id="ACG71627.1"
FT                   /translation="MTPADRRPIVWAFSTSRLRHVFESVAPLMADVAEVRVFDKGFEEA
FT                   LQVARELRQSGEEVDAFVAAGTNGAYLRDHADVPVVVVTASTVDALQALVQARKLSRRI
FT                   GVVNFRRTVAGLEGVHLIDDTVIEQRPYVTPEEGQAAVDDLSARGFKVIVGPGPICSVA
FT                   ERSGLRAVLLYGQDSLEEAIRQAAEVARIARVEGSRRTHLQAMFQHLEVGMVAVDTEER
FT                   IQAINPALQRLLGVTAAEVHGRRLSAVAPELALGPVLEGGPPEVETVQRIGVSAAVVSR
FT                   FPLHEHGVLRGAVLTCQPAPMIQRLERGLRSTHRPPRFVARYALSGLVGESPAMDRLRE
FT                   LAGRYARTDATVLITGESGTGKEMVAQGIHGASRRRDRPFVAVNCAAFPETLLEAELFG
FT                   YEEGAFTGSRRGGRPGLFEAAHTGTLFLDEIGDVPVTLQTRLLRVLQERQVLRLGSNDP
FT                   TPVDVRVIAATHRDLRQAIARGEFREDLYYRLDILPLHLPPLRERGEADVELIASDLLK
FT                   RALLRHDAADAHRRALSTVLPRLRGHAWPGNVRELENVLERVAVLFADRDPRARVTEEE
FT                   LAAVMPEISDPSARAAAPAAPAVPAAPSALAAPIDLRLARAAQERALIERTVAECGGNQ
FT                   AEAARRLGIGRTTLYRKLGRVRA"
FT   gene            436285..438669
FT                   /locus_tag="AnaeK_0386"
FT   CDS_pept        436285..438669
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0386"
FT                   /product="3-hydroxyacyl-CoA dehydrogenase NAD-binding"
FT                   /note="PFAM: Enoyl-CoA hydratase/isomerase;
FT                   3-hydroxyacyl-CoA dehydrogenase domain protein;
FT                   3-hydroxyacyl-CoA dehydrogenase NAD-binding; KEGG:
FT                   ade:Adeh_0358 3-hydroxyacyl-CoA dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71628"
FT                   /db_xref="GOA:B4UAE8"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR006108"
FT                   /db_xref="InterPro:IPR006176"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B4UAE8"
FT                   /protein_id="ACG71628.1"
FT                   /translation="MDRIERVAVLGSGVMGSTIAAHLANAGFGVLLLDIVPKEPNADER
FT                   AAGLGLDSPAVRNRLATAARAGLEKLKPAPLYLPSYASRIDVGNLEDDLPRLASCDWVV
FT                   EVVLENLEVKRQLLGRIAPHLKPTAVLTTNTSGLSVNAIADTLPEALRPRFLVTHFFNP
FT                   PRYMRLVEIVSSRHTDPAIAAGMAELIRVRLGKGIVTGKDTPNFVANRIGVFAMCNAIR
FT                   HMVELDLTVEEVDAIAGPPTARPKSATFRTADLVGLDTLLHVAKNSYDLLPGDSRRDEF
FT                   KLPAFLEQMVAKGILGNKSRGGFFRKEKGEGGGLSIYDHRKGEYVPAAKPRSAAVEATK
FT                   GIDDPVQRLRTALAGKDKAAEHAWRNLRDTLLYAFERIPEIADDVVNVDAAMRWGFGWD
FT                   LGPFEMLDAIGVPAFVARAAQDGVAVPERLRGIERFYAEEDGRRRFLDLAGGGYRDVPR
FT                   PADQIDLAVLEKSGAVVERNAGASVLDLGDGVFCLEFHTKMNAIGPDVLAMVHKAVARA
FT                   ERDGQGLVIANRGQPAFSAGANLMLIAVAIAEGAFDEIALTIRAFQKAMMALKYARVPV
FT                   VAAPHGLALGGGCEVCLHATAMNPLAETYMGLVEIGVGLLPAGGGTKEMALRAIRLAEK
FT                   YEIDASPFVFKHFNTVALAKVSASADELVAMGMLREGDAVTLSPDRLVHDAKQKALALA
FT                   ANFRPGTPATGLRAPGRGAAASIASQLWNMRMGGFITEYEEQLGRTIAGVMTGGDVPAG
FT                   TPVSEQDLLDLEREAFLKLCGERKTLERIQHMLKKGKPLRN"
FT   sig_peptide     436285..436365
FT                   /locus_tag="AnaeK_0386"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.809) with cleavage site probability 0.508 at
FT                   residue 27"
FT   gene            438714..439886
FT                   /locus_tag="AnaeK_0387"
FT   CDS_pept        438714..439886
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0387"
FT                   /product="acetyl-CoA acetyltransferase"
FT                   /note="TIGRFAM: acetyl-CoA acetyltransferase; PFAM:
FT                   Thiolase; KEGG: ade:Adeh_0359 3-ketoacyl-CoA thiolase"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71629"
FT                   /db_xref="GOA:B4UAE9"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020610"
FT                   /db_xref="InterPro:IPR020613"
FT                   /db_xref="InterPro:IPR020615"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:B4UAE9"
FT                   /protein_id="ACG71629.1"
FT                   /translation="MSAAYVLAAVRTPGCKAKKGKLKDVRPDDLAAVAIRALLARTGVD
FT                   PGQVEDVILGCAFPEGEQGMNLGRVAALRAGLPVGVPGQTVNRFCASGLQTIATAAERI
FT                   MAGQADCIVAGGAESMSLVPMGGSHFSANPALVASWPESFAAMGITAELVAARDQVSRE
FT                   DQDAFAVQSHARAARAQAEGLFADELVPVEVEQVTLEKGKPVRRTEQVTADDGVRPGTT
FT                   QEALAKLKPAFKLDGTVTAGNASQTTDGAAAALVVSEAFLTRTGLAPLARFVSYAVRGV
FT                   PPEIMGIGPVEAIPAALKRAGLRLEDVGQIELNEAFAAQSLACVRALGLDPERVNPTGG
FT                   AIALGHPLGCTGAKLTATLLHGLRRTGARHGIVSMCVGGGMGAAAVFERA"
FT   gene            439930..441705
FT                   /locus_tag="AnaeK_0388"
FT   CDS_pept        439930..441705
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0388"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain protein;
FT                   Acyl-CoA dehydrogenase type 2 domain; KEGG: ade:Adeh_0360
FT                   butyryl-CoA dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71630"
FT                   /db_xref="GOA:B4UAF0"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:B4UAF0"
FT                   /protein_id="ACG71630.1"
FT                   /translation="MARLFKGAEYLISEATKDDVFTPEDFTEEQRQIADTAEQFAETEA
FT                   LPAEHALEQHEPGVAAALMRKAGDAGLLMIDAPEAYGGLALDKATSMLAAERMGMGGAF
FT                   SVSYAAHTGIGTLPLVYYGTDAQKDRYLTKLVTGEWAAAYCLTEPEAGSDAMGGKAIAT
FT                   LSPDGKHYLLDGTKQFITNGSFANLFTVFAKVDRKHFTAFLVERTFPGVTVGPEEKKLG
FT                   IKGSSTTSVIFESAKVPVENVLGEIGKGHKIAFNVLNVGRFKLGAAVTGAAKLALATGA
FT                   AYANARKQFGTPIARFGAIREKLADQAAGVYASESLIYRLAGLIDDRLATIPAEQPGYY
FT                   EAYQQGIEEYAIECAIAKVFCSEVLADVVDEVVQIHGGYGFIQEYPAEKYYRDERINRI
FT                   FEGTNEINRLLVPGTILRRALKGELPLQREVMKAMDALMNPSLDEVDPAVPFAAEKATV
FT                   ANLKRAFLVVAGAAVQKYGEALKDEQEVLLALADVAIQAFAAESVVLRAEKTAATQPEA
FT                   RRALAAAAVKVHTFAAAEKAATAARRAAFYVGEGDTLTILLGGIRRFSKYDAAGLLQAK
FT                   RRLADAVLESEKYPF"
FT   gene            441940..442635
FT                   /locus_tag="AnaeK_0389"
FT   CDS_pept        441940..442635
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0389"
FT                   /product="oxidoreductase molybdopterin binding"
FT                   /note="PFAM: oxidoreductase molybdopterin binding; KEGG:
FT                   ade:Adeh_0361 molybdopterin-binding oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71631"
FT                   /db_xref="GOA:B4UAF1"
FT                   /db_xref="InterPro:IPR000572"
FT                   /db_xref="InterPro:IPR036374"
FT                   /db_xref="UniProtKB/TrEMBL:B4UAF1"
FT                   /protein_id="ACG71631.1"
FT                   /translation="MDDQQRRIAEGVALLRARFGEKMKATPSLADASPQGDGPANRHGM
FT                   PKEPPGQNVFEKHEWPVMDLGTGTPDVAPERWRLAVDGAVEAPLELSYADLLALPQVDE
FT                   EADFHCVTGWSILDVAFRGVRLETVLALARPTASATHLMAHSADGYSTNLPLEEALKPD
FT                   VLLVHAVEGKPVTREHGGPVRIVVPQLYAWKGAKWVTRLELMTQDRRGYWEIRGYSNTA
FT                   HPWRDDRTW"
FT   gene            complement(442661..443044)
FT                   /locus_tag="AnaeK_0390"
FT   CDS_pept        complement(442661..443044)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0390"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ade:Adeh_0362 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71632"
FT                   /db_xref="InterPro:IPR027392"
FT                   /db_xref="UniProtKB/TrEMBL:B4UAY4"
FT                   /protein_id="ACG71632.1"
FT                   /translation="MDCPRCSVELNEIAHEDSAVQRCAECGGIWVGDAADLNKVLLHAN
FT                   LPALSALGGYVNADEISGMCPACNVDLVVVEGGEKRALAYDTCESCGGIWVDGTEDEPA
FT                   AELDWKGATAQIVAFFKAFAKKK"
FT   gene            complement(443157..443822)
FT                   /locus_tag="AnaeK_0391"
FT   CDS_pept        complement(443157..443822)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0391"
FT                   /product="ATP phosphoribosyltransferase"
FT                   /EC_number="2.4.2.17"
FT                   /note="TIGRFAM: ATP phosphoribosyltransferase; PFAM: ATP
FT                   phosphoribosyltransferase catalytic region; KEGG:
FT                   ade:Adeh_0363 ATP phosphoribosyltransferase
FT                   (homohexameric)"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71633"
FT                   /db_xref="GOA:B4UAY5"
FT                   /db_xref="InterPro:IPR001348"
FT                   /db_xref="InterPro:IPR013820"
FT                   /db_xref="InterPro:IPR018198"
FT                   /db_xref="InterPro:IPR024893"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4UAY5"
FT                   /protein_id="ACG71633.1"
FT                   /translation="MPGTSELITVAVPKGRLLQESSALFERALGVSPRKLLEGTRKLAA
FT                   DAPEAGLRFISIRAGDVASYVEHGAAEVGIVGLDVLREEPRDLYEPLDLGIGRCTVIVA
FT                   RPKGARPLPRGVAPRVATKYLSLAARHFAAKGVPAEIIPLHGSIEVAPSLGLADTIVDI
FT                   TETGETLRANGLVIEEKVLEVSARLVVNRVALKLHPERLRRLIEALRAAVAAAGAEAR"
FT   gene            complement(443822..445090)
FT                   /locus_tag="AnaeK_0392"
FT   CDS_pept        complement(443822..445090)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0392"
FT                   /product="UDP-N-acetylglucosamine
FT                   1-carboxyvinyltransferase"
FT                   /note="TIGRFAM: UDP-N-acetylglucosamine
FT                   1-carboxyvinyltransferase; PFAM: EPSP synthase
FT                   (3-phosphoshikimate 1-carboxyvinyltransferase); KEGG:
FT                   ade:Adeh_0364 UDP-N-acetylglucosamine
FT                   1-carboxyvinyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71634"
FT                   /db_xref="GOA:B4UAY6"
FT                   /db_xref="InterPro:IPR001986"
FT                   /db_xref="InterPro:IPR005750"
FT                   /db_xref="InterPro:IPR013792"
FT                   /db_xref="InterPro:IPR036968"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4UAY6"
FT                   /protein_id="ACG71634.1"
FT                   /translation="MDKIVIEGGVPLRGSVDVSGAKNAALPVIAAALLAEGEHEVRNVP
FT                   DLADVRTLGKLLGHMGCEVARGEGDRRTVRLRVPAAVAPEAPYELVKTMRASVLVLGPL
FT                   LARLGRARVSLPGGCAIGARPIDQHLKALTALGAEIRIEHGYVNATVPRGRLRGTVFTF
FT                   DAQTVTGTENVMMAAALAEGETVLRNCAREPEVKDLGDALVAMGALVEGAGTDEIWIEG
FT                   VPSLRPLSHAVIPDRIEAGTFLVAGALPGNDVTVRGCVAAHQEALVEKLRAVGAEVTKV
FT                   EGGLRVVGDGRPRPVDVRTAPHPGFPTDMQAQLMVLLCLADGTSRITETVFENRFMHVQ
FT                   ELIRLGAHVEVDGRVAMVKGVPELSGAPVMASDLRASAALVLAGLAASGTTEVLRVYHL
FT                   DRGYERIEEKLAPLGARIRRVRG"
FT   gene            complement(445170..446030)
FT                   /locus_tag="AnaeK_0393"
FT   CDS_pept        complement(445170..446030)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0393"
FT                   /product="protein-(glutamine-N5) methyltransferase, release
FT                   factor-specific"
FT                   /note="TIGRFAM: modification methylase, HemK family;
FT                   protein-(glutamine-N5) methyltransferase, release
FT                   factor-specific; PFAM: methyltransferase small; Protein of
FT                   unknown function methylase putative; KEGG: ade:Adeh_0365
FT                   modification methylase, HemK family"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71635"
FT                   /db_xref="GOA:B4UAY7"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR004556"
FT                   /db_xref="InterPro:IPR007848"
FT                   /db_xref="InterPro:IPR019874"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR040758"
FT                   /db_xref="UniProtKB/TrEMBL:B4UAY7"
FT                   /protein_id="ACG71635.1"
FT                   /translation="MSEGEAWTTLRLLAWTQEFFGRKGVDAPRLTAELLLAHALRCERM
FT                   RLYLDFDRPLGEPELAAFRELVRRRAEGEPTAYLTGRRDFYGRPFLVDARVLVPRPETE
FT                   LVLEAARDALPEGGAALDLCTGSGALGVSLALERPGARVVATDLSADALAVAAENARAL
FT                   GAAVDLRQGDLWAPLREGERFDVIVSNPPYVPRGELDTLPREVRREPRLALDGGPDGLS
FT                   LLRRIVEGAPTRLVPGGTLVLEMHEGHLELLPRLCRDAGFERAEARRDLAGLPRLTVAR
FT                   LPGAA"
FT   gene            complement(446027..447139)
FT                   /locus_tag="AnaeK_0394"
FT   CDS_pept        complement(446027..447139)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0394"
FT                   /product="peptide chain release factor 1"
FT                   /note="TIGRFAM: peptide chain release factor 1; PFAM: Class
FT                   I peptide chain release factor; PCRF domain protein; KEGG:
FT                   ade:Adeh_0366 bacterial peptide chain release factor 1
FT                   (bRF-1)"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71636"
FT                   /db_xref="GOA:B4UAY8"
FT                   /db_xref="InterPro:IPR000352"
FT                   /db_xref="InterPro:IPR004373"
FT                   /db_xref="InterPro:IPR005139"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4UAY8"
FT                   /protein_id="ACG71636.1"
FT                   /translation="MLSPDVLKKLEAIEQRFEELTQLLSDPAVAGNGDRFRKVAKERAS
FT                   IEQTVTALRAYRKLLEDVEGNEALLADKDPELRELAKEELAQLRPQVEPAEEQLKLYLV
FT                   PKDPNDEKDVIVEIRAGAGGDEAGLFAAEVMRMYVRYAERRGWRVELMDTSGGALGGVK
FT                   EATLTVSGDAVYSSLKYESGVHRVQRVPATEAQGRIHTSTVTVAVMPEAEEIDVQVNPA
FT                   DVEMDVFRSTGSGGQSVNTTDSAVRLTHKPTGIVVKCQQEKSQLKNRTMAMKMLRAKLF
FT                   EIEQERQRSARDATRKSQVGTGDRSEKIRTYNFPQDRLTDHRVNYTRHNLPAVMDGDVQ
FT                   DVIDACRTFYAAQALREASRGEAGAAERRA"
FT   gene            447351..448880
FT                   /locus_tag="AnaeK_0395"
FT   CDS_pept        447351..448880
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0395"
FT                   /product="multi-sensor signal transduction histidine
FT                   kinase"
FT                   /note="TIGRFAM: PAS sensor protein; PFAM: ATP-binding
FT                   region ATPase domain protein; histidine kinase A domain
FT                   protein; PAS fold-3 domain protein; PAS fold-4 domain
FT                   protein; PAS fold domain protein; SMART: PAS domain
FT                   containing protein; PAC repeat-containing protein; KEGG:
FT                   ade:Adeh_0367 multi-sensor signal transduction histidine
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71637"
FT                   /db_xref="GOA:B4UAY9"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR025201"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B4UAY9"
FT                   /protein_id="ACG71637.1"
FT                   /translation="MDMRPPLRIPPPPALRRAPAYAVSASLAVAGAALAAAGAEHLARA
FT                   PFVPVIPFVLLSAWLGGVGPGIFAALLSALGVNLVLLGPASGWSFGARELTATGAFVAL
FT                   SALLVAAVGAIRDGFVERAARERAVRESEERFRTLVETIPQLVFTLAPDGTPDFHSPQF
FT                   QAYTGLDNEAIRAAGWEAQFHPDDRARARADWAAGFAARRTVSGEYRLRGHDGGYRWFL
FT                   VSAVPLREAGGRVVKWFGTFTDIEAQKEVERHKSEAIAARDVFLSVASHELKTPVTAAL
FT                   LQTQQALRTLDRDPPDAGRARGQVASAAGSVERLGRLVEALLDVSRLATGRAALERRRF
FT                   DLSDAVRQAAARLAEPAARAGSALELEVEAGIACEGDRLRIEQVLTNLASNALKFGAGR
FT                   PVTIALRREGGRAVLRVRDRGIGIPATDLERIFGRFERAHEARHYGGLGLGLWIAREIV
FT                   EASGGTIGAESTPGEGATFTVALPLAPADPERAGAPGAAVSPAAPAPRRAP"
FT   sig_peptide     447351..447458
FT                   /locus_tag="AnaeK_0395"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.997) with cleavage site probability 0.962 at
FT                   residue 36"
FT   gene            complement(448843..449424)
FT                   /locus_tag="AnaeK_0396"
FT   CDS_pept        complement(448843..449424)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0396"
FT                   /product="transcriptional regulator, ArsR family"
FT                   /note="PFAM: regulatory protein ArsR; KEGG: ade:Adeh_0368
FT                   regulatory protein, ArsR"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71638"
FT                   /db_xref="GOA:B4UAZ0"
FT                   /db_xref="InterPro:IPR026282"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B4UAZ0"
FT                   /protein_id="ACG71638.1"
FT                   /translation="MTAAAQRAAAPTSHALQKADLAVADAVGALMELWGFRRQLGRIWA
FT                   VLFLSDRPLAAPDLCDRLQISTGLLSMSLAELRRWGVVRTVEVPGDRKEHFEAETNVWK
FT                   LVARVLREREKRAVEQALAAFERALGEVRGALADVDPAVKAQARFKVRRLEVLSDLARA
FT                   ALTVLKLLVDSSRADVGPIKALSEALARRD"
FT   gene            complement(449438..450298)
FT                   /locus_tag="AnaeK_0397"
FT   CDS_pept        complement(449438..450298)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0397"
FT                   /product="4-hydroxybenzoate polyprenyltransferase"
FT                   /note="TIGRFAM: 4-hydroxybenzoate polyprenyltransferase;
FT                   PFAM: UbiA prenyltransferase; KEGG: ade:Adeh_0369
FT                   4-hydroxybenzoate polyprenyltransferase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71639"
FT                   /db_xref="GOA:B4UAZ1"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR006371"
FT                   /db_xref="InterPro:IPR039653"
FT                   /db_xref="UniProtKB/TrEMBL:B4UAZ1"
FT                   /protein_id="ACG71639.1"
FT                   /translation="MTVAALARMVKLSHSLFALPFAAAAVALVAAEARLDLARLALVAL
FT                   AVVAARTAAMAMNRIADRAFDARNPRTQRRELVTGEVSAAAAWALLAGSSAAFVVAAAL
FT                   ISPICGALALPVLAILLGYSYAKRFTWACHLWLGVAQALAPVGVAIALTGTAPLASVVL
FT                   GLGVGAWIAGFDVFYSMQDMDYDRGAGLRSIPARFGVAGALRWARGLHLLAAAAIFAAG
FT                   ALAGRGAGWITGSVILAATLAAEHRYVAPGGALRPERINVAFFNYNAFASIAFALCALA
FT                   DLALR"
FT   sig_peptide     complement(450206..450298)
FT                   /locus_tag="AnaeK_0397"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.995) with cleavage site probability 0.887 at
FT                   residue 31"
FT   gene            complement(450295..451533)
FT                   /locus_tag="AnaeK_0398"
FT   CDS_pept        complement(450295..451533)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0398"
FT                   /product="amidohydrolase"
FT                   /note="PFAM: amidohydrolase; KEGG: ade:Adeh_0370
FT                   amidohydrolase 1"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71640"
FT                   /db_xref="GOA:B4UAZ2"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:B4UAZ2"
FT                   /protein_id="ACG71640.1"
FT                   /translation="MIRVVAAPWVLPGLAPGAPAASAPAIADGAVALEGDRVRAVGPRA
FT                   EVEARFGPGERLDAVLLPALVNAHLHLELSHMKGWVAGGEGLPGWIQLFVAARRRTREG
FT                   EPEEAMGMAAEDLVRAGVAAVGDISNTLDSLAPLAAAGLGGTIFHEVFGFTPERFEEAR
FT                   AAARQVREAAAPPPGLRVVESPHAIYSTNAAALRALLRGGPGSLHLAEDPAERAFCATE
FT                   SAGPFGRMYATLGAALHALRITGRSPVDAVKAELRPHHLAVHCVDLDDEDVRVLAATGA
FT                   TVVLCPRSNRYILGALPRLEALLAAGIPLAVGTDSLASAPSLAPLAELALLRREVAAVA
FT                   AARLLPLAWNGAALAAPHVGRLAPGAAPGVVAAPLEGARPPDPAEWLVSTFGAEERPFT
FT                   WLARQRPGPERPE"
FT   sig_peptide     complement(451450..451533)
FT                   /locus_tag="AnaeK_0398"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.978) with cleavage site probability 0.749 at
FT                   residue 28"
FT   gene            complement(451530..453410)
FT                   /locus_tag="AnaeK_0399"
FT   CDS_pept        complement(451530..453410)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0399"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: protein of unknown function DUF178; Radical
FT                   SAM domain protein; KEGG: ade:Adeh_0371 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71641"
FT                   /db_xref="GOA:B4UAZ3"
FT                   /db_xref="InterPro:IPR003773"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR020050"
FT                   /db_xref="InterPro:IPR022431"
FT                   /db_xref="InterPro:IPR030868"
FT                   /db_xref="InterPro:IPR034405"
FT                   /db_xref="UniProtKB/TrEMBL:B4UAZ3"
FT                   /protein_id="ACG71641.1"
FT                   /translation="MPKKIRAAAVSFLNAWPLTAGLEGSERIELVLAEPSRCAAMLEAG
FT                   EVDLALVSVAALTKGQYDIVPGIAIGADGPVQTVVLAGEQSPAIWDEVFLDTASRTSHV
FT                   LAKLVLDAMGVHPRFTPMHADEGLARARGTKGALVIGDRGFGVRANHVLDLGREWTRLT
FT                   GLPMIFALWAARPGAVTPEDVQELTRAAQHGLGIRTELAQKFAAQKGGDPEKYRRYLTQ
FT                   KIRYGLGPYELQGLEAFLERAAAKGFLPPMPLRFVDDVVRTRRVRRAVSVDTALQKGAD
FT                   GERLDADEAATLDEKAPLLELGLAADQRRRALHPGDLVTYIVSRNVNYTNVCTTACHFC
FT                   AFYRPRGHQESYVLTREELTQKIDETVALGGIEILLQGGLHPDLGVEWYEDLFRWVKQT
FT                   WPVINLHALSPEEIWHIARTSELGLEATIDRLVAAGMDSIPGGGAEILDDEVRRRIAPL
FT                   KCSTDEWLTVMKAAHLKGLKSTATMMFGVGEGPEHRVAHLMRLRELQDETHGFTAFICW
FT                   PFQSQNTRLEPGDGSAHAYLRTNALSRLVLDNVPNLQASWVTMGGGVAQAALHMGCNDF
FT                   GQVMIEENVVSAAGTTFKMDSEEVERHIRDAGFRAARRNMKYQLVEETRA"
FT   sig_peptide     complement(453348..453410)
FT                   /locus_tag="AnaeK_0399"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.747) with cleavage site probability 0.383 at
FT                   residue 21"
FT   gene            complement(453425..454591)
FT                   /locus_tag="AnaeK_0400"
FT   CDS_pept        complement(453425..454591)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0400"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: Radical SAM domain protein; SMART: Elongator
FT                   protein 3/MiaB/NifB; KEGG: ade:Adeh_0372 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71642"
FT                   /db_xref="GOA:B4UAZ4"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR020050"
FT                   /db_xref="InterPro:IPR022432"
FT                   /db_xref="InterPro:IPR034405"
FT                   /db_xref="UniProtKB/TrEMBL:B4UAZ4"
FT                   /protein_id="ACG71642.1"
FT                   /translation="MLSTLANRALERDGLGPIRDKVLAGERLTDEDGLKLFEASDLPAL
FT                   GALANHVREARHGALAFYNRNVHLNPTNVCVASCKFCSFARKDDQRASDGYTMSIDEAV
FT                   GKVLSRKPLGVTEVHIVSGLHPDLPFEYYTELLSRIRAGWPEVAIKAFTAIEIHFFAEK
FT                   FGMSYEQVLRRLMDAGLQTMPGGGAEIFAPRVRRKICDDKATADQWIEIHRTAHRLGVK
FT                   TNSTMLYGHIERLDERVDHMRRLRALQDETHGFQVFIPLAFHPEHNMIGKAFPKPTGYD
FT                   ALRTLAVARLYLDNFDHVKAYWVSLGERLAQTALSFGVDDLDGTVLEERIYHMAGSTVP
FT                   QALSERTLHQLIRAAGRVPAERDSLYRVLKVHDAPLPEEPPARLQVTA"
FT   gene            complement(454593..455180)
FT                   /locus_tag="AnaeK_0401"
FT   CDS_pept        complement(454593..455180)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0401"
FT                   /product="3-octaprenyl-4-hydroxybenzoate carboxy-lyase"
FT                   /note="TIGRFAM: 3-octaprenyl-4-hydroxybenzoate
FT                   carboxy-lyase; PFAM: flavoprotein; KEGG: ade:Adeh_0373
FT                   3-octaprenyl-4-hydroxybenzoate carboxy-lyase"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71643"
FT                   /db_xref="GOA:B4UAZ5"
FT                   /db_xref="InterPro:IPR003382"
FT                   /db_xref="InterPro:IPR004507"
FT                   /db_xref="InterPro:IPR036551"
FT                   /db_xref="UniProtKB/TrEMBL:B4UAZ5"
FT                   /protein_id="ACG71643.1"
FT                   /translation="MKLVVAVSGASGAPYARRLLDFLAANADLGVSADLVFTQTGKQVW
FT                   KQEIGAEPRYPFKIWKNQDFTAPFASGSSMYDAMVVIPCSAGALARIAYGISVDLVGRA
FT                   ADVMLKERKRLVLVLRETPISLVHARAMTQVIEAGAFVMPASPSFYSGPRTVDQVVDTV
FT                   VARVLDRLGIPNELMKRWDGISPRAPEPVEEP"
FT   gene            complement(455177..455884)
FT                   /locus_tag="AnaeK_0402"
FT   CDS_pept        complement(455177..455884)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0402"
FT                   /product="ubiquinone/menaquinone biosynthesis
FT                   methyltransferase"
FT                   /note="TIGRFAM: ubiquinone/menaquinone biosynthesis
FT                   methyltransferase; PFAM: UbiE/COQ5 methyltransferase;
FT                   Methyltransferase type 11; Methyltransferase type 12; KEGG:
FT                   ade:Adeh_0374 demethylmenaquinone methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71644"
FT                   /db_xref="GOA:B4UAZ6"
FT                   /db_xref="InterPro:IPR004033"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B4UAZ6"
FT                   /protein_id="ACG71644.1"
FT                   /translation="MNVNVPLPGEAHRGSAVRAMFDRIAPRYDLLNRVMTLKVDQAWRR
FT                   RLLSDLAPKDGERMLDLCAGTMDVADLARRRAPGLRVTGADFSMQMLRRGVEKTALPAS
FT                   QADAMALPFLDARFDLATVTFGMRNLERYEVGLAELARVLRPGGRLGVLEFFRSESRGS
FT                   RLVHGAYNRLALPVLGRILSPDPEAYRYLVASMERFASRVEFEDAARRAGFREVRGETL
FT                   FPGVCGLVTAVRA"
FT   gene            complement(455881..457395)
FT                   /locus_tag="AnaeK_0403"
FT   CDS_pept        complement(455881..457395)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0403"
FT                   /product="UbiD family decarboxylase"
FT                   /note="TIGRFAM: UbiD family decarboxylase; PFAM:
FT                   Carboxylyase-related protein; KEGG: ade:Adeh_0375
FT                   3-octaprenyl-4hydroxybenzoate decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71645"
FT                   /db_xref="GOA:B4UAZ7"
FT                   /db_xref="InterPro:IPR002830"
FT                   /db_xref="InterPro:IPR022390"
FT                   /db_xref="UniProtKB/TrEMBL:B4UAZ7"
FT                   /protein_id="ACG71645.1"
FT                   /translation="MAYRSLREFLARLDEAGELVRITEPVDPVLEMAALADRAAKQGGP
FT                   ALLFDRPGTLPVAMNLFGTRRRTSWALSCDDFEQHADELRALLRTAPPQSFWDKLKMLP
FT                   KLGKLAAMAPKHVSSGACQDIVDREPDLGTLPVLTTWPHDGGPFVTLPQVITRDPETGI
FT                   RNVGMYRLQVLGPRRLALHWQLHKTATAHYRAYQQRGERMPVAIALGGDPALTYCASAP
FT                   LPPNVDEYLFAGFLRGSSVHTVTGVATGLDVPADADLVIEGFVDTAAPLVREGPFGDHT
FT                   GFYSLADDYPALDVVAITRRKDAVYPATVVGPPPVEDQWLGKATERMFLPLMQIVAPEI
FT                   VDICMPVEGVFHNLCLVSIKKEHPGQAKKVIHGLWGSGQMAQTKTLVVFDDDVDVQDVP
FT                   QAAWRAFANVDVKRDLVIADGPVDVLDHAAGGFAYGGKIGVDATRKWREEGGREWPEVC
FT                   VHPPEVIARMDALYDRLVPGAAPLRRPRIAPPPAASWTPRRGGILQ"
FT   gene            457548..457823
FT                   /locus_tag="AnaeK_0404"
FT   CDS_pept        457548..457823
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0404"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ade:Adeh_0376 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71646"
FT                   /db_xref="UniProtKB/TrEMBL:B4UAZ8"
FT                   /protein_id="ACG71646.1"
FT                   /translation="MERRNRARDLIVLALTELDGELSTNQHRLCPEQLGTCRSRLQGYL
FT                   SALDGDALPPKRDRAEDLGRLILDSWPYDVPLGQVILRAERAWRNA"
FT   gene            complement(457852..460581)
FT                   /locus_tag="AnaeK_0405"
FT   CDS_pept        complement(457852..460581)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0405"
FT                   /product="peptidase M16 domain protein"
FT                   /note="PFAM: peptidase M16 domain protein; KEGG:
FT                   ade:Adeh_0377 peptidase M16-like"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71647"
FT                   /db_xref="GOA:B4UAZ9"
FT                   /db_xref="InterPro:IPR007863"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="InterPro:IPR011765"
FT                   /db_xref="UniProtKB/TrEMBL:B4UAZ9"
FT                   /protein_id="ACG71647.1"
FT                   /translation="MRARVAALVPLLLASCALGRPRLSTPACATGAEALPSGIQLVAYA
FT                   LPHRPDTLVAASYRVGSARDPAGKEGLAHLVEHLSFRAHRGGGRALSAQLEAEGVEFDG
FT                   RTSADATDFHAVGDPEQLDALLRIEADRLRDPLAGVDEAELRREREVVLQELALRGDPD
FT                   ALWPQVDWLTARALAGHPYGRIATPGSLRAITLEDVRAFARAHYRPENLLLIVAGPAPA
FT                   EAVAARARAALGELATRPGQAADPPVPPPELGAARPAALDVVRAPVERAWLLLTVPLPG
FT                   DAAAGGARAYLALRALEAQVEQVLSGPDRERALSVELLVHGMDGASLPVIRIGLRGPDD
FT                   ARPLVERLRAGLRFAGWQGGPDPGGEELRDRLVLDAHVRLEALDASEVARWIRLTGRTD
FT                   YLTGMPAAVGAAVTPDRAEFARRWLREERLVALAVVPGEAPRDDAPPRLPGASALDDDD
FT                   PHGAAAAGEPAPARDAARAMRPPHLDSARRRKLKNGVRVIVSPRPGYRVLSAHLVVRTE
FT                   PAGPLERVFEVLALRSARCADRPATVGGDRLEFGARAPTELVDLALAQVACRAGDLRVD
FT                   AAAFERERDAMADALRRRPPTLHEAAGQQLLELLYPGHPYSAEVTEARVRAFRAADAGK
FT                   WLGLNVRPERAALVIAGDVAATDALFERIEQRLGRWRPRGGDGKLPPRPPAPLPGRREL
FT                   VVVDRPGWRVAEVLVGVRVPPRGARDEAAFRTLSWRLQHALTARLRDDAGLTYRVSLSI
FT                   LEQSLGSALVLSTAVDRARAGEALAAMLGELAASARPLEPEALAQARWRAVRRAGRGLG
FT                   TSWRNALRLTEMFVHGLPPDEWDTFAARTASLDARALVAEAGRWALGREAIVVVGDAAA
FT                   IAPALQDAGVPARVLPAIARRLPPGAAQPLPGPRAAVP"
FT   sig_peptide     complement(460522..460581)
FT                   /locus_tag="AnaeK_0405"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.990) with cleavage site probability 0.702 at
FT                   residue 20"
FT   gene            complement(460956..462005)
FT                   /locus_tag="AnaeK_0406"
FT   CDS_pept        complement(460956..462005)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0406"
FT                   /product="Polyprenyl synthetase"
FT                   /note="PFAM: Polyprenyl synthetase; KEGG: ade:Adeh_0378
FT                   farnesyltranstransferase"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71648"
FT                   /db_xref="GOA:B4UB00"
FT                   /db_xref="InterPro:IPR000092"
FT                   /db_xref="InterPro:IPR008949"
FT                   /db_xref="InterPro:IPR033749"
FT                   /db_xref="UniProtKB/TrEMBL:B4UB00"
FT                   /protein_id="ACG71648.1"
FT                   /translation="MAAQEQAILSQLDASAQRGVRPERAQAALAGVPSLPESLLELEAQ
FT                   LTRATEDAEAKLQAAARHLVSAGGKRIRPMVTLLACGACGGEMRGAVPYAVAAELTHSA
FT                   TLLHDDVIDDGPVRRGQPASRVIWGNAVSVLSGDWLLTRALEIVSAEPARSAALPPLLA
FT                   TMRRLVEGEVLQLSLRGGFSATEQAYMDVVMGKTASLFGWAAAAGAWAAGEVGEIPAAL
FT                   VRFGEGIGVAFQLVDDALDYAADPRLLGKRLGTDLIEGKATLPLIRACEAEPALRERLG
FT                   GVVDGTADVETVAGEVIAVVKRVGGVDAARALAREHTRTALEALEQVPDGVHRRALHAA
FT                   ALQLTERAF"
FT   gene            complement(462103..463632)
FT                   /locus_tag="AnaeK_0407"
FT   CDS_pept        complement(462103..463632)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0407"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ade:Adeh_0379 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71649"
FT                   /db_xref="GOA:B4UB01"
FT                   /db_xref="InterPro:IPR038731"
FT                   /db_xref="UniProtKB/TrEMBL:B4UB01"
FT                   /protein_id="ACG71649.1"
FT                   /translation="MDPTQRARRPLVDAPRALAALAFALHAACGGRYGIFRDELYFVAC
FT                   GRRLAAGYVDQPPGIAVVARLASELFGTWVPGLRLPAWLASAATVLLAGRLAARLGAGA
FT                   AGAALASAATLACGVLLALGHYLTMNAFEPLLVLALALLLVRLADGGDPRLWVAAGAVA
FT                   GLAALFKYTSALVALALLAGVAATSARRALRTRWALAGAAVGLLAVLPNLAWQLAHGLP
FT                   FLELVRNGQLHKNAPTSPSAFALALLRDANPLLAPLWLGGLGWLVGRPGAPGARALGIG
FT                   AALYLALLAATGGKPYYAAPVLPLLLAAGGAAAARLLRRPALRLAAPALTVLSVAPALP
FT                   LALPLLPEPAFVRWQAALGVEPERMERTTYGVLPQIFADQHGWRELVRGVGEAAATLAP
FT                   AERATAAVFGQNYGEAAAVDVYGADLGLPPAISGHNQYWLWGVPPGRGDPILVISDADE
FT                   DCGGAFRERVLAARLPSSPWVMPYEDARWIWICRGLRRPLAGLWPALRSYQ"
FT   gene            complement(463690..464952)
FT                   /locus_tag="AnaeK_0408"
FT   CDS_pept        complement(463690..464952)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0408"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ade:Adeh_0380 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71650"
FT                   /db_xref="UniProtKB/TrEMBL:B4UB02"
FT                   /protein_id="ACG71650.1"
FT                   /translation="MRTAPVSAVVVLRPVALLAVALAVAALLARCGSGGDGGGATPPPG
FT                   DGGPNPPPAPPPGAPGWAVAAAERFEATLPDGAFAPDPVPDDGPFSDGGAFFASRSVTP
FT                   PAAFRASTPAGAGGWFTIESYTRRAGASTHELAEVVQDPADPSNHALRITSRAHTDATV
FT                   LRPSAPLPARYRVSVRVGFPSFGDGVAGGPNGYDGPADAGPWWPGEDATRQNGFYWLTI
FT                   LDRLPRPHVNTWIHHHRKVVVDSDNHYPPWMEIWDGGRFVWSGEHPVMLFALDGTQPGT
FT                   ERTGPPFLSFSNGAWQPSGAIRAVDAYLPDTWYRLTIERDGPRYTIEVSGRFRYGGEQT
FT                   YRATIDAAAACVFHYPVDAAEAAGAARCVDEGAFASVGPAYPRWPAGGAWPDWFMLGDP
FT                   HVNYYEGSVLYDDLVLETWRE"
FT   sig_peptide     complement(464875..464952)
FT                   /locus_tag="AnaeK_0408"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.954) with cleavage site probability 0.712 at
FT                   residue 26"
FT   gene            465008..465745
FT                   /locus_tag="AnaeK_0409"
FT   CDS_pept        465008..465745
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0409"
FT                   /product="tRNA pseudouridine synthase A"
FT                   /EC_number="5.4.99.12"
FT                   /note="TIGRFAM: tRNA pseudouridine synthase A; PFAM: tRNA
FT                   pseudouridine synthase; KEGG: ade:Adeh_0381 tRNA
FT                   pseudouridine synthase A"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71651"
FT                   /db_xref="GOA:B4UB03"
FT                   /db_xref="InterPro:IPR001406"
FT                   /db_xref="InterPro:IPR020095"
FT                   /db_xref="InterPro:IPR020097"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/TrEMBL:B4UB03"
FT                   /protein_id="ACG71651.1"
FT                   /translation="MPVVKLVLEYDGTAYVGWQVQPNGPSIQAEVERALATLHKAPRRV
FT                   TAAGRTDAGVHARGQVVSFPEDRPLPVKAYVMGMNALLPPDVAVRAASLEPDGFDARRS
FT                   ARGKRYRYVIENLPTRAPLTRLQAWQHFHPLELASVREAAAHLVGRHDFAAFQASDCAC
FT                   EHAVREVRRLDVLGEAGGRIEVVIEATAFVKHMVRNIVGTLVEVGRGRRAPGSMLDLLA
FT                   RGDRTEAGPTAPPQGLFLEEVFY"
FT   gene            465855..466943
FT                   /locus_tag="AnaeK_0410"
FT   CDS_pept        465855..466943
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0410"
FT                   /product="aspartate-semialdehyde dehydrogenase"
FT                   /EC_number="1.2.1.11"
FT                   /note="TIGRFAM: aspartate-semialdehyde dehydrogenase; PFAM:
FT                   Semialdehyde dehydrogenase NAD - binding; Semialdehyde
FT                   dehydrogenase dimerisation region; KEGG: ade:Adeh_0382
FT                   aspartate-semialdehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71652"
FT                   /db_xref="GOA:B4UB04"
FT                   /db_xref="InterPro:IPR000534"
FT                   /db_xref="InterPro:IPR005676"
FT                   /db_xref="InterPro:IPR012280"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B4UB04"
FT                   /protein_id="ACG71652.1"
FT                   /translation="MSQKKLKVGVLGATGMVGQRFVALLEHHPWYEVTLVAASANSAGQ
FT                   KYADAVKGRWALRSALPAATAGLTVKNASDVAAIAGEVDFVFCAVDMPKDETARLEEDY
FT                   AKHETPVVSNNSAHRGTPDVPMMVPEINPEHAAVIEAQRKRLGTSRGFVAVKPNCSLQS
FT                   YVPAIHPLMKFGPKRIAVATYQAISGAGKTFESWPEMVDNLIPFIKGEEEKSEKEPMKI
FT                   WGRVEGGRIVAAQDPVISAQCIRVPASDGHMAAVFVSFERKPSRDDVLELWKSFSGKPQ
FT                   KLGLPSAPKPFLQYFEDESRPQTRLDRDAGNGMAVTIGRLRPDAIFDYRFVCLSHNTVR
FT                   GAAGGAVLTAELLTSDGYIQAK"
FT   gene            467112..467555
FT                   /locus_tag="AnaeK_0411"
FT   CDS_pept        467112..467555
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0411"
FT                   /product="hemerythrin-like metal-binding protein"
FT                   /note="TIGRFAM: hemerythrin-like metal-binding protein;
FT                   PFAM: Hemerythrin HHE cation binding domain protein; KEGG:
FT                   ade:Adeh_0383 hemerythrin-like, metal-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71653"
FT                   /db_xref="GOA:B4UB05"
FT                   /db_xref="InterPro:IPR012312"
FT                   /db_xref="InterPro:IPR012827"
FT                   /db_xref="InterPro:IPR016131"
FT                   /db_xref="InterPro:IPR035938"
FT                   /db_xref="UniProtKB/TrEMBL:B4UB05"
FT                   /protein_id="ACG71653.1"
FT                   /translation="MRFVDASQIPELPLPFMNEDHAEEVRLLEGLGEALEAHRARTGGL
FT                   ETVLERLSLLAVHTREHFLREEQVMRETGFPAYPQHKGEHDRVLAEMDGEARAFREGGD
FT                   PVRLRGYLFETVPAWFVQHIRTMDAMTARFVVSRPGAPGAAAV"
FT   gene            complement(467563..468405)
FT                   /locus_tag="AnaeK_0412"
FT   CDS_pept        complement(467563..468405)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0412"
FT                   /product="Water Stress and Hypersensitive response domain
FT                   protein"
FT                   /note="SMART: Water Stress and Hypersensitive response
FT                   domain protein; KEGG: ade:Adeh_0384 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71654"
FT                   /db_xref="GOA:B4UB06"
FT                   /db_xref="InterPro:IPR004864"
FT                   /db_xref="InterPro:IPR013990"
FT                   /db_xref="UniProtKB/TrEMBL:B4UB06"
FT                   /protein_id="ACG71654.1"
FT                   /translation="MRPLGHAALAALAALLALAVACGGRAARTPPLAVDPPAFRPEALL
FT                   PTGADAYGVALALSGRIENPNPVALPVAGFTYAFEVMGAAAGGGQVASDLVLPAGGALP
FT                   VTVPVRLRWADVPGFLEALATRPSVPVTVSGAARVRAGDGTVAAPYRIDGSVVLPRLPT
FT                   VTLADAVVRESTLFHTVVELRMSVRNPNPFPLPTGRLSYDLRVSGVPVIQAAKSALDAV
FT                   PPQGQATVVVPVRFSTVGAAAGALAGAARGRADLSMSGRAGYGALEVGVDLRGALAAR"
FT   sig_peptide     complement(468322..468405)
FT                   /locus_tag="AnaeK_0412"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.636 at
FT                   residue 28"
FT   gene            complement(468538..471150)
FT                   /locus_tag="AnaeK_0413"
FT   CDS_pept        complement(468538..471150)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0413"
FT                   /product="ATP-dependent chaperone ClpB"
FT                   /note="TIGRFAM: ATP-dependent chaperone ClpB; PFAM: AAA
FT                   ATPase central domain protein; Clp domain protein; ATPase
FT                   associated with various cellular activities AAA_5; ATPase
FT                   AAA-2 domain protein; SMART: AAA ATPase; KEGG:
FT                   ade:Adeh_0385 AAA ATPase, ClpA/B"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71655"
FT                   /db_xref="GOA:B4UB07"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004176"
FT                   /db_xref="InterPro:IPR017730"
FT                   /db_xref="InterPro:IPR018368"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028299"
FT                   /db_xref="InterPro:IPR036628"
FT                   /db_xref="InterPro:IPR041546"
FT                   /db_xref="UniProtKB/TrEMBL:B4UB07"
FT                   /protein_id="ACG71655.1"
FT                   /translation="MRMEKLTVKAQEVLAAAQGEARRRDHQAVDVEHLVLALLAQEEGI
FT                   ARPVLEKIGADPRLVASRVEDELRSLPKVSGAEPYPANRLLKLFDRAEDGARKLKDEYV
FT                   STEHLLLAAAEDKGGAGDALRASGATPDRVRQAVQEVRGGARVTSPEAESQYRALEKYA
FT                   KDLTDLARKGKLDPVIGRDDEIRRVVQILSRRTKNNPVLVGDPGVGKTAIVEGLARRIV
FT                   DGDVPEGLKNKRLLALDLGALLAGAKFRGEFEERLKAVLKEVTGSEGQIILFIDEMHTI
FT                   VGAGAAEGAMDAGNMLKPALARGELHAVGATTVNEYRKHIEKDPALERRFQPVFVGEPS
FT                   LTDTISILRGLKDRYELHHKVRIQDAALVEAARLSSRYITDRFLPDKAIDLVDEAASRL
FT                   RIEIDSMPTEVDEVRRRIGQLEIERQGLRKEQDEASRARLAAVEKELAARNEEFTALKG
FT                   RWDAEKAVIQELSQARQELETLKVEQAAAERQADFQKAAEIKFGRLPELTRRVKAAEEK
FT                   LAEAQTRGAMLKEEVTPEEIGEVVSKWTGIPVSRLMEGEVEKLLGMEQRLHERVVGQEE
FT                   AVSAVSAAVRRARSGLQDPNRPIGSFIFLGPTGVGKTETARALAQFLFDDERAMVRLDM
FT                   SEYMEKHTVSRLIGAPPGYVGYEEGGQLTEAVRRRPYAVVLFDEIEKAHHDVFNVLLQI
FT                   LDDGRLTDGQGRTVDFRNTVIIMTSNIGSADIQRLAGRPGADMQQIREAALEHLRGEFR
FT                   PEFLNRVDEIVVFRPLGREDVGRIVEIQLARLRKLIEERHVTLELTEAAREAIADAGYD
FT                   PVYGARPLKRAIQRMVQDPLATRLLQGEFKAGDHVVVDEGKDGNIVFRKGERPEVTVH"
FT   gene            471360..472805
FT                   /locus_tag="AnaeK_0414"
FT   CDS_pept        471360..472805
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0414"
FT                   /product="peptidase S1 and S6 chymotrypsin/Hap"
FT                   /note="PFAM: peptidase S1 and S6 chymotrypsin/Hap;
FT                   PDZ/DHR/GLGF domain protein; KEGG: ade:Adeh_0386 peptidase
FT                   S1 and S6, chymotrypsin/Hap"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71656"
FT                   /db_xref="GOA:B4UB08"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR001940"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="InterPro:IPR041489"
FT                   /db_xref="UniProtKB/TrEMBL:B4UB08"
FT                   /protein_id="ACG71656.1"
FT                   /translation="MASGGQGWKAMALAAALGVLGAPGAAGAGPKAAPPAQAPPKAKGP
FT                   AGTGILRALDAALGEVIEKISPAVVQVTVSGYAPADETASGAIVRQRVLGSGVVVDPDG
FT                   YIVTNAHVVAGAQRVRILLPEGRGPAAHTARRIYDARVIGVEPEIDLALLKIDARNLPV
FT                   LALGRREVRPGQLVFAVGSPEGLASTVTMGVVSSVARQPDPARPVVYIQTDAPINPGNS
FT                   GGPLVDTDGNVVGINTFILTQGGGSEGLGFAIPSDVVKYVYESLRRHGRVEHSMIGLAA
FT                   QAITPGLAAGLRLSQDWGVVVGDVAPGSPAEKAGVLAGDIIVSVDGRPIDGMPSLAPAI
FT                   YLHPADAPLALALRRGEDVLSVKVAGVEPRRPAERLAEVADLARSTVPRLGVVAMDLDA
FT                   QARAAMPELRSPAGVVVVARVPEAGQAGAALEPGDVIHAVNRTPVASLAALKAAVAALP
FT                   PGGPGVLRVERRGQLSWIELDLD"
FT   sig_peptide     471360..471446
FT                   /locus_tag="AnaeK_0414"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.814 at
FT                   residue 29"
FT   gene            472885..474021
FT                   /locus_tag="AnaeK_0415"
FT   CDS_pept        472885..474021
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0415"
FT                   /product="3-Oxoacyl-(acyl-carrier-protein (ACP)) synthase
FT                   III domain protein"
FT                   /note="PFAM: chalcone and stilbene synthase domain protein;
FT                   FAE1/Type III polyketide synthase-like protein;
FT                   3-Oxoacyl-[acyl-carrier-protein (ACP)] synthase III domain
FT                   protein; KEGG: ade:Adeh_0387 chalcone/stilbene
FT                   synthase-like"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71657"
FT                   /db_xref="GOA:B4UB09"
FT                   /db_xref="InterPro:IPR001099"
FT                   /db_xref="InterPro:IPR011141"
FT                   /db_xref="InterPro:IPR012328"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="UniProtKB/TrEMBL:B4UB09"
FT                   /protein_id="ACG71657.1"
FT                   /translation="MQRAPRPRIRWASPRRSPVPSTSPNPEVLSVGRALPATVADQETL
FT                   IAALSAHWGEAHFNTGRLAELHRATGVARRHLALPLEAYSRLGGFGEANAAYAQAGAEL
FT                   GEAAVRDALERAGLGPSDVGHLFYVTVTGVATPSLDARLVNRMALPRSVKRTPIFGLGC
FT                   LAGAAGLARASDALRAFPDEVAVLLSVELCSLTLQRDDTSMANVVATGLFGDGAAAVVL
FT                   GGGARPASARPRGPEVVATASVLYPDTEWVMGWEVVDGGFKVLLSSKVPDVIAANLGAD
FT                   VDRFLGAHGLDRGRIRHWVAHTGGPKVLEAVGAALGLPRAALERSWRSLHDIGNLSSAS
FT                   VLFVLGDLLDSGEARAGDLGLLAAMGPGFAAELVLLRW"
FT   gene            474015..474317
FT                   /locus_tag="AnaeK_0416"
FT   CDS_pept        474015..474317
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0416"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ade:Adeh_0388 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71658"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/TrEMBL:B4UB10"
FT                   /protein_id="ACG71658.1"
FT                   /translation="MVSARDVGQAAGDDAEGRVAQEIVRIARAELRLDGAHAALAAGRD
FT                   APLVDALDSLARLSLVVAVEDRFRIALDDEAGLAVRTLGDLARLVVARTAPELLP"
FT   gene            474314..476074
FT                   /locus_tag="AnaeK_0417"
FT   CDS_pept        474314..476074
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0417"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /note="PFAM: AMP-dependent synthetase and ligase; KEGG:
FT                   ade:Adeh_0389 AMP-dependent synthetase and ligase"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71659"
FT                   /db_xref="GOA:B4UB11"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR040097"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:B4UB11"
FT                   /protein_id="ACG71659.1"
FT                   /translation="MRLRGPPQPPPRHATLAHALAAAAAHPSGATFLDLHERETFLPWS
FT                   EVRARAERAAANLVHLGIRRGDRVAIVLRTEPAFLDAFFGAWLAGAVPVPLYPPVRLGR
FT                   LDAYAVDTGRMIQVAGARLVVSAGGTRRLLGGAVERGGPELGCVDVSALSALPARIARE
FT                   PEPDALGLVQFSSGTTVDPKPVALTHRALAAMTDALVAATSAGPDDVLVSWLPLYHDMG
FT                   LIGCLLAAMSYPGPLVLIPPEHFLTRPALWLRALARRRGTISAAPSFAYAYAADRVQDA
FT                   DLAGLSLATVRLLLDGAEPVSAVALRRFAERFRPHGLDPRALVPVYGLSEAALAVTFAR
FT                   PGGPLGGLGVDAARLASDGVVAPGGREVMPVGTPVPGVEVELRGEAGVRVGEGRVGRVF
FT                   VRGPALMREYLGDPEATARALRGGWLDTGDLGFVVDGALHLHGRARDLVIVRGANHAPE
FT                   EFEAPLAALPGLRPGCAVALGFEPEGGAGEALLVLAERARDEGTPDAELEARVRRAVLA
FT                   ATGIAPHTVRLLAPGTLPRTSSGKLRRAEALRRFQAGTLTPPQPVSALRLALAAARSQL
FT                   AFGRSRRRGG"
FT   gene            476078..477172
FT                   /locus_tag="AnaeK_0418"
FT   CDS_pept        476078..477172
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0418"
FT                   /product="monooxygenase FAD-binding"
FT                   /note="PFAM: monooxygenase FAD-binding; HI0933 family
FT                   protein; FAD dependent oxidoreductase; KEGG: ade:Adeh_0390
FT                   FAD-binding monooxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71660"
FT                   /db_xref="GOA:B4UB12"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B4UB12"
FT                   /protein_id="ACG71660.1"
FT                   /translation="MARLRDAVVVGGGPAGLAFAAAAAARGLDVLVLERRRGPVDKACG
FT                   EGILPAGVAALERLGVRARLGPAQARPLRELRWVDASGAAARLVLPGPGGLGVRRVALE
FT                   AALRGRAREAGAELREGAEVTEHRVLADRVRVALAGGEAAEGRVLVAADGLGSPTRRRA
FT                   GLERPVRAPERFGVRRHVDVPDAGDAVEVHFGDGVEAYVTPVGPRQVGVAFLFERGAAR
FT                   SFEALIGRFPALAARLEGAAFASPARGAGPLARAARARVADRLVLLGDAGGYLDAVTGE
FT                   GLSLAFGCALDLAALLPRALARGATPRDLAAYEGAWRRRYGPYARWTRLVLALARHPAL
FT                   RRRVIALAAAAPRPFERAVAAAVG"
FT   sig_peptide     476078..476155
FT                   /locus_tag="AnaeK_0418"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.994) with cleavage site probability 0.551 at
FT                   residue 26"
FT   gene            477340..478305
FT                   /locus_tag="AnaeK_0419"
FT   CDS_pept        477340..478305
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0419"
FT                   /product="Curli production assembly/transport component
FT                   CsgG"
FT                   /note="PFAM: Curli production assembly/transport component
FT                   CsgG; KEGG: ade:Adeh_0391 curli production
FT                   assembly/transport component CsgG"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71661"
FT                   /db_xref="GOA:B4UB13"
FT                   /db_xref="InterPro:IPR005534"
FT                   /db_xref="UniProtKB/TrEMBL:B4UB13"
FT                   /protein_id="ACG71661.1"
FT                   /translation="MRIRFALPAAALALQACATVSQPPVEVESPVPKAAQVAAQQQAQA
FT                   PAPSAKRYKTRIAIARFTNETSYGRSLLNDADLDRIGKQASDMLASRLVMSGSFVVLER
FT                   PDLQKLEREQALRGVAGLVGADTVISGSVTEFGRSVGGKKGFLSSTKVQTARAKVDIRL
FT                   VDVKTGHAYFSALGAGEASTESGEIAGFGSRAEYDATLNDRAIAAAISDVIDRLVSTLA
FT                   ARPWRSDILEVQGRQVFISGGRHQGVREGDVLAVMEAGNTVKSRQTGFEVALPPKRVGT
FT                   IKVLSLFGDGETSEGAVCEVTSGAIEKAALPKLFVAEATP"
FT   sig_peptide     477340..477396
FT                   /locus_tag="AnaeK_0419"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.489 at
FT                   residue 19"
FT   gene            478314..478616
FT                   /locus_tag="AnaeK_0420"
FT   CDS_pept        478314..478616
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0420"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ade:Adeh_0392 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71662"
FT                   /db_xref="UniProtKB/TrEMBL:B4UB14"
FT                   /protein_id="ACG71662.1"
FT                   /translation="MRNVVFAAAAAALVAGCAMPQTVVKTIESRPSLAVAGAPAGAVLV
FT                   VDGQPVGDASAYDGNPTVLRVEPGTHQVEIRDPSGAAVYRQTVFVESELKTVRVH"
FT   sig_peptide     478314..478388
FT                   /locus_tag="AnaeK_0420"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.995) with cleavage site probability 0.345 at
FT                   residue 25"
FT   gene            478616..479098
FT                   /locus_tag="AnaeK_0421"
FT   CDS_pept        478616..479098
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0421"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ade:Adeh_0393 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71663"
FT                   /db_xref="InterPro:IPR014508"
FT                   /db_xref="UniProtKB/TrEMBL:B4UB15"
FT                   /protein_id="ACG71663.1"
FT                   /translation="MRASLRAVLVLAATAALLQGCAGRTLYRWGAYDDALYAHYKNPQD
FT                   REAFVERLRVVIDEADQAGEKVPPGCYAEYGYALYEEARYEDASRYFKLEREKWPESGV
FT                   LMQKMIGLADRRGGKEPAAPAPAKPASAPPKATRAPAKAPAKAAATHGPAGALERR"
FT   sig_peptide     478616..478684
FT                   /locus_tag="AnaeK_0421"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.950) with cleavage site probability 0.455 at
FT                   residue 23"
FT   gene            479101..479775
FT                   /locus_tag="AnaeK_0422"
FT   CDS_pept        479101..479775
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0422"
FT                   /product="protein of unknown function DUF799"
FT                   /note="PFAM: protein of unknown function DUF799; KEGG:
FT                   ade:Adeh_0394 lipoprotein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71664"
FT                   /db_xref="InterPro:IPR008517"
FT                   /db_xref="UniProtKB/TrEMBL:B4UB16"
FT                   /protein_id="ACG71664.1"
FT                   /translation="MERLASVAGRIASLAALAALLSACGTAQVKKDYGAFNTARPRAIL
FT                   VVPVVNKSVEIDAPEYFLSTLPVPVAERGYYVFPVNLVKRVLEDDGLADASLVHGADPV
FT                   RLCSLFGADAVLLASIEKWEAKYMVVTTQVNVEFEYVLKDGKTGQTLWTERRSMSYQPG
FT                   NSGGGLIGALVNAAVTKASPNYMPLARQANAQAFAWPGPGFPAGPYRAEYGQDVQVVAA
FT                   QR"
FT   sig_peptide     479101..479190
FT                   /locus_tag="AnaeK_0422"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.995) with cleavage site probability 0.439 at
FT                   residue 30"
FT   gene            479833..480561
FT                   /locus_tag="AnaeK_0423"
FT   CDS_pept        479833..480561
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0423"
FT                   /product="Tetratricopeptide TPR_4"
FT                   /note="PFAM: Tetratricopeptide TPR_4; KEGG: ade:Adeh_0395
FT                   tetratricopeptide repeat protein"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71665"
FT                   /db_xref="GOA:B4UB17"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="UniProtKB/TrEMBL:B4UB17"
FT                   /protein_id="ACG71665.1"
FT                   /translation="MSKLLLFYLLVQLTGSPLGALALLLAVWWATDRMTVGVLPDPLRG
FT                   VARWRRRLQLARALEVNPHDRRARLELADLLLAGRRPARAAQVLRPNVEAGDEDAHTAF
FT                   LMGAALGRSGQAEPAERALAVARAADPDFRAGEIDLELGRQRLGRGDAAGAREALERLL
FT                   VERPGSVEGRLWLARALDKLGDQDGARRRREEGWREYVSLPRFHRKHERPFAWRLQPWR
FT                   PAAVALGVVLVLAAVAAAAG"
FT   sig_peptide     479833..479901
FT                   /locus_tag="AnaeK_0423"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.902) with cleavage site probability 0.743 at
FT                   residue 23"
FT   gene            480679..481677
FT                   /locus_tag="AnaeK_0424"
FT   CDS_pept        480679..481677
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0424"
FT                   /product="Glycerol-3-phosphate dehydrogenase (NAD(P)(+))"
FT                   /EC_number="1.1.1.94"
FT                   /note="PFAM: NAD-dependent glycerol-3-phosphate
FT                   dehydrogenase domain protein; 3-hydroxyacyl-CoA
FT                   dehydrogenase NAD-binding; Ketopantoate reductase ApbA/PanE
FT                   domain protein; KEGG: ade:Adeh_0396 glycerol-3-phosphate
FT                   dehydrogenase (NAD(P)+)"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71666"
FT                   /db_xref="GOA:B4UB18"
FT                   /db_xref="InterPro:IPR006109"
FT                   /db_xref="InterPro:IPR006168"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR011128"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4UB18"
FT                   /protein_id="ACG71666.1"
FT                   /translation="MRATVLGAGSWGTALASLLAGKGYTVTSWDKDAAVLDDIARNHRN
FT                   ERYLPGLQLPPTLHASGEVAKALEGAELVVLAVPSHAVRPVVIEAKRHVHAGTPIVCVA
FT                   KGIELDTLMTMTEVVEDVLPVPLHPYLAVLSGPSFAKEVAKGLPTAVTVAARWERIAKQ
FT                   VQDAFHTKTFRPYTSGDVVGCEVGGCVKNVVAIAAGISDGMGFGANAMAALVTRGLAEI
FT                   TRLAVRKGANPLTLSGLAGLGDLVLTCSSDLSRNRTVGRGLAAGKTADAIQRELGQVAE
FT                   GVRNARSARELAKRLGVDMPITEAIYRVLYEGLAPREAVTALMMRETKPEL"
FT   sig_peptide     480679..480741
FT                   /locus_tag="AnaeK_0424"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.808) with cleavage site probability 0.260 at
FT                   residue 21"
FT   gene            481789..483735
FT                   /locus_tag="AnaeK_0425"
FT   CDS_pept        481789..483735
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0425"
FT                   /product="Thimet oligopeptidase"
FT                   /EC_number="3.4.24.15"
FT                   /note="PFAM: peptidase M3A and M3B thimet/oligopeptidase F;
FT                   KEGG: ade:Adeh_0397 thimet oligopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71667"
FT                   /db_xref="GOA:B4UB19"
FT                   /db_xref="InterPro:IPR001567"
FT                   /db_xref="InterPro:IPR024077"
FT                   /db_xref="UniProtKB/TrEMBL:B4UB19"
FT                   /protein_id="ACG71667.1"
FT                   /translation="MSEPLRPEASRELTGTPLAFTEGCRRDMDRARAEAARARALGPAG
FT                   GLATLEAFDAAFAALSEAASRASLARNVHPDPALRDAAEAAEREVDALSTELSLDRGLY
FT                   DALAGLDPSGLDAATRHLVEKSLRDFRRAGVDRDDATRARVKALREELVRVGQEFGRNI
FT                   KDDVRRLEVEPAALDGLPEDWRRAHAPGPNGRVTLTTDNTDYVPFLTYARSAAAREALW
FT                   RLYRLRGHPRNLEVLSRMLARRADLARLLGYPSWAAYVTEDKMIGSEGAAADFIERIAG
FT                   AAEARMRRDHAQLLERKREDSPGADRVDPWDSAWLQERVKAERYGFDSQSVRPYFEYQR
FT                   VKQGVLDVTGRIFGIAYRRAPDAPVWHPEVEAWDVIEDGALLGRVYLDMHPRDGKYKHY
FT                   AQFTLASGQAGRRLPEGVLVCNFPRPAAGAPALMEHGDVRTFFHEFGHLLHHVLGGHTR
FT                   WAGQSGVATEWDFVEAPSQMLEEWVWDPEVLATFARHVETGEPIPAELVARMKAADEYG
FT                   KGLMVRQQMFYAATSLELHRRDPAALDTTALVAELQERYTPFRHVPGTYFHESFGHLDG
FT                   YSAIYYTYMWSLVIAKDLLGPFREAGLLDPAPARRYRRAVLEPGGSKPAADLVKDFLGR
FT                   PHAFDAFAAWLEA"
FT   gene            483782..484759
FT                   /locus_tag="AnaeK_0426"
FT   CDS_pept        483782..484759
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0426"
FT                   /product="oxidoreductase FAD/NAD(P)-binding domain protein"
FT                   /note="PFAM: oxidoreductase FAD/NAD(P)-binding domain
FT                   protein; KEGG: ade:Adeh_0398 FAD/NAD(P)-binding
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71668"
FT                   /db_xref="GOA:B4UB20"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:B4UB20"
FT                   /protein_id="ACG71668.1"
FT                   /translation="MAGRRRPAYVLSMSEPALETRAVRTAVPPEGEPVRAEVPRRRIKD
FT                   LEVMVADVIEETADTTTLVLFTGNDRLDYLAGHFLTIDPRQFPALERWVAYLEDLKGKR
FT                   EAPRAYSLASAPHERYLAITVKEETYQSGRTRYPPLLSPMLVRRTPRGSRFVITGFTGP
FT                   YVLPPRVEEKTDHLVHVVAGSGSVPNWSILKHALREHPRLRHTFVYSNRTWDDVIYRDG
FT                   LRQLAAEHPDRLRVVHTLTREPEPERRGPGVRRGRISAELLRELVPDPRAALWYACGPA
FT                   VGPIERAAAKERGETPAPRFLEAALAALDELGVPRDRVKRESYG"
FT   gene            484817..485614
FT                   /locus_tag="AnaeK_0427"
FT   CDS_pept        484817..485614
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0427"
FT                   /product="protein of unknown function DUF990"
FT                   /note="PFAM: protein of unknown function DUF990; KEGG:
FT                   ade:Adeh_0399 ABC transporter, inner membrane subunit"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71669"
FT                   /db_xref="GOA:B4UB21"
FT                   /db_xref="InterPro:IPR010390"
FT                   /db_xref="UniProtKB/TrEMBL:B4UB21"
FT                   /protein_id="ACG71669.1"
FT                   /translation="MPRTLRAIPTLLKIGFAEAVAYRAEMVVWLLSTNMPLVMLALWTA
FT                   VARDAPVGRFGQRDFVAYYLATLVVRLLTGAWVIWELNYEIRQGTLAFRLLRPVHPLLA
FT                   YAAENLSAIPVRLLVSLPIALGALLVVGRDRLTGDPLLVALFPVTVLGAWLITFLAMAI
FT                   IGALAFWIDQAGSLFEIWLGLFGVFSGYLVPLELFPHWVATAARFLPFRYMLAFPVEMI
FT                   IGMTPRSAALAELAIQWAFVGALALGARAAWALGLRRFAAFGG"
FT   gene            485615..486403
FT                   /locus_tag="AnaeK_0428"
FT   CDS_pept        485615..486403
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0428"
FT                   /product="protein of unknown function DUF990"
FT                   /note="PFAM: protein of unknown function DUF990; KEGG:
FT                   ade:Adeh_0400 protein of unknown function DUF990"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71670"
FT                   /db_xref="GOA:B4UB22"
FT                   /db_xref="InterPro:IPR010390"
FT                   /db_xref="UniProtKB/TrEMBL:B4UB22"
FT                   /protein_id="ACG71670.1"
FT                   /translation="MRRYLRLLAVQFRASAAVAMQYRVEFLVEGALALFWTGWSLVPLL
FT                   VVYGSRDAVAGWSFDEALVVMGWFTLMKGVLEGAVNPSLTTVVEHIRKGTLDFVLLKPA
FT                   DAQFLVSTAKFEPWRIIDVLGGLVIFAVAFHRMGRPPAAGGVLAACLLFGAATVILYSL
FT                   WIIVVAAAFFVVKVDNLSFLFVSIYDAARWPASVFRGALRVIFTFIVPLAVMTTFPAEA
FT                   LLGRLAPPRALLIAAGAVAFAGLARAVWLRSISRYTSASS"
FT   gene            486430..487386
FT                   /locus_tag="AnaeK_0429"
FT   CDS_pept        486430..487386
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0429"
FT                   /product="ribonuclease Z"
FT                   /EC_number="3.1.26.11"
FT                   /note="TIGRFAM: ribonuclease Z; PFAM: beta-lactamase domain
FT                   protein; KEGG: ade:Adeh_0401 ribonuclease Z"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71671"
FT                   /db_xref="GOA:B4UB23"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR013471"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:B4UB23"
FT                   /protein_id="ACG71671.1"
FT                   /translation="MPPGPRFDYIPAGMLRLTFLGTSAAQPTIRRNLTGHAVRRERELF
FT                   LVDCGEGTQRQLIQFGAGFDVAAIFFTHFHADHYLGAIGFLRTLSMQNRTEPLDLYGPR
FT                   PAKRLLETMLFTGAERFSYEVRIHEVRAGEAVRRDGCAMVPFPTEHRTPSLGWALREDA
FT                   RPGRFHPDKAEALGIPKGPLFGALQRGEPVTLPDGRTVRPEEVVEAARRGRSLVITGDT
FT                   RPCAATVEAARGADVLVHDCTFGDGEAERAEETLHSTARGAARVAHDAGVGRLVLTHLS
FT                   TRYDRAWEPLVEQAREVWQGPLDVAHDGMVLEVPLPA"
FT   gene            487478..488182
FT                   /locus_tag="AnaeK_0430"
FT   CDS_pept        487478..488182
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0430"
FT                   /product="Pirin domain protein"
FT                   /note="PFAM: Pirin domain protein; KEGG: ade:Adeh_0402
FT                   pirin-like"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71672"
FT                   /db_xref="InterPro:IPR003829"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR012093"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR041602"
FT                   /db_xref="UniProtKB/TrEMBL:B4UB24"
FT                   /protein_id="ACG71672.1"
FT                   /translation="MITVRKSEARGHFDHGWLDTRHTFSFADYHDEAHMGFRALRVVNE
FT                   DRVKPGEGFGTHGHRDMEILSYVLAGTLAHRDSTGGGGRLRPGEVQRMSAGTGVMHSEF
FT                   NGSDREEVHFLQIWLIPDRQGVKPSYEQREVPEAERRGRLRLIAAPDGAEGATTIQTDA
FT                   RVYATLLAAGERAALPLAAGRHAWVQVARGEATVNGERLRAGDGAALSGEAEVALAGAG
FT                   EGTAELLVFDLA"
FT   gene            488185..489477
FT                   /locus_tag="AnaeK_0431"
FT   CDS_pept        488185..489477
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0431"
FT                   /product="Methyltransferase type 12"
FT                   /note="PFAM: Methyltransferase type 11; Methyltransferase
FT                   type 12; Ribosomal small subunit Rsm22; KEGG: ade:Adeh_0403
FT                   methyltransferase type 12"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71673"
FT                   /db_xref="GOA:B4UB25"
FT                   /db_xref="InterPro:IPR015324"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B4UB25"
FT                   /protein_id="ACG71673.1"
FT                   /translation="MREAAPRRARGLAGAGCRLARAPLFRRNAGWSRTTGVPNTPADDL
FT                   ARWVPRLLATWRAARKGPPRRGPRPPPDALLPEELREVGAAVARLSRGLTRDRELAGAR
FT                   YMDEERLLGAYLLFYWPVSYLQARGVLSELPRRPRAVLDLGSGPGPMAFAALDAGAAEV
FT                   TAADRSARALAAARELARHAGEPLATREWNPARAGLAALAGGRRFDLVSMGHVLNELWK
FT                   GQDEDRRRAGLLEEALALVAPGGSLLVIEPALRDTSRALLRVRDLLVERGAAVRAPCLF
FT                   RGPCPALLRDTDWCHAERPVDPPPLVAQIAKAAGLRREAVKMSYLVVAAPGEAWQAPPA
FT                   GKVFRIVSEPLPSKGRLRYMGCGPEGRMGLSLQEKHVRPENRAFERLLRGDVVEVTGAE
FT                   PRGDGLALGEASTVKVLAPAGRPVPPPRDER"
FT   gene            complement(489650..490654)
FT                   /locus_tag="AnaeK_0432"
FT   CDS_pept        complement(489650..490654)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0432"
FT                   /product="ABC transporter-related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: ade:Adeh_0404 ABC transporter, ATPase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71674"
FT                   /db_xref="GOA:B4UB26"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B4UB26"
FT                   /protein_id="ACG71674.1"
FT                   /translation="MIQVRALAKHYRVARRPPGLAAAVRALFHRTYETVRAVDGIDFSV
FT                   GEGERVGFLGPNGAGKTTTLKMLSGLLHPTAGDVTVAGHVPRRREPAFLKAITLVMGQK
FT                   QQLIWDLPPAETFELNRAVYDIPRAQFQETVAELTELLELGPLVQKPTRQLSLGERMKC
FT                   ELAAALLHRPRVLFLDEPTIGLDVSMQATVRQFVKAYNERYGASVILTSHYMEDVLQLC
FT                   PRVVVIDHGRIIYDGDLRALAHRMRPDKRIVLRLATGNGAGPSGGDLARFGQVVSAEPG
FT                   SATLQVAAEEVSAVVARLLAAMPVTDLTVEDPPLEEVFSELFRASRRAAEPAK"
FT   gene            490726..491703
FT                   /locus_tag="AnaeK_0433"
FT   CDS_pept        490726..491703
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0433"
FT                   /product="ParB domain protein nuclease"
FT                   /note="SMART: ParB domain protein nuclease; KEGG:
FT                   ade:Adeh_0405 ParB-like nuclease"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71675"
FT                   /db_xref="InterPro:IPR003115"
FT                   /db_xref="InterPro:IPR036086"
FT                   /db_xref="UniProtKB/TrEMBL:B4UB27"
FT                   /protein_id="ACG71675.1"
FT                   /translation="MAATKKKRPVTKTGRPRARKGVTLKPTELGAQQVALAERPPELEA
FT                   LAQAVEADGGAVLAAYREPLGGHPLLFVALPVEKVERTAFQRDVSDAHVRKLTLAMDKT
FT                   RRYLDPIVAVREGERYLTPNGGHRLTALKELGARTVLALLVPEREVAYQILALNIEKAH
FT                   NLREKALEVVRMYRDLAGALDPRESEMALEFEEPALVTLGFAYEQRPRLSGGAYAPILR
FT                   KVDALSDEKLSRALAERERRAGVLLAFDDAVGEAVARLKARGFDSPYLKNFVVARVNPL
FT                   RFMKGAAPPFDELFAQMTKRAQGMDPGKIKSEDVARSGGAPEAE"
FT   gene            complement(491722..492153)
FT                   /locus_tag="AnaeK_0434"
FT   CDS_pept        complement(491722..492153)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0434"
FT                   /product="Hemerythrin HHE cation binding domain protein"
FT                   /note="PFAM: Hemerythrin HHE cation binding domain protein;
FT                   KEGG: ade:Adeh_0406 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71676"
FT                   /db_xref="InterPro:IPR012312"
FT                   /db_xref="UniProtKB/TrEMBL:B4UB28"
FT                   /protein_id="ACG71676.1"
FT                   /translation="MLVAFQLKMGLAGHPESAGAPKDLPGLLALARRFDEQVFRTHSRT
FT                   EEDVLGRHLTGADLHRLGSEHAELTRLLESARTARPQELRAALTAFAELLERHVRWEER
FT                   EVFPYAEDHVDEATLATIGGELELRLVLARTEARGAQRR"
FT   gene            492374..493681
FT                   /locus_tag="AnaeK_0435"
FT   CDS_pept        492374..493681
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0435"
FT                   /product="acetyl-CoA acetyltransferase"
FT                   /EC_number="2.3.1.16"
FT                   /note="TIGRFAM: acetyl-CoA acetyltransferase; PFAM:
FT                   Thiolase; KEGG: ade:Adeh_0407 3-ketoacyl-CoA thiolase"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71677"
FT                   /db_xref="GOA:B4UB29"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR012806"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020610"
FT                   /db_xref="InterPro:IPR020613"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:B4UB29"
FT                   /protein_id="ACG71677.1"
FT                   /translation="MGMNGSPPPGRRAAVVAGLRTPFVKAGTDFKDLSATDLGALVVNE
FT                   LVVRSGLPPKAFDSVIFGQVIPSPTVTLIGREMVLRTQLPRSVQAHTVARACATSIQAA
FT                   TDAADQIRLGHSDCAIAGGAESVSDAPIFASRPLAQALVELSRARTLADRARILAGLRP
FT                   KDFTPTPPALKEPTTGLTMGESAEKMAQVNGISRAAQDRLAYESHRRAAEAWDAGRFDA
FT                   EVMHVPVPPRYDHVAARDNIVRKDTTVETLAKLRPVFDRKYGTITAGNASPLTDGAAAL
FT                   VLMSEERAKALGMKPLGFLKAYAYAALDPRDQLLQGPAYAAPVALERAGLRLADMDLVD
FT                   MHEAFAAQVLSNLQAFASKDFAERELGRSEPLGEVDPARLNVNGGSIALGHPFAATGAR
FT                   MILQTLRELGRRGGQHALITVCAAGGLGAAVVLERE"
FT   gene            493734..495911
FT                   /locus_tag="AnaeK_0436"
FT   CDS_pept        493734..495911
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0436"
FT                   /product="3-hydroxyacyl-CoA dehydrogenase NAD-binding"
FT                   /note="PFAM: Enoyl-CoA hydratase/isomerase;
FT                   3-hydroxyacyl-CoA dehydrogenase domain protein;
FT                   3-hydroxyacyl-CoA dehydrogenase NAD-binding; KEGG:
FT                   ade:Adeh_0408 multifunctional fatty acid oxidation complex
FT                   subunit alpha"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71678"
FT                   /db_xref="GOA:B4UB30"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR006108"
FT                   /db_xref="InterPro:IPR006176"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B4UB30"
FT                   /protein_id="ACG71678.1"
FT                   /translation="MMSAEAMTAGQGASRYFRVEVAGGVATLVLDEPGERVNTVHPEAM
FT                   REFAAHLDRLEKDEAVKAVVVATGKPDVWVAGAKVELMQEAKDAAEAERLSRDGQALFD
FT                   RVERCRKPVVAAIHGACLGGGLEWALACHYRIATDHPKTSLGLVEVQLGLIPGGGGTQR
FT                   LPRLIGIQPALDLILAGKTVKARKALKLGLVDEAVPPPLLRQVAQERAAALASGKLRRA
FT                   PRRDAGAVARVTRAALEENFLGREVLFRQARKLTLAKTKGHYPAPLRALEAIEHGYAKG
FT                   FEKGLEKEAELFGKLAMTPEAHRLMEIFFATTALKKDNGVDDPAVKARPVSAVGVLGGG
FT                   LMGGGIAYVTVNAGLPVRLRERDDAAAAHGVAAVRGVLDERVKRRSIDRLERAEKLRLL
FT                   TTTTDWSGLERVDVLVEAVFEDLALKQEMVRAFEAVNPTGIFASNTSSIPIGRIAEASR
FT                   HPETVLGMHYFSPVHKMPLLEVIVTPRTAPEATATAVALGKKQGKTVIVVRDGPGFYTS
FT                   RILAPYMNEAAHLLVEGAAIEDLDHALVAFGFPVGPITLLDEVGIDVGDKVGKILQEAF
FT                   GARMAPPPALHDVVKAGRLGRKNGKGFYTYGGKEKRVDETVYDLLPGGRRRKRVAADEI
FT                   QERLVLQLVNEAVRCLGEGILRSARDGDVGAVFGLGFPPFRGGPFRWADAVGTKALLDR
FT                   MERLRARHGERFEPAPLLAELGRAGRPFHGG"
FT   gene            complement(496027..498402)
FT                   /locus_tag="AnaeK_0437"
FT   CDS_pept        complement(496027..498402)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0437"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ade:Adeh_2907 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71679"
FT                   /db_xref="GOA:B4UB31"
FT                   /db_xref="InterPro:IPR011031"
FT                   /db_xref="InterPro:IPR012286"
FT                   /db_xref="InterPro:IPR036280"
FT                   /db_xref="UniProtKB/TrEMBL:B4UB31"
FT                   /protein_id="ACG71679.1"
FT                   /translation="MQNVMRYSGALFFAGVLALAGCKGSDGDVGPQGPAGQDGQAGQPG
FT                   QPGQPGQDLTATAKPESCSVCHGSAGGQHQAIYDNFTDGLDPATSKLQISNITVVSVPG
FT                   TAAGTFDSTLTFNVTVNGQPYTAGIAALKQKRFTATEFDTATNTFTTATAFSWGTPAHV
FT                   ANGQYTATKTAAAFAPEASNAFVYLYLGDKLILPAEGHYNLMDNVASAGVTYGTWSYTS
FT                   AANVAGCEKCHPAPYAKHGYRQATVNGLQDMVACKACHTDQREGTDFVFQILGDDPAAA
FT                   AALQTDESGETIYSADQMTKYAYTATIVNDTHMSHAMEFPYPQSMANCVTCHEGKLDLI
FT                   LTDANFTVKTCKSCHPVTGTGANAPALKDVVSVMPYHPTDFYATQIACNDCHKAGGIGP
FT                   VFSVIHTGYNKAIYKDAATKYATAITSAVSSATFDSATNKLTVKFTVTGADADALVKPT
FT                   VVAGLYGYGTKDMYVSGHNGQADGTRNLEWSEGAVQRGDPTKSANSDRLTVTPATAAAG
FT                   QAEWTAVADLTLWANLIADGTVQKVEIAFLPVLGLDQGAAVSATNAAIAVAGKSVTFDL
FT                   AANAIVPDADAYGKAIVNTAKCNACHESLGTTFHSPSYGSAGVVACRICHTPRDGGSHL
FT                   EMQSRSIDSYVHAIHSFQVFDVAGVDFANPVEKMEYEHHIGSAYPNFTILNCKSCHEDG
FT                   TFEVPDQTKSLPGVFSKAAANTSWDRTIGAVPMYVSGPASRACGSCHRSQDINADAASD
FT                   LASFNQHAATFGFLLETSSATAGADYEAAIAKIFSIFN"
FT   gene            499132..500055
FT                   /locus_tag="AnaeK_0438"
FT   CDS_pept        499132..500055
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0438"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /EC_number="2.7.13.3"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase A domain protein; KEGG: ade:Adeh_0410
FT                   periplasmic sensor signal transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71680"
FT                   /db_xref="GOA:B4UB32"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B4UB32"
FT                   /protein_id="ACG71680.1"
FT                   /translation="MPRQRAPLKLRHVLPLIIGFVFVPAALMLTVGILILVYGSVARDY
FT                   LFGILIVSLVGTTIIGSAATLAVLFREARVAKLQTDFVNKVSHELRTPLTSIRMFVETL
FT                   QLGRLQDPQRQREALEIVAEETARLSGLINRLLDWARMESGRRVYELSRQPLGPVLDAA
FT                   LAAFEPQLLHHPVQLERDLPPRLPSVMADRSALVEAVLNLLNNAFKYTGPDKRIRLSAV
FT                   ASGPTVTIAVTDNGPGIPQRDQKHVFDKFYRASDPLRRTVEGTGLGLAMVKHIVVGHGG
FT                   KVSVESEPGCGATFRIALPVAGGNHG"
FT   gene            500048..500740
FT                   /locus_tag="AnaeK_0439"
FT   CDS_pept        500048..500740
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0439"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein; KEGG: ade:Adeh_0411 two component
FT                   transcriptional regulator, winged helix family"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71681"
FT                   /db_xref="GOA:B4UB33"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:B4UB33"
FT                   /protein_id="ACG71681.1"
FT                   /translation="MAERILVIEDDPSILRGLQLNLGMEGYTVRSATDGETGLQLARTE
FT                   QPDLVVVDVMLPRMGGLEVVREIRKEDPELPILILSAKNQETDKVAGLQLGADDYLGKP
FT                   FGLKELLARIDALLRRRRARGEGVQPKAIRRAGGIELDLDARRALVDGRALDLTSREFD
FT                   LLAFFVTHPDRVYSREQLMEAVWGSRYFGTARTVDNFVARLRAHIGDDAEQPRHLETVR
FT                   GIGYRFNV"
FT   gene            complement(500890..502365)
FT                   /locus_tag="AnaeK_0440"
FT   CDS_pept        complement(500890..502365)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0440"
FT                   /product="L-seryl-tRNA(Sec) selenium transferase"
FT                   /EC_number="2.9.1.1"
FT                   /note="PFAM: L-seryl-tRNA selenium transferase; KEGG:
FT                   ade:Adeh_0412 selenocysteine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71682"
FT                   /db_xref="GOA:B4UB34"
FT                   /db_xref="InterPro:IPR004534"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR018319"
FT                   /db_xref="InterPro:IPR025862"
FT                   /db_xref="UniProtKB/TrEMBL:B4UB34"
FT                   /protein_id="ACG71682.1"
FT                   /translation="MTTPKFAPGPAGAALRGLPRTDRLVEAADQAGMVEKLGRGAVLEA
FT                   VRAELDRHRAAVLAGEPCPSPEAIEAGLLDRLREDARGSLRPVVNATGVVIHTNLGRAP
FT                   LSDDAIAAMGRAARGYTNLEYDLVAGERGDRYGHAEAPLCRLTGAEAAVAVNNNASAVM
FT                   LALAALMDAPPDRSGGGEAGVRPLAAPGRGEAEPGLPEVIVSRGQLVEIGGGFRIPDVL
FT                   RRSGAALVEVGTTNRTYLRDHEAAVGPRTRILLAVHRSNFRLSGFVHDTPLEELVDLGR
FT                   RRALWVVDDLGSGTLLETAPFGLGIEPTVQERIRAGADLVCFSGDKLLGGPQAGILCGT
FT                   REAIARVKRHPLMRALRVDKVTLAALSATLAHYERGEALEQVPVWRAIAAAPEALEARA
FT                   RGWLAALGPAGAGCAVRPSRSAVGGGSLPEVTLPTSVLSLPGAPDALAARLRRGEPPVV
FT                   GRIEEDRVVLDPRTVLPAEDEALVAAVRAALAG"
FT   gene            502446..504476
FT                   /locus_tag="AnaeK_0441"
FT   CDS_pept        502446..504476
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0441"
FT                   /product="proton-translocating NADH-quinone oxidoreductase,
FT                   chain L"
FT                   /EC_number="1.6.99.5"
FT                   /note="TIGRFAM: proton-translocating NADH-quinone
FT                   oxidoreductase, chain L; PFAM: NADH-Ubiquinone
FT                   oxidoreductase (complex I) chain 5/L domain protein;
FT                   NADH/Ubiquinone/plastoquinone (complex I); KEGG:
FT                   ade:Adeh_0413 proton-translocating NADH-quinone
FT                   oxidoreductase, chain L"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71683"
FT                   /db_xref="GOA:B4UB35"
FT                   /db_xref="InterPro:IPR001516"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="InterPro:IPR003945"
FT                   /db_xref="InterPro:IPR018393"
FT                   /db_xref="UniProtKB/TrEMBL:B4UB35"
FT                   /protein_id="ACG71683.1"
FT                   /translation="MPSIVPSPAAAESYLWAIILFPLAGAIVNGLTGRRLGRGNVTVIA
FT                   IGVMVGAFLVSSVAFYHALTGTVLRFRGDPWIQVTGADGRTIISIGWGLLVDRLSATMI
FT                   MVVTGVGTLIHVYSASYMSHEDDAGYARFFTYLNLFVAAMLTLVLGDSLILTFVGWEGV
FT                   GLCSYLLIGFWYTDPAKAYAGRKAFVTNRIGDFGFLIGVFALFSIFGTVGYADLQSLAH
FT                   GVDPAAAIQTGVFAGRTYQAAVTFALIGLFVGACGKSAQLPLYVWLPDAMAGPTPVSAL
FT                   IHAATMVTAGVYLVARNAYLFSLAPAAMATVTLVGALTALFAALIAFVQTDIKKVLAYS
FT                   TVSQLGFMFIGVGVGAWWAGVLHLVTHAFFKACLFLGAGSVMHGMNEDTDIRNMGGLAK
FT                   KMPHTAATFGIATLAITGFVPLSGFFSKDAILGNALFSHNPAWHQVGQIAYVLGSLAAL
FT                   GTAFYMSRLFFLTFTGKPRTAAAAHAHESSPVMYVPLWVLAILSIVALVLGLPGHGPLA
FT                   EVFARFTEPVFAAGTERLHEVGHLHAGAHPAWPFAVAWGLAAVGTLVAFLMYAGALRSA
FT                   PAALARTFPRLYQFAVDKFRVDELYQMVVIEPLKTAAYLLWRIVDVFAIDGLVVNGVAR
FT                   LVGYAGAVLRLAQNGDVQRYAAIMVVAAAVILWTVVGAGGR"
FT   gene            504480..506108
FT                   /locus_tag="AnaeK_0442"
FT   CDS_pept        504480..506108
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0442"
FT                   /product="proton-translocating NADH-quinone oxidoreductase,
FT                   chain M"
FT                   /EC_number="1.6.99.5"
FT                   /note="TIGRFAM: proton-translocating NADH-quinone
FT                   oxidoreductase, chain M; PFAM:
FT                   NADH/Ubiquinone/plastoquinone (complex I); KEGG:
FT                   ade:Adeh_0414 proton-translocating NADH-quinone
FT                   oxidoreductase, chain M"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71684"
FT                   /db_xref="GOA:B4UB36"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="InterPro:IPR003918"
FT                   /db_xref="InterPro:IPR010227"
FT                   /db_xref="UniProtKB/TrEMBL:B4UB36"
FT                   /protein_id="ACG71684.1"
FT                   /translation="MNLLTVVTFLPLLGALAMVLVPRDEPSQHRALALVASLVTFALSL
FT                   GLWFGFDASPGAPEFQFELMVPWMPTIGIGFHVGIDGVALLLFMLTTVLMPVVVLSAWK
FT                   AVGDRVKEFMIALLVLESAMLGTFIALDLVLFYVFWEAMLIPMYLLIGIWGSQNRLYAT
FT                   VKFFVYTFAASVLMLLAILYVYFHDGGTFDYVEARRALAVTPGAASWLFLAFALAFAVK
FT                   VPMFPLHTWLPDAHTEAPTAGSVILAGVLLKMGTFGFFRYALPLFPEAALQHRNLVAVL
FT                   AVIGIIYGALMSLVQTDMKRLVAYSSVSHLGFVMLGLMALSAEGMTGSVYQMLNHGVST
FT                   GALFLLVGMLYERRHTRLISEYGGIAKRVPVIAAAFVIVTLSSIGLPGTNGFVGEFLIL
FT                   SGTWLSRLGGSAVFATVAALGVILGAVYMLLLVEKVFFGPNQNPQNHHLPDLSVREGFV
FT                   LAPMIALIVVMGLLPGPFLAPAKPAVDRLIQRFQVAEARLGKGPQVGTAVPAVMVRAPA
FT                   PAPAAEPAPLPAPAPVPLQQPGGNY"
FT   gene            506110..507585
FT                   /locus_tag="AnaeK_0443"
FT   CDS_pept        506110..507585
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0443"
FT                   /product="proton-translocating NADH-quinone oxidoreductase,
FT                   chain N"
FT                   /EC_number="1.6.99.5"
FT                   /note="TIGRFAM: proton-translocating NADH-quinone
FT                   oxidoreductase, chain N; PFAM:
FT                   NADH/Ubiquinone/plastoquinone (complex I); KEGG:
FT                   ade:Adeh_0415 proton-translocating NADH-quinone
FT                   oxidoreductase, chain N"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71685"
FT                   /db_xref="GOA:B4UB37"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="InterPro:IPR010096"
FT                   /db_xref="UniProtKB/TrEMBL:B4UB37"
FT                   /protein_id="ACG71685.1"
FT                   /translation="MSGFPTQDFVALVPVAILTMGALVLLMTEVFLTSGRRAYQAYLTM
FT                   VFAAAAAAYAAWMPVPGNVFGRQAVVDSFSAFVTVVLCAGLALSALVGQSWLNARNSER
FT                   GEFYALALFGTAGMVLLGMATDLLIAFIAVEVMSLSTYCLAAFLRRGKKPAEAAFKYVV
FT                   LGSISSALLLYGSALLYGASGSTLFSVLPRGQGSALYLAGIALVAGGVAFKIAAVPFHA
FT                   WTPDVYEGAPTPVTAFMAAGVKTAAFAVLVRLFLATESGSAAMSTSLGTVLSALAVLTM
FT                   IFGNLLALPQRSVKRMLAYSSIGHAGYLLVGVVSAVVAGARDKALAGLLFYLAAYTATV
FT                   IGAFAVVGALERRTRGDFEPADAWDLDRFAGLARRRPALAFAMAVFLFSLAGVPPTAGF
FT                   IGKFYIFKAAMGAGLYGLAVLGVLTSVLGAYYYLRVVLYMYFLPSKDEAGEVVLSAPSL
FT                   TIALAAAVAVVVLLGVVADPMVRLAQAASAIIL"
FT   gene            complement(507690..508031)
FT                   /locus_tag="AnaeK_0444"
FT   CDS_pept        complement(507690..508031)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0444"
FT                   /product="response regulator receiver protein"
FT                   /note="PFAM: response regulator receiver; KEGG:
FT                   ade:Adeh_0416 response regulator receiver domain protein
FT                   (CheY-like)"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71686"
FT                   /db_xref="GOA:B4UB38"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:B4UB38"
FT                   /protein_id="ACG71686.1"
FT                   /translation="MAQCFLLVDADRNFREALAIALRLDGHRVEVCVGADEALALLAAG
FT                   GVDCCLVDAHMPGADEVLAAATAAGARPVMTGPYADVLEQAARRHPAATALPKPFRAAE
FT                   LADAGRAAQ"
FT   gene            complement(508341..509786)
FT                   /locus_tag="AnaeK_0445"
FT   CDS_pept        complement(508341..509786)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0445"
FT                   /product="two component, sigma54 specific, transcriptional
FT                   regulator, Fis family"
FT                   /note="PFAM: response regulator receiver; sigma-54 factor
FT                   interaction domain-containing protein; helix-turn-helix
FT                   Fis-type; ATPase associated with various cellular
FT                   activities AAA_5; SMART: AAA ATPase; KEGG: ade:Adeh_0417
FT                   two component, sigma54 specific, transcriptional regulator,
FT                   fis family"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71687"
FT                   /db_xref="GOA:B4UB39"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B4UB39"
FT                   /protein_id="ACG71687.1"
FT                   /translation="MADIPGRMIDPVPPEDPRAPRIAEPPTGGKVLVVDDQKNMRATTA
FT                   ILLRQAGHAVEEAEDGASATQRVQHESFDVVLTDLRMPTVDGMEVLRAVQQASPETQVI
FT                   VMTAYGTIESAVEAIRRGAYDFLAKPFKESEVLLRVAKALEKRRLLGEVNLFAEEFRKR
FT                   YGLEHIVGRSPAMREVLDRVLRVAPTDATVLVTGESGTGKELVARALHVTSRRSDKPFV
FT                   PVNCAAITDTLLESELFGHARGAFTGATRARRGMFEEANGGTLFIDEIGETSPGFQAKL
FT                   LRALQEGEIRRVGESSPVQVNVRIIAATNQDLRRAIAERRFREDLFYRLNVVPLRIPPL
FT                   RERREDVPLLAAHFLQRFVQRTGSERVLTPEAVASLVAHDWPGNVRELENIIEQAAALC
FT                   TGREIRAADVQIEARAAPAGGAGVTLADAVEETERRAITAALARCGNDLGRVARDLGIS
FT                   GTTLWRKMKRLGIEAREHPPVTS"
FT   gene            complement(509779..514362)
FT                   /locus_tag="AnaeK_0446"
FT   CDS_pept        complement(509779..514362)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0446"
FT                   /product="multi-sensor signal transduction histidine
FT                   kinase"
FT                   /note="TIGRFAM: PAS sensor protein; PFAM: GAF domain
FT                   protein; ATP-binding region ATPase domain protein;
FT                   histidine kinase A domain protein; PAS fold-3 domain
FT                   protein; PAS fold-4 domain protein; KEGG: ade:Adeh_0418
FT                   multi-sensor signal transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71688"
FT                   /db_xref="GOA:B4UB40"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B4UB40"
FT                   /protein_id="ACG71688.1"
FT                   /translation="MAERFQAGSLVVRDRKIVHASEGAAALAGRTVPDMVGLDVLDLVA
FT                   PEDVARVVERHERRLRGEAAPAEYEVGVLLPDGTRRPVELRVRVHGADVILEVRDATAQ
FT                   AARRPRLEALAALGAALQREPSEAAVLERLRGAADELSALVLLARPDGGGLRVDWSALP
FT                   PPAAARLERALERPLDGQPGRWPPMFRAAWDAGAAYSDDLPNEAAAFVPEARAAATREA
FT                   IAAIGIARAVAVRVDTRAGPALGLLVAARWLRSEDLGALRLFGAQLAAALDAARTIADL
FT                   SRHNADLALLNRVGRLAGDAPDLDTFFGEVTTVLTSATGCAVVAVYLVEDGGRELVRTF
FT                   ASGTSPDVQARLQRVPVTARIGEVLRDRAARAVPVDDAESGADALRALGIRAGIWVPLV
FT                   ARGRAVGVMVVAFREALEAVRPWLGLLGAVGPHVASAVETQGLLGALRRRVAELTLIND
FT                   VAMGSAQLDPVLLLDTSLRRVVETFQADTGAAFVREGERLALVAGHGLSAETLRRTARL
FT                   GLGESLPGLAVKRCAPARYPDDADPTAVQVAQAEGLREAMAVPLLAKGQSAVGSIVLGR
FT                   RTARPFADREVTLLSAMAVQIGVAVENARLFADVRRRLSDLEAVHALALRIFGNAPGDV
FT                   PALLDDGCREVASALSCRGAAVLLVDPQERCLRGVGGWGGPLRAEALRIPAGQDLLAED
FT                   ALRRGAPAWTEDASRDPRSALCGREDLPPTALLVVPLTSRQATRGVLFLLDDAGRSFSD
FT                   PELALANALGGELAVGLENAELYAEASRRVEDLSLLNEMSRTVAGSLDLDHVLSEGVVA
FT                   ARRLLGAGVGVVHLYDPVHLSLRAAAVSPGGPAALERASAALASGEGLSWRSVRERRTF
FT                   VVEDVDAEAAGLNRLLVEYHRARAAIVAPLLLRGEPLGVLVVVDTERPRRFAPAEVERV
FT                   TAVANQLAVAIENARLYAEARGRLHELSTVIDVARVVSSSLDLEEVLSAGAEHLKQTLQ
FT                   GSDCTILLDDYRRRELRRAATRGAPIGPASVPLAERSLARDALEARTPIAGRLAEPGVP
FT                   DRALLAVPLHVRDQPVGVALVAAATTDRTFSPGELSRAMAIASQLAVAVDNARLYSETR
FT                   RRAEELGLLHEVGRSLVATLDFEQVLDAGVRNLARIVDAPRAVIALSSPGGEQLRVRAV
FT                   WGLPQAAVGVDLSVEAAAPRLAALVFERREPIAIEDAARDPRVREDLSLDPSIRAMLGL
FT                   PLLVRDRYIGAAVILETRGPRRFSPAEIERGAAIANQLAVAAENARLYEDLRRSYAELA
FT                   HAQRQLIQQERLAALGELSAVVAHEVRNPLGVIFNSLGSLRRMLRPQGDARMLLDIVGE
FT                   EADRLNRIVGDLLDFARPSTPEVRPEPLDRVVEEALATALAQNGQPIQIQREVDPALPQ
FT                   VPMDARLVRQAVVNVAVNAVQAMPRGGRLTVRLRRDGDAAVLELEDTGAGIPDEVRGRI
FT                   FEPFFTTKASGTGLGLAVVRRIVEGHGGEVTVTSRPGAGTAFALRFPLTPLAGEDGGPV
FT                   EKEAGIG"
FT   gene            complement(514362..516311)
FT                   /locus_tag="AnaeK_0447"
FT   CDS_pept        complement(514362..516311)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0447"
FT                   /product="selenocysteine-specific translation elongation
FT                   factor"
FT                   /note="TIGRFAM: selenocysteine-specific translation
FT                   elongation factor; small GTP-binding protein; PFAM: protein
FT                   synthesis factor GTP-binding; elongation factor Tu domain 2
FT                   protein; Elongation factor SelB winged helix 2; Elongation
FT                   factor SelB winged helix 3; KEGG: ade:Adeh_0419
FT                   selenocysteine-specific translation elongation factor SelB"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71689"
FT                   /db_xref="GOA:B4UB41"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004535"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR015190"
FT                   /db_xref="InterPro:IPR015191"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B4UB41"
FT                   /protein_id="ACG71689.1"
FT                   /translation="MKRVVIGTAGHIDHGKTSLVRALTGIDTDRLRDEKRRGITIELGF
FT                   AHLALPDGSVAGVVDVPGHERFVRSMAAGAGGIDLVVLVIAADEGVMPQTREHLDICRL
FT                   LGVPRGLVAVTKADLLPELGADWLPLLEQDVREVTRGTFLEGAPIVPVSSATGEGLDAL
FT                   RAALAALAAEVPERPTDGPLFLPIDRAFSMKGFGTVVTGTLLSGQIAEGDAAALLPASP
FT                   GGDGLRVRSVQVHGKPTPRALAGQRTAVNLPGIEPAAIRRGQVLVHPGVVPPSSILDAE
FT                   LTLLAAAPKPLRHRAKLLLHVGTAQVPAVISLLDRAELAPGATAHAQLRLAEPAAALPG
FT                   QRFILRGFAVLEGRGKTVGGGRVLAVAAPKRRRGRPESLAQLAVLAGADPEARLATVLA
FT                   MAGPAGLDLPALVGRTALSPKAAQATLDRLGARGGAVLFDRERRAYVAGTVAQELTRRM
FT                   AAAVAAFHRDHPLAAGMGREALRGKLPPVTDPRLFQRLLAHAAERGELVVEGDAVREKG
FT                   HAAASGESAGGALKEKVAAALAKGGLTPPWLAELPGAVGASAPDVQAVLKLLAAEGRAL
FT                   RVSSELYFDAAAVKTLEAKLVAWLRERRQITTQEFKDLVGATRKHVIPLAEFFDREKVT
FT                   LRVGEKRVLRGEGR"
FT   gene            complement(516332..516877)
FT                   /locus_tag="AnaeK_0448"
FT   CDS_pept        complement(516332..516877)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0448"
FT                   /product="phosphoribosyltransferase"
FT                   /note="PFAM: phosphoribosyltransferase; KEGG: ade:Adeh_0420
FT                   phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71690"
FT                   /db_xref="GOA:B4UB42"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:B4UB42"
FT                   /protein_id="ACG71690.1"
FT                   /translation="MGVADGFAMDRLAAPAHLRRAPKKAMREIGWAAFGEVARSLAARI
FT                   HESYRPDVVVGIAKGGVFVGGALAAALGAEFQPVRIEKRRRDAGGPGAPASELPPLTGR
FT                   RVLVVDDVAATGATLAKARAVARKAGAREVRTAVLVVRPSGARPDFHAFETDELILFAW
FT                   DYQLDQLGAAVDPGEVGV"
FT   gene            complement(517114..518001)
FT                   /locus_tag="AnaeK_0449"
FT   CDS_pept        complement(517114..518001)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0449"
FT                   /product="Hsp33 protein"
FT                   /note="PFAM: Hsp33 protein; KEGG: ade:Adeh_0421 HSP33
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71691"
FT                   /db_xref="GOA:B4UB43"
FT                   /db_xref="InterPro:IPR000397"
FT                   /db_xref="InterPro:IPR016153"
FT                   /db_xref="InterPro:IPR016154"
FT                   /db_xref="UniProtKB/TrEMBL:B4UB43"
FT                   /protein_id="ACG71691.1"
FT                   /translation="MTDRLCRGLLPQRGLRAVFVRVGDTARMARVLHGLYPTSAHLFAQ
FT                   GLAAGALLGALQKEQGRVNLQIECDGPVGGIFVDADRDGNVRGYVRRPAVHFPGDPARA
FT                   ARAALGGSGFLSVLRDPGSGQYYRSAVELEALDVAQDLRRWFAASEQVETALDLAVVGR
FT                   EGEPLADVGGLLLQKLPDGDAAAVQAARERLADGALRAALARGAPAQEIIREVAGDGFE
FT                   LLADEEIAYRCGCSPERARAAVSALGRDGIAQVLAEEKQAVISCEFCRQRYVIGEAELR
FT                   DIARRLADADAEGG"
FT   gene            complement(518145..518717)
FT                   /locus_tag="AnaeK_0450"
FT   CDS_pept        complement(518145..518717)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0450"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ade:Adeh_0422 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71692"
FT                   /db_xref="UniProtKB/TrEMBL:B4UB44"
FT                   /protein_id="ACG71692.1"
FT                   /translation="MRTPTLLRLSALCAGLLAAAAARAQDVPFEPSGEVRVLAWGTMGT
FT                   SAAFDEGRIVGPTVNLTRREDGTWAGDLAGRNIALEIREGRLTGANVNLVLTQKGSATH
FT                   GEGLFYGIRFRFDLDGKRLSARFGDCTVDAKRLKAPGQLRGDAACLRRGASFPSSSRAT
FT                   VQLIGDAANEPPPLPQLALALLATMAD"
FT   sig_peptide     complement(518643..518717)
FT                   /locus_tag="AnaeK_0450"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 25"
FT   gene            complement(518744..519691)
FT                   /locus_tag="AnaeK_0451"
FT   CDS_pept        complement(518744..519691)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0451"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase;
FT                   short-chain dehydrogenase/reductase SDR; 3-beta
FT                   hydroxysteroid dehydrogenase/isomerase;
FT                   dTDP-4-dehydrorhamnose reductase; Male sterility domain;
FT                   KEGG: ade:Adeh_0423 NAD-dependent epimerase/dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71693"
FT                   /db_xref="GOA:B4UB45"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B4UB45"
FT                   /protein_id="ACG71693.1"
FT                   /translation="MPADPVTFPGMPRTVLVTGISGNLGRALAKHLHTEAQVVGLDRRA
FT                   FPGKPKDIEHHQADLRKARSEDAFRRRRVDAVIHMGIMHDPRMPFSEAHSFNVVGTQRL
FT                   LELCVRHRVKKVVVLSSANVYGPRPQNSNFLPEETPLMGADRASDVRDLVEVDMYAQSF
FT                   MWRHPELETVIVRPVNIVGPTVRNAPSNYLRLESPLTVMGFDPMLQLIHEEDVCRALVL
FT                   ALRPGLRGVFNVSGPGEVPLSAVLRELGRSPVPVPHPLVRPLVRRLFDARLTSFPPDEV
FT                   DHIQYLCVVDGSRFAREAGWAPRFSMRETIRSVL"
FT   gene            complement(519697..520551)
FT                   /locus_tag="AnaeK_0452"
FT   CDS_pept        complement(519697..520551)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0452"
FT                   /product="phospholipid/glycerol acyltransferase"
FT                   /note="PFAM: phospholipid/glycerol acyltransferase; KEGG:
FT                   ade:Adeh_0424 phospholipid/glycerol acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71694"
FT                   /db_xref="GOA:B4UB46"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="UniProtKB/TrEMBL:B4UB46"
FT                   /protein_id="ACG71694.1"
FT                   /translation="MAELSEAIKARLRAWTFALGGPGTRGRLEKLTPPRNEYGVDPYGF
FT                   DSEYAVAAIAPLLWLYRKYFRVQVHGLENLPTEGRVVLVSNHSGQLPFDAAMIEVACLI
FT                   ELDPPRAVRALVERWVPTLPFVSTFMARCGQIVGTPENCRRLLAADEAILVFPEGVRGL
FT                   NKPFSQRYQLQRFGAGFLRLALESGAPVVPIGVVGAEEQAPALFDLKPLAKLLSFPAFP
FT                   ITPTLLPFPLPSRYHIHFGAPMRFQGSPDEEDEALERKVAEVEAAVRGLLARGLAEREH
FT                   VYW"
FT   gene            520693..524127
FT                   /locus_tag="AnaeK_0453"
FT   CDS_pept        520693..524127
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0453"
FT                   /product="MJ0042 family finger-like protein"
FT                   /note="TIGRFAM: MJ0042 family finger-like protein; PFAM:
FT                   TPR repeat-containing protein; Tetratricopeptide TPR_4;
FT                   Tetratricopeptide TPR_2 repeat protein; SMART:
FT                   Tetratricopeptide domain protein; KEGG: ade:Adeh_0425 zinc
FT                   finger/thioredoxin putative"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71695"
FT                   /db_xref="GOA:B4UB47"
FT                   /db_xref="InterPro:IPR011723"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:B4UB47"
FT                   /protein_id="ACG71695.1"
FT                   /translation="MRVTCPHCKAAYKIDDARVTPAGVKVRCPRCHQSFPVRRPDDEAA
FT                   AVPLPGGEAASAAGVPLPAPPSAATGGIPLPPPSGTGSIPLPPPDAAQAGEPSPFAFGP
FT                   APEAPSPFAFGPAPEPGLTGAAGTPAPVELPAPAGADDAPLGFGEVDFSGGAAAPPSGG
FT                   TPDALDAGPAPVDDADIVVDEPGPQADPFADATFADAGLGASLAAPAAGPGMGGPSGAA
FT                   RAGASEELEMLFGEAARPATAPAQATHGDGYRVRRRSGKVFGPFSEAQIAEMLSKGELL
FT                   GNEDVSADGATFEALSAVPAFAAELERLAAQEAAHAPPAAAARPPGGQPFGDRMAAAKV
FT                   VEGEREPLARRLAKPLAAGLAVAAVLAIGLGAGLTGHGWFFTGHLRRGDAKALAPKLAG
FT                   ARAALARGDHASERSALDLAAQAVAADAGSAEAAALHAMAVAALERRHAAPGPALDQAR
FT                   RAAEALERDDPGSLPALEARLAVALATAPGAGTAAAEAALAAALARARPDPQAFALLGD
FT                   AALARGDAVKAAAAFQRLGSLEQGPRAPMGLARAALLRGKPDEARPTLEKLAAADAAYL
FT                   PARLELAALAEAAGDVEGARTHLAPVLADAAQPRLAPLERGRARMVEAALLDRSAATAA
FT                   DAEKALLAALDADPRLAAARAALVRQRLRRGDAAGAVAASDPVAAEAASDPALAAARVR
FT                   ALALAGRALDAAQLADQALRAAPGTPALLVAKAVALSAAGKPQEAAALYGEALARDAAA
FT                   VEPRVALGRLALARGDLPAAREALAQAVEKGPRDPAAHAALGELRAADGDAAGAEAAYR
FT                   AALALDAEHAAAVLGLARLAQARGDVAAAREGLVRALALEPRSAEAQLALGTLEWSARD
FT                   LAKAEAALAIAVDLQPRNAAALTRLGAVKLERGDAEAAVKLLGAATSEAPGAGEAQLWF
FT                   GRALLARGETPAALVRLRKAVELSPGAAEPRLELGQALERSGALQEAIDAYQDAAAAAP
FT                   ALPDPHERTALLYTANGRCDLALAPLARAIELAPRATRLRVELGECQGKLGKHAEAVRT
FT                   LRAAQRADPAAAQVLYPLAREVHQAEGARAALPLYERAAREDPKNAMPHYFLGYAYKER
FT                   SQRERAIQAFRTFLALKPDAPERRDIEAEIEDLGGAR"
FT   gene            524209..524760
FT                   /locus_tag="AnaeK_0454"
FT   CDS_pept        524209..524760
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0454"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="PFAM: regulatory protein MarR; KEGG: ade:Adeh_0426
FT                   transcriptional regulator, MarR family"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71696"
FT                   /db_xref="GOA:B4UB48"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B4UB48"
FT                   /protein_id="ACG71696.1"
FT                   /translation="MRSTPARPGPGPAADARRVRELLVRLSRRGSLRDPIGGSGHGLDL
FT                   SPVQVHALLWLGLGGALTMGELARHVAVTEKTITGVVDRLERDGLVQRARSRDDRRVVR
FT                   VSLAARGEAAWRALDAEISARLEGLLALLEPRDRRDLVRILARLDERLRPAAEAAAPGT
FT                   ARARPPRGAGGRQHERREDA"
FT   gene            524757..526148
FT                   /locus_tag="AnaeK_0455"
FT   CDS_pept        524757..526148
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0455"
FT                   /product="outer membrane efflux protein"
FT                   /note="PFAM: outer membrane efflux protein; KEGG:
FT                   ade:Adeh_0427 outer membrane efflux protein"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71697"
FT                   /db_xref="GOA:B4UB49"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="UniProtKB/TrEMBL:B4UB49"
FT                   /protein_id="ACG71697.1"
FT                   /translation="MNALITAALALALAQTPGTPSTPAPAAATPAAPAPAPAPDAAPVA
FT                   APAAPVALPVLTLDDALAAAAAQNLDLKAAQARLRQADELSWKAWSGYLPQVTASGTYT
FT                   RNETEAVLPAGSLGPGSPKITIQAQDQLNGLVEATQALLAPQLLFAIPNASRAEEIARL
FT                   NVETARREVLFGVAQAYYGAASLRRAMEVSERLLEIAARQEKDARVRYQAGAIAKVGLL
FT                   RAEIDRARAEQDVKRSQNAFASARIALATLLDRRPDFDVVDPPEPVLAGDADALVAAAL
FT                   RDRPDVQAARLNVELQRGARNQAVARYLPNLGAFGRYTLANEAGFTGTNHAWAAGLALQ
FT                   WKVLDGGLRESDIREANAKIDEANASSGSAELKARQEVEQAYLDLESARANAAKAKEQR
FT                   DLAAENQRLVDVAFRAGTATAVEQADATAQLRTAEVGQITESLTAQLAALRVLKAAGAF
FT                   HPTRR"
FT   sig_peptide     524757..524843
FT                   /locus_tag="AnaeK_0455"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.996) with cleavage site probability 0.789 at
FT                   residue 29"
FT   gene            complement(526169..527440)
FT                   /locus_tag="AnaeK_0456"
FT   CDS_pept        complement(526169..527440)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0456"
FT                   /product="putative GAF sensor protein"
FT                   /note="PFAM: GAF domain protein; KEGG: ade:Adeh_0428
FT                   putative GAF sensor protein"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71698"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="UniProtKB/TrEMBL:B4UB50"
FT                   /protein_id="ACG71698.1"
FT                   /translation="MRSHDARAAAMGGTGHAGGVIHVPAVADEPAPAPADLASLTQAQR
FT                   AERALAEGKREPEIPIERAFLQAALDFRQTLRVLVSAVVPKFADWCFVDLIDGDGIPRR
FT                   VEVAHGDPTKAPLAQEMRSIAFGPGWATPGAQTIRDRAPRLFRQVTTEVMEWATHGERH
FT                   LAVLRAIKPNSLLSVPLVARDRVIGSITLIRSAMLPGLDESDLLFAEALAEPAALALDN
FT                   ARWYQVEKAGRGAALEEADRERHDRVEAQRGVLRLRRIESVSASLASVLAPQAIARVAV
FT                   ENGLSVLEPATAMVVRAAPGASVLEVLHCQGWADDLTIDLRELRADSPALLAEAYRIQT
FT                   AIWVSNPEALAHSYPNAAELALRVGDRAWAAVPLRCDGRTVGALGLGFAHPRDLDADEK
FT                   RFVLTVAQIVAQALERARLRDEAR"
FT   gene            complement(527559..528539)
FT                   /locus_tag="AnaeK_0457"
FT   CDS_pept        complement(527559..528539)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0457"
FT                   /product="diguanylate cyclase"
FT                   /note="TIGRFAM: diguanylate cyclase; PFAM: GGDEF domain
FT                   containing protein; Forkhead-associated protein; KEGG:
FT                   ade:Adeh_0429 diguanylate cyclase (GGDEF domain)"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71699"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR032030"
FT                   /db_xref="UniProtKB/TrEMBL:B4UB51"
FT                   /protein_id="ACG71699.1"
FT                   /translation="MPVERRSERTWTTLPTTPCAAGRRHAFLLVLAGPQLGDIYPLASD
FT                   RELVIGRRDDCDLPIHDDGVSRRHAAIRVEGEGALLRDLGSANGTYVDGARAEGEVRLA
FT                   DGGRVSLGGATVLKFAWADELEARWQMKLAEIALLDPLTGVFNRRHLDDRLAAELAAAQ
FT                   RHGRSMSVLLVDVDRFRAVNEAHGQAAGDEALKMVAFVLRGALRREDVLARAGGAAFAV
FT                   IARETTLAGGRALGERIRRAVARSRCAWQPQDGGEAASIGVKVSVGVAEVAEGRTQREV
FT                   MESAGRALQLAKQAGRNTVVALPMAPAEGRPDPAQAAMTRGGAAP"
FT   gene            528643..529548
FT                   /locus_tag="AnaeK_0458"
FT   CDS_pept        528643..529548
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0458"
FT                   /product="protein of unknown function DUF72"
FT                   /note="PFAM: protein of unknown function DUF72; KEGG:
FT                   ade:Adeh_0430 protein of unknown function DUF72"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71700"
FT                   /db_xref="InterPro:IPR002763"
FT                   /db_xref="InterPro:IPR036520"
FT                   /db_xref="UniProtKB/TrEMBL:B4UB52"
FT                   /protein_id="ACG71700.1"
FT                   /translation="MIRYGPAGWEYRDWAGVVYPPGEGKRFDRLAYLARWFSTVEVDAT
FT                   FYRPFPAAVAARWCERVREVPTFRFGAKVWRRFTHEREAYGAEEVAQARAALDRLHEEG
FT                   RLGAALLQFPWSFKRSEASEEWLRGLFRAFAGLPLALEVRHASWDDPEVLEELAAAGVA
FT                   LVNVDQPRFQRSLAPAARVTAPVAYVRVHGRNYRDWFRKGAPRDARYDYLYGADELEPW
FT                   AGRIAEMAASPRAPDVYVVTNNHFRGQAPANAKMLEAMVEHRRVAVPPPLLAAYEAALA
FT                   PFVAPAGDDAATGNSATTGA"
FT   gene            complement(529467..530264)
FT                   /locus_tag="AnaeK_0459"
FT   CDS_pept        complement(529467..530264)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0459"
FT                   /product="exodeoxyribonuclease III Xth"
FT                   /EC_number="3.1.11.2"
FT                   /note="TIGRFAM: exodeoxyribonuclease III;
FT                   exodeoxyribonuclease III Xth; PFAM:
FT                   Endonuclease/exonuclease/phosphatase; KEGG: ade:Adeh_0431
FT                   exodeoxyribonuclease III"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71701"
FT                   /db_xref="GOA:B4UB53"
FT                   /db_xref="InterPro:IPR004808"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR020847"
FT                   /db_xref="InterPro:IPR020848"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="InterPro:IPR037493"
FT                   /db_xref="UniProtKB/TrEMBL:B4UB53"
FT                   /protein_id="ACG71701.1"
FT                   /translation="MKIGTWNVNGIRAREAQVGEFIAREAPDVVCLQEIKAPPSKVPPS
FT                   LCELEGYWCLWHGETAYSGVALLVRKAIAPERPAFVHPPFDLETRIATCELGGVTVASI
FT                   YVPNGGKDLAAKLRFLEAMERFAADAQASGRRLVLCGDLNVARTDLDVHPKERKAGAIG
FT                   QLPEERALFERILSRGLVDVGRALDPANEGLFTWWAPWRNLRQRNIGWRIDYVLASASL
FT                   AASATRCRVLADFGTSDHAPVVAEFPVAASSPAGATNGASAAS"
FT   gene            530407..532266
FT                   /locus_tag="AnaeK_0460"
FT   CDS_pept        530407..532266
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0460"
FT                   /product="inositol monophosphatase"
FT                   /note="PFAM: inositol monophosphatase;
FT                   ADP-ribosylation/Crystallin J1; KEGG: ade:Adeh_0432
FT                   inositol monophosphatase/ADP-ribosylglycohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71702"
FT                   /db_xref="GOA:B4UB54"
FT                   /db_xref="InterPro:IPR000760"
FT                   /db_xref="InterPro:IPR005502"
FT                   /db_xref="InterPro:IPR036705"
FT                   /db_xref="UniProtKB/TrEMBL:B4UB54"
FT                   /protein_id="ACG71702.1"
FT                   /translation="MTDLSRALEAALRAARAAADLLRAELFRAGGPRGEPGHCPADEEA
FT                   EDLIRAVLDAEFPGDGLVGEERPERNRPPALPGGRCWLVDPNDGTADFQRGHRGAAVSI
FT                   GLVQGGVPVLGVVLAHTAPHGGEDLLAWAEGQGPVRRNGAPLPPMSAAPLRAGDVVLVS
FT                   SSAAKRARGNAEAVQPARFRPLTSIAYRLALVATGDARGAISLHRPRALDIAAGHALVR
FT                   GAGGVLLDEAGREVRYGPAGEGRVAFCFGGAPPVAARLASRSWVEAQAYGPGAPGLCAP
FT                   LAGRAVRDDGLLRRGQGALLGQFAGDALGGQVEFSGPARIAATHPGGVRDLADGGHWST
FT                   LAGQPTDDSELALALARTVIAFGRFDAARVAEAYADWLGSEPFDVGRTVDAALRPALRL
FT                   RAAGAGAEQVAEAARAAASRGSLANGALMRVSPLGIAGHASPAAEVAAWARADAALTHP
FT                   AAPCQDASAVFAATVAFAIATGASAAEVADRGEALAAELGCGPEVREALAAARTGPPED
FT                   FETSAGLVTIALQNAFFQLRHAPDLEAGLVDTVGRGGDTDTNAAIAGALLGAVHGVLAV
FT                   PERWRRAVLSCWPVEGAPGVRRPRPPVCWPGDALILAERLLGL"
FT   gene            complement(532327..534054)
FT                   /locus_tag="AnaeK_0461"
FT   CDS_pept        complement(532327..534054)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0461"
FT                   /product="HNH endonuclease"
FT                   /note="PFAM: HNH endonuclease; SMART: HNH nuclease; KEGG:
FT                   ade:Adeh_2806 HNH endonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71703"
FT                   /db_xref="GOA:B4UB55"
FT                   /db_xref="InterPro:IPR003615"
FT                   /db_xref="UniProtKB/TrEMBL:B4UB55"
FT                   /protein_id="ACG71703.1"
FT                   /translation="MDAALATAGLDAAALDAALARHAPPRVELPPFTPAEIEAWFRGGE
FT                   IEGDLGEQLLVWAARVRGCIDVELAEGLAALKRGDRLAALGCHFDDYAREALDLGKRAA
FT                   ENLARLGAGLPDRPLLREALRSGRVRLRAGETILAVAVGDAEAAWVERAGEESVRGLEA
FT                   AVRAARARDDASGHARGGTGDEDGAWVELRTQLPPEERRVLDEALSVARELEPGASRIE
FT                   QLEALAQEYLAEHPGDPDADDARPLGPGFRARGPEPARRGAVASLGRDGWADLPDVPPV
FT                   AAPDLSLDDGLTAQELDARLRALAACRAGWDRLIGLCGYAVKRSGMHRLSGYGSFREYV
FT                   EERLGLPARAVEQRVALEARLAASPALEEARRRGVSYEKLRVLARLHEPEIAQWIPRGL
FT                   DATCVALRREVEGEREGQLRARGKLVTTLPRGVAVLLAAAIASVRERHGHALSTGTCLA
FT                   VIAFHFLATWGDAPGRSPTRSRRIRERDSGWCQVPGCSRHAAHAHHIDFRSHGGSDDPE
FT                   NLVGLCAFHHLRCIHGGYLRVLGRARGELVWLLGGQVWAGPQRPPATGSAGDAAPAAC"
FT   gene            complement(534293..534463)
FT                   /locus_tag="AnaeK_0462"
FT   CDS_pept        complement(534293..534463)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0462"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pap:PSPA7_5329 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71704"
FT                   /db_xref="UniProtKB/TrEMBL:B4UB56"
FT                   /protein_id="ACG71704.1"
FT                   /translation="MSDLTTAEKRKLERPFKMGSGCVLNLSNRTMADFIEEHSGRDYAK
FT                   DHPQRGTGSKA"
FT   gene            complement(535093..536929)
FT                   /pseudo
FT                   /locus_tag="AnaeK_0463"
FT   gene            complement(535600..535848)
FT                   /pseudo
FT                   /locus_tag="AnaeK_0464"
FT   gene            complement(536108..536233)
FT                   /locus_tag="AnaeK_0465"
FT   CDS_pept        complement(536108..536233)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0465"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71705"
FT                   /db_xref="UniProtKB/TrEMBL:B4UB57"
FT                   /protein_id="ACG71705.1"
FT                   /translation="MMGLFCMASHNCQDWAGETCKAYARLSKDPTVQEDCKPCGK"
FT   gene            complement(537113..538831)
FT                   /locus_tag="AnaeK_0466"
FT   CDS_pept        complement(537113..538831)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0466"
FT                   /product="RHS protein"
FT                   /note="PFAM: RHS protein; KEGG: ade:Adeh_2813 YD repeat
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71706"
FT                   /db_xref="InterPro:IPR001826"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR022385"
FT                   /db_xref="UniProtKB/TrEMBL:B4UB58"
FT                   /protein_id="ACG71706.1"
FT                   /translation="MILWGRQTLVGSGANSGGDGISCARDADVSDPTARFKYDAQGRRI
FT                   ARWVAATGQWTYFVFGPSGELLSELAFTNDPSQPWMPLRDYVWLDGRPLAQLEYAPSAA
FT                   PRPYYFHLDHIGMPRALSSLEGATVWSAATKPYGEVSETMTPDPVTGRPIVTNLRLPGQ
FT                   YDERLLRSVGLQGPYYNWSRWYLPGVGRYLELDPIALAGGFNGIGWFAPDWYNYGGGNP
FT                   LRWTDPTAYRSRIQSRTNAGRTTTLWCVSLHRDARFLSRGPLQCGLGSRGTTRSLTQRR
FT                   TIAHRRASATACAGGGRLGAGSERRRRGRPQGQEPERLSEAVRKPVLRRALREHQGPVQ
FT                   MTGRSEILPALVSFVVGAKADDHSRRVAATVLLLEHPENPELARALRSGSVAVHERFLA
FT                   QYCGAAPKDSLTALVGTPLVRRLRPHLFESLWRAALRAAKSDARRTALGSALAAYLRAW
FT                   PRAARRFRQDVRSYLHSTRPALRQRGLELAGLLDKMGGDDLAVVQGSLASRSQYIRMAA
FT                   LFAVYQMASRGASAPPAARRFVASPVIKETVRALATRDRDADVRVGARNCLASLP"
FT   gene            complement(539391..543128)
FT                   /locus_tag="AnaeK_0467"
FT   CDS_pept        complement(539391..543128)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0467"
FT                   /product="exonuclease SbcC"
FT                   /note="KEGG: ade:Adeh_0433 exonuclease SbcC"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71707"
FT                   /db_xref="GOA:B4UB59"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038729"
FT                   /db_xref="UniProtKB/TrEMBL:B4UB59"
FT                   /protein_id="ACG71707.1"
FT                   /translation="MRILAIRGENLASLYGKFELRLDRAPIAGAGIFSIAGPTGSGKST
FT                   LLDALCLALYGKTPRLRDRAAGKRVMVGWSEEGETLDMNDVRALVSRGTAGATAEVEYQ
FT                   GMDGRRYLARWRVRRARDRVEGAFQAQAMTVEDLDTGEVLAEKVTQAVARNEAAIGFTF
FT                   DELKRAVVLPQFEFTNFLRADADVRAAILERVTGTAVYGRLSQAAHQRLGRELAARQAL
FT                   EAELGGVKVLDAEARAALQARQAELARALEEAKAAARAAEAEVRWHQRDAELRDGLERS
FT                   EAELARAAGAVEDGATLRAELAEVEAAEPHRAALAEAVRAEQARAGAEARAAEAMGALG
FT                   RAEADAGAAARGEADARAALEAAAEAEARARPELAEARRRDEALAAALRAEADAGAAHA
FT                   TARAEQAQAAAGADAAARARQAAETARDAAEAWLAAHAAEASLAAEWNRWAARLAEHAA
FT                   ECAGAAQAGAGLRGAREAAAEAARALATEARGAEETARRLESAGAALAEAARAAAGADA
FT                   AALTAEVARLGELRALLGEAWKAAQAAGVAAARREQARAEAARAEGEADAARRAHGAAS
FT                   AAVHAAEGGAEQARAALRRVELTLGLADRRADLADGEPCPLCGATEHPYAHGAPLPALL
FT                   EAQRAAAADAEEAVRAATREREALAARASELAARVEAERRSEVRAEADRAQHAAEYDAL
FT                   RARLAAPAGGALELPAHAEGAAAAVEACGRDAKAALEAARVALEAARHAADAERAARAE
FT                   VDAAREAHDAARARQRALEKARDDATAAVAAHEAAGARHAAALGRIEAELAPALGFLPG
FT                   WPEAARRGPEAFRAACAGRAEAYAAQVRARDAAAADVAARATGAEKAAALAAERAGRAA
FT                   RAGEAAAGAAAARERAEAERRGVLAGKPADEVEGALRAALDRARTAHERARAARADADR
FT                   AHAAAAEAARATATAREDAAAEAARAGEALAAALAALGVDRPALEARLARGHAWAAQAR
FT                   AELETRARAAQAAGAVRDERRRQVEAHAAGRPAGDAEDARARHAEAEREAARLGDEHSQ
FT                   VKLELDLDKEARARHEEVSGALEAARTAADRWERLAKVIGSADGSRFRRYAQGLALDGL
FT                   LAAANVHLRDLARRYELMRVPGADLEIQVIDHDLADEVRTVNGLSGGELFLVSLALALG
FT                   LASLSTRAAHARTLFIDEGFGTLDRDTLEHAMAALEGLRQTGRTVGVISHVPELHERIG
FT                   VQVTVERVSAGRSRLVVPEG"
FT   gene            complement(543125..544378)
FT                   /locus_tag="AnaeK_0468"
FT   CDS_pept        complement(543125..544378)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0468"
FT                   /product="nuclease SbcCD, D subunit"
FT                   /note="TIGRFAM: nuclease SbcCD, D subunit; PFAM:
FT                   metallophosphoesterase; KEGG: ade:Adeh_0434
FT                   exodeoxyribonuclease I subunit D"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71708"
FT                   /db_xref="GOA:B4UB60"
FT                   /db_xref="InterPro:IPR004593"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR026843"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="InterPro:IPR041796"
FT                   /db_xref="UniProtKB/TrEMBL:B4UB60"
FT                   /protein_id="ACG71708.1"
FT                   /translation="MAIRILHTADWHLGHALHGVDRGPEHERFVAWLLDTVEAEAVDAV
FT                   IVAGDVFDASNPPAGAQALWYRFLAEAWRRLPRLQLVVVGGNHDSASRLDAVDPLLREM
FT                   GRLHVVGGVPRAAAGAPDLERLLVPLEDASGRRAAWVAAVPYLRAADLGAGAADDDAAE
FT                   ATRRFYAAAVERVRARRAPGEALLATGHLYAVGGKTSELSERRLAVGNQAAVPADAFPA
FT                   DLAYVALGHLHLAQAVGGRETVRYSGSVLPLSFGERGYRHGVVVADVEGEAVRAQRVLR
FT                   VPRFVELVSVPDAEAPAPLPEVLAALEALPARGDGPDALRPLLEVKVRLERPEPALRAL
FT                   LDQALAGKEARLVRIATTLAGTGRALGDGERRALGDLVPEEVFRRKYDADYGGPPPDAL
FT                   LEAFRALLQEVESEEGAR"
FT   gene            544627..544902
FT                   /locus_tag="AnaeK_0469"
FT   CDS_pept        544627..544902
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0469"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ade:Adeh_0435 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71709"
FT                   /db_xref="UniProtKB/TrEMBL:B4UB61"
FT                   /protein_id="ACG71709.1"
FT                   /translation="MGARAQARSERLRRRLQSERVHLVIEYVTLADGSWAALCGMPEAI
FT                   ALGATYAEARERLCAELGERMGRAALEAATVVEDVPFGAEELGMAY"
FT   gene            complement(544926..545276)
FT                   /locus_tag="AnaeK_0470"
FT   CDS_pept        complement(544926..545276)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0470"
FT                   /product="Rhodanese domain protein"
FT                   /note="PFAM: Rhodanese domain protein; KEGG: ade:Adeh_0436
FT                   rhodanese-like"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71710"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:B4UB62"
FT                   /protein_id="ACG71710.1"
FT                   /translation="MKVPWWFPFGSVAEVSAVELNDRLRGRPAPQLVDVRTAAEFAQGR
FT                   IRGAVNVPIGELRSRLDALKLDPARPVVAICLSGHRSVPAVRLLERGGFEAAQLAGGML
FT                   AWRGARLPEVKG"
FT   gene            545383..546675
FT                   /locus_tag="AnaeK_0471"
FT   CDS_pept        545383..546675
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0471"
FT                   /product="chromate transporter, chromate ion transporter
FT                   (CHR) family"
FT                   /note="TIGRFAM: chromate transporter, chromate ion
FT                   transporter (CHR) family; PFAM: Chromate transporter; KEGG:
FT                   ade:Adeh_0437 chromate transporter"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71711"
FT                   /db_xref="GOA:B4UB63"
FT                   /db_xref="InterPro:IPR003370"
FT                   /db_xref="InterPro:IPR014047"
FT                   /db_xref="UniProtKB/TrEMBL:B4UB63"
FT                   /protein_id="ACG71711.1"
FT                   /translation="MGAHATPPPGAAPATLSRRPRPTLPALARASAWLGLTGFGGGLSV
FT                   LGTMHDLLVERRRWLTDREFTVTATVSQMLPGGAAANALAYTGLRFHGPAGAVAAYAAF
FT                   IAPGAIGVTALAALYVRLGVTPTAAPLLAGLNAAVVGIVASITLQMLRAAVQRPWQMGV
FT                   AAATLLFSLGAAASAGEMAALGIGAGLVLDLGVKRMRLARFQRRARRPPPPVALPDEGM
FT                   PLPAPEREDDPLAAPASADTPTRLPALALLSVPALGALGAMALLFLRAGLGAYGGGFAI
FT                   IPHLQASVLAEHWIGPRQFADAVAIGKLTPGPVLLMATFIGYLVHGIAGAAVATAAVFA
FT                   GPLALVLAVGAWLARVRSRRPVRAALRGLTPAVVGLMAAAALALGRSLEGRVELAIAAA
FT                   SLLTLVRFRVNPVLVMALGGAVRLALSLAGL"
FT   gene            546756..547247
FT                   /locus_tag="AnaeK_0472"
FT   CDS_pept        546756..547247
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0472"
FT                   /product="NosL family protein"
FT                   /note="PFAM: NosL family protein; KEGG: ade:Adeh_0438 NosL
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71712"
FT                   /db_xref="InterPro:IPR008719"
FT                   /db_xref="UniProtKB/TrEMBL:B4UB64"
FT                   /protein_id="ACG71712.1"
FT                   /translation="MSPLRSLVLLATLTTLAAPAQPAAGTPAAAATSPGPKDRCAVCGM
FT                   LVARFPQWVASIRYRDGEVAFFDGVKDLLVYWHDLPRHAPGRAQGDVAAIFVTDYYSTR
FT                   PIDGRAAFYVIGGDVRGPMGAELVAFAREGDAKAFLNEHRGERILRFDDATPAVLEALR
FT                   "
FT   sig_peptide     546756..546848
FT                   /locus_tag="AnaeK_0472"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.631 at
FT                   residue 31"
FT   gene            547244..547528
FT                   /locus_tag="AnaeK_0473"
FT   CDS_pept        547244..547528
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0473"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ade:Adeh_0439 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71713"
FT                   /db_xref="UniProtKB/TrEMBL:B4UB65"
FT                   /protein_id="ACG71713.1"
FT                   /translation="MSLRRSDRFLAVLAVAAVLGAAALADARARRAADRPAAEERARLV
FT                   ARLGLTDPCLFNDARYTRHLSQADRFAPFQDHPRALEHFPSGSLTAGAR"
FT   sig_peptide     547244..547321
FT                   /locus_tag="AnaeK_0473"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.948 at
FT                   residue 26"
FT   gene            547525..548673
FT                   /locus_tag="AnaeK_0474"
FT   CDS_pept        547525..548673
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0474"
FT                   /product="protein of unknown function DUF214"
FT                   /note="PFAM: protein of unknown function DUF214; KEGG:
FT                   ade:Adeh_0440 protein of unknown function DUF214"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71714"
FT                   /db_xref="GOA:B4UB66"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="UniProtKB/TrEMBL:B4UB66"
FT                   /protein_id="ACG71714.1"
FT                   /translation="MRLRAALERQRSLLDFALGALGRRRGKTVALVAVHALLVFALASV
FT                   LLFTGGLRQQVRAALRGAPDLVVQRMAAGRHEQVPAGWVETLGALRGVSAARGRLWGYY
FT                   FEPVSGANLTVMVPDGGWATPGGAVAGPGVARVLGLKEGDRLPLRTYDGEALDLGVAAV
FT                   ASPAVELVASDLLLVSEGDYRALFGAEPGRFTDVAVAVPNPDEVTRLAEKIVRMFPDAR
FT                   VVTRAEMIRTYDAVLDWRSGLAAAVLAGAVLAFAILAWDRASGLSAEERHELGILKALG
FT                   WDTRDVLAAKAWEGAAVSLSAFAVGTLAAYAHVFLGGAALLRPILEGWAALYPDLRPAP
FT                   PVEPLALGTLFFLTVIPYVAATVVPCWRAATVDPDALMRGDA"
FT   gene            548670..549356
FT                   /locus_tag="AnaeK_0475"
FT   CDS_pept        548670..549356
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0475"
FT                   /product="ABC transporter-related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: ade:Adeh_0441 ABC transporter, ATPase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71715"
FT                   /db_xref="GOA:B4UB67"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B4UB67"
FT                   /protein_id="ACG71715.1"
FT                   /translation="MIQLREVTKVFDEGRPGALAAVDRVTLEVAGGAVTVLVGPSGSGK
FT                   TTLLTLLGAMARPTEGRIFLDGRELTSLPERFLAALRRRTFGFVFQQFHLLPALTALEN
FT                   VMLPALPSGEPRRAVEARARAALARLGVEARAGVRAGRLSGGEAQRVALARALVDDPKV
FT                   IVADEPTAHLDSARARALMEIVRGLKAEGRTVVVASHDPIVYAADCVDRVVRMRDGRIV
FT                   APGAEP"
FT   gene            549353..550345
FT                   /locus_tag="AnaeK_0476"
FT   CDS_pept        549353..550345
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0476"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ade:Adeh_0442 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71716"
FT                   /db_xref="GOA:B4UB68"
FT                   /db_xref="UniProtKB/TrEMBL:B4UB68"
FT                   /protein_id="ACG71716.1"
FT                   /translation="MILSPPVLALQAGAAASSGFLLYALRWAAPVVRRWDPASGSRAQL
FT                   RLERRALLVGVLVRTALAVQLASLALFVHASDALAPMFTGAMCAAGTLSASRYGWPALA
FT                   VQVAATVVAGAWLAIDRADGLAPDQPLVRVKHALLPAVAIPVVAGAALQAAHFLALRPE
FT                   IITSCCGSLFGREGRGGWAGLAWLPPRAAGALLVAVPGAAALAALALRRTGRGARAVAA
FT                   LSALAGPAAAAGVIAWLSPYVYEAPGHRCPFCLLQPEQGWVGYPLHAAVLVGCVAGVAV
FT                   GVLQPFRRVPSLAGPLPALQRRLAGAAALAWIALLAGAAALVAASGLRA"
FT   sig_peptide     549353..549439
FT                   /locus_tag="AnaeK_0476"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.788) with cleavage site probability 0.702 at
FT                   residue 29"
FT   gene            551301..552386
FT                   /locus_tag="AnaeK_0477"
FT   CDS_pept        551301..552386
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0477"
FT                   /product="cation diffusion facilitator family transporter"
FT                   /note="TIGRFAM: cation diffusion facilitator family
FT                   transporter; PFAM: cation efflux protein; KEGG:
FT                   ade:Adeh_0444 cation diffusion facilitator family
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71717"
FT                   /db_xref="GOA:B4UB69"
FT                   /db_xref="InterPro:IPR002524"
FT                   /db_xref="InterPro:IPR027469"
FT                   /db_xref="UniProtKB/TrEMBL:B4UB69"
FT                   /protein_id="ACG71717.1"
FT                   /translation="MHLEDLGPWKHGHAFGTAVEASGERRTRWVVALTLAMMVGEIAAG
FT                   MVYGSMALLADGWHMGTHAAALGVAAFAYAYARRHAADPRYSFGTGKVGALGGFASAVG
FT                   LAVVALLVLGESAVRLASPVAIRFDQAIGVAVLGLLVNLFSAFLLRDEDHGHAHDHGDH
FT                   EDHDDHPAHDHGAHGHAHNDHDHDEHGHAHRDHDHDAHAHAVHAPGHDEHRDHNLRAAY
FT                   LHVLADALTSVLAIVALLAGRVLGWTWMDPVMGIVGALVIARWSVGLLRDTGAVLLDAE
FT                   VAEGRRAAIRAALEQGEDRVADLHLWRVGPRHLAAIVSVVSTAPRAPAEYKERLHAFPD
FT                   LVHLTIEVHACEAAPGARAAR"
FT   gene            complement(552387..552911)
FT                   /locus_tag="AnaeK_0478"
FT   CDS_pept        complement(552387..552911)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0478"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ade:Adeh_0445 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71718"
FT                   /db_xref="InterPro:IPR012312"
FT                   /db_xref="UniProtKB/TrEMBL:B4UB70"
FT                   /protein_id="ACG71718.1"
FT                   /translation="MSAREAGRIERFLSDDHLQLDGLLTRAAADPAAIDRPSYDAFRGG
FT                   LLRHIALEEKVLLPAAREAQGGEPLPLARRLRIEHGAIASLLVPTPTHALVGEIRKILE
FT                   PHNLLEEAPDGLYATCDRLLAARAEEIVARMAAYPPVKVAAYNDGPRVLRTAEAALEQS
FT                   AKQAEARPGPR"
FT   gene            complement(552908..553381)
FT                   /locus_tag="AnaeK_0479"
FT   CDS_pept        complement(552908..553381)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0479"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ade:Adeh_0446 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71719"
FT                   /db_xref="UniProtKB/TrEMBL:B4UB71"
FT                   /protein_id="ACG71719.1"
FT                   /translation="MPTPAAEIVTRYAAGAATHPNGKPLAPDAAAAWAALARPDAGRLG
FT                   AARVRDSARREWLLEAHRELERGRFVVLRPAHGDLEPFRASADGYRPEAYLPISEQDWL
FT                   LLALLAAGRDGDAGRDDPELAGAAFPLVDRMVREAQHRQLMGEASDEDDEEAP"
FT   gene            complement(553484..554209)
FT                   /locus_tag="AnaeK_0480"
FT   CDS_pept        complement(553484..554209)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0480"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ade:Adeh_0447 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71720"
FT                   /db_xref="UniProtKB/TrEMBL:B4UB72"
FT                   /protein_id="ACG71720.1"
FT                   /translation="MNPKQLVPLLSLALAALLAPAAARAHCDTLDGPVVVAAKAALESG
FT                   KLSPVLAWVQPADEAEIKAAFAKTRAARKAGGEAREVADTWFLETLVRVHRAGEGAPYT
FT                   GLKPAGADLDPAVVAMDRAIAKGDPAEVERLLQAAVHQGLEKHWTRLAAEKAPADDVAA
FT                   GRRWVAAYVPLVHWAEGVNAAATQGGAHAGHAEAGAADPHAAHAKPGARAPAADPHAAH
FT                   GRAPAKAPVKPAADTHHAH"
FT   sig_peptide     complement(554132..554209)
FT                   /locus_tag="AnaeK_0480"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.983 at
FT                   residue 26"
FT   gene            complement(554215..554886)
FT                   /locus_tag="AnaeK_0481"
FT   CDS_pept        complement(554215..554886)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0481"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: ade:Adeh_0448
FT                   transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71721"
FT                   /db_xref="GOA:B4UB73"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:B4UB73"
FT                   /protein_id="ACG71721.1"
FT                   /translation="MQSSSASRSARKPGTDRRREIADAALRVIAAQGAAHFTALAIARE
FT                   VGVSDAALFRHFPTKDAIAAAAIDRMEELLFEGFPPEAADPLARLGAFFRKRVAVIRAN
FT                   PAIARVFASDDVGLVGDGAGAARLEAFRRRSTAFVRGCLEEARRAGGLSPEAGIDEALV
FT                   LVLGALLALAHSPGAASRPPELVERVWRTLETFLRRPDGRAAAAERRPPRAPRSRRTDE
FT                   R"
FT   gene            complement(554988..555698)
FT                   /locus_tag="AnaeK_0482"
FT   CDS_pept        complement(554988..555698)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0482"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ade:Adeh_0449 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71722"
FT                   /db_xref="GOA:B4UB74"
FT                   /db_xref="UniProtKB/TrEMBL:B4UB74"
FT                   /protein_id="ACG71722.1"
FT                   /translation="MWEAVAITLRESFQRLAVNAARLVPGLLATLVFALLSLALAWACA
FT                   RLVRRILKAVQLDRLLRRWAPAEDRSRLPSLVTGATRLTFWLTFAVGLALSLTSVESRW
FT                   TSALAERVLTYAPSVIVAGVLFAAAVALSRWVEASVLVSAVNMQIRSARLLATGARWLV
FT                   TVLGGAMALQHLGVGGALVTISFSILFGGIVLALALAVGLGSREVVTRSWERRLRDRDE
FT                   AHPHDEEPPRIAHL"
FT   gene            555904..558075
FT                   /locus_tag="AnaeK_0483"
FT   CDS_pept        555904..558075
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0483"
FT                   /product="HAD-superfamily hydrolase, subfamily IIB"
FT                   /EC_number="2.4.1.15"
FT                   /EC_number="3.1.3.12"
FT                   /note="TIGRFAM: HAD-superfamily hydrolase, subfamily IIB;
FT                   PFAM: glycosyl transferase family 20;
FT                   trehalose-phosphatase; KEGG: ade:Adeh_0450
FT                   trehalose-phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71723"
FT                   /db_xref="GOA:B4UB75"
FT                   /db_xref="InterPro:IPR001830"
FT                   /db_xref="InterPro:IPR003337"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:B4UB75"
FT                   /protein_id="ACG71723.1"
FT                   /translation="MSRVVIVSNRLPVTVERAAEAVRVVPSVGGLATGLRRPHEQGGGP
FT                   WVGWPGDLAGLDPEQQARVEARLSDLRLVPVHLTSEEVQRYYQDYSNALLWPVFHSFPG
FT                   EVPLEIGGAAEYERVNARFADAVAATARPGDVIWIHDYQLLRLPALLRERLPEARIGFF
FT                   LHIPFPSSDLFRVLPQREALLEGMLGADLIGFHTASYMRHFSSSVLRVLGAWTDVDRIR
FT                   WRGREVRIGVFPMGVDAADFAGTAHGADMDEEVRALRRDGSRLIVGIDRLDYTKGIPRR
FT                   LLAYERLLREHPELRGKVRLVQVAVPSRTEVGAYQEFRDQVDGLVGRIHGAFATPTWSP
FT                   IHYLSRGLDRPQVVALYRAADVMLVTPIRDGMNLVAKEFVAVRDDGDGVLVLSEFTGAA
FT                   AELAEAVQVNPYDEAGTAAAIQRALEMPEDERRTRMTGLRRRVTRYDVHWWARTFLDRL
FT                   REAPAPVRPQGLEVSPRAAVQDALSRLRAAPHATLLLDYDGTLVPFAPTPELARPDREL
FT                   RDLLRELARHPRLAVHLVTGRQRDTVDRWFGDLGIGLHAEHGFWSKLPGNGWQLAAPVS
FT                   TAWREPARAILEEFAARTPGSLVEEKSAGFAWHYRTADPDFGAAQAHDLMLHLSTVLSN
FT                   APVEILPGALVVEVRPQGVDKGKVVARAAAASPEGSLLAALGDDRTDEDMFAALPTGAI
FT                   AVHVGPSPSRAPLRLAGVPESRAFLRGLL"
FT   gene            558384..559247
FT                   /locus_tag="AnaeK_0484"
FT   CDS_pept        558384..559247
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0484"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ade:Adeh_0451 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71724"
FT                   /db_xref="GOA:B4UB76"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012348"
FT                   /db_xref="UniProtKB/TrEMBL:B4UB76"
FT                   /protein_id="ACG71724.1"
FT                   /translation="MLYPELFRSLERARWSLEDDVPWSSFDPAALSDEQALTVKMNAIT
FT                   EWSALPATEMFLRDNRHDSDFSAFMSIWFYEEQKHALVLMEYLRRFRPDLVPTEDELHA
FT                   VRFEFDPAPALETLALHFCGEIRLTQWYRRAAEWHTEPVLKQVYGLISQDEGRHGGAYL
FT                   RYMRQAIERHGDAARAAFAKLGVLMASSGRSGKPLHPTNLHVNQQLFPRDTVQSRLPDP
FT                   GWLDRWLDGQIRFDEGCERRVVRTMLRSLSALLGESFETVRDLNRYRKSLAGAAAPAAS
FT                   AAPMHA"
FT   gene            complement(559257..560222)
FT                   /locus_tag="AnaeK_0485"
FT   CDS_pept        complement(559257..560222)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0485"
FT                   /product="aldo/keto reductase"
FT                   /note="PFAM: aldo/keto reductase; KEGG: ade:Adeh_0452
FT                   aldo/keto reductase"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71725"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:B4UB77"
FT                   /protein_id="ACG71725.1"
FT                   /translation="MTSSIPQRRRLGATDLSVFPVCLGGNVFGWTADRAASFAVLDAYR
FT                   EAGGNFVDTADVYSAWVPGHRGGESEEILGAWLRERRCRDEVVIATKVGMGGPDAAAGL
FT                   SAEKILHACDGSLRRLGVERIDLYYAHRDDPATPLEETLGAFDRLVRAGKVRHLGASNY
FT                   SAPRLAAALDLSARAGLAPFAVLQPEYNLVSRGGYEGALADLCAARGLGVCTYYALASG
FT                   FLTGKYGPGLPPPTARAGKVNALLADRAAMAVLAAAREVARAHGATVAQVALAWQLRSP
FT                   RVTAPIASATSAAQVRELAGAVEVALTADDVARLEGAGGR"
FT   gene            complement(560306..560977)
FT                   /locus_tag="AnaeK_0486"
FT   CDS_pept        complement(560306..560977)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0486"
FT                   /product="Methyltransferase type 12"
FT                   /note="PFAM: Methyltransferase type 11; Methyltransferase
FT                   type 12; KEGG: ade:Adeh_0453 methyltransferase type 12"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71726"
FT                   /db_xref="GOA:B4UB78"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B4UB78"
FT                   /protein_id="ACG71726.1"
FT                   /translation="MPPRAPRRRPARPAPPPAAASARRASPDAPGRFDAAYYRRHYRGK
FT                   DRVHSAPEIARLASGVCGLAGWLGVEVRSVLDVGAGTGLWRAWLRRHRPEASYRSIDVS
FT                   PYACARYGHEQRDISRWRARERFDLVVCHGVLHYLDDRAAARAIDNLGAMCRGLLYLEV
FT                   ITRGDLETVVDLERTDTAMHRRTGAWYRRRLARHFVQVGAGLWAARRAGLPFYELEAAR
FT                   G"
FT   gene            complement(561022..561213)
FT                   /locus_tag="AnaeK_0487"
FT   CDS_pept        complement(561022..561213)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0487"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71727"
FT                   /db_xref="UniProtKB/TrEMBL:B4UB79"
FT                   /protein_id="ACG71727.1"
FT                   /translation="MRERMKTPGPCGPITGNRRLGDPVHEVRAALDRSLDPACRRRAER
FT                   RVRMIAALLDGGAPTLDV"
FT   gene            561325..562119
FT                   /locus_tag="AnaeK_0488"
FT   CDS_pept        561325..562119
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0488"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ade:Adeh_0454 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71728"
FT                   /db_xref="GOA:B4UBR7"
FT                   /db_xref="InterPro:IPR021382"
FT                   /db_xref="UniProtKB/TrEMBL:B4UBR7"
FT                   /protein_id="ACG71728.1"
FT                   /translation="MPEPTQRERRPLRGGDLAAIVLALAVAGAIAYFWVHRRPAAPATP
FT                   PAVPEQSAPAATPPPAPPSAAVQADPARVKTLLEAASADPEYRRWIGAGGDLVRLWAVL
FT                   TDNLAEGVSPRKQLPFLVPEQPFSVAEQGGRRVIAPASYARYDRFGDAVASIDAKAIAA
FT                   AYRALRPAVETAYRLLGYPDAVLDRVTARALHRLESAPHPGGPVEVVPHAEAGAGWAYA
FT                   DPALEHLGAVEKHLLRMGPRNAGKVQAKAREIREALGLREAR"
FT   gene            562478..563974
FT                   /locus_tag="AnaeK_0489"
FT   CDS_pept        562478..563974
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0489"
FT                   /product="ABC transporter-related protein"
FT                   /note="PFAM: ABC transporter related; LysR
FT                   substrate-binding; SMART: AAA ATPase; KEGG: ade:Adeh_0455
FT                   ABC phosphonate transporter, ATPase subunit/LysR type
FT                   substrate-binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71729"
FT                   /db_xref="GOA:B4UBR8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR012693"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B4UBR8"
FT                   /protein_id="ACG71729.1"
FT                   /translation="MPQRLEAARAGPVAGPDATRSAPPGPALALRGAGRAYGPVRALRP
FT                   LTLEIRRGERVALLGPSGAGKSTLLRLLDTSLAPSEGMVEVLGQPIAAADARRLRALRA
FT                   RIGTVHQQLLLVPQATTMQNVVAGRLGRTSLARTLAALVSRREAARVRALLDDVGIGDK
FT                   IFERVDRLSGGEQQRVAIARTLYQDPELILADEPLASVDPARAADIAALLARAFAGRTL
FT                   VVSTHRIEPLLAHVDRVVALRDGALAFDKPAAALTLRDLGELYEARRGAALPASAPAAR
FT                   PPSDPEVAPGGTLRIGASSTPGEHLLPSIVRAFARAYPGTRVSLSLSDSAAVTEAVRAG
FT                   TLDLGFVGAREEDPSLAYEDVARDEIVLVAAPALELPPEPIALEAAVRLPRVDREPGSG
FT                   TRAVVEQHLANMGAALDPAAVVLEAGALVALKAAVVSGMGVAFVSRRAIEDDLRGGHVR
FT                   VVRVEGLSIPRHVFAVLRRDPGPGAAARAFLEVARAEVPP"
FT   gene            563971..565701
FT                   /locus_tag="AnaeK_0490"
FT   CDS_pept        563971..565701
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0490"
FT                   /product="phosphonate ABC transporter, inner membrane
FT                   subunit"
FT                   /note="TIGRFAM: phosphonate ABC transporter, inner membrane
FT                   subunit; PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: ade:Adeh_0456 ABC
FT                   phosphonate transporter, fused inner membrane subunits"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71730"
FT                   /db_xref="GOA:B4UBR9"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B4UBR9"
FT                   /protein_id="ACG71730.1"
FT                   /translation="MSAAVLQERPPLPLLLRWPGLVLAAVLGIAWRMSEGSLGALLGPE
FT                   ARSAAADFARGFWPPAHSPEFLRFLVRPLGETVAIAFAGMTLALVLAAPLAWLATAPGV
FT                   ARADGDAPGPLRRAAWVGARTVLNLMRSVPELVWALVFVRALGLGPAAGVAAIGIGYAG
FT                   VVGKVFAEIWESSPCAPARALAAAGAPPRRAFALAVLPGSAPLLASYALYRLDCALRAS
FT                   AVLGLVGAGGMGVQLELSLKMFAYDEVATLVLALFAVVAAVDLLSAWARRRLAGSRGLY
FT                   PAGPGALRWRAAIVGTWLALAAGAAAYLELPLGELFSGATLRSAAAFFASMFPPDLSPG
FT                   FLRGLVPAAAETLAVSILGSAIASVLGLGLALAAVHPGARGLAGSPGDSRLRSGARLAL
FT                   AAGARGAMNLLRTLPELLWALLAIFAVGLGPFAGALALGIHNSGVLGRLYAEALEEVPP
FT                   GPVAALRGAGARPLAATLLGALPQAWPQLVAYTLYRWEVAVRASAVLGVVGAGGIGALL
FT                   HVSLNLFQHHRTLTLVAAIVVLVTAVDLFSGWLRARMLAGPASRAAPRAACAPGLANAT
FT                   "
FT   gene            565876..566727
FT                   /locus_tag="AnaeK_0491"
FT   CDS_pept        565876..566727
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0491"
FT                   /product="phosphonate ABC transporter, periplasmic
FT                   phosphonate-binding protein"
FT                   /note="TIGRFAM: phosphonate ABC transporter, periplasmic
FT                   phosphonate-binding protein; SMART: extracellular
FT                   solute-binding protein family 3; KEGG: ade:Adeh_0457 ABC
FT                   phosphonate-binding periplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71731"
FT                   /db_xref="GOA:B4UBS0"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR005770"
FT                   /db_xref="InterPro:IPR030836"
FT                   /db_xref="UniProtKB/TrEMBL:B4UBS0"
FT                   /protein_id="ACG71731.1"
FT                   /translation="MHRIAVLSLAAVLLFPPAARALDALRVSAIPDESPTELQRKFEPL
FT                   GKYLEKQIGIPVKFVPVTDYAATVEGLAAGKLDMVWYGGFTFVQARRRTGNAIPIVQRA
FT                   EDARFHSKFIVPASSKAQSLKDLKGASFAFGSVSSTSGHLMPRYFLLQAGIDPDKDFAK
FT                   VAYSGAHDVTAKWVEAGKVDAGALNESIWQRLVDEKKVDTSKVRVLSTTPEYQDYNWTV
FT                   RGDLDPKLVEKLRAAFLALDPAKPEDKAILDLQRASRFIPTSPDAYKNIEQAAKSAGLI
FT                   KD"
FT   sig_peptide     565876..565941
FT                   /locus_tag="AnaeK_0491"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 22"
FT   gene            complement(566822..567490)
FT                   /locus_tag="AnaeK_0492"
FT   CDS_pept        complement(566822..567490)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0492"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ade:Adeh_3436 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71732"
FT                   /db_xref="UniProtKB/TrEMBL:B4UBS1"
FT                   /protein_id="ACG71732.1"
FT                   /translation="MTLLAAPLIFSTYTVVDKLAGNVALPWAETARLNLGFAYGFSAFA
FT                   AFLFARPRRHGLPAGGRVVLRIPTWRRFAFASMMPGFFALADLDVVLRGEAPLDVVAAL
FT                   AGVAAVCLAVTTERLAFFGEGIQRLSGLGARHRILWGDISKVEVSPASITIHGKSGKTI
FT                   AVAGLWLDGYPELVVAVLERAPKQVLHALDEERREQLLCIAELMDPAAAARHRAAFQGG
FT                   "
FT   gene            567754..568422
FT                   /locus_tag="AnaeK_0493"
FT   CDS_pept        567754..568422
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0493"
FT                   /product="transposase"
FT                   /note="KEGG: ade:Adeh_0459 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71733"
FT                   /db_xref="GOA:B4UBS2"
FT                   /db_xref="InterPro:IPR002686"
FT                   /db_xref="InterPro:IPR036515"
FT                   /db_xref="UniProtKB/TrEMBL:B4UBS2"
FT                   /protein_id="ACG71733.1"
FT                   /translation="MARVPRFAMVERDSSNHCTWRAHDFEFVFEEVGARDKFLELLGRY
FT                   KDRYCIEIGSYCLMGTHPHVTCTCRQEQVQFSRFWQAVNGLFARWYNKVRNRRGQVVME
FT                   RMRSPRIQDGGAHQLRVMRYGDLNPVRAGLVKSPKDWKWSSYRHYAFGEPNPLITDAPE
FT                   YLALGKTPQERRKAYQALFALPLSESLRTRRVELVSFPFVGDASWVMHRLELAGLSPPD
FT                   "
FT   gene            568419..569276
FT                   /locus_tag="AnaeK_0494"
FT   CDS_pept        568419..569276
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0494"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71734"
FT                   /db_xref="UniProtKB/TrEMBL:B4UBS3"
FT                   /protein_id="ACG71734.1"
FT                   /translation="MTAAGIAPTERPFALTRAVRADVLGRLRRRIPSCGWRAADSGRTR
FT                   AELMRLGVLDGSRGHVGPNGAKLLSCWCSTPLPDPHLRSDYPRRTSAPSTLSAAEPMHS
FT                   SSSRRTMLVSLLWRVPAVEETQHSRHVGEGFQRRVIQRDAHHAPEPRDGVHGSPRARGA
FT                   AEKPPAGRCDSGGHDTALDLRRRDEGAFGHARDPLVRRDFGDERGEELGRACVWAGLRP
FT                   GTERTAGGRRRRHVPRSTERPARIVPSVRSIHRTRRRFRASYDRYKGLHASRHRRLGAP
FT                   GRRR"
FT   gene            569390..570003
FT                   /pseudo
FT                   /locus_tag="AnaeK_0495"
FT   gene            570772..572496
FT                   /locus_tag="AnaeK_0496"
FT   CDS_pept        570772..572496
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0496"
FT                   /product="Propionyl-CoA carboxylase"
FT                   /EC_number="6.4.1.3"
FT                   /note="PFAM: carboxyl transferase; KEGG: ade:Adeh_0463
FT                   propionyl-CoA carboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71735"
FT                   /db_xref="GOA:B4UBS4"
FT                   /db_xref="InterPro:IPR011762"
FT                   /db_xref="InterPro:IPR011763"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR034733"
FT                   /db_xref="UniProtKB/TrEMBL:B4UBS4"
FT                   /protein_id="ACG71735.1"
FT                   /translation="MTTKAIKPTLTNPLDPPEKVEFTIPGEIARATGGYEEAMQEGWEL
FT                   IQRPIRSVPVDQIEKQHIKKRMTVWERIRVLSDKEPMVLYQNWGKNLDGASLVTAILNI
FT                   GGRDVAVYGHDFTVRAGSMDATNGSKLARLFRMAGEKGIPLIGMNDSAGAYVPAGVGGL
FT                   DGYAEAFTALRRISGVVPSIMCMFGFNAGGGSYLPRQGSFVIQPADTFFGLTGPGVVKS
FT                   VLGEEISPEDLGGPKVHGASGVADLTVIDELAALRQAVRLLNYVPDNNRSMAPFQETSD
FT                   PLDRKTWEINTLLKKAFNSPTGFNTPFDVSIIIQQVCDYGDFFEIQPERAREVVTAFGR
FT                   LGGHVVGFVANNSAIGSGQIDCDTALKIARFVRFCNIYNIPIIFMEDTTGFLPGREQEA
FT                   RGIVQAGRSMLDAIVDVRTPRILLILRNAFGGAYASYNNYPTGADVVLALPTTRLAVMG
FT                   PAGKEFVYKDELRKMRGAAAERARKGAQQRVAAGMEGEAARKDAEKEAAEWLKGEEAAL
FT                   GRRYEKELMNPKEGLALGSISSLVMPTDLRKVLGQNLHFLLRHYTPSPMSGPQREFH"
FT   gene            572537..575515
FT                   /locus_tag="AnaeK_0497"
FT   CDS_pept        572537..575515
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0497"
FT                   /product="biotin/lipoyl attachment domain-containing
FT                   protein"
FT                   /note="PFAM: biotin/lipoyl attachment domain-containing
FT                   protein; Carbamoyl-phosphate synthase L chain ATP-binding;
FT                   KEGG: ade:Adeh_0464 biotin carboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71736"
FT                   /db_xref="GOA:B4UBS5"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001249"
FT                   /db_xref="InterPro:IPR001882"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005481"
FT                   /db_xref="InterPro:IPR005482"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR011764"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:B4UBS5"
FT                   /protein_id="ACG71736.1"
FT                   /translation="MASNVDHYRNNPLIHRDRRLGSSPSAWVRSFACEDLKPLIVCRGP
FT                   IRKEAMDVFAEMGITHVGILLSEKDSIVYANALAPELRQLANHDRVHRVPDYTGATKEE
FT                   RVERMNQIVQIALDNGYDSIFAGYGFMAEDEEFVATIERAGLKFIGPNSITQARAGKKD
FT                   EAKRTALEVKVSVTPGVNDVAARTLLAKHRTRKQLLALVEAEGLACDAKVLADEKVELP
FT                   VLAEHVLQASYARGLDLFTIDELGAQVQVEVAEMFRKYPRSRVRLKAIGGGGGKGQRIL
FT                   GASLLTAKDADDKAVAAAAAEAPAMVREVLSEVKATGVGDNKNVLIELNIEQTRHNEIQ
FT                   LLGNGEWCVSLGGRDCSLQMHEQKLLEVSVTQEALAATIARAANNGKTARAKALAVDLE
FT                   ILKRMEDDAARFGQAVGLDSASTFECIVDRDRYYFMEVNTRIQVEHRVSELCYSLEFAN
FT                   PDDPSDTFVVESLVEAMALLARHKKRLPKPRRIPRFGAAVEARLNATDASLSPHAGGVI
FT                   RYWSKPIEGEIRDDQGISMPNPDTRMFMRYKVAGAYDSNIALLLTKGDRRLESYKHMAR
FT                   VLARMELRGTTLATNMEFHYGLVNWFLGQSVNAKPTTRFVVPYLTLVGMLKDEANKLDT
FT                   AYAFAEMKKHYAKLMATENPGDAAAQKAMTDVLDRKVTLLTRVIDRFLDDPHLFAGWLS
FT                   MNRRHYRIENGKLLWIRNPLGVLNDAYAYLNMAFHPRRPASQVMWEHDHELLTKSLRFY
FT                   VALRERFGLKREEYYKLNEILQKEEPQDGFDAETWTKIRSAHLGYEAGNELLGLLFMVA
FT                   ESVRFFDFKVEDDLEVTIPEHLHDPELQARMKKVLCPPPATKADELVAPFGGMFYRQEA
FT                   PGRPPFVEEGQHFEKGQPLYIIEVMKMFNTVRAPFSGTIEKVLMQGADGTVVQKGQPLF
FT                   KITPDEKFVPVDPKAVERERRTRTQKHLEGVLMTFAEKFTTVEPVRFEEPEEEVAWAGV
FT                   EAV"
FT   gene            complement(575592..576059)
FT                   /locus_tag="AnaeK_0498"
FT   CDS_pept        complement(575592..576059)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0498"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ade:Adeh_0465 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71737"
FT                   /db_xref="GOA:B4UBS6"
FT                   /db_xref="InterPro:IPR032808"
FT                   /db_xref="UniProtKB/TrEMBL:B4UBS6"
FT                   /protein_id="ACG71737.1"
FT                   /translation="MTDRTDRDEIHRTAPAYWALRIALGVVPIVAGLDKFTNLLADWAG
FT                   YLSPLAVRLLPVSPTAFMRAAGVIEVIVGVGILSGRARTFGWIAMAWLAAIALNLIASG
FT                   AFLDVAARDAVMAVAAFALARLAAVHEPVRARRAAAVEPQATAAHPAATRS"
FT   gene            576160..576846
FT                   /locus_tag="AnaeK_0499"
FT   CDS_pept        576160..576846
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0499"
FT                   /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
FT                   /note="TIGRFAM: RNA polymerase sigma factor, sigma-70
FT                   family; PFAM: sigma-70 region 2 domain protein; sigma-70
FT                   region 4 domain protein; Sigma-70 region 4 type 2; KEGG:
FT                   ade:Adeh_0466 RNA polymerase sigma factor"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71738"
FT                   /db_xref="GOA:B4UBS7"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:B4UBS7"
FT                   /protein_id="ACG71738.1"
FT                   /translation="MAVQAGRTRVVPTLAPADDEVVARVLDGDAALFEVLMRRHNPRLY
FT                   RAIRSVLRDEAEVEDAMQQAYLQAYAHLGDFQGQAAFPTWLVRIGVNEALMRLRGRGRL
FT                   VLAAEPPEGGSVGEEEHVADPSPEDQAATHEARALLEQAVDRLPLHLRTVYVLREIEQL
FT                   STAEVAAALELGEEAVKVRLHRARLALRELIAERVGQSAPEAFGFLAPRCDRVVAAVLA
FT                   AIPARR"
FT   gene            complement(576951..577451)
FT                   /locus_tag="AnaeK_0500"
FT   CDS_pept        complement(576951..577451)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0500"
FT                   /product="blue (type 1) copper domain"
FT                   /note="KEGG: ade:Adeh_0467 blue (type 1) copper domain"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71739"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="UniProtKB/TrEMBL:B4UBS8"
FT                   /protein_id="ACG71739.1"
FT                   /translation="MMSWKTWRLGAAALAAAGVAACGGSSDSGSASSTRPTAAGYYIQI
FT                   SGMRFNPLDLKVPAGATVTVINDDSMAHSVTSEATPGAYTPGEVSGIAFDTGAFNGVHT
FT                   FSIPASAAQGTVIPYYCSTHLGGMATPNGSITIDPAAQPAPPPARPGTGGGGGGGGGGG
FT                   GGY"
FT   sig_peptide     complement(577359..577451)
FT                   /locus_tag="AnaeK_0500"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.275 at
FT                   residue 31"
FT   gene            complement(577580..580249)
FT                   /locus_tag="AnaeK_0501"
FT   CDS_pept        complement(577580..580249)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0501"
FT                   /product="ATPase, P-type (transporting), HAD superfamily,
FT                   subfamily IC"
FT                   /note="TIGRFAM: ATPase, P-type (transporting), HAD
FT                   superfamily, subfamily IC; PFAM: cation transporting ATPase
FT                   domain protein; Haloacid dehalogenase domain protein
FT                   hydrolase; E1-E2 ATPase-associated domain protein; KEGG:
FT                   ade:Adeh_0468 cation transporting P-type ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71740"
FT                   /db_xref="GOA:B4UBS9"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR004014"
FT                   /db_xref="InterPro:IPR006068"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:B4UBS9"
FT                   /protein_id="ACG71740.1"
FT                   /translation="MANVPEWHALSADEALARLGSGPDGLDPAEAARRLAEHGPNELAR
FT                   GRRAPWIALLAAQFKNVLVVILMVAIALSLFLGHDLEALTIGAILAFTVVLGFVQEHRA
FT                   ENALAALRQMAAPHATVIRGGAERRVPARELVPGDLLLVHAGDRIPADARVIEAVNLQA
FT                   DEAALTGESVPVPKVAGPLPAGPIPVGDRTDMLFGGTAATYGRGRAVVVATGASTELGA
FT                   IARMLAEVKPARTPLQLELDRVGTQLARAAGVVVVLLAGLGLLRGQPFLEMVVFAIALA
FT                   VAVVPEALPAVVTIALALGVQRLARRNALVRRLAAAETLGSTTVICSDKTGTLTRDEMT
FT                   VRALHVDGRTLEVTGSGYRVEGDFRHDGAPVDSPPALLALLAGAVLASDAKVERTPSGE
FT                   LTVSGDPTEAALVVAALKAGLDRAELDARAPRVGEIPFTSELKRMTTLHRTEHGRVAFV
FT                   KGAPEVLLPACARVASGEGERPLDEAGRAALAEVVRGMAERALRVLAVARREGVSLAES
FT                   DRDLTLLGLVGMIDPPRPEARAALERCAAAGVRVVMITGDHPVTARAIAAELGLLRTGA
FT                   VVTGPELARLSDAELAGRVQALEVYARVSPADKLRIVTALQSRGEVVAMTGDGVNDAPA
FT                   LKKADIGVAMGITGTDVTREAAAMTLTDDNFASIVGAVEEGRAIFANVKKYLMYLLSSN
FT                   VGEIGLMAAATLLGLPLPLTAVQILYVNLATDGLPALALAVDPPDADLMRQPPRDPRAG
FT                   IFTRPVVALIATGGAWSTAVNLGLFAWARASGRGDAEAMTMCFMSLVLVQFAKAFAFRS
FT                   ERHSVLRRPFANRWLDLAIAWELALLLLVVYLPPLRAAFGTYALPAADWLLVTGAALTV
FT                   LPVLELAKLAVRRATPSA"
FT   gene            580364..581551
FT                   /locus_tag="AnaeK_0502"
FT   CDS_pept        580364..581551
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0502"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ade:Adeh_0469 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71741"
FT                   /db_xref="GOA:B4UBT0"
FT                   /db_xref="InterPro:IPR018657"
FT                   /db_xref="UniProtKB/TrEMBL:B4UBT0"
FT                   /protein_id="ACG71741.1"
FT                   /translation="MSASAPVLLGYGTRPLPFPSGVPARVLGAPPAPAVADLPAALDAA
FT                   LAHPEGARPLQEVAGPRTRVLVIVSDASRDEPRAELFAAVRRALAVVPDDHLTVGVANG
FT                   THGPGPLEALGLPEDVFRRHRVVNHDARDEASMVEMGRTSRGTRLRVNRCVAESDLVVT
FT                   TGRVKPHYFAGWGGGAKGIFPGLGHDDDIRQNHKLKADPASSLGRADGNPCREDLEEAI
FT                   RRLGRDTYMLNVVEAGGVVLGAVAGDVVYAHRAGVRMARPWCEVAAEPADVVVVSAPLP
FT                   VSGSLYQASKLVPPAGMLLREGGVVVVCAECPGGVGPLRTVNEGIFQLGVRRFLPERYT
FT                   LLLVSGMPEATVRETYATFAPSLEAALASAREIVGKAEPDVLVLPDAGDLVPRRR"
FT   gene            581586..582884
FT                   /locus_tag="AnaeK_0503"
FT   CDS_pept        581586..582884
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0503"
FT                   /product="aminotransferase class I and II"
FT                   /note="PFAM: aminotransferase class I and II; KEGG:
FT                   ade:Adeh_0470 aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71742"
FT                   /db_xref="GOA:B4UBT1"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:B4UBT1"
FT                   /protein_id="ACG71742.1"
FT                   /translation="MTDEPIPQGGKLSSFRQVPRTGVIYATSEATKLGFSMQDPEWCNL
FT                   GQGQPETGPLSGAPDRVHSVAVSVDDQEYAPVAGLWELREEVAGLYNRLYRRGLPSQYK
FT                   AENVSISGGGRTSLTRAAASLGRVNMGHFLPDYTAYEELLDLFRTFTPIPILLEGERGY
FT                   AFTVDDLRREVTGRGLSALLLSNPCNPTGKLVQGEELARWVELARELECAMLMDEFYSH
FT                   YVWTAPPGRLPVESAARYVEDVDRDPIVLFDGLTKNWRYPGWRVTWTVGPRKVIDAVAS
FT                   AGSFLDGGGSKPLQRAAIPLLAEEAVRQETEAIHRSFGEKRRHMLDALETMGVRIDRAP
FT                   DGTFYVWGNLANLPAPLNDGMGFFREALRRKVIVVPGEFFDVNPGKRRARHVARFRSYV
FT                   RFSFGPSLETLEKAFGRLAAMIQERSSSTASVG"
FT   gene            complement(582906..583748)
FT                   /locus_tag="AnaeK_0504"
FT   CDS_pept        complement(582906..583748)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0504"
FT                   /product="hydrogenase accessory protein HypB"
FT                   /note="TIGRFAM: hydrogenase accessory protein HypB; PFAM:
FT                   cobalamin synthesis protein P47K; KEGG: ade:Adeh_0471
FT                   hydrogenase accessory protein HypB"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71743"
FT                   /db_xref="GOA:B4UBT2"
FT                   /db_xref="InterPro:IPR003495"
FT                   /db_xref="InterPro:IPR004392"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B4UBT2"
FT                   /protein_id="ACG71743.1"
FT                   /translation="MCTTCGCGDPELVPVELHEKILAGNDRAARHNREHFLEAGVLALN
FT                   IMGSPGAGKTGVLEATAKAAATKGWKLGAVSADLATDNDARRLEKAGIPSKAITTGQAC
FT                   HLDAELVHRSLHDFPWRDTDVFFIENVGNLVCPAIYDLGQAANVVVLSVTEGEDKPLKY
FT                   PVMFKAADLVLVSKVDLVPHLDVDLPKLRDAIAHVMPTAKVIELSARTGEGMDRWIAWL
FT                   EELRRPILRPAHARSHTHTHEHGHEHTHADGTTHAHAHDHAAEHTHDHGHGHGHGHRH"
FT   gene            complement(583748..584092)
FT                   /locus_tag="AnaeK_0505"
FT   CDS_pept        complement(583748..584092)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0505"
FT                   /product="hydrogenase expression/synthesis HypA"
FT                   /note="PFAM: hydrogenase expression/synthesis HypA; KEGG:
FT                   ade:Adeh_0472 hydrogenase expression/synthesis, HypA"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71744"
FT                   /db_xref="GOA:B4UBT3"
FT                   /db_xref="InterPro:IPR000688"
FT                   /db_xref="UniProtKB/TrEMBL:B4UBT3"
FT                   /protein_id="ACG71744.1"
FT                   /translation="MHEYSLVEALVRRVEQEARRREAVAIRSLTVSVGELSGVDPELFR
FT                   TAYETFRAGSLCADTPLTLKRLEARWSCPTCRAPIARGAVLRCPTCDVPARLDEGSDAL
FT                   TLDSIDMEVP"
FT   gene            complement(584107..585132)
FT                   /locus_tag="AnaeK_0506"
FT   CDS_pept        complement(584107..585132)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0506"
FT                   /product="hydrogenase expression/formation protein HypE"
FT                   /note="TIGRFAM: hydrogenase expression/formation protein
FT                   HypE; PFAM: AIR synthase related protein; AIR synthase
FT                   related protein domain protein; KEGG: ade:Adeh_0473
FT                   hydrogenase expression/formation protein HypE"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71745"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR011854"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="UniProtKB/TrEMBL:B4UBT4"
FT                   /protein_id="ACG71745.1"
FT                   /translation="MDTKAQQKIGLKHGSGGRAMRQLIEDVFLSLASPVDGIGLSALDD
FT                   GAAIRVGDRWLVITTDSHVVHPIFFPGGDIGRISVSGTVNDLAMMGATEPVGLTCAVIL
FT                   EEGFPRGDLERVVASMRETAKEAGAPFVTGDTKVMGKGQVDGIVLNTTGVALADRVVSD
FT                   AGLRAGDLLVVTGSIGDHGMAVMARRHDLRLEGDLRSDVAPINGLVRAALAAGGEDVVA
FT                   MKDPTRGGVAGVLHEMAAKGGVGIVVDEPSLPVNDEVRAAGEMIGIDPLLVANEGKAVI
FT                   GVRARSADKVLAALRAHPLGARATVFARAIAERPGAVILDTGFGRRMLAEPEGELLPRI
FT                   C"
FT   gene            complement(585153..586289)
FT                   /locus_tag="AnaeK_0507"
FT   CDS_pept        complement(585153..586289)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0507"
FT                   /product="hydrogenase formation HypD protein"
FT                   /note="PFAM: hydrogenase formation HypD protein; KEGG:
FT                   ade:Adeh_0474 hydrogenase formation HypD protein"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71746"
FT                   /db_xref="GOA:B4UBT5"
FT                   /db_xref="InterPro:IPR002780"
FT                   /db_xref="InterPro:IPR042243"
FT                   /db_xref="InterPro:IPR042244"
FT                   /db_xref="UniProtKB/TrEMBL:B4UBT5"
FT                   /protein_id="ACG71746.1"
FT                   /translation="MSNEDLFRQLKFRDPARARALAEALRHNMDAIGREVSVMHVCGSH
FT                   EQAIARFGLRAVLPPGLELIMGPGCPVCVTDGPEVDEAVALAGQGVRVCTYGDMLRLPG
FT                   TARSLADAQADGGKVEVVYSISQAAELAQAHPDEQVVFLASGFETTAVATAAVALASPP
FT                   PNFSILSVHKYVPAAMEIVAASKETHIEGYIAAGHAAIITGWAIFEPFAARTGAPVVVA
FT                   GFEPLDILAALVKLTELIREGRPEVANVYPRCVTKEGNLPAQRSLWRAFRTVTGRWRGI
FT                   AEVPGGNLELVPELGALDARRRFRIDTAGVRDAAAEEEAKGCICGRIMLGLATPEHCAL
FT                   FGTTCVPESPVGACMVSSEGQCRIWHTYGGVPDLRKVG"
FT   gene            complement(586302..586589)
FT                   /locus_tag="AnaeK_0508"
FT   CDS_pept        complement(586302..586589)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0508"
FT                   /product="hydrogenase assembly chaperone hypC/hupF"
FT                   /note="TIGRFAM: hydrogenase assembly chaperone hypC/hupF;
FT                   PFAM: hydrogenase expression/formation protein (HUPF/HYPC);
FT                   KEGG: ade:Adeh_0475 hydrogenase assembly chaperone
FT                   HypC/HupF"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71747"
FT                   /db_xref="InterPro:IPR001109"
FT                   /db_xref="InterPro:IPR019812"
FT                   /db_xref="InterPro:IPR037254"
FT                   /db_xref="UniProtKB/TrEMBL:B4UBT6"
FT                   /protein_id="ACG71747.1"
FT                   /translation="MCLGVPGKVIAIDGLDATVDFFGVRKSLRLDIVDEPVQVGDYVLN
FT                   HVGFAIRRIPPEEVQETLALFDQILEVSGAKEDLMAADVRGEMAAGKDQK"
FT   gene            complement(586618..588939)
FT                   /locus_tag="AnaeK_0509"
FT   CDS_pept        complement(586618..588939)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0509"
FT                   /product="(NiFe) hydrogenase maturation protein HypF"
FT                   /note="TIGRFAM: [NiFe] hydrogenase maturation protein HypF;
FT                   PFAM: acylphosphatase; SUA5/yciO/yrdC domain; zinc finger
FT                   HypF domain protein; KEGG: ade:Adeh_0476 (NiFe) hydrogenase
FT                   maturation protein HypF"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71748"
FT                   /db_xref="GOA:B4UBT7"
FT                   /db_xref="InterPro:IPR001792"
FT                   /db_xref="InterPro:IPR004421"
FT                   /db_xref="InterPro:IPR006070"
FT                   /db_xref="InterPro:IPR011125"
FT                   /db_xref="InterPro:IPR017945"
FT                   /db_xref="InterPro:IPR017968"
FT                   /db_xref="InterPro:IPR036046"
FT                   /db_xref="InterPro:IPR041440"
FT                   /db_xref="UniProtKB/TrEMBL:B4UBT7"
FT                   /protein_id="ACG71748.1"
FT                   /translation="MTTQRTTDGGPDLSAEGRRIAVSGTVQGVGFRPFVYRLAHQTGVT
FT                   GRVRNDAAGVTIEAFGTSAALDAFQARLVSDRPPAASIAALRAEAIPAEAAPRFEIVES
FT                   GRSAERRVAIPPDLATCPECLRELGDPADRRHRYPFTNCTACGPRFTIALGVPYDRPAT
FT                   TMAGFRMCPACAREYGDPLDRRFHAQPNACPACGPRVALRDAAGAPRPSADPIRDCAGL
FT                   LRAGGIAAVKGLGGYHLACDASAPAAVRTLRERKRREEKPLAVMVADLDAARALAEVSP
FT                   AEAALLTSPERPIVLCRRRPGAALAPELAPGSPIVGLMLAYAPLHHLLLADAGVPLVMT
FT                   SANLSDEPIAFDDGEALARLAGIADLFLVHDRPIASRCDDSVARVVAGRPMVMRRSRGF
FT                   VPRPVRTARRFARPVLAAGAQLKNACCLARGDEATLGPHVGDLDGLETYGAFEAAVARL
FT                   ETFLAFRPELLACDLHPLYLSTRWARERAAALALPLVEVQHHHAHAAACMAEHGLEGPV
FT                   LALCWDGTGLGTDGASWGGELLLAEAARFDRLATFRPVLLAGGDRAIRDPWRIALAALL
FT                   DAFGEDAPLDRLPLFAGVPARELEVVRRMLATGLNAPPAHGAGRAFDAAGALALCRPST
FT                   RFEGQVALALDAAAHGHEAPPYPFDLDASGPVEALDLRPLWRALAADVLAARPAGEMSA
FT                   RFHAALAAAGAEQVRRAARRAGKLPVVLTGGCFQNARLAEAIRARLEGEFAVYQHGEVP
FT                   PGDGGIALGQAVVADAVARA"
FT   gene            complement(589084..589611)
FT                   /locus_tag="AnaeK_0510"
FT   CDS_pept        complement(589084..589611)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0510"
FT                   /product="hydrogenase maturation protease"
FT                   /note="TIGRFAM: hydrogenase maturation protease; PFAM:
FT                   peptidase M52 hydrogen uptake protein; KEGG: ade:Adeh_0477
FT                   peptidase M52, hydrogen uptake protein"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71749"
FT                   /db_xref="GOA:B4UBT8"
FT                   /db_xref="InterPro:IPR000671"
FT                   /db_xref="InterPro:IPR023430"
FT                   /db_xref="UniProtKB/TrEMBL:B4UBT8"
FT                   /protein_id="ACG71749.1"
FT                   /translation="MARIAVFGIGNVLTGDDAVGPYVVKVLEAGWELPGVEVVDAGTPG
FT                   LDLTAYFAGLDAAVLVDAVKARAAPGELRTYSREDLVKRSPVLAVSPHEPGLREAVMNA
FT                   EFMGVCPATVRLVGVVAERTDLGCALSPAVQAAVPAAVEQVLSELRALGIAPRPRDPPA
FT                   EPDLWWEKGRAG"
FT   gene            complement(589708..591441)
FT                   /locus_tag="AnaeK_0511"
FT   CDS_pept        complement(589708..591441)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0511"
FT                   /product="nickel-dependent hydrogenase large subunit"
FT                   /note="PFAM: nickel-dependent hydrogenase large subunit;
FT                   KEGG: ade:Adeh_0478 nickel-dependent hydrogenase, large
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71750"
FT                   /db_xref="GOA:B4UBT9"
FT                   /db_xref="InterPro:IPR001501"
FT                   /db_xref="InterPro:IPR018194"
FT                   /db_xref="InterPro:IPR029014"
FT                   /db_xref="UniProtKB/TrEMBL:B4UBT9"
FT                   /protein_id="ACG71750.1"
FT                   /translation="MSKLITIDPVTRIEGHLRIDVEVDGGAVKNAWSSGTMWRGIETIL
FT                   QGRDPRDAWIFTQRICGVCTTVHAIASVRSVENALGLEIPLNAQLIRNLIVTAHTLHDH
FT                   IVHFYQLSALDWVDVTSALKADPVKAAQLAESISSWPGNSKHELAAVKARLEGFVKAGQ
FT                   MGIFTNGYWGHPAMKLSPEVNLLAVAHYLQALEIQRKANMAVAILGSKTPNIQNLAVGG
FT                   VANAINLDSPAALNMEKLYQVKTLIDEVATFIQQCYLPDVAAIGGFYPDWFKYGAGVTN
FT                   YLSVPELPLDEKMSKFDIPGGVLWNGKLEVAHKITGWNDDYLKQNVTESIAHAHYDGAW
FT                   AKGPWEEDDKPKFAGEWKHETPAPDRYTWVKAPRLEGKAVQVGPLACVLVGLASGHEPT
FT                   TRWATAAIGAVKAVHKIDLTPAHLHSTLGRHAARAIRAAMMAEMAQKQWKLLVENIGKG
FT                   DTRIWVDPMANLKPGIYKGVGFHEAPRGTLSHWCVIEADKKGMKLKNYQAVVPSTWNAG
FT                   PRDASGALGPYEKSLVGNPIADPKLPLEALRTIHSFDPCLACAIHTVDAEGEEISRVKV
FT                   L"
FT   gene            complement(591453..592700)
FT                   /locus_tag="AnaeK_0512"
FT   CDS_pept        complement(591453..592700)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0512"
FT                   /product="Polysulphide reductase NrfD"
FT                   /note="PFAM: Polysulphide reductase NrfD; KEGG:
FT                   ade:Adeh_0479 predicted hydrogenase 2 cytochrome b type
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71751"
FT                   /db_xref="GOA:B4UBU0"
FT                   /db_xref="InterPro:IPR005614"
FT                   /db_xref="UniProtKB/TrEMBL:B4UBU0"
FT                   /protein_id="ACG71751.1"
FT                   /translation="MSGHDHPQAIGGKMLDPLMKILLAVFGVSAVVMAYRFVMGVGAVS
FT                   NMTDGFTWGIWEPINVVVFTGIGAGAYGVGLLCYLLNKGQYHGLVRPAVLLGAIAYTLG
FT                   GSSIMIALGRYWNAVTLPIVPWWNLSSALLEVAVCVMMYVMVLWIEVLPAVFDGAAQSK
FT                   SPRWSAIGKKWGARMAKAMPYIIALAILLPTMHQSSLGGLYLIAGPKLHPLWHTALLPT
FT                   LFLVSCLSMGYGAVVVLVNILRLNWNAKQDQALFASMSKVNAGFLLLYVVLRLGDVVLN
FT                   GKLRFLGADFATFLFVVELALFIAPAVMFVMPGVQRNRGKLFGAALLALLAGAVYRADT
FT                   YMTMYRPAGWTADGKSIAAGWDYFPSLGETVVTVGMAAVGMAIFIFISRLFPVVVVDQG
FT                   KKSTIGRGEVRAASGH"
FT   gene            complement(592697..593650)
FT                   /locus_tag="AnaeK_0513"
FT   CDS_pept        complement(592697..593650)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0513"
FT                   /product="hydrogenase 2 protein HybA"
FT                   /note="KEGG: ade:Adeh_0480 hydrogenase 2 protein HybA"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71752"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR019546"
FT                   /db_xref="UniProtKB/TrEMBL:B4UBU1"
FT                   /protein_id="ACG71752.1"
FT                   /translation="MTISRRDLLKGAVAAGAAVAIPATAEARHEIEPLPDAVGMLFDST
FT                   LCVGCRACQSACKASNKLPEDKVEANGGVYDAPNDLNSTTKNVIKAFPAGDVQHYMKQQ
FT                   CMHCVDPSCVSVCMLGALHKEGEGKRDFKGEKKGTGIVLWDKWTCVGCRYCQIGCAFNV
FT                   PKFEWFEAFPAIVKCELCRHRRDEQKTGPYAVANPACCEVCPREAVVFGYRKDLLAEAK
FT                   RRVAADPQRYNPHVYGEHDGGGTQVLYLAAAGVQFHDLGLPDLPERSQAEFSESVSHAP
FT                   YLHGVTPIALYAAMAFVINRNKKKEEAAEHGEEGKR"
FT   sig_peptide     complement(593573..593650)
FT                   /locus_tag="AnaeK_0513"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.996) with cleavage site probability 0.871 at
FT                   residue 26"
FT   gene            complement(593656..594780)
FT                   /locus_tag="AnaeK_0514"
FT   CDS_pept        complement(593656..594780)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0514"
FT                   /product="hydrogenase (NiFe) small subunit HydA"
FT                   /EC_number="1.12.99.6"
FT                   /note="TIGRFAM: hydrogenase (NiFe) small subunit HydA;
FT                   PFAM: NADH ubiquinone oxidoreductase 20 kDa subunit;
FT                   Nickel-iron dehydrogenase small subunit domain protein;
FT                   KEGG: ade:Adeh_0481 hydrogenase (NiFe) small subunit
FT                   (HydA)"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71753"
FT                   /db_xref="GOA:B4UBU2"
FT                   /db_xref="InterPro:IPR001821"
FT                   /db_xref="InterPro:IPR006137"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR019546"
FT                   /db_xref="InterPro:IPR027394"
FT                   /db_xref="InterPro:IPR037024"
FT                   /db_xref="InterPro:IPR037148"
FT                   /db_xref="UniProtKB/TrEMBL:B4UBU2"
FT                   /protein_id="ACG71753.1"
FT                   /translation="MDNIGSQMISGPETKGVSRRDFIKVCSVAAAAVGLPAWAGEKMAE
FT                   NVGKKKPSVVWLHFQECTGCTESLLRTSHPDVGALILDLVSVDYHETLFAAAGKQIEAA
FT                   LETAKKAGGYVLVVEGAIPKKDDGIYCMVGGKTAVDSLVECAEKAAAVICIGSCSSWGG
FT                   VPSAAPNPTQAVGAPEILKEKGIKKPVVTLPGCPANPYNLLGTVLQFATFGTLPKLDEK
FT                   GRPAFAYGRVIHEDCPRRPHFDAGRFAQAYGDEGHRNGWCLYKIGCKGPQTHANCSLLS
FT                   FCEVPGAWPIGIGHPCVGCTEQGIVFNVPINQNLPIEHPTAPMAYPAIHPEHGVVGGSP
FT                   VAVGLGGAVIGALVGAGVVASRKMAAADDADGKE"
FT   sig_peptide     complement(594661..594780)
FT                   /locus_tag="AnaeK_0514"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.601) with cleavage site probability 0.601 at
FT                   residue 40"
FT   gene            complement(595249..595740)
FT                   /locus_tag="AnaeK_0515"
FT   CDS_pept        complement(595249..595740)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0515"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="PFAM: regulatory protein MarR; KEGG: ade:Adeh_0482
FT                   transcriptional regulator, MarR family"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71754"
FT                   /db_xref="GOA:B4UBU3"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B4UBU3"
FT                   /protein_id="ACG71754.1"
FT                   /translation="MPLPEPSIGLLVLLARHGIRDVVGPRAARHRLTVQQFWALYWLLH
FT                   QPGLAPGELAAAMLLDAPAGSRLVSELAKRNLVEARPDRVDRRRARLFLSEKGEPLARR
FT                   VAEDAARYHAESLRGMEPAEVAALRSGLRKLIDNLAALAGAPAQPPAAARRNGRGARAG
FT                   "
FT   gene            595871..597568
FT                   /locus_tag="AnaeK_0516"
FT   CDS_pept        595871..597568
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0516"
FT                   /product="MutT/NUDIX family protein"
FT                   /note="KEGG: ade:Adeh_0483 MutT/NUDIX family protein"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71755"
FT                   /db_xref="InterPro:IPR039461"
FT                   /db_xref="UniProtKB/TrEMBL:B4UBU4"
FT                   /protein_id="ACG71755.1"
FT                   /translation="MNAVRNLSTSLLASIAALAAAVPGPSRAAEAAPPGVAALRRAEAR
FT                   FAPVDLKVDLSKLPASERTALAKLVEAGRIMDALFLRQVWAGNEALLLRLVEDRSPLGE
FT                   ARLRLFLRNKGPWDRLEEDRAFLPGVPEKPQQANFYPAGAGKDEVERWAAGLAPEEKDR
FT                   AMGFFTTVRRDAAGKLVAVPYSLEYQGELARAAALLRDAAAATQDAGLRTFLEARAAAF
FT                   VGNAYRDSDVAWMRLDSAVEPTIGPYEVYEDGWFNAKAAFEAFIGVRDEAETAKVARFA
FT                   AELQGIEDALPIDAAFKNPKIGALAPIRVVNEVYAGGDAAKGVQTAAYNLPNDEWVTRT
FT                   MGSKRVMLKNVQEAKFQKVLLPVARRLLSPADRAHVAFDPFFTHILMHELVHGLGPHHA
FT                   KVNGEEVTVRAALADTYSALEEAKADVAGLFALEKLLDDGKLDRRMRATLYPTFLCGAF
FT                   RSIRFGLNEAHGKGMAIQLNWLLDHGAIVARKDGTFAVDGPKMRDAVAGLTREIMTIQA
FT                   KGDRAGAKAMLEKLGVVRPEVARALARIEDVPVDIAPRFVTADALTAR"
FT   sig_peptide     595871..595957
FT                   /locus_tag="AnaeK_0516"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.963 at
FT                   residue 29"
FT   gene            complement(597774..599882)
FT                   /locus_tag="AnaeK_0517"
FT   CDS_pept        complement(597774..599882)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0517"
FT                   /product="TonB-dependent receptor"
FT                   /note="PFAM: TonB-dependent receptor; TonB-dependent
FT                   receptor plug; KEGG: ade:Adeh_0484 TonB-dependent receptor"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71756"
FT                   /db_xref="GOA:B4UBU5"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039426"
FT                   /db_xref="UniProtKB/TrEMBL:B4UBU5"
FT                   /protein_id="ACG71756.1"
FT                   /translation="MSRNWKLARLVAALTLLPAPGAAEEPAAEPRTEVLLEEIVVKSRR
FT                   EPRADGLEVREVRETPARDLGEALEQTLGLGKVRKAGIASDVVLRGLKRDDVNVLVDGT
FT                   RTHGACPSRMDPPAFHLDWAEVDGVEVRRGPFDVSQPGGLGGMVDVRTRAARPGPGAEV
FT                   NLGAGSSGAMESSAVASYGGGRASLLLGGAFKRSDPYLAGDGRNITEVIPATSTGRYRD
FT                   TSDHQTAYDVRSGWAKVGLTPAEGQQLEVAYTRQEADDVLYPYLLMDGIRDDTDRVNAT
FT                   WRAGALGPLASARAQLYWTRVAHDMDDRDRCSSAADPAACAGGLAEAWSMRTEARTRTL
FT                   GAKLEASLGEAGDAIEARIGADLLVRNWDNETIRVRRAMPGQPYVGEASIPDVTQTTGG
FT                   AYAELRRALAPSVRATAGARLDVAESYAGVDRRDFYATWRPDTTPERSRTDLLLAGNVQ
FT                   LDWDAARGLTVFAGYGHGTRLPDPQERYMALAGLMGKPAWVGDPSLRPTRSDELDAGLR
FT                   FTADRLLAKAQVFHAWVEDEITLVPLALASGATAKTYAGVSARRVGGEASARLALPLRL
FT                   YAAAAVAYVWARNDTAGTPLAEVPPLRASASLRWDNGRFFAEAEEQWAARQDRVDPALG
FT                   ERPTDAWFITNLRAGAAWRGVKAFVGVRNLLDKTYAEHLSYLRDPFAAGVKVPEPGRTL
FT                   YANVQWTF"
FT   sig_peptide     complement(599811..599882)
FT                   /locus_tag="AnaeK_0517"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.912 at
FT                   residue 24"
FT   gene            complement(599987..600475)
FT                   /locus_tag="AnaeK_0518"
FT   CDS_pept        complement(599987..600475)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0518"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ade:Adeh_0485 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71757"
FT                   /db_xref="UniProtKB/TrEMBL:B4UBU6"
FT                   /protein_id="ACG71757.1"
FT                   /translation="MLAAAGRPAARVAAALLALALSGGVRLLPAGPVSGPHRCSCRSHG
FT                   EDHLCACAVCNAQARRARKAARPEDLPPCHRDAARRAAAQEEARARRAALPGILPTCGD
FT                   PDGGLAAPGALDPFAVPARSALALAEWRTTPADPAATAPERAPRPAVPPPRPSAVRAS"
FT   gene            complement(600583..604884)
FT                   /locus_tag="AnaeK_0519"
FT   CDS_pept        complement(600583..604884)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0519"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ade:Adeh_0486 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71758"
FT                   /db_xref="InterPro:IPR002931"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR024618"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:B4UBU7"
FT                   /protein_id="ACG71758.1"
FT                   /translation="MNLRLLPALAAASLSLLAARAGAADAPWEGAPFSADPKAMLAAAQ
FT                   ALAPPKAAGVDVLLEEGRFRYDARGALTLEHRLVFRLLTAEAARSWSRVERSYAPWQQA
FT                   RPELRARVITAQGEVHELDPSTLTEQGVADRADLMYSDRRVVAGPLPAVRAGSLVEELI
FT                   VVRDTAPAFDGGTSARFFLAQALPARRIRVEVAAPAGLPLRWVVRGIDAAPRETKDRGE
FT                   RRLVIDRRDVPGWTAVEPGAPRDTPPAPYLAFGWGRSWADVSARYAATWERQLSGSDLA
FT                   AAAREALGEGKAPDRAEAVRRVVAWVHRSVRYTGLELGEAALVPATPAEVLKRRYGDCK
FT                   DLSLLVAGLLRAAGHDARLALVRTDWHEVNPELPGISQFDHVVVRVEGSPAIWVDATDP
FT                   YTPPGVLPPAVEGRLALVTPGGRELVRTPERAAADNRVRIVRELFMAESGRGRIRETRE
FT                   LVGALAATERAFRERIPPERRDEVAEHYAKEVLRAGEVLSATTEGLDDPSAPLRMVVDA
FT                   KETDAVRTADDEAALPVTPDQVFDALPGFLTGDPEGHAAAPAKRTADLLLVVPYQWEVT
FT                   YRIHAPDGFKPRPLPASTTERFGPATYSQAYALEPDGTVTATFRFDTGGRRLSAADAAR
FT                   LGKRAREVVRGGSPVVALDRTAATLLAGGKVPEALAEMRRLAALHPKEALHHVQLAAAL
FT                   VRVGFSEQAAAEVRQAIALEPDSAWAHRILGWILQHDAVGRYQGPGHDRAGALAAYRKA
FT                   KDLDPDHAGGRAALAELLAREANGAPAATIGEAIEEFEAIRSDLHEQAFDGPYLRTLFD
FT                   AGRDADAEKLARDVPRGRERDALLLAAVAMQRGAPAAEDEARGMGEGRRDALRDAARLM
FT                   VGRRSYAAAAALAGAAAQGAPNAAEIRQQADLFQGLKPWETLAPQGSEAARLVKRLFVV
FT                   ALRAPEPGRELPGMVARARLGPELARIADQGLGGPVAGARRSLHEQGIPPDVLLDLVLS
FT                   RVEMLEDGDPRAAVRVRVQFPFTPGDGRSAVFVVRDGKEPKVLATDTAWPILGAEALRL
FT                   AGAGDLAGARRWLDWARETLPGAESDPSTPAGVLARLWRPGAEAGAPEVRRAAAAVLAW
FT                   ADEAGRTLPTLSEARAQAADPAERRALGFALAQAYRAAGKREDQLRVARELLQDDPASR
FT                   EAFALGAVALADLKRPADLEALAAGVLQRLPDDPEVLGLLGNLRLGAGKVDEAAKAFRR
FT                   LIDAGKASPLVLNNAAWLELFRATPGKDALDWARRAVEGERGQNHPSLNTLAAIYAASG
FT                   QPAEAREVFLRSLDVSGDALEPADWFVFGRIAEAWGVPEAARAAYARVAPDPQDPTAPH
FT                   ALAQRRLALLGPAPAVPGAPAQPVPAGPAPAPADAPVVKPAGPAPAPSPAAAPPPAPAT
FT                   PDGAKPGKKAPARRKLAPPAPKAPVAGERPA"
FT   sig_peptide     complement(604813..604884)
FT                   /locus_tag="AnaeK_0519"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.966 at
FT                   residue 24"
FT   gene            complement(604985..605686)
FT                   /locus_tag="AnaeK_0520"
FT   CDS_pept        complement(604985..605686)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0520"
FT                   /product="MgtC/SapB transporter"
FT                   /note="PFAM: MgtC/SapB transporter; KEGG: ade:Adeh_0487
FT                   MgtC/SapB transporter"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71759"
FT                   /db_xref="GOA:B4UBU8"
FT                   /db_xref="InterPro:IPR003416"
FT                   /db_xref="UniProtKB/TrEMBL:B4UBU8"
FT                   /protein_id="ACG71759.1"
FT                   /translation="MPPAIVDAEDLRILGHLCVALVVGGAIGIERSYHGRPAGFRTHAL
FT                   VCLASSLLMLLTLYQQRWFPSAESVRLDPTRMAQGIMTGIGFLGAGVIFKEGITVRGLT
FT                   TAASIWITSAIGVMVGSGMYFPALAATVLTLGVLSGFRLIEARLPAHQYAAHRLRFHRD
FT                   EALGEEAVRELLARHGCKVSSMSWRLTDEGRCVEYRMTVRTSDSRNFSRLAATLQGLAV
FT                   VREFVLSPAGD"
FT   gene            complement(605771..606334)
FT                   /locus_tag="AnaeK_0521"
FT   CDS_pept        complement(605771..606334)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0521"
FT                   /product="protein of unknown function UPF0016"
FT                   /note="PFAM: protein of unknown function UPF0016; KEGG:
FT                   ade:Adeh_0488 protein of unknown function UPF0016"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71760"
FT                   /db_xref="GOA:B4UBU9"
FT                   /db_xref="InterPro:IPR001727"
FT                   /db_xref="UniProtKB/TrEMBL:B4UBU9"
FT                   /protein_id="ACG71760.1"
FT                   /translation="MESILGSFLLVAASEMGDKTQLLAFSLATRFRKPWPIMAGILVAT
FT                   LANHGLASSLGAWISANVPARMLAGVLALTFLLFGLWTLRPDSLEASKGPERFGAFLTT
FT                   TLLFFLAEMGDKTQLATVALAARYGDVIRVTMGTTLGMLAADGLAVFLGEKLAARVSSA
FT                   RIRWAAAGLFFLFGLISAWAAIAG"
FT   gene            606432..607985
FT                   /locus_tag="AnaeK_0522"
FT   CDS_pept        606432..607985
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0522"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ade:Adeh_0489 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71761"
FT                   /db_xref="InterPro:IPR025079"
FT                   /db_xref="UniProtKB/TrEMBL:B4UBV0"
FT                   /protein_id="ACG71761.1"
FT                   /translation="MRGSAVPARRVLIAAACLALSWPQPHDAADPRSPPPAAEDEVAAA
FT                   PASAAPLRAGAPDAPAATAATLPASVLPPPALSPHPSPHPLPPGANVFLPAAESAAVTL
FT                   AMMGWNRWVGEAPWADITGDSIGRNLRSAWVLDDDQFWINQFGHPYQGMWSMTAARSAG
FT                   LGFWGSTPYTIASSLVWEIAGETEPPSINDQITTPIGGIVLGEVLFRLAGILRGDGRNP
FT                   WRELGAGLLAPMDALNHGLLHDGHDELDEPRAWTLSAGPVAARLAWDAAGPPPGWETSP
FT                   EVAFRMVHGLAWHPAFRFERPFDHFELEAAYAGRSNPDATLILRGLLAGATYGDPAGWR
FT                   GVYGLYGSFDLDTPGVFRVSTSALGLGTSGGRLLAHDVRVEGTAIVSGILIGGGGQVAR
FT                   DAEGKGRDYRLGPGGQSVLELQLTAAERATVRLGLRNYLLFGAGTIGGDELIGAGDAAV
FT                   VVRIAGEHGVGIEGTLHTRTLWPETGGREAFTGRSVRVFWEMNGFHAPPEPLDPALLTQ
FT                   "
FT   gene            608165..609001
FT                   /locus_tag="AnaeK_0523"
FT   CDS_pept        608165..609001
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0523"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ade:Adeh_0490 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71762"
FT                   /db_xref="GOA:B4UBV1"
FT                   /db_xref="InterPro:IPR025576"
FT                   /db_xref="UniProtKB/TrEMBL:B4UBV1"
FT                   /protein_id="ACG71762.1"
FT                   /translation="MPSQPIVPQARQAPQAPAAAPAKRRSMLPHEHGAWGQLAMPLLTA
FT                   LAIARPGAAAWLLTAAVVLAFVAHEPLLIVLGQRGRRAVAEDGARARRWLAALGALTAA
FT                   TGLAGIALAPPAARLALLLPAALAVVVGVLVWRRLEKTVAGEITVAAALASAGYAVALA
FT                   AGAEHPAALAALLAWILAFGAATLAVQVILVRVRSKGAADPGRRHAVLAGLLALAAVAL
FT                   SAAGLPGALALATLPTALFSIAVCLVRVSPKRLRELGWALVGSSAVTLVILVVGLR"
FT   gene            609034..609795
FT                   /locus_tag="AnaeK_0524"
FT   CDS_pept        609034..609795
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0524"
FT                   /product="nuclease (SNase domain protein)"
FT                   /note="PFAM: nuclease (SNase domain protein); KEGG:
FT                   ade:Adeh_0491 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0524"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71763"
FT                   /db_xref="InterPro:IPR016071"
FT                   /db_xref="InterPro:IPR035437"
FT                   /db_xref="UniProtKB/TrEMBL:B4UBV2"
FT                   /protein_id="ACG71763.1"
FT                   /translation="MIRSRPPLLALCCLALALAAPSEARARRGRSARAADGRVVLDGEA
FT                   AAVRWTDGDTFRLLTGPRAGQRARLAGVNTLETYGPVHRWGGWRPEALLAVARAAGPRA
FT                   AAGTWDCRSVHGRGARDRYGRLLVDCPGLSRALVREGLATVFAMDGPADPALLAAQQEA
FT                   QRAGAGMWAEGVPDVIVSSAHSAGEAGLGRRGAYDRLVDARTGAATARPHARTYRACEE
FT                   VCAGEGRGRSCLVYVPYERRFRDRPPCLGGR"
FT   sig_peptide     609034..609108
FT                   /locus_tag="AnaeK_0524"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.558 at
FT                   residue 25"
FT   gene            609972..610403
FT                   /locus_tag="AnaeK_0525"
FT   CDS_pept        609972..610403
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0525"
FT                   /product="hemerythrin-like metal-binding protein"
FT                   /note="TIGRFAM: hemerythrin-like metal-binding protein;
FT                   PFAM: Hemerythrin HHE cation binding domain protein; KEGG:
FT                   ade:Adeh_0492 hemerythrin-like, metal-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71764"
FT                   /db_xref="GOA:B4UBV3"
FT                   /db_xref="InterPro:IPR012827"
FT                   /db_xref="InterPro:IPR016131"
FT                   /db_xref="InterPro:IPR035938"
FT                   /db_xref="UniProtKB/TrEMBL:B4UBV3"
FT                   /protein_id="ACG71764.1"
FT                   /translation="MIEAHAWNEKLDLGHEAMDHEHHLQIALVTALTEAIEQARPWMAR
FT                   QLSAQLLSYSGIHFGSEEMLMQASAFVGLADHASEHRTLLEAMREIQGALERGEDDLAL
FT                   AFAVELRAGLAGHMAGSDRRLADHVRPVQPAGAVVIPIR"
FT   gene            complement(610427..611188)
FT                   /locus_tag="AnaeK_0526"
FT   CDS_pept        complement(610427..611188)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0526"
FT                   /product="ABC transporter-related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: ade:Adeh_0493 ABC transporter, ATPase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71765"
FT                   /db_xref="GOA:B4UBV4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B4UBV4"
FT                   /protein_id="ACG71765.1"
FT                   /translation="MALRGRPVLREIRFSVAAGERVVLLGVNGCGKTTLLKLMDGLAFP
FT                   QEGAVRWRGRALDAAALAGAAFRRAFRGEVALLFQNVDAMLFNPSVADEIAFGPRQLGV
FT                   AEPEVEARVARWAGAFELTALLERPPFELSGGEKKRVAMAALMAVGPKVLLLDEPTAGL
FT                   DPASAGRLVDFLAGLEGVTVVTSTHHLTLAEELGTRAVLLGPDRPGVLYDGPTSALLGD
FT                   ERALVESGLAHRHVHAHGVEVHAHFHVHDTE"
FT   gene            complement(611218..611784)
FT                   /locus_tag="AnaeK_0527"
FT   CDS_pept        complement(611218..611784)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0527"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ade:Adeh_0494 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71766"
FT                   /db_xref="GOA:B4UBV5"
FT                   /db_xref="UniProtKB/TrEMBL:B4UBV5"
FT                   /protein_id="ACG71766.1"
FT                   /translation="MAPPDPRRERLLLAGWLAAAFALSAVTDLRTLGLAALAAAVAFRR
FT                   GLPRALARVARLVLPVTLGMSGLSWAFLRLGAPAAPPLAPFLALAARTLLLAFLAFSVL
FT                   ARVNLLRALAPWPAATRLVVIALAQIHALRLLATESADGLRSRLPRRPGPLDVVRNASG
FT                   ITAALLVLAVRNAREVSDAMRSRGF"
FT   sig_peptide     complement(611707..611784)
FT                   /locus_tag="AnaeK_0527"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.977) with cleavage site probability 0.526 at
FT                   residue 26"
FT   gene            complement(611771..612403)
FT                   /locus_tag="AnaeK_0528"
FT   CDS_pept        complement(611771..612403)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0528"
FT                   /product="cobalamin (vitamin B12) biosynthesis CbiM
FT                   protein"
FT                   /note="PFAM: cobalamin (vitamin B12) biosynthesis CbiM
FT                   protein; KEGG: ade:Adeh_0495 cobalamin (vitamin B12)
FT                   biosynthesis CbiM"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71767"
FT                   /db_xref="GOA:B4UBV6"
FT                   /db_xref="InterPro:IPR002751"
FT                   /db_xref="UniProtKB/TrEMBL:B4UBV6"
FT                   /protein_id="ACG71767.1"
FT                   /translation="MHVPDGFLSPAITLPAYAAAAPLWALAARRHLGRDAADALPVVGA
FT                   LTALAFVVQTLAIPVPGGTSTHLVGVTLLALLYDPLLAFLCQSLVLLLQALFFGAGGVT
FT                   VLAVNALAMGLLGPLAGWAVHRLLRRRAARAAAFLGAWVSMQVAAGAVALVLGLQHRIA
FT                   PEYFPVPFAVSGAALLAPSLAVTGPVEGLYTLLALALLRRADLRGAA"
FT   sig_peptide     complement(612341..612403)
FT                   /locus_tag="AnaeK_0528"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.960) with cleavage site probability 0.842 at
FT                   residue 21"
FT   gene            complement(612433..612870)
FT                   /locus_tag="AnaeK_0529"
FT   CDS_pept        complement(612433..612870)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0529"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ade:Adeh_0496 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71768"
FT                   /db_xref="GOA:B4UBV7"
FT                   /db_xref="UniProtKB/TrEMBL:B4UBV7"
FT                   /protein_id="ACG71768.1"
FT                   /translation="MRAVLVLLSLLLAPAAARGHEVLHELVPGHAAGLRVFESDGEPLG
FT                   DRAYELWSPSDPRAPWQAGRTDRAGWIAFVPDVPGAWRVKVVDPGGHGLDTTVQISGAQ
FT                   GPTAPSGPGAGFVLRPLVGAAVVAAIFAALFLIQRRRGARP"
FT   sig_peptide     complement(612811..612870)
FT                   /locus_tag="AnaeK_0529"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.998 at
FT                   residue 20"
FT   gene            complement(612996..613415)
FT                   /locus_tag="AnaeK_0530"
FT   CDS_pept        complement(612996..613415)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0530"
FT                   /product="putative transcriptional regulator, CopG family"
FT                   /note="PFAM: CopG domain protein DNA-binding domain
FT                   protein; NikR nickel binding; KEGG: ade:Adeh_0497
FT                   transcriptional regulator, CopG family"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71769"
FT                   /db_xref="GOA:B4UBV8"
FT                   /db_xref="InterPro:IPR002145"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="InterPro:IPR013321"
FT                   /db_xref="InterPro:IPR014864"
FT                   /db_xref="InterPro:IPR022988"
FT                   /db_xref="InterPro:IPR027271"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4UBV8"
FT                   /protein_id="ACG71769.1"
FT                   /translation="MLERIGISLEDGLLEQFDKLIAEKGYVNRSEAIRDLIRDALVQRA
FT                   FTESSGREERVAVVTLVYDHDSSSLAQKLAHIQHENHRAVVSALHVHMDPHNCLEVLVL
FT                   RGRGKDVVAMGESLVATKGVKYGKLVPATAGHDLG"
FT   gene            613517..614374
FT                   /locus_tag="AnaeK_0531"
FT   CDS_pept        613517..614374
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0531"
FT                   /product="PfkB domain protein"
FT                   /note="PFAM: PfkB domain protein; KEGG: ade:Adeh_0498
FT                   carbohydrate kinase, PfkB"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71770"
FT                   /db_xref="GOA:B4UBV9"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:B4UBV9"
FT                   /protein_id="ACG71770.1"
FT                   /translation="MTPPARPPLRLAVVGHVEHVTIGRVPAVPRAGEIAHLQAPRWFPG
FT                   GGGGVAFWQLARSPAEVLLYTALGDDEAGAQVERALGAAGARVRVHAARRAEPHTRDLV
FT                   LLTPDGERTIVVVGEPLHPRADDPLPWGALSGCDAAYFTAQDPAALRAARAARLLVVTA
FT                   RRREALARSGVAADVVVGSRLDAREVSARADYPVPPAALVLTEGAAGGIIETAAGVERF
FT                   PAPPSPEAVGGAYGAGDSFAGALVFFLAAGLPLRDACAAAGRHGAAVLRAVDPRDGQLP
FT                   LEAP"
FT   gene            614371..614979
FT                   /locus_tag="AnaeK_0532"
FT   CDS_pept        614371..614979
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0532"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ade:Adeh_0499 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71771"
FT                   /db_xref="InterPro:IPR013595"
FT                   /db_xref="InterPro:IPR026555"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B4UBW0"
FT                   /protein_id="ACG71771.1"
FT                   /translation="MSGARRQRPLVLLAPGAGAPSTSAWMERWAGHLSALGEVGRFDYP
FT                   YRLAGRRSPDRLPVLLEAHRAALRALRGRSRRPVVLAGKSMGSRVGCHLALEEEVAALV
FT                   CLGYPLRGASGALRDEVLLALRAPVLFVQGTRDPLCPLDALEGVRRRMRAPSALHVVED
FT                   GNHSLEAGVRALRARGTTQAEVEARALEAVRTFLADALR"
FT   sig_peptide     614371..614445
FT                   /locus_tag="AnaeK_0532"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.911) with cleavage site probability 0.677 at
FT                   residue 25"
FT   gene            615130..615852
FT                   /locus_tag="AnaeK_0533"
FT   CDS_pept        615130..615852
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0533"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ade:Adeh_0500 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71772"
FT                   /db_xref="UniProtKB/TrEMBL:B4UBW1"
FT                   /protein_id="ACG71772.1"
FT                   /translation="MKRWIIGAAAALLASGAARAQTTPTTDPVQQQDHDRLHDGTGAGT
FT                   GDQVRQHDRLHDGSGIGDPVRQMAKDPAHQADPTAMGDQVREMAQDRDRLHDGAGTGDQ
FT                   TRARMHDQARAQMHEAMMQHAPVGAAHPELPGQAMQGMAQRSAAEAREAQATRAAERHA
FT                   LRHQAGQAATQRPEGAQGHHGTGHGEGMNGAGECGEAAGARHLMEMHGGTMGGHGGTGG
FT                   MDGGSGTGGGTGDHGGMH"
FT   sig_peptide     615130..615192
FT                   /locus_tag="AnaeK_0533"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 21"
FT   gene            615870..616472
FT                   /locus_tag="AnaeK_0534"
FT   CDS_pept        615870..616472
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0534"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ade:Adeh_0501 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71773"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:B4UBW2"
FT                   /protein_id="ACG71773.1"
FT                   /translation="MHALILLGVALAAGADAGEHLLAGARHFREGRYTEALVEFRVAER
FT                   MGDPDARPYAGATLVKLGRPEEALEAFGTGAAAGGDALIAYYQALACYDARLYLCADAL
FT                   LAGVGERSGPRVAAEAARLRADIARTLRAEPSTAAVDFYLARCQALGGERRPAAAAAFC
FT                   REAAGLSARRRDGYRRDDARKLLAGLTARAEAAEARP"
FT   sig_peptide     615870..615923
FT                   /locus_tag="AnaeK_0534"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.820) with cleavage site probability 0.602 at
FT                   residue 18"
FT   gene            616469..617872
FT                   /locus_tag="AnaeK_0535"
FT   CDS_pept        616469..617872
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0535"
FT                   /product="tetratricopeptide TPR_2"
FT                   /note="KEGG: ade:Adeh_0502 tetratricopeptide TPR_2"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71774"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:B4UBW3"
FT                   /protein_id="ACG71774.1"
FT                   /translation="MIAALLLAAAAAATSPCAPVAAAAAPDASAAAEYRAVAEAALGAG
FT                   DRGTAAAAFRAAAERDPADARSRAALAKLCAAGPAGPDPFEEGLRLLDAGETRQAADAF
FT                   AAARAAGAGESAALLEGICRYDLGEDDAARPLLREAERVPAHRELARLYLGLVALRAGQ
FT                   GAEAASLFDAATASPALARMATDLSRLASRDGRLVLSAWAESGWDSNVTLASPGSAGSG
FT                   DADGIWAVGATGLWRPRGAAGPYLRAGGAAHEQFQLGAYDLAALDGAAGWQMRAGAASL
FT                   LAEYAYGYRTLAGDRYLSAHRLLASAGLPIGRAVLSGTAFVRLESYSGAYDPFSGVLTR
FT                   GEVKLAFPVGLAWLGLAYGAGRDAADVGYLSWVEHGPRAELRLPLGARARLAGEVGASF
FT                   RTYDAADPVLLDTRRDTYLDAALLGELDLGRRLTARLGLQARRALSSIPSLEYDKLVPT
FT                   VGLQWTAGY"
FT   sig_peptide     616469..616537
FT                   /locus_tag="AnaeK_0535"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.455 at
FT                   residue 23"
FT   gene            617872..619116
FT                   /locus_tag="AnaeK_0536"
FT   CDS_pept        617872..619116
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0536"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase A domain protein; KEGG: ade:Adeh_0503
FT                   periplasmic sensor signal transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71775"
FT                   /db_xref="GOA:B4UBW4"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B4UBW4"
FT                   /protein_id="ACG71775.1"
FT                   /translation="MGRALAPLLAGLLGLAGALGATLALHRAASAALDRVLEERLAGAG
FT                   ATAAELLGRAGADPAALRAVMAANGLEGAYLVDRDLRVLADATGAAGGRADLLRADPAR
FT                   VARALRGEPSVAFAYAVGDLPVATGYFPVRGPDGAPVAALALEAGQGFAAARAGLRRAL
FT                   WTGVALSALAALALALGAAGFARAERRSAQAAARAARGEALATMAAMVAHEIRNPLGVI
FT                   RGAAELVRARSGAALAPRDQEALADVLGEVERLRRLTEDFLDLARDPAIAAEPADLAEL
FT                   AAEAARALGRAHPSVEVALSVPPLRVRADAARVRQVLANLLENAALAGARRVAVTGGPA
FT                   GPMARLEVRDDGPGVDAAVRARLFEPFASGRARGAGLGLAISRRIAERHGGALELADPG
FT                   PPGAAFALTLPLEPG"
FT   sig_peptide     617872..617967
FT                   /locus_tag="AnaeK_0536"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.546 at
FT                   residue 32"
FT   gene            619126..620466
FT                   /locus_tag="AnaeK_0537"
FT   CDS_pept        619126..620466
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0537"
FT                   /product="two component, sigma54 specific, transcriptional
FT                   regulator, Fis family"
FT                   /note="PFAM: response regulator receiver; sigma-54 factor
FT                   interaction domain-containing protein; helix-turn-helix
FT                   Fis-type; ATPase associated with various cellular
FT                   activities AAA_5; SMART: AAA ATPase; KEGG: ade:Adeh_0504
FT                   two component, sigma54 specific, transcriptional regulator,
FT                   fis family"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71776"
FT                   /db_xref="GOA:B4UBW5"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B4UBW5"
FT                   /protein_id="ACG71776.1"
FT                   /translation="MSRVLVVDDEPKLGRFVQEMLELDGHEVVRAGGGVEALARLGEGA
FT                   FDVVVTDLRMPQVDGLAVLRAARARTPPPEVVMMTAHGSAESAVEAMKAGAADYVTKPF
FT                   PMDELRLRVRRLAEQRAAAARSAGLVARLAPDLVAESAGMRAAVAAAEQVAATDATVLL
FT                   LGESGTGKSQLARLVHWRSRRAAGPLVEVHCAALPDTLLEGELFGHERGAFTGAAQRRP
FT                   GHLAAADGGTLFLDEIGEIPPSTQVKLLRFLQDRSFVPLGATAPRTVDARVVAATNRDL
FT                   AAAVGAGAFREDLYYRLDVFAIRVPPLRERREDVLPIAERHLAGHGVPPERLGPDARAR
FT                   LLERPWPGNVRELENALERALILAGEGEIRAEHVAPGAAPRAAGRAAELLVEGFGLDAF
FT                   EREVIEAALARAGGNKTRAARLLGVTRRRLYSLLASHGLAVEGGERD"
FT   gene            complement(620487..621659)
FT                   /locus_tag="AnaeK_0538"
FT   CDS_pept        complement(620487..621659)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0538"
FT                   /product="Vitamin K epoxide reductase"
FT                   /note="PFAM: DSBA oxidoreductase; Vitamin K epoxide
FT                   reductase; KEGG: ade:Adeh_0505 vitamin K epoxide reductase"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71777"
FT                   /db_xref="GOA:B4UBW6"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR012932"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR038354"
FT                   /db_xref="UniProtKB/TrEMBL:B4UBW6"
FT                   /protein_id="ACG71777.1"
FT                   /translation="MPASHVPDTSRGKQPDRGGPPARSRALALAILVLALAGAGLAAEL
FT                   TLLHGRAHAGGASSFCAISERVNCDKVALSAWSSLLGVPLAAWGLLAYLVVAALALSAL
FT                   RRPRGDSGWPAGLLFAASAFMAAGAVFLAAISELVIGSLCIVCAGSWLVSFALAGCSFA
FT                   LARRAGGPAAALRADVATLRARPLASATAALALLAASGGLLARYAGPPPAPAGAPAAAP
FT                   AASLGPPGSIVLYEYSDYECPFCARSHEANKPILASRPDVKVVRRHFPLDDTCNPKLTR
FT                   PFHVGACDLARAAICAEAQGRFEQMDDALFRNQAEKAPVRELARRIGLDLPRFDACLSS
FT                   PGTEKRLADDIESAIQAGVRGTPSYVYGGKVYPGDLATLLGAKPAAASGG"
FT   sig_peptide     complement(621531..621659)
FT                   /locus_tag="AnaeK_0538"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.923) with cleavage site probability 0.913 at
FT                   residue 43"
FT   gene            complement(621716..622867)
FT                   /locus_tag="AnaeK_0539"
FT   CDS_pept        complement(621716..622867)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0539"
FT                   /product="PAS/PAC sensor signal transduction histidine
FT                   kinase"
FT                   /note="TIGRFAM: PAS sensor protein; PFAM: ATP-binding
FT                   region ATPase domain protein; histidine kinase A domain
FT                   protein; PAS fold-3 domain protein; PAS fold-4 domain
FT                   protein; PAS fold domain protein; SMART: PAS domain
FT                   containing protein; KEGG: ade:Adeh_0506 PAS/PAC sensor
FT                   signal transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71778"
FT                   /db_xref="GOA:B4UBW7"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B4UBW7"
FT                   /protein_id="ACG71778.1"
FT                   /translation="MSDPSDHRPHPAGPGHLQEQEQLLRLLVDSVKEYAIFMLDPSGHV
FT                   LTWNPGAERIKGYPAHEIVGRHFAVFFTPEDVRRGKPDAELLEAAEQGSSEDEGWRVRR
FT                   DGTRFFASVVVTALRGPDGALRGFAKITRDLTERRRGEEARRNLAEAREAVRSRDDFLA
FT                   VASHELRTPLTCVQLVAQSLARQTHEGQPVTGQQVERLHQLQRHVARLGELVSGLLDLA
FT                   EMSRGALQLEPAPFDLSELVQEVAARFEPDVRRKGTALSVHAPGPIPGRWDRRRVADAI
FT                   AAVLGNAVKYGGRSPIEVTASRDDRRALVVIEDRGPGIAPEDQSRVFERFERAAPVAHY
FT                   PGLGVGLWTARQILNAHGGDIAVESASGKGARFSLRLPLESPA"
FT   gene            623123..624151
FT                   /locus_tag="AnaeK_0540"
FT   CDS_pept        623123..624151
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0540"
FT                   /product="FAD dependent oxidoreductase"
FT                   /note="PFAM: FAD dependent oxidoreductase; KEGG:
FT                   ade:Adeh_0507 FAD dependent oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71779"
FT                   /db_xref="GOA:B4UBW8"
FT                   /db_xref="InterPro:IPR002937"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B4UBW8"
FT                   /protein_id="ACG71779.1"
FT                   /translation="MAGTEGSPVVIVGAGVAGLSCARALAEGGRRALVLDRAHGVGGRC
FT                   ATRALEGQPVDYGAVFLHGRDPAFLAALDAVPATRLDWPADVHGSGPPCQPEAFSPGEV
FT                   RRAFAEGVNAFPRHLAEGLELRLQRKVVGLVPGDGTVALRLDDGSFLETEIAVLALAAE
FT                   QADELLATVLPAPPAVAAARALLATASSHCALALLAAYGPAAPRPPWHVSYPETSRIVQ
FT                   LVSHESSKRPGSPLLVLTYQAHPAWSRQHLDDPDWPRHVLDEAARLLGPWAADPRTAHP
FT                   HRWRWARTDLAAELARPLLLALPGGARLGVAGDRFAPGGGIEAAWRSGRALAGRILAGE
FT                   GA"
FT   gene            624148..624894
FT                   /locus_tag="AnaeK_0541"
FT   CDS_pept        624148..624894
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0541"
FT                   /product="GTP cyclohydrolase II"
FT                   /EC_number="3.5.4.25"
FT                   /note="PFAM: GTP cyclohydrolase II; KEGG: ade:Adeh_0508 GTP
FT                   cyclohydrolase II"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71780"
FT                   /db_xref="GOA:B4UBW9"
FT                   /db_xref="InterPro:IPR000926"
FT                   /db_xref="InterPro:IPR032677"
FT                   /db_xref="InterPro:IPR036144"
FT                   /db_xref="UniProtKB/TrEMBL:B4UBW9"
FT                   /protein_id="ACG71780.1"
FT                   /translation="MTGGGDALAQLVLRDRDHECEGFGPGRVCVRVVAVARLPTRAGPF
FT                   RIVAFWNNRDAKEHVALVHGDVVGAADVPVRLHSECLTGDVMGSLRCDCRDQLTEGLAA
FT                   IQREGRGVLLYLRQEGRGIGLINKIRAYALQEQGLDTVEANLALGFRDDERDYAVAAHM
FT                   IHGLELRSIRLITNNPEKLRQLTAYRVEVSGRIPHVIPPGEHNRFYLETKARRSGHLLD
FT                   LEALEPRSEQADPVVVAPAPGTPGGE"
FT   gene            625013..626170
FT                   /locus_tag="AnaeK_0542"
FT   CDS_pept        625013..626170
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0542"
FT                   /product="glucose sorbosone dehydrogenase"
FT                   /note="PFAM: glucose sorbosone dehydrogenase; KEGG:
FT                   ade:Adeh_0509 glucose sorbosone dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71781"
FT                   /db_xref="GOA:B4UBX0"
FT                   /db_xref="InterPro:IPR011041"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR012938"
FT                   /db_xref="UniProtKB/TrEMBL:B4UBX0"
FT                   /protein_id="ACG71781.1"
FT                   /translation="MRPARPALAPLLLLLACGAASARRPAPGCTMVEEGFGPAGAIPIR
FT                   VERVASGLEVPWGLAFLPGGDVLVTERPGRVRLIRDGQLQPEPVATVAIAPGGEGGLLG
FT                   IAADPRFAENRRFYLYATVEAGGAPVNQVSRWTLSADGRAATREKVLLDGIPAARYHDG
FT                   GRIRFGPDGMLYVGTGDGGRPDRARDPASPSGKLLRVTPDGAPAPGNPRPDSPVLLSGV
FT                   RNLEAFDWLDAGTLILADHGPSGERSRTGQDEVTVARAGDDLGWPAVSGCDAEPGTVAP
FT                   ILSFRRAAPPGGGSVYRGSAVPQWRGSFLFGTLGSRHLHRVVLDGRGGLRAHEVYLAGD
FT                   PPSGLGRVREVVEGPDGALWVTTSNCDGRGTCPAERDLVVRLVGG"
FT   sig_peptide     625013..625081
FT                   /locus_tag="AnaeK_0542"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.983 at
FT                   residue 23"
FT   gene            626471..626887
FT                   /locus_tag="AnaeK_0543"
FT   CDS_pept        626471..626887
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0543"
FT                   /product="GreA/GreB family elongation factor"
FT                   /note="KEGG: ade:Adeh_0510 GreA/GreB family elongation
FT                   factor"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71782"
FT                   /db_xref="GOA:B4UBX1"
FT                   /db_xref="InterPro:IPR001437"
FT                   /db_xref="InterPro:IPR023459"
FT                   /db_xref="InterPro:IPR029462"
FT                   /db_xref="InterPro:IPR036953"
FT                   /db_xref="UniProtKB/TrEMBL:B4UBX1"
FT                   /protein_id="ACG71782.1"
FT                   /translation="MSRDRIYVSETDHERLRALVEQHQEGRDAAAAERLDAELDRAVRV
FT                   PDGQVPADVVAMNSRVVYEDGATGRLREVTLVYPTAADLREGRLSVLAPVGAALLGLST
FT                   GQSISWTLPDGREVELRVRSVQPPPAAPAASAAV"
FT   gene            complement(626903..628126)
FT                   /locus_tag="AnaeK_0544"
FT   CDS_pept        complement(626903..628126)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0544"
FT                   /product="sodium/hydrogen exchanger"
FT                   /note="PFAM: sodium/hydrogen exchanger; KEGG: ade:Adeh_0511
FT                   sodium/hydrogen exchanger"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71783"
FT                   /db_xref="GOA:B4UBX2"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:B4UBX2"
FT                   /protein_id="ACG71783.1"
FT                   /translation="MLRAVSSELAYIALLFALFVIPKALQRFRIPGAITSLLLGLAAAR
FT                   AGLFTGDPTLALLATLGITGLFLFAGLDVDAKDLRRGAALVAQHLVIQALLLAGVAWAI
FT                   AAATGVDWRPATLVALALVTPSTGFILDSLQSFGLDADQRFWTRTKAVATELLALAVLF
FT                   AVLQSTSVARFAGATAALLAVVVLIPLVMRAFAVAIAPWAPRSEFAFLVMLAVMAAFAT
FT                   RKLGVYYLVGAFLVGVAARRFRERLPAFSSDRLLHAVEVFASFFAPFYFFSAGAHLHPE
FT                   LLTLSSLATGVVYLAAMIPLRVGLVAVHRKLALREHLGQARRVATALVPTLVFSLVLAE
FT                   IVIERFEGVPPWLVGGIIPYALLNTMLPALTLGATASFDEVHLEVTEPEPGPALAAAPP
FT                   PAGPGQAG"
FT   gene            complement(628182..628526)
FT                   /locus_tag="AnaeK_0545"
FT   CDS_pept        complement(628182..628526)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0545"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ade:Adeh_0512 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71784"
FT                   /db_xref="UniProtKB/TrEMBL:B4UBX3"
FT                   /protein_id="ACG71784.1"
FT                   /translation="MPLLVSVRDLVFRSKIHAAGERLGVALRFAPRGGRLSEAARELGQ
FT                   GTILADLSEPGVLDEVRATRAAGLPVRIIGFLGHVEVELAGAARAAGVDEVISRGQFVQ
FT                   RLDALLTEHA"
FT   gene            complement(628584..629090)
FT                   /locus_tag="AnaeK_0546"
FT   CDS_pept        complement(628584..629090)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0546"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71785"
FT                   /db_xref="UniProtKB/TrEMBL:B4UBX4"
FT                   /protein_id="ACG71785.1"
FT                   /translation="MTRTPWIAAAALALALSGCASVAAQRARTRYLEAELDRLRFPQPA
FT                   EEIWGDVRRLLMKNEFPLADEEDPREGIQGLVVNLFTPARPTEIDRAGRRTLDTGWRKD
FT                   QTRVHAEAAPGEGGVQVRLTRLVEDQTEHGRGKPYRDVDLELELARLLAPQEAARIEAG
FT                   IPKPR"
FT   sig_peptide     complement(629019..629090)
FT                   /locus_tag="AnaeK_0546"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.455 at
FT                   residue 24"
FT   gene            complement(629087..630073)
FT                   /locus_tag="AnaeK_0547"
FT   CDS_pept        complement(629087..630073)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0547"
FT                   /product="Integral membrane protein TerC"
FT                   /note="PFAM: Integral membrane protein TerC; KEGG:
FT                   ade:Adeh_0514 integral membrane protein TerC"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71786"
FT                   /db_xref="GOA:B4UBX5"
FT                   /db_xref="InterPro:IPR005496"
FT                   /db_xref="InterPro:IPR022369"
FT                   /db_xref="UniProtKB/TrEMBL:B4UBX5"
FT                   /protein_id="ACG71786.1"
FT                   /translation="MVESIGSPTLWIGFLAFVALMLALDLGVFHRKAHVIRVREALGWS
FT                   VVWVTLALGFNALVWWQFGADRGLEFLTGYLIEKSLAVDNIFVFVIIFSALGVPPIYQH
FT                   RVLFWGILSALVLRAGMIFAGTALLARFHWTIYLFGALLVATGVKLFLGRNEAPDPTGG
FT                   RLMRLVRRVIPSTHALQGGHFVTIENGRRVATPLLLALVLVEISDVVFAVDSIPAIFAV
FT                   TLDPFIVFTSNIFAILGLRSMFFLLAGMVERFSGLKTGLSAVLVYVGLKMLAMDWVKVP
FT                   PALSLAVVAALLVAPVLFGAWRDRARGHRAAPASGRVLGSSSPEESR"
FT   gene            630234..630617
FT                   /locus_tag="AnaeK_0548"
FT   CDS_pept        630234..630617
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0548"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ade:Adeh_0515 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0548"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71787"
FT                   /db_xref="UniProtKB/TrEMBL:B4UBX6"
FT                   /protein_id="ACG71787.1"
FT                   /translation="MTVLRRAARWCLTALALATAPAARAQGEPAADAPYPLTLDVGQVK
FT                   PLCPTGTVQCPPRAILCDDPKVAVGADSPEGGALRGVGPGTTTCSAAGGSPLGARRVYR
FT                   VTVVAPGDGGARGTESDAGGTGR"
FT   sig_peptide     630234..630311
FT                   /locus_tag="AnaeK_0548"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.967 at
FT                   residue 26"
FT   gene            complement(630799..632304)
FT                   /locus_tag="AnaeK_0549"
FT   CDS_pept        complement(630799..632304)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0549"
FT                   /product="RND efflux system, outer membrane lipoprotein,
FT                   NodT family"
FT                   /note="TIGRFAM: RND efflux system, outer membrane
FT                   lipoprotein, NodT family; PFAM: outer membrane efflux
FT                   protein; KEGG: ade:Adeh_0516 RND efflux system, outer
FT                   membrane lipoprotein, NodT"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71788"
FT                   /db_xref="GOA:B4UBX7"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="InterPro:IPR010131"
FT                   /db_xref="UniProtKB/TrEMBL:B4UBX7"
FT                   /protein_id="ACG71788.1"
FT                   /translation="MRSPGLAALAALSVLAVSGCTLAPRYQRPAAPVAAEFAGGAEPAA
FT                   GPAAADLGWRDVFQDPGLQAVIDQALRENRDLRVAALNVELARAQYGIQRSYLLPTVGA
FT                   TGSGSRARTAKDLSFTGEPSVGNTFSAGVGLTSFEIDLFGRVRSLRNQALEQYLATEEA
FT                   HRSAHLALVSEVAVQYLASRALQSQVALAEQTLQTVQQSYDLAKRTFEAGRTSELDFRT
FT                   AEAQVETARVNLSAYRQQLAQAENALVLLAGGPLPKDLPAATPLEQQPPVAELPAGLPS
FT                   DLLQRRPDILSAEHQLKAANASIGAARAAFFPSISLTASVGTASTELSNLFTVGSGTWA
FT                   FSPRIDLPIFTGGRNKANLDAANVRKQIEIASYEKAIQAAFREVADALVARGRLDEQLE
FT                   AQTRRVEAEQRRYDISELRYRKGVDSYLNVLTAQRDLYGAQQQLIQTRLARFSNSIGLY
FT                   RALGGGWLERGAAAATAPAPAAPASPETPAPAETAPAAPAQQG"
FT   sig_peptide     complement(632245..632304)
FT                   /locus_tag="AnaeK_0549"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.997) with cleavage site probability 0.765 at
FT                   residue 20"
FT   gene            complement(632297..635467)
FT                   /locus_tag="AnaeK_0550"
FT   CDS_pept        complement(632297..635467)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0550"
FT                   /product="transporter, hydrophobe/amphiphile efflux-1
FT                   (HAE1) family"
FT                   /note="TIGRFAM: transporter, hydrophobe/amphiphile efflux-1
FT                   (HAE1) family; PFAM: acriflavin resistance protein; KEGG:
FT                   ade:Adeh_0517 hydrophobe/amphiphile efflux-1 HAE1"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71789"
FT                   /db_xref="GOA:B4UBX8"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR004764"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:B4UBX8"
FT                   /protein_id="ACG71789.1"
FT                   /translation="MARFFIDRPIFAWVISIMIMLAGGLAILGLPVSQYPAIAPPVVTV
FT                   FATYPGANAQTLENSVTQVIEQKMTGIDHLRYMSAASDSSGNASVTLTFEAEADPDIAQ
FT                   MQVQNKLQNAMPLLPQQVQQQGVRVLKTVSNYLLIAGLISEDGSMTRDDLNDYAFSNIV
FT                   DQISRVTGVGEVTAFGTQYAMRIWLDADKLASFKLTPLDVSAALRAQNAQVSTGSLGAA
FT                   PAVPGQQLNATVTSQTRLQTPEQFLNILLRVNPDGSQVRLRDVGTANLGGETYELESYY
FT                   NGKPAGGMGIRLASGANALRTADLVRAKLSELSQYFPPGMKVVYPVDSTPFVRISIEEV
FT                   VKTLAEAIVLVFLVMFLFLQNFRATLIPTIAVPVVLLGTFGVLAAAGFTVNTLTMLGLV
FT                   LAIGLLVDDAIVVVENVERVMSEEGLSPREATRKSMGQITGALVGIALVLAAVFVPMAF
FT                   FGGSVGVIYRQFSITVVSAMALSVVVALTLTPALCATILKPVEKGHHAGETGFFGWFNR
FT                   LYGRGSGVYEKSVGWILRRTGRALIVYAVLLAALGGLFLHLPTGFLPEEDQGSIINMVQ
FT                   LPAGATMDRTRTVMQEVTRHYLEDEKDNVEAVMAITGFSFSGRGQNAGLAFVRLKDWAE
FT                   RPKKEQHAPAIAGRAMRAFSQIKDGLAFAFVPPAVPELGNATGFELQLQDRGNLGHEAL
FT                   MAARNQLLGMAAQDPRLAKVRPLGLEDTPQYRIDVDQQKAAALGLSLADINATLSSTWG
FT                   INYVDDFVDKGRTKRVYVQAAAPFRMKPEDLNRWYVRNAGGQMVPFSSFSTGTWVYGPT
FT                   KLERFNGSPAMVIQGEPSPGHSSGEAMAAMEEHVKALPPGIGLEWSGLSYEERLSGANA
FT                   PALYAISLLVVFLALAALYESWSIPFSVMLVVPLGVLGAVLFTELAGLEAGVYFQVGLL
FT                   TTIGLSAKNAILIVEFARALYEQGMSLFDAAVEAARMRLRPIIMTSLAFILGVLPLAIA
FT                   NGAGAAGQNAIGVAVIGGMLSATFLAILLVPVFFVKIAGKRKTPPPDLVAGPRDDEDEA
FT                   APKEIAHA"
FT   gene            complement(635554..636789)
FT                   /locus_tag="AnaeK_0551"
FT   CDS_pept        complement(635554..636789)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0551"
FT                   /product="efflux transporter, RND family, MFP subunit"
FT                   /note="TIGRFAM: efflux transporter, RND family, MFP
FT                   subunit; PFAM: secretion protein HlyD family protein; KEGG:
FT                   ade:Adeh_0518 secretion protein HlyD"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71790"
FT                   /db_xref="GOA:B4UBX9"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:B4UBX9"
FT                   /protein_id="ACG71790.1"
FT                   /translation="MNPSLRSSRAAARRAPALFSGKRALALAALALAAAGCGGKKQDAR
FT                   APGPVEVGVVTISPQAVTLTTELPGRVSASKVAEVRARVNGIVLKRLFTEGSDVKQGQP
FT                   LFKIDPAPYQAALDSARAQLARAEATLASARLTSERYTELVAANAVSRQEHEDAVAALK
FT                   KAEADVAAGRAAVDAARINLGYTTVTSPVSGRIGRSEVTEGAYVQAAQATLLATVQQLD
FT                   PVYVDVTQSSAELLRMRRDLEAGKLQSAGAGKAKVALTTEDGHEYGLPGTLQFADVTVD
FT                   PGTGSVKVRAIFPNPRAELLPGTYVRARLAEGVNPAALLVPQRAVARNNKGEPTALVVA
FT                   GGKVELRNLVTERVVGDAWLVTSGVKPGEQVIVEGLQKVRPGAPVNPVPAGGAKQANAA
FT                   TPGQPAPAGAAR"
FT   sig_peptide     complement(636670..636789)
FT                   /locus_tag="AnaeK_0551"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.964) with cleavage site probability 0.501 at
FT                   residue 40"
FT   gene            636956..637582
FT                   /locus_tag="AnaeK_0552"
FT   CDS_pept        636956..637582
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0552"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: ade:Adeh_0519
FT                   transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71791"
FT                   /db_xref="GOA:B4UBY0"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR039536"
FT                   /db_xref="UniProtKB/TrEMBL:B4UBY0"
FT                   /protein_id="ACG71791.1"
FT                   /translation="MAENQAQRPPDWCVGKRQQILDGARKVFAELGYERASVDLIASRT
FT                   GVSKATLYNHFDDKSALFVACFEQGSHEMRSDLEALFGETSDDLESALQAAGERLLGKF
FT                   LSSEAVALYRSALDGFRLPEIGKMLYERGPRVTHELIAAALSRWAARGLLRLDDPYYAA
FT                   VQFVNLCHGDVMMRLHLGVLQEASPDDVRATVRRAVQTFLRAFRP"
FT   gene            637702..639315
FT                   /locus_tag="AnaeK_0553"
FT   CDS_pept        637702..639315
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0553"
FT                   /product="alpha amylase catalytic region"
FT                   /note="PFAM: alpha amylase catalytic region; SMART: alpha
FT                   amylase catalytic sub domain; KEGG: ade:Adeh_0520 alpha
FT                   amylase"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71792"
FT                   /db_xref="GOA:B4UBY1"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:B4UBY1"
FT                   /protein_id="ACG71792.1"
FT                   /translation="MTPARSPRRTPLALLAAIALAALACGGGSTPPPPVDVSPVPAADP
FT                   GSALPDGWERGPFAEIYVRGYQDSDGDGVGDLRGLASRLDHLAGLGVRGIWLMPVTASQ
FT                   DHDHGYAVADYRGVEPGYGTLEDLDALVAAAHARGIGVILDYVMNHSAANNPLFLNSAD
FT                   DKSNPYRGWYLWRSSQPSGWSVYGGNPWRQSGSGWYYAPFATNMPDFDLANPAVAAYHA
FT                   DSQRFWLNRGVDGFRFDAVGMLYENGPGAWNDQPQNYVRMAEVRALLDGYERRFMVCEG
FT                   PDDPAGFTAACGSAFAFGLQYDVMGAARGDAAAVARVAAYFEDPARLAASTLLSNHDAF
FT                   AGQRPWDQLGGDEARYRLAAATYLLLPGIPFVYYGEEIGMGGAASLSGDWRLRAPMSWT
FT                   GDARTAGFTTGKPFRALSSNAATHNVEAEQGRAGSLLEFYREVIGLRRSVPALDRGGYE
FT                   GARASGATLSFRRTLGTSHALVLLNYDVVPLTLPVTGLPPGAALAPRLPGTAPAVTADA
FT                   AGAASFDLPALSVRVYTWDG"
FT   sig_peptide     637702..637776
FT                   /locus_tag="AnaeK_0553"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.697 at
FT                   residue 25"
FT   gene            complement(639317..640108)
FT                   /locus_tag="AnaeK_0554"
FT   CDS_pept        complement(639317..640108)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0554"
FT                   /product="phosphoesterase PA-phosphatase related"
FT                   /note="PFAM: phosphoesterase PA-phosphatase related; KEGG:
FT                   ade:Adeh_0521 phosphoesterase, PA-phosphatase related"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71793"
FT                   /db_xref="GOA:B4UBY2"
FT                   /db_xref="InterPro:IPR000326"
FT                   /db_xref="InterPro:IPR036938"
FT                   /db_xref="UniProtKB/TrEMBL:B4UBY2"
FT                   /protein_id="ACG71793.1"
FT                   /translation="MRRHRLLVPPALAAVLALSALPAPARPAPAELRVNLAADGAVTAG
FT                   ALAAALGLRLLERDLLPATCRWCSPGRFDAWAHETLAWKHPSRAATASDLLGVGVPLGA
FT                   AAALTVPDLAAGAPRRAAEDALLLAEAVSIATLGTELVKVGTDRIRPDAWDGSGPARAL
FT                   DSRVSFWSGHTATAFAAAAAAGTLATLRDAPAAPWIVGGGAAAAGAVGYLRLAADRHWA
FT                   TDVLAGAGWGTAVGILVPWLHWHPVAHVRLMPSPGGIAGEF"
FT   sig_peptide     complement(640046..640108)
FT                   /locus_tag="AnaeK_0554"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.993) with cleavage site probability 0.749 at
FT                   residue 21"
FT   gene            complement(640105..641028)
FT                   /locus_tag="AnaeK_0555"
FT   CDS_pept        complement(640105..641028)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0555"
FT                   /product="alpha/beta hydrolase fold"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG: ade:Adeh_0522
FT                   alpha/beta hydrolase fold-1"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0555"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71794"
FT                   /db_xref="GOA:B4UBY3"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR000639"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B4UBY3"
FT                   /protein_id="ACG71794.1"
FT                   /translation="MEATRARGRYAASVDTLALQANGLRFAALADGPGDGPLALLLHGF
FT                   PELARSWRHQLPALAAAGWRAVAPDLRGYGGTEKRGPFDLATLAADAAGLVRALGRERA
FT                   VVIGHDWGGAVAWAVAGRHPEVVSRLVVLNAPHPSAFARELRRNRRQLLRSSYMLLFQV
FT                   PLLPEWLLTRDRAAGVARALRGGSYVRSAWPAEELEPYRRAFLQPGAARAALGYYRAAF
FT                   RGRRSPGPRPRPISAPTLILWGVEDRFLGVETIARAKLAPYLSPGNPPEIVPIEGAGHF
FT                   VQNEAPEQVNAALLRWLGPGAGRSAT"
FT   gene            641186..641941
FT                   /locus_tag="AnaeK_0556"
FT   CDS_pept        641186..641941
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0556"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ade:Adeh_0523 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0556"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71795"
FT                   /db_xref="UniProtKB/TrEMBL:B4UBY4"
FT                   /protein_id="ACG71795.1"
FT                   /translation="MKKLTWLAALLPALAAADTSPLLLAGAQIDATGTTAVQTQPMPKG
FT                   WFSTRNVLDRTKTSLVTRLAAGATPCSADLGVVATLSSVTAGNFTEVVNPQDRTVRYVW
FT                   DTVADLSPFQNRWHYYTGCDGVRVVLGCPESIPVTVGMEAFARSGACQSYVDDLGQTVC
FT                   AADQVVAMLPAVQEADQVATGCVEEGGDTSCGIGPCESACTQSCDAQFPVGRGADKGNV
FT                   ALLKACKEACPCTCKYERPARCPQPQNCD"
FT   sig_peptide     641186..641239
FT                   /locus_tag="AnaeK_0556"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.559 at
FT                   residue 18"
FT   gene            642097..642531
FT                   /locus_tag="AnaeK_0557"
FT   CDS_pept        642097..642531
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0557"
FT                   /product="protein of unknown function DUF454"
FT                   /note="PFAM: protein of unknown function DUF454; KEGG:
FT                   ade:Adeh_0524 protein of unknown function DUF454"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0557"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71796"
FT                   /db_xref="GOA:B4UBY5"
FT                   /db_xref="InterPro:IPR007401"
FT                   /db_xref="UniProtKB/TrEMBL:B4UBY5"
FT                   /protein_id="ACG71796.1"
FT                   /translation="MPPDPEPTTAATRAAAPARRLLLLALGWTAFALGAIGLLLPIVPT
FT                   TPFMLVALWAFSASSERFHRWLYTHRLFGPPLQKWQRDRAIPAWVKALALGSMTLSLAW
FT                   LAFAVRPPRYVLLAAAALVAGGAAFVLRIPSRPRQPVREP"
FT   gene            642531..642884
FT                   /locus_tag="AnaeK_0558"
FT   CDS_pept        642531..642884
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0558"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ade:Adeh_0525 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0558"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71797"
FT                   /db_xref="UniProtKB/TrEMBL:B4UBY6"
FT                   /protein_id="ACG71797.1"
FT                   /translation="MAPRLLAILGVAALLVACGAGRGHRGEAARAAAATGGCGAGCPEG
FT                   QVCVDVPGDACTWPSDPACPGACVEPVPCGGFAAIRCPGDRACVDDPRDDCAPPRGADC
FT                   GGLCAPGPAADAR"
FT   sig_peptide     642531..642590
FT                   /locus_tag="AnaeK_0558"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.976) with cleavage site probability 0.429 at
FT                   residue 20"
FT   gene            642954..643868
FT                   /locus_tag="AnaeK_0559"
FT   CDS_pept        642954..643868
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0559"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: ade:Adeh_0526 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0559"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71798"
FT                   /db_xref="GOA:B4UBY7"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B4UBY7"
FT                   /protein_id="ACG71798.1"
FT                   /translation="MKDLPLNALRALALVFAHRGVRPAARELGVAHSSLSRHLAELEAW
FT                   AGTPLTRGPGGRGGLAFTPQGEALGQAALAALRELERAAAAVREARSERSVVISTTASF
FT                   AARWLLPRLPALEASHADLEVSVLVDPRPVDLGTAGVGEVDLAIRLGHGPWRDLDCEPL
FT                   LDEVLYPVMSPAAWRAAGSPRRPAALARLRLLHDRDPGATWELWRRAHGPASLDVRRGP
FT                   RLASTDLVLRAAAQGQGVALARHRLAADDLAAGLLVRPFEPSVAIGPAYWLVLPPHGRG
FT                   RPATAAVVGWLEDQARACGPVPS"
FT   gene            644091..644795
FT                   /locus_tag="AnaeK_0560"
FT   CDS_pept        644091..644795
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0560"
FT                   /product="aspartate racemase"
FT                   /note="TIGRFAM: aspartate racemase; PFAM: Asp/Glu/hydantoin
FT                   racemase; KEGG: ade:Adeh_0528 aspartate racemase"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0560"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71799"
FT                   /db_xref="GOA:B4UBY8"
FT                   /db_xref="InterPro:IPR001920"
FT                   /db_xref="InterPro:IPR004380"
FT                   /db_xref="InterPro:IPR015942"
FT                   /db_xref="UniProtKB/TrEMBL:B4UBY8"
FT                   /protein_id="ACG71799.1"
FT                   /translation="MQPIVGIVGGLGPEGTVHYYRKLTARLAALPLDAGRPGIAVDHVW
FT                   IDRFSALLRAGADADALELLLGSLRRLERAGATLALFAAVTPHRFLPALRPRSPLPIAD
FT                   LVGATCEDVRAAGHRVVGLVGTRFTVSEPFFRDALEAAGVRVVVPDEAGTDDLDALIFG
FT                   PLARGEKTPAMQGELAAIVSRMARREPLDALVVACTDLMDLMGTEVPLLDPIDSHLRLA
FT                   LRMLPASGARAQ"
FT   gene            complement(644800..645264)
FT                   /locus_tag="AnaeK_0561"
FT   CDS_pept        complement(644800..645264)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0561"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; KEGG: ade:Adeh_0529
FT                   glyoxalase/bleomycin resistance protein/dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0561"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71800"
FT                   /db_xref="GOA:B4UBY9"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:B4UBY9"
FT                   /protein_id="ACG71800.1"
FT                   /translation="MPAVKHIPDGYQALTPYLVMKDAARAIDFYAKVFGAVELMRMPGP
FT                   EGRVGHAELKIGDARLMLADEHPEMGALGPKSIGGTAVGLVVYVPDVDATVARAVAAGA
FT                   TVKGAVEDKFYGDRMGSIVDPFGHLWHVGTHKEDVSPEEMQRRMAALPPM"
FT   gene            complement(645347..645946)
FT                   /locus_tag="AnaeK_0562"
FT   CDS_pept        complement(645347..645946)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0562"
FT                   /product="phosphoesterase PA-phosphatase related"
FT                   /note="PFAM: phosphoesterase PA-phosphatase related; KEGG:
FT                   ade:Adeh_0530 phosphoesterase, PA-phosphatase related"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71801"
FT                   /db_xref="GOA:B4UBZ0"
FT                   /db_xref="InterPro:IPR000326"
FT                   /db_xref="InterPro:IPR036938"
FT                   /db_xref="UniProtKB/TrEMBL:B4UBZ0"
FT                   /protein_id="ACG71801.1"
FT                   /translation="MLAAITHDLHTAGEAWLFRALNADGGPILDGLMVVLSSKPFGAAW
FT                   AILLAVLIARAVRGPAGLRLVAALGAAIAMSDGLGSQLLRPLLARRRPCYALPPGTFRW
FT                   LAPAADVGSLPSLHAANFFAMATVAAAAGPRLGLAALGVAVLVALSRVYVGVHWPTDVL
FT                   AGAAWGVVCGMVARLLATRLWAAWGRRRAAPPPPAP"
FT   gene            complement(646016..647833)
FT                   /locus_tag="AnaeK_0563"
FT   CDS_pept        complement(646016..647833)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0563"
FT                   /product="thermosensitive mutation transmembrane protein,
FT                   SuhR"
FT                   /note="KEGG: ade:Adeh_0531 suppressor of E.coli RpoH
FT                   thermosensitive mutation transmembrane protein, SuhR"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0563"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71802"
FT                   /db_xref="GOA:B4UBZ1"
FT                   /db_xref="InterPro:IPR002641"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="UniProtKB/TrEMBL:B4UBZ1"
FT                   /protein_id="ACG71802.1"
FT                   /translation="MQTGTGSADGLLECDLVMKGGITSGVVYPLALVELARRYRFRSVG
FT                   GSSAGAIAAAAAVAAEYGRQTGATAEGAGFAGLAALPASLGERLPDGRSRLGSLFQPSR
FT                   RTRPVLEALLGAARGRSAAGKVARALAPLVLAAPGCWVALAGLLLAGAVGALAARQEGA
FT                   AAAIAVALSAVAVLVLSALGAIAMSGAAALGAIAANGLGVCSGFAPPGGDRPPPLTPWL
FT                   HGLIQRLAGTREVLTLGDLERHGLRLEVTTTSVTHQRPFRLPLHPDDPVFFFREAEFRA
FT                   LFPGEVVDRLVEAGRAEEAERRARTDGRRVRLPAHDPSLVLFPRGPGLPVVVLARMSLS
FT                   FPLLLGAVPLYGVDWTRKRNQRRRARPELERAWFSDGGICSNIPIHFFDAALPTRPTFA
FT                   IDLREQHPDHPLGAWLPANNASGIAQRWHRLGEGRAAPLRFLAAVVTTMQTWVDEMQLA
FT                   APGYRDRIVHVSHAADEGGLNLEMPPEVIERLAARGAAAGERLRDRFRWEDHRWIRFRS
FT                   LLDVMQRYVAPTWTAHAPGTAGRAALLELLEAHRGRRGSYPVTGPQADCARAALQGVDR
FT                   LVEATAATGGDLTERAPRPAPELRARPRV"
FT   gene            648013..648957
FT                   /locus_tag="AnaeK_0564"
FT   CDS_pept        648013..648957
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0564"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ade:Adeh_0532 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0564"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71803"
FT                   /db_xref="UniProtKB/TrEMBL:B4UBZ2"
FT                   /protein_id="ACG71803.1"
FT                   /translation="MTRDPAPGAWPELPLAQWDATRYALHMWTQMMGKTLLACAAPLNH
FT                   WWHVALRVSARGLASAAAIPTRDGCLDLELDLVEHALVVRTERRTVSIPLVTRSVHAFY
FT                   DEYLAVLDALGVRVRLWPVPVEVPDPVPFDRDDAPRPYDAEAAHRFWQVLRRCAAALEA
FT                   LGDGFVGKQSPVHFFWGGFDLAATRFSGRRAPARPGVDAMMREAYSHEVISWGFWPGGA
FT                   AMSGIRVDEPVLFAYAAPEPAGFRDADPGAAAARYDGRLGEFLLPYAAVRAAPDPAAEI
FT                   RAFCEATYRAGASRGGWDRAALERTAGPPAAGP"
FT   gene            649030..650226
FT                   /locus_tag="AnaeK_0565"
FT   CDS_pept        649030..650226
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0565"
FT                   /product="aminotransferase class I and II"
FT                   /note="PFAM: aminotransferase class I and II; KEGG:
FT                   ade:Adeh_0533 aspartate aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0565"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71804"
FT                   /db_xref="GOA:B4UBZ3"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:B4UBZ3"
FT                   /protein_id="ACG71804.1"
FT                   /translation="MDVVTRQIRSEMEGASWIRRMFDAGLELKQRIGADQVFDFSLGNP
FT                   DVPPPAAAAAALRDLAGEVTAPMGLGYCPNAGLPSVRAALARRLAAEQQAPVEARHLVL
FT                   TCGAAGGLVTFFRAVLEPGDEVLCFAPYFVEYGAYAGHFGGVLRAVPSIVPDFTPDLAA
FT                   LEAAIGPRTRVVLVNSPNNPTGRIYDAATMQALGALLSRVNQGRERPVFLVSDEPYRRL
FT                   AYGGAAVPAILPLTPFSLVVGSFSKSLSLAGERVGYLLVNPAMPDAQVLVDALTLTNRT
FT                   LGFVNAPVVGQRLVEALVDESVDVGVYDRRRRAMAEALTGAGISFHLPEGAFYFFPEVP
FT                   GGDDQAFVRLLLEENILAVPGRGFGMPGYMRLTFCVDEQVIRRAAPGFARAARKARGG"
FT   gene            complement(650223..651308)
FT                   /locus_tag="AnaeK_0566"
FT   CDS_pept        complement(650223..651308)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0566"
FT                   /product="thioesterase superfamily protein"
FT                   /note="PFAM: thioesterase superfamily protein; KEGG:
FT                   ade:Adeh_0534 thioesterase superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0566"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71805"
FT                   /db_xref="GOA:B4UBZ4"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="InterPro:IPR033120"
FT                   /db_xref="UniProtKB/TrEMBL:B4UBZ4"
FT                   /protein_id="ACG71805.1"
FT                   /translation="MTPAQTDRTLTLPLSRDLALRRRFMVVDEPLQGNLRFGLLLEALD
FT                   KLAEEAALDYARSAHPQARVVTAAVDNILVRHPPDVERDLELSARVNHVGRTSMEVGIR
FT                   VTQPGDPPLHVASCYFTMVARLGEGDEARSVPLPPLEYPGERARHRERRALERRDEYRR
FT                   HLAASDEPPDRAEFELLRGLHRAQDVPGFTGLLAAELATDAWERMFPEQENVPRKIFGG
FT                   YVMRRAYELSSICAEHAAPERPVLAAVNRVNFFHPVRLGDTLHFSCRVVHTAGSFVSVE
FT                   ASIERRSRDRTVRALSNSCLFTFVNVDREMRPRDALAVYPTTFAEDARLLAARRQHAAL
FT                   LRHAHRGWISEGWTSEAPAGA"
FT   gene            651566..652192
FT                   /locus_tag="AnaeK_0567"
FT   CDS_pept        651566..652192
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0567"
FT                   /product="OmpW family protein"
FT                   /note="PFAM: OmpW family protein; KEGG: ade:Adeh_0535 outer
FT                   membrane protein, OmpW"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0567"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71806"
FT                   /db_xref="GOA:B4UBZ5"
FT                   /db_xref="InterPro:IPR005618"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="UniProtKB/TrEMBL:B4UBZ5"
FT                   /protein_id="ACG71806.1"
FT                   /translation="MKRMLLVMALALAMAPVAKAQEPTPESGLMVRLRALYLSPSDRSD
FT                   AIPALGVPKDAITVSDKVIPEVDLSWFFNRYLAAELILTYPQEHDVKLSGTKIGTFSHL
FT                   PPTLTVQGHLPLGRVKPYLGAGVNLTLVTDTSLNVPGVGKLELEDYSFGFAAQAGLDVQ
FT                   VTGRWYVNADVKYVTIRSDVKAGGTKVSEVRVDPWLIGGGVGYRF"
FT   sig_peptide     651566..651628
FT                   /locus_tag="AnaeK_0567"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.998 at
FT                   residue 21"
FT   gene            652332..653045
FT                   /locus_tag="AnaeK_0568"
FT   CDS_pept        652332..653045
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0568"
FT                   /product="histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase A domain protein; KEGG: ade:Adeh_0536
FT                   histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0568"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71807"
FT                   /db_xref="GOA:B4UBZ6"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B4UBZ6"
FT                   /protein_id="ACG71807.1"
FT                   /translation="MRDAREPGEPAAAGGADRAASRGEGLDGATLAHELKNPLTAVKAL
FT                   VQLGLANPREAASHERLEQVARAVERMERILRDYLASARGMAELAPAQVEVGPLVTGVL
FT                   QGLSARASEARVRLVARGDATVEADPRRLEEALVNLVANGIEATPPGGEVAVEVLSSAE
FT                   GAELVVRDTGSGITADALERLGTPFFSTRSGGNGLGVAHVRSVIAMHGGSLRYESEPGK
FT                   GTVVRATLPRRARAA"
FT   gene            complement(653047..653784)
FT                   /locus_tag="AnaeK_0569"
FT   CDS_pept        complement(653047..653784)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0569"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ade:Adeh_0537 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0569"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71808"
FT                   /db_xref="GOA:B4UBZ7"
FT                   /db_xref="UniProtKB/TrEMBL:B4UBZ7"
FT                   /protein_id="ACG71808.1"
FT                   /translation="MTGAPSWPAARRARGPLAEVDGRVVLLLALLFGVLVWRAGAAANA
FT                   LYAAGFAAALAASGATAREARRLARWAGGFALLWGGVKLALDLAGGVPPPAALATAGLL
FT                   CLRLAALLLLGAAVSALVTPRALGLALATLTRPVLRDRAWTASLALLLMVHFVPRALAA
FT                   FEAARAALRARRVRLSRTRALALVVEAGTRNLARMTWDQTLAVAARRLDRPEAWTGAPP
FT                   PRARDWCAGTAVAVLALAAAALL"
FT   gene            complement(653781..654509)
FT                   /locus_tag="AnaeK_0570"
FT   CDS_pept        complement(653781..654509)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0570"
FT                   /product="ABC transporter-related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: ade:Adeh_0538 ABC transporter, ATPase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0570"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71809"
FT                   /db_xref="GOA:B4UBZ8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B4UBZ8"
FT                   /protein_id="ACG71809.1"
FT                   /translation="MIRADGLGYAFGAGGPALEAIGFALPRAALCAVVGANGSGKSTLL
FT                   ALLAGLFTPSAGTLAVGGDASPGAEEAIRRRAALVLQDPDQQIIGATVEEDLLLGLPPG
FT                   DAAARDAARALAARLGLADLAAPVHALSLGTRRKLCIATALRDAPEVLLLDEPFAGLDY
FT                   PAIREVRAVLAANRAAGVTQVVAAHDLEALADLADRWLVLERGRLVADGAAEAVFPLLR
FT                   RHGVRPPGAWLSAHGLDPWA"
FT   gene            complement(654506..655087)
FT                   /locus_tag="AnaeK_0571"
FT   CDS_pept        complement(654506..655087)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0571"
FT                   /product="BioY protein"
FT                   /note="PFAM: BioY protein; KEGG: ade:Adeh_0539 BioY
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0571"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71810"
FT                   /db_xref="GOA:B4UBZ9"
FT                   /db_xref="InterPro:IPR003784"
FT                   /db_xref="UniProtKB/TrEMBL:B4UBZ9"
FT                   /protein_id="ACG71810.1"
FT                   /translation="MPAPNTDPAPPRPAPSPPLARVHRLVWTALLAACIAVGAWIQVPI
FT                   GAVPITLQPLFAFLAGYLLGPARGAAAVALYVAAGVLGLPVFAGGAAGLGVVLGPTGGY
FT                   LLGFVVAAALTGLVPRRGPLGWAAGLAAGAAALAAAYLVGAAWLAAVLHLGARQAIVAG
FT                   VVPFLPFDVVKVVVALWVARRLRAQGLAPA"
FT   gene            655204..655860
FT                   /locus_tag="AnaeK_0572"
FT   CDS_pept        655204..655860
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0572"
FT                   /product="phospholipase/Carboxylesterase"
FT                   /note="PFAM: phospholipase/Carboxylesterase; KEGG:
FT                   ade:Adeh_0540 phospholipase/carboxylesterase"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0572"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71811"
FT                   /db_xref="GOA:B4UC00"
FT                   /db_xref="InterPro:IPR003140"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B4UC00"
FT                   /protein_id="ACG71811.1"
FT                   /translation="MTSRPALPLVHVVRPPRVPSAHPPLLVLLHGIGADERDLLPLAAH
FT                   LDPRFLVVSLRAPNQAEPMGFAWYAIDWRTSPPRHDAAQAAASLDILVAFLAAAPAALG
FT                   TDPARTFLFGFSQGAAMSLAAALARPELVRGAVLHSGRPLPGQPAPAGELAGLEVLVLH
FT                   GRADPVLPPEHGRAIRDLLAPALGPRLVHRELDGAHEVTAETLGEAARWLSARLG"
FT   gene            655870..656670
FT                   /locus_tag="AnaeK_0573"
FT   CDS_pept        655870..656670
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0573"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ade:Adeh_0541 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0573"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71812"
FT                   /db_xref="UniProtKB/TrEMBL:B4UC01"
FT                   /protein_id="ACG71812.1"
FT                   /translation="MRPRSLAVGLAVAVSCAAALAPARPLAGPPYTTDDPEPVPFRHWE
FT                   VYLATADQWSHADGWGGTCPHLEVNYGAVPGVQLHLVAPLAWVRPPGGPGHAGPGDTEL
FT                   GAKWRFVAEGERRPQVGVFPLVELPTGDDRRGLGAGRTQVFLPVWVQKSLGEWTTYGGG
FT                   GYWLNPGAGNRNWWLVGWQAQRRVAEGVALGAEVFHSSAREIGGGGDTRFNVGAVLDLG
FT                   ELHHVLVSAGRALGSRAAQAYLAYQLTFGPGGGSEQPPGNGAPR"
FT   sig_peptide     655870..655953
FT                   /locus_tag="AnaeK_0573"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.759 at
FT                   residue 28"
FT   gene            complement(656612..657589)
FT                   /locus_tag="AnaeK_0574"
FT   CDS_pept        complement(656612..657589)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0574"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: ade:Adeh_0542 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0574"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71813"
FT                   /db_xref="GOA:B4UC02"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B4UC02"
FT                   /protein_id="ACG71813.1"
FT                   /translation="MDREQLAAFDQVAREASFTRAAIALGLGQPAVSARIRALEDQVGG
FT                   ALFTRGRRVALTALGESLLPYARRALEVLSEGLEAARLAQVGQRGRVRLGTLGSVAGGL
FT                   VGPALGAFVRGHPEVECLVRAGDHERIVALLLDGLVDLGIVTWPCPEPVAAELQDVLRF
FT                   HEPVLLVARPGHPVTTRADLAADELVRLGRPMFRLRWWQGQHPLLTRLAEQAGTPVEIP
FT                   METARALALEGAGVGFFVRTYVAEDLARGTLVEVAVRDLPPVFRDTALVRRRRGGPLSP
FT                   AAAALVELLRRQAAALGVLEGGRGPVSAGRRSRGAAPIRRQGRR"
FT   gene            657705..658298
FT                   /locus_tag="AnaeK_0575"
FT   CDS_pept        657705..658298
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0575"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   ade:Adeh_0543 GCN5-related N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0575"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71814"
FT                   /db_xref="GOA:B4UC03"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:B4UC03"
FT                   /protein_id="ACG71814.1"
FT                   /translation="MKRIRMATLDDAGDVAEIYGAVVAGTPISFELEPPGPGEMARRMA
FT                   AVLELAPWLVCEEDGRVDGYVYASRHHERAAYRWSVDVTVYVREGRRRGGLGRALYTAL
FT                   LELLRAQGFHAAHAGITLPNAGSVGLHEALGFRPIGVYPRVGWKMGAWHDVGYWQLELR
FT                   ERTGAPGPILPVDALRRSAAWDRAIAAGEALLAR"
FT   gene            658404..658763
FT                   /locus_tag="AnaeK_0576"
FT   CDS_pept        658404..658763
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0576"
FT                   /product="SirA-like protein"
FT                   /note="KEGG: swo:Swol_1887 SirA-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0576"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71815"
FT                   /db_xref="InterPro:IPR003787"
FT                   /db_xref="InterPro:IPR019870"
FT                   /db_xref="InterPro:IPR027396"
FT                   /db_xref="UniProtKB/TrEMBL:B4UC04"
FT                   /protein_id="ACG71815.1"
FT                   /translation="MAEATARQGGTVVVVNAEQMGRGDDGLGAKLLGNYLRTLASLEPK
FT                   PEAIVFYNGAVRLLGPGSAHLEALRQLDDAGVDLLACITCLEFFQLTGKLEVGHVSNMR
FT                   EIAQRTLAAAKVITL"
FT   gene            658963..659955
FT                   /locus_tag="AnaeK_0577"
FT   CDS_pept        658963..659955
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0577"
FT                   /product="aldo/keto reductase"
FT                   /note="PFAM: aldo/keto reductase; KEGG: ade:Adeh_0544
FT                   aldo/keto reductase"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0577"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71816"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:B4UC05"
FT                   /protein_id="ACG71816.1"
FT                   /translation="MTLATRRLGSQGLEVSALGLGCMGMSQSYGEADETESIATLHRAL
FT                   ELGVTFLDTAEVYGPFHNEELLGRALAGKRDRAVVATKFGFQIGGGARTGALDSRPEHV
FT                   REAVEGSLRRLRTDRIDLLYQHRVDPAVPIEDVVGAMSRLVEEGKVRYLGLSEAGARTI
FT                   RRAHAVHPITALQSEYSLWERNLEPEILPALRALGIGLVAFSPLGRGFLTGAVRRAEEY
FT                   PETDFRRRDPRFQGANFDANVRAADAVRALAARKGATPGQLALAWLLHRGEDVVPIPGT
FT                   KRRRYLEENVAAATIALSPEERAELDAALSPENVSGPRYDDERMRTVDR"
FT   gene            complement(659975..660331)
FT                   /locus_tag="AnaeK_0578"
FT   CDS_pept        complement(659975..660331)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0578"
FT                   /product="Antibiotic biosynthesis monooxygenase"
FT                   /note="PFAM: Antibiotic biosynthesis monooxygenase; KEGG:
FT                   ade:Adeh_0545 antibiotic biosynthesis monooxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0578"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71817"
FT                   /db_xref="GOA:B4UC06"
FT                   /db_xref="InterPro:IPR007138"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:B4UC06"
FT                   /protein_id="ACG71817.1"
FT                   /translation="MTLLTTPLESDPSLQFRIDAFEVPEDARAEFEAAMRGNLEVLAGL
FT                   PGFRGHLVFRRTGGPSRFGLITLAVWESRAALDAAAAAVRAHYERIGFDRTAALARWRI
FT                   RSELGGYEVLRPPE"
FT   gene            660419..661192
FT                   /locus_tag="AnaeK_0579"
FT   CDS_pept        660419..661192
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0579"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="SMART: helix-turn-helix- domain containing protein
FT                   AraC type; KEGG: ade:Adeh_0546 transcriptional regulator,
FT                   AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0579"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71818"
FT                   /db_xref="GOA:B4UC07"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="UniProtKB/TrEMBL:B4UC07"
FT                   /protein_id="ACG71818.1"
FT                   /translation="MQVRTFQPGPALADLVRCFQIVEAPEEATRTLLPDPGAVVAFRYR
FT                   GAAALVEDGEATRIPDASITGPRGTSRRIRTFAGGALVVAKLREDGAARLLGVPVDELY
FT                   GAVLPADVLAPRADVDRAAARIAGAASDEERVASLEAFLRARGGPRAPDRLVGAAVQAI
FT                   RARRGCLRIAALARELGVGQDALEKRFRRVVGTSPKRLASLLRLHHAVEVHLGGASLSS
FT                   APYQAGYSDQSHFIREFRAVTGEPPGRYFAAGTHG"
FT   gene            complement(661206..661805)
FT                   /locus_tag="AnaeK_0580"
FT   CDS_pept        complement(661206..661805)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0580"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sus:Acid_2818 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0580"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71819"
FT                   /db_xref="UniProtKB/TrEMBL:B4UC08"
FT                   /protein_id="ACG71819.1"
FT                   /translation="MRPFAPVRVPVLLTLSLCAFATPAAAADPGPVKPGGAAAAAAAQA
FT                   PDRWAAFRGFLGVWEGTSRGAPGTGTVRREYRLVLGDRFIEVRNASTYPPQEGNREGEL
FT                   HEDVGYISLDRARSVHVLRQFHLEGFVNTYAAPAGSPPASPLVFTSEAIENIAPGWRAR
FT                   ETYRFEGPDELVEVFELAAPGKDFTTYTEARLKRVR"
FT   sig_peptide     complement(661725..661805)
FT                   /locus_tag="AnaeK_0580"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.954 at
FT                   residue 27"
FT   gene            complement(661865..662491)
FT                   /locus_tag="AnaeK_0581"
FT   CDS_pept        complement(661865..662491)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0581"
FT                   /product="pyridoxamine 5'-phosphate oxidase-related
FT                   FMN-binding"
FT                   /note="PFAM: pyridoxamine 5'-phosphate oxidase-related
FT                   FMN-binding; KEGG: ade:Adeh_0547 FMN-binding pyridoxamine
FT                   5'-phosphate oxidase-related protein protein"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0581"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71820"
FT                   /db_xref="GOA:B4UC09"
FT                   /db_xref="InterPro:IPR011576"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:B4UC09"
FT                   /protein_id="ACG71820.1"
FT                   /translation="MGHRFAELAFTPSVRAAQEAMGSRAAYARMEAGPDHHDALGPDEA
FT                   GFIAARDSFYLASVGETGWPYVQHRGGPPGFVRVLGPRTIGFADYRGNRQYVTVGNVTH
FT                   DDRVALFFMDYPARTRLKLLGHARLVGPEEPALLAALGPPPAAARVERALVVEVAAFDW
FT                   NCSQHITPRWTEAEVEAATAPLRARIEELERRLADAEAAGGPGRR"
FT   gene            complement(662574..663584)
FT                   /locus_tag="AnaeK_0582"
FT   CDS_pept        complement(662574..663584)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0582"
FT                   /product="alpha/beta hydrolase fold"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG: ade:Adeh_0548
FT                   alpha/beta hydrolase fold-1"
FT                   /db_xref="EnsemblGenomes-Gn:AnaeK_0582"
FT                   /db_xref="EnsemblGenomes-Tr:ACG71821"
FT                   /db_xref="GOA:B4UCJ7"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR000639"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B4UCJ7"
FT                   /protein_id="ACG71821.1"
FT                   /translation="MIPIPPTRRPARPLAAALLAALALAPAALPSRTAAAPARQASTAA
FT                   QVRYRTVNLDGVEVFYREAGRPGAPAILLLHGFPTSSHMFRNLIPALADRYHVIAPDYP
FT                   GFGHSAMPARDAFSYTFDRYAQVVEALTERLGLRRYALYVMDYGAPVGFRLATAHPERV
FT                   TALVVQNGNAYDEGIREFWDPIKAYWASGSAADREAIRWLTSLKATHWQYTNGAPDPSL
FT                   VSPDTWTVDQARLDRPGNQEVQLDLFYDYRTNLPLYPAWQAYFRSHRPPTLVVWGKNDA
FT                   IFVAAGAEPYRRDNPSAEVHLLDTGHFALETHGPEIARLIREFLGRAVPAKAAGN"
FT   sig_peptide     complement(663477..663584)
FT                   /locus_tag="AnaeK_0582"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.613 at
FT                   residue 36"
FT   gene            663705..664664
FT                   /locus_tag="AnaeK_0583"
FT   CDS_pept        663705..664664
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AnaeK_0583"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note