(data stored in ACNUC7421 zone)

EMBL: CP001135

ID   CP001135; SV 1; circular; genomic DNA; STD; PRO; 3760463 BP.
XX
AC   CP001135;
XX
PR   Project:PRJNA28539;
XX
DT   18-NOV-2009 (Rel. 102, Created)
DT   15-MAY-2014 (Rel. 120, Last updated, Version 4)
XX
DE   Edwardsiella tarda EIB202, complete genome.
XX
KW   .
XX
OS   Edwardsiella tarda EIB202
OC   Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales;
OC   Hafniaceae; Edwardsiella.
XX
RN   [1]
RC   Publication Status: Online-Only
RP   1-3760463
RX   DOI; 10.1371/journal.pone.0007646.
RX   PUBMED; 19865481.
RA   Wang Q., Yang M., Xiao J., Wu H., Wang X., Lv Y., Xu L., Zheng H., Wang S.,
RA   Zhao G., Liu Q., Zhang Y.;
RT   "Genome sequence of the versatile fish pathogen Edwardsiella tarda provides
RT   insights into its adaptation to broad host ranges and intracellular
RT   niches";
RL   PLoS One 4(10):E7646-E7646(2009).
XX
RN   [2]
RP   1-3760463
RG   Chinese National Human Genome Center at Shanghai
RA   Zhang Y., Wang Q., Liu Q., Yang M., Ma Y., Wu H.;
RT   ;
RL   Submitted (15-AUG-2008) to the INSDC.
RL   State Key Laboratory of Bioreactor Engineering, East China University of
RL   Science and Technology, Meilong Road 130, Shanghai 200237, People's
RL   Republic of China
XX
DR   MD5; 432a9c1e395040ce9ee122d58c3e4c7b.
DR   BioSample; SAMN02603129.
DR   EnsemblGenomes-Gn; EBG00000994478.
DR   EnsemblGenomes-Gn; EBG00000994481.
DR   EnsemblGenomes-Gn; EBG00000994483.
DR   EnsemblGenomes-Gn; EBG00000994485.
DR   EnsemblGenomes-Gn; EBG00000994486.
DR   EnsemblGenomes-Gn; EBG00000994488.
DR   EnsemblGenomes-Gn; EBG00000994490.
DR   EnsemblGenomes-Gn; EBG00000994491.
DR   EnsemblGenomes-Gn; EBG00000994493.
DR   EnsemblGenomes-Gn; EBG00000994495.
DR   EnsemblGenomes-Gn; EBG00000994497.
DR   EnsemblGenomes-Gn; EBG00000994500.
DR   EnsemblGenomes-Gn; EBG00000994503.
DR   EnsemblGenomes-Gn; EBG00000994507.
DR   EnsemblGenomes-Gn; EBG00000994510.
DR   EnsemblGenomes-Gn; EBG00000994513.
DR   EnsemblGenomes-Gn; EBG00000994516.
DR   EnsemblGenomes-Gn; EBG00000994519.
DR   EnsemblGenomes-Gn; EBG00000994521.
DR   EnsemblGenomes-Gn; EBG00000994523.
DR   EnsemblGenomes-Gn; EBG00000994526.
DR   EnsemblGenomes-Gn; EBG00000994528.
DR   EnsemblGenomes-Gn; EBG00000994529.
DR   EnsemblGenomes-Gn; EBG00000994531.
DR   EnsemblGenomes-Gn; EBG00000994533.
DR   EnsemblGenomes-Gn; EBG00000994536.
DR   EnsemblGenomes-Gn; EBG00000994539.
DR   EnsemblGenomes-Gn; EBG00000994541.
DR   EnsemblGenomes-Gn; EBG00000994543.
DR   EnsemblGenomes-Gn; EBG00000994545.
DR   EnsemblGenomes-Gn; EBG00000994547.
DR   EnsemblGenomes-Gn; EBG00000994551.
DR   EnsemblGenomes-Gn; EBG00000994552.
DR   EnsemblGenomes-Gn; EBG00000994553.
DR   EnsemblGenomes-Gn; EBG00000994555.
DR   EnsemblGenomes-Gn; EBG00000994557.
DR   EnsemblGenomes-Gn; EBG00000994559.
DR   EnsemblGenomes-Gn; EBG00000994561.
DR   EnsemblGenomes-Gn; EBG00000994563.
DR   EnsemblGenomes-Gn; EBG00000994565.
DR   EnsemblGenomes-Gn; EBG00000994567.
DR   EnsemblGenomes-Gn; EBG00000994571.
DR   EnsemblGenomes-Gn; EBG00000994574.
DR   EnsemblGenomes-Gn; EBG00000994577.
DR   EnsemblGenomes-Gn; EBG00000994580.
DR   EnsemblGenomes-Gn; EBG00000994583.
DR   EnsemblGenomes-Gn; EBG00000994586.
DR   EnsemblGenomes-Gn; EBG00000994587.
DR   EnsemblGenomes-Gn; EBG00000994588.
DR   EnsemblGenomes-Gn; EBG00000994590.
DR   EnsemblGenomes-Gn; EBG00000994591.
DR   EnsemblGenomes-Gn; EBG00000994595.
DR   EnsemblGenomes-Gn; EBG00000994597.
DR   EnsemblGenomes-Gn; EBG00000994601.
DR   EnsemblGenomes-Gn; EBG00000994602.
DR   EnsemblGenomes-Gn; EBG00000994606.
DR   EnsemblGenomes-Gn; EBG00000994610.
DR   EnsemblGenomes-Gn; EBG00000994614.
DR   EnsemblGenomes-Gn; EBG00000994617.
DR   EnsemblGenomes-Gn; EBG00000994620.
DR   EnsemblGenomes-Gn; EBG00000994623.
DR   EnsemblGenomes-Gn; EBG00000994626.
DR   EnsemblGenomes-Gn; EBG00000994629.
DR   EnsemblGenomes-Gn; EBG00000994633.
DR   EnsemblGenomes-Gn; EBG00000994636.
DR   EnsemblGenomes-Gn; EBG00000994639.
DR   EnsemblGenomes-Gn; EBG00000994642.
DR   EnsemblGenomes-Gn; EBG00000994645.
DR   EnsemblGenomes-Gn; EBG00000994648.
DR   EnsemblGenomes-Gn; EBG00000994653.
DR   EnsemblGenomes-Gn; EBG00000994656.
DR   EnsemblGenomes-Gn; EBG00000994659.
DR   EnsemblGenomes-Gn; EBG00000994662.
DR   EnsemblGenomes-Gn; EBG00000994665.
DR   EnsemblGenomes-Gn; EBG00000994669.
DR   EnsemblGenomes-Gn; EBG00000994672.
DR   EnsemblGenomes-Gn; EBG00000994676.
DR   EnsemblGenomes-Gn; EBG00000994678.
DR   EnsemblGenomes-Gn; EBG00000994681.
DR   EnsemblGenomes-Gn; EBG00000994684.
DR   EnsemblGenomes-Gn; EBG00000994688.
DR   EnsemblGenomes-Gn; EBG00000994689.
DR   EnsemblGenomes-Gn; EBG00000994693.
DR   EnsemblGenomes-Gn; EBG00000994697.
DR   EnsemblGenomes-Gn; EBG00000994700.
DR   EnsemblGenomes-Gn; EBG00000994702.
DR   EnsemblGenomes-Gn; EBG00000994706.
DR   EnsemblGenomes-Gn; EBG00000994709.
DR   EnsemblGenomes-Gn; EBG00000994712.
DR   EnsemblGenomes-Gn; EBG00000994714.
DR   EnsemblGenomes-Gn; EBG00000994717.
DR   EnsemblGenomes-Gn; EBG00000994722.
DR   EnsemblGenomes-Gn; EBG00000994726.
DR   EnsemblGenomes-Gn; EBG00000994729.
DR   EnsemblGenomes-Gn; EBG00000994732.
DR   EnsemblGenomes-Gn; EBG00000994735.
DR   EnsemblGenomes-Gn; EBG00000994738.
DR   EnsemblGenomes-Gn; EBG00000994742.
DR   EnsemblGenomes-Gn; EBG00000994746.
DR   EnsemblGenomes-Gn; EBG00000994752.
DR   EnsemblGenomes-Gn; EBG00000994756.
DR   EnsemblGenomes-Gn; EBG00000994761.
DR   EnsemblGenomes-Gn; EBG00000994765.
DR   EnsemblGenomes-Gn; EBG00000994769.
DR   EnsemblGenomes-Gn; EBG00000994773.
DR   EnsemblGenomes-Gn; EBG00000994777.
DR   EnsemblGenomes-Gn; EBG00000994782.
DR   EnsemblGenomes-Gn; EBG00000994787.
DR   EnsemblGenomes-Gn; EBG00000994792.
DR   EnsemblGenomes-Gn; EBG00000994797.
DR   EnsemblGenomes-Gn; EBG00000994802.
DR   EnsemblGenomes-Gn; EBG00000994806.
DR   EnsemblGenomes-Gn; EBG00000994809.
DR   EnsemblGenomes-Gn; EBG00000994813.
DR   EnsemblGenomes-Gn; EBG00000994817.
DR   EnsemblGenomes-Gn; EBG00000994821.
DR   EnsemblGenomes-Gn; EBG00000994824.
DR   EnsemblGenomes-Gn; EBG00000994828.
DR   EnsemblGenomes-Gn; EBG00000994834.
DR   EnsemblGenomes-Gn; EBG00000994837.
DR   EnsemblGenomes-Gn; EBG00000994841.
DR   EnsemblGenomes-Gn; EBG00000994845.
DR   EnsemblGenomes-Gn; EBG00000994849.
DR   EnsemblGenomes-Gn; EBG00000994854.
DR   EnsemblGenomes-Gn; EBG00000994859.
DR   EnsemblGenomes-Gn; EBG00000994864.
DR   EnsemblGenomes-Gn; EBG00000994868.
DR   EnsemblGenomes-Gn; EBG00000994871.
DR   EnsemblGenomes-Gn; EBG00000994875.
DR   EnsemblGenomes-Gn; EBG00000994879.
DR   EnsemblGenomes-Gn; EBG00000994881.
DR   EnsemblGenomes-Gn; EBG00000994884.
DR   EnsemblGenomes-Gn; EBG00000994889.
DR   EnsemblGenomes-Gn; EBG00000994892.
DR   EnsemblGenomes-Gn; EBG00000994895.
DR   EnsemblGenomes-Gn; EBG00000994902.
DR   EnsemblGenomes-Gn; EBG00000994904.
DR   EnsemblGenomes-Gn; EBG00000994907.
DR   EnsemblGenomes-Gn; EBG00000994910.
DR   EnsemblGenomes-Gn; EBG00000994913.
DR   EnsemblGenomes-Gn; EBG00000994916.
DR   EnsemblGenomes-Gn; EBG00000994917.
DR   EnsemblGenomes-Gn; EBG00000994918.
DR   EnsemblGenomes-Gn; EBG00000994921.
DR   EnsemblGenomes-Gn; EBG00000994924.
DR   EnsemblGenomes-Gn; EBG00000994928.
DR   EnsemblGenomes-Gn; EBG00000994931.
DR   EnsemblGenomes-Gn; EBG00000994934.
DR   EnsemblGenomes-Gn; EBG00000994937.
DR   EnsemblGenomes-Gn; EBG00000994940.
DR   EnsemblGenomes-Gn; EBG00000994943.
DR   EnsemblGenomes-Gn; EBG00000994946.
DR   EnsemblGenomes-Gn; EBG00000994949.
DR   EnsemblGenomes-Gn; EBG00000994951.
DR   EnsemblGenomes-Gn; EBG00000994954.
DR   EnsemblGenomes-Gn; EBG00000994957.
DR   EnsemblGenomes-Gn; EBG00000994961.
DR   EnsemblGenomes-Gn; EBG00000994963.
DR   EnsemblGenomes-Gn; EBG00000994965.
DR   EnsemblGenomes-Gn; EBG00000994967.
DR   EnsemblGenomes-Gn; EBG00000994969.
DR   EnsemblGenomes-Gn; EBG00000994971.
DR   EnsemblGenomes-Gn; EBG00000994973.
DR   EnsemblGenomes-Gn; EBG00000994975.
DR   EnsemblGenomes-Gn; EBG00000994977.
DR   EnsemblGenomes-Gn; EBG00000994979.
DR   EnsemblGenomes-Gn; EBG00000994981.
DR   EnsemblGenomes-Gn; EBG00000994982.
DR   EnsemblGenomes-Gn; EBG00000994983.
DR   EnsemblGenomes-Gn; EBG00000994985.
DR   EnsemblGenomes-Gn; EBG00000994988.
DR   EnsemblGenomes-Gn; EBG00000994990.
DR   EnsemblGenomes-Gn; EBG00000994992.
DR   EnsemblGenomes-Gn; EBG00000994994.
DR   EnsemblGenomes-Gn; EBG00000994995.
DR   EnsemblGenomes-Gn; EBG00000994998.
DR   EnsemblGenomes-Gn; ETAE_R025.
DR   EnsemblGenomes-Gn; ETAE_r001.
DR   EnsemblGenomes-Gn; ETAE_r002.
DR   EnsemblGenomes-Gn; ETAE_r003.
DR   EnsemblGenomes-Gn; ETAE_r004.
DR   EnsemblGenomes-Gn; ETAE_r005.
DR   EnsemblGenomes-Gn; ETAE_r006.
DR   EnsemblGenomes-Gn; ETAE_r007.
DR   EnsemblGenomes-Gn; ETAE_r008.
DR   EnsemblGenomes-Gn; ETAE_r009.
DR   EnsemblGenomes-Gn; ETAE_r010.
DR   EnsemblGenomes-Gn; ETAE_r011.
DR   EnsemblGenomes-Gn; ETAE_r012.
DR   EnsemblGenomes-Gn; ETAE_r013.
DR   EnsemblGenomes-Gn; ETAE_r014.
DR   EnsemblGenomes-Gn; ETAE_r015.
DR   EnsemblGenomes-Gn; ETAE_r016.
DR   EnsemblGenomes-Gn; ETAE_r017.
DR   EnsemblGenomes-Gn; ETAE_r018.
DR   EnsemblGenomes-Gn; ETAE_r019.
DR   EnsemblGenomes-Gn; ETAE_r020.
DR   EnsemblGenomes-Gn; ETAE_r021.
DR   EnsemblGenomes-Gn; ETAE_r022.
DR   EnsemblGenomes-Gn; ETAE_r023.
DR   EnsemblGenomes-Gn; ETAE_r024.
DR   EnsemblGenomes-Gn; ETAE_t001.
DR   EnsemblGenomes-Gn; ETAE_t002.
DR   EnsemblGenomes-Gn; ETAE_t003.
DR   EnsemblGenomes-Gn; ETAE_t004.
DR   EnsemblGenomes-Gn; ETAE_t005.
DR   EnsemblGenomes-Gn; ETAE_t006.
DR   EnsemblGenomes-Gn; ETAE_t007.
DR   EnsemblGenomes-Gn; ETAE_t008.
DR   EnsemblGenomes-Gn; ETAE_t009.
DR   EnsemblGenomes-Gn; ETAE_t010.
DR   EnsemblGenomes-Gn; ETAE_t011.
DR   EnsemblGenomes-Gn; ETAE_t012.
DR   EnsemblGenomes-Gn; ETAE_t013.
DR   EnsemblGenomes-Gn; ETAE_t014.
DR   EnsemblGenomes-Gn; ETAE_t015.
DR   EnsemblGenomes-Gn; ETAE_t016.
DR   EnsemblGenomes-Gn; ETAE_t017.
DR   EnsemblGenomes-Gn; ETAE_t018.
DR   EnsemblGenomes-Gn; ETAE_t019.
DR   EnsemblGenomes-Gn; ETAE_t020.
DR   EnsemblGenomes-Gn; ETAE_t021.
DR   EnsemblGenomes-Gn; ETAE_t022.
DR   EnsemblGenomes-Gn; ETAE_t023.
DR   EnsemblGenomes-Gn; ETAE_t024.
DR   EnsemblGenomes-Gn; ETAE_t025.
DR   EnsemblGenomes-Gn; ETAE_t026.
DR   EnsemblGenomes-Gn; ETAE_t027.
DR   EnsemblGenomes-Gn; ETAE_t028.
DR   EnsemblGenomes-Gn; ETAE_t029.
DR   EnsemblGenomes-Gn; ETAE_t030.
DR   EnsemblGenomes-Gn; ETAE_t031.
DR   EnsemblGenomes-Gn; ETAE_t032.
DR   EnsemblGenomes-Gn; ETAE_t033.
DR   EnsemblGenomes-Gn; ETAE_t034.
DR   EnsemblGenomes-Gn; ETAE_t035.
DR   EnsemblGenomes-Gn; ETAE_t036.
DR   EnsemblGenomes-Gn; ETAE_t037.
DR   EnsemblGenomes-Gn; ETAE_t038.
DR   EnsemblGenomes-Gn; ETAE_t039.
DR   EnsemblGenomes-Gn; ETAE_t040.
DR   EnsemblGenomes-Gn; ETAE_t041.
DR   EnsemblGenomes-Gn; ETAE_t042.
DR   EnsemblGenomes-Gn; ETAE_t043.
DR   EnsemblGenomes-Gn; ETAE_t044.
DR   EnsemblGenomes-Gn; ETAE_t045.
DR   EnsemblGenomes-Gn; ETAE_t046.
DR   EnsemblGenomes-Gn; ETAE_t047.
DR   EnsemblGenomes-Gn; ETAE_t048.
DR   EnsemblGenomes-Gn; ETAE_t049.
DR   EnsemblGenomes-Gn; ETAE_t050.
DR   EnsemblGenomes-Gn; ETAE_t051.
DR   EnsemblGenomes-Gn; ETAE_t052.
DR   EnsemblGenomes-Gn; ETAE_t053.
DR   EnsemblGenomes-Gn; ETAE_t054.
DR   EnsemblGenomes-Gn; ETAE_t055.
DR   EnsemblGenomes-Gn; ETAE_t056.
DR   EnsemblGenomes-Gn; ETAE_t057.
DR   EnsemblGenomes-Gn; ETAE_t058.
DR   EnsemblGenomes-Gn; ETAE_t059.
DR   EnsemblGenomes-Gn; ETAE_t060.
DR   EnsemblGenomes-Gn; ETAE_t061.
DR   EnsemblGenomes-Gn; ETAE_t062.
DR   EnsemblGenomes-Gn; ETAE_t063.
DR   EnsemblGenomes-Gn; ETAE_t064.
DR   EnsemblGenomes-Gn; ETAE_t065.
DR   EnsemblGenomes-Gn; ETAE_t066.
DR   EnsemblGenomes-Gn; ETAE_t067.
DR   EnsemblGenomes-Gn; ETAE_t068.
DR   EnsemblGenomes-Gn; ETAE_t069.
DR   EnsemblGenomes-Gn; ETAE_t070.
DR   EnsemblGenomes-Gn; ETAE_t071.
DR   EnsemblGenomes-Gn; ETAE_t072.
DR   EnsemblGenomes-Gn; ETAE_t073.
DR   EnsemblGenomes-Gn; ETAE_t074.
DR   EnsemblGenomes-Gn; ETAE_t075.
DR   EnsemblGenomes-Gn; ETAE_t076.
DR   EnsemblGenomes-Gn; ETAE_t077.
DR   EnsemblGenomes-Gn; ETAE_t078.
DR   EnsemblGenomes-Gn; ETAE_t079.
DR   EnsemblGenomes-Gn; ETAE_t080.
DR   EnsemblGenomes-Gn; ETAE_t081.
DR   EnsemblGenomes-Gn; ETAE_t082.
DR   EnsemblGenomes-Gn; ETAE_t083.
DR   EnsemblGenomes-Gn; ETAE_t084.
DR   EnsemblGenomes-Gn; ETAE_t085.
DR   EnsemblGenomes-Gn; ETAE_t086.
DR   EnsemblGenomes-Gn; ETAE_t087.
DR   EnsemblGenomes-Gn; ETAE_t088.
DR   EnsemblGenomes-Gn; ETAE_t089.
DR   EnsemblGenomes-Gn; ETAE_t090.
DR   EnsemblGenomes-Gn; ETAE_t091.
DR   EnsemblGenomes-Gn; ETAE_t092.
DR   EnsemblGenomes-Gn; ETAE_t093.
DR   EnsemblGenomes-Gn; ETAE_t094.
DR   EnsemblGenomes-Gn; ETAE_t095.
DR   EnsemblGenomes-Tr; EBT00001521866.
DR   EnsemblGenomes-Tr; EBT00001521867.
DR   EnsemblGenomes-Tr; EBT00001521868.
DR   EnsemblGenomes-Tr; EBT00001521869.
DR   EnsemblGenomes-Tr; EBT00001521870.
DR   EnsemblGenomes-Tr; EBT00001521871.
DR   EnsemblGenomes-Tr; EBT00001521872.
DR   EnsemblGenomes-Tr; EBT00001521873.
DR   EnsemblGenomes-Tr; EBT00001521874.
DR   EnsemblGenomes-Tr; EBT00001521875.
DR   EnsemblGenomes-Tr; EBT00001521876.
DR   EnsemblGenomes-Tr; EBT00001521877.
DR   EnsemblGenomes-Tr; EBT00001521878.
DR   EnsemblGenomes-Tr; EBT00001521879.
DR   EnsemblGenomes-Tr; EBT00001521880.
DR   EnsemblGenomes-Tr; EBT00001521881.
DR   EnsemblGenomes-Tr; EBT00001521882.
DR   EnsemblGenomes-Tr; EBT00001521883.
DR   EnsemblGenomes-Tr; EBT00001521884.
DR   EnsemblGenomes-Tr; EBT00001521885.
DR   EnsemblGenomes-Tr; EBT00001521886.
DR   EnsemblGenomes-Tr; EBT00001521887.
DR   EnsemblGenomes-Tr; EBT00001521888.
DR   EnsemblGenomes-Tr; EBT00001521889.
DR   EnsemblGenomes-Tr; EBT00001521890.
DR   EnsemblGenomes-Tr; EBT00001521891.
DR   EnsemblGenomes-Tr; EBT00001521892.
DR   EnsemblGenomes-Tr; EBT00001521893.
DR   EnsemblGenomes-Tr; EBT00001521894.
DR   EnsemblGenomes-Tr; EBT00001521895.
DR   EnsemblGenomes-Tr; EBT00001521896.
DR   EnsemblGenomes-Tr; EBT00001521897.
DR   EnsemblGenomes-Tr; EBT00001521898.
DR   EnsemblGenomes-Tr; EBT00001521899.
DR   EnsemblGenomes-Tr; EBT00001521900.
DR   EnsemblGenomes-Tr; EBT00001521901.
DR   EnsemblGenomes-Tr; EBT00001521902.
DR   EnsemblGenomes-Tr; EBT00001521903.
DR   EnsemblGenomes-Tr; EBT00001521904.
DR   EnsemblGenomes-Tr; EBT00001521905.
DR   EnsemblGenomes-Tr; EBT00001521906.
DR   EnsemblGenomes-Tr; EBT00001521907.
DR   EnsemblGenomes-Tr; EBT00001521908.
DR   EnsemblGenomes-Tr; EBT00001521909.
DR   EnsemblGenomes-Tr; EBT00001521910.
DR   EnsemblGenomes-Tr; EBT00001521911.
DR   EnsemblGenomes-Tr; EBT00001521912.
DR   EnsemblGenomes-Tr; EBT00001521913.
DR   EnsemblGenomes-Tr; EBT00001521914.
DR   EnsemblGenomes-Tr; EBT00001521915.
DR   EnsemblGenomes-Tr; EBT00001521916.
DR   EnsemblGenomes-Tr; EBT00001521917.
DR   EnsemblGenomes-Tr; EBT00001521918.
DR   EnsemblGenomes-Tr; EBT00001521919.
DR   EnsemblGenomes-Tr; EBT00001521920.
DR   EnsemblGenomes-Tr; EBT00001521921.
DR   EnsemblGenomes-Tr; EBT00001521922.
DR   EnsemblGenomes-Tr; EBT00001521923.
DR   EnsemblGenomes-Tr; EBT00001521924.
DR   EnsemblGenomes-Tr; EBT00001521925.
DR   EnsemblGenomes-Tr; EBT00001521926.
DR   EnsemblGenomes-Tr; EBT00001521927.
DR   EnsemblGenomes-Tr; EBT00001521928.
DR   EnsemblGenomes-Tr; EBT00001521929.
DR   EnsemblGenomes-Tr; EBT00001521930.
DR   EnsemblGenomes-Tr; EBT00001521931.
DR   EnsemblGenomes-Tr; EBT00001521932.
DR   EnsemblGenomes-Tr; EBT00001521933.
DR   EnsemblGenomes-Tr; EBT00001521934.
DR   EnsemblGenomes-Tr; EBT00001521935.
DR   EnsemblGenomes-Tr; EBT00001521936.
DR   EnsemblGenomes-Tr; EBT00001521937.
DR   EnsemblGenomes-Tr; EBT00001521938.
DR   EnsemblGenomes-Tr; EBT00001521939.
DR   EnsemblGenomes-Tr; EBT00001521940.
DR   EnsemblGenomes-Tr; EBT00001521941.
DR   EnsemblGenomes-Tr; EBT00001521942.
DR   EnsemblGenomes-Tr; EBT00001521943.
DR   EnsemblGenomes-Tr; EBT00001521944.
DR   EnsemblGenomes-Tr; EBT00001521945.
DR   EnsemblGenomes-Tr; EBT00001521946.
DR   EnsemblGenomes-Tr; EBT00001521947.
DR   EnsemblGenomes-Tr; EBT00001521948.
DR   EnsemblGenomes-Tr; EBT00001521949.
DR   EnsemblGenomes-Tr; EBT00001521950.
DR   EnsemblGenomes-Tr; EBT00001521951.
DR   EnsemblGenomes-Tr; EBT00001521952.
DR   EnsemblGenomes-Tr; EBT00001521953.
DR   EnsemblGenomes-Tr; EBT00001521954.
DR   EnsemblGenomes-Tr; EBT00001521955.
DR   EnsemblGenomes-Tr; EBT00001521956.
DR   EnsemblGenomes-Tr; EBT00001521957.
DR   EnsemblGenomes-Tr; EBT00001521958.
DR   EnsemblGenomes-Tr; EBT00001521959.
DR   EnsemblGenomes-Tr; EBT00001521960.
DR   EnsemblGenomes-Tr; EBT00001521961.
DR   EnsemblGenomes-Tr; EBT00001521962.
DR   EnsemblGenomes-Tr; EBT00001521963.
DR   EnsemblGenomes-Tr; EBT00001521964.
DR   EnsemblGenomes-Tr; EBT00001521965.
DR   EnsemblGenomes-Tr; EBT00001521966.
DR   EnsemblGenomes-Tr; EBT00001521967.
DR   EnsemblGenomes-Tr; EBT00001521968.
DR   EnsemblGenomes-Tr; EBT00001521969.
DR   EnsemblGenomes-Tr; EBT00001521970.
DR   EnsemblGenomes-Tr; EBT00001521971.
DR   EnsemblGenomes-Tr; EBT00001521972.
DR   EnsemblGenomes-Tr; EBT00001521973.
DR   EnsemblGenomes-Tr; EBT00001521974.
DR   EnsemblGenomes-Tr; EBT00001521975.
DR   EnsemblGenomes-Tr; EBT00001521976.
DR   EnsemblGenomes-Tr; EBT00001521977.
DR   EnsemblGenomes-Tr; EBT00001521978.
DR   EnsemblGenomes-Tr; EBT00001521979.
DR   EnsemblGenomes-Tr; EBT00001521980.
DR   EnsemblGenomes-Tr; EBT00001521981.
DR   EnsemblGenomes-Tr; EBT00001521982.
DR   EnsemblGenomes-Tr; EBT00001521983.
DR   EnsemblGenomes-Tr; EBT00001521984.
DR   EnsemblGenomes-Tr; EBT00001521985.
DR   EnsemblGenomes-Tr; EBT00001521986.
DR   EnsemblGenomes-Tr; EBT00001521987.
DR   EnsemblGenomes-Tr; EBT00001521988.
DR   EnsemblGenomes-Tr; EBT00001521989.
DR   EnsemblGenomes-Tr; EBT00001521990.
DR   EnsemblGenomes-Tr; EBT00001521991.
DR   EnsemblGenomes-Tr; EBT00001521992.
DR   EnsemblGenomes-Tr; EBT00001521993.
DR   EnsemblGenomes-Tr; EBT00001521994.
DR   EnsemblGenomes-Tr; EBT00001521995.
DR   EnsemblGenomes-Tr; EBT00001521996.
DR   EnsemblGenomes-Tr; EBT00001521997.
DR   EnsemblGenomes-Tr; EBT00001521998.
DR   EnsemblGenomes-Tr; EBT00001521999.
DR   EnsemblGenomes-Tr; EBT00001522000.
DR   EnsemblGenomes-Tr; EBT00001522001.
DR   EnsemblGenomes-Tr; EBT00001522002.
DR   EnsemblGenomes-Tr; EBT00001522003.
DR   EnsemblGenomes-Tr; EBT00001522004.
DR   EnsemblGenomes-Tr; EBT00001522005.
DR   EnsemblGenomes-Tr; EBT00001522006.
DR   EnsemblGenomes-Tr; EBT00001522007.
DR   EnsemblGenomes-Tr; EBT00001522008.
DR   EnsemblGenomes-Tr; EBT00001522009.
DR   EnsemblGenomes-Tr; EBT00001522010.
DR   EnsemblGenomes-Tr; EBT00001522011.
DR   EnsemblGenomes-Tr; EBT00001522012.
DR   EnsemblGenomes-Tr; EBT00001522013.
DR   EnsemblGenomes-Tr; EBT00001522014.
DR   EnsemblGenomes-Tr; EBT00001522015.
DR   EnsemblGenomes-Tr; EBT00001522016.
DR   EnsemblGenomes-Tr; EBT00001522017.
DR   EnsemblGenomes-Tr; EBT00001522018.
DR   EnsemblGenomes-Tr; EBT00001522019.
DR   EnsemblGenomes-Tr; EBT00001522020.
DR   EnsemblGenomes-Tr; EBT00001522021.
DR   EnsemblGenomes-Tr; EBT00001522022.
DR   EnsemblGenomes-Tr; EBT00001522023.
DR   EnsemblGenomes-Tr; EBT00001522024.
DR   EnsemblGenomes-Tr; EBT00001522025.
DR   EnsemblGenomes-Tr; EBT00001522026.
DR   EnsemblGenomes-Tr; EBT00001522027.
DR   EnsemblGenomes-Tr; EBT00001522028.
DR   EnsemblGenomes-Tr; EBT00001522029.
DR   EnsemblGenomes-Tr; EBT00001522030.
DR   EnsemblGenomes-Tr; EBT00001522031.
DR   EnsemblGenomes-Tr; EBT00001522032.
DR   EnsemblGenomes-Tr; EBT00001522033.
DR   EnsemblGenomes-Tr; EBT00001522034.
DR   EnsemblGenomes-Tr; EBT00001522035.
DR   EnsemblGenomes-Tr; EBT00001522036.
DR   EnsemblGenomes-Tr; EBT00001522037.
DR   EnsemblGenomes-Tr; EBT00001522038.
DR   EnsemblGenomes-Tr; EBT00001522039.
DR   EnsemblGenomes-Tr; EBT00001522040.
DR   EnsemblGenomes-Tr; EBT00001522041.
DR   EnsemblGenomes-Tr; ETAE_R025-1.
DR   EnsemblGenomes-Tr; ETAE_r001-1.
DR   EnsemblGenomes-Tr; ETAE_r002-1.
DR   EnsemblGenomes-Tr; ETAE_r003-1.
DR   EnsemblGenomes-Tr; ETAE_r004-1.
DR   EnsemblGenomes-Tr; ETAE_r005-1.
DR   EnsemblGenomes-Tr; ETAE_r006-1.
DR   EnsemblGenomes-Tr; ETAE_r007-1.
DR   EnsemblGenomes-Tr; ETAE_r008-1.
DR   EnsemblGenomes-Tr; ETAE_r009-1.
DR   EnsemblGenomes-Tr; ETAE_r010-1.
DR   EnsemblGenomes-Tr; ETAE_r011-1.
DR   EnsemblGenomes-Tr; ETAE_r012-1.
DR   EnsemblGenomes-Tr; ETAE_r013-1.
DR   EnsemblGenomes-Tr; ETAE_r014-1.
DR   EnsemblGenomes-Tr; ETAE_r015-1.
DR   EnsemblGenomes-Tr; ETAE_r016-1.
DR   EnsemblGenomes-Tr; ETAE_r017-1.
DR   EnsemblGenomes-Tr; ETAE_r018-1.
DR   EnsemblGenomes-Tr; ETAE_r019-1.
DR   EnsemblGenomes-Tr; ETAE_r020-1.
DR   EnsemblGenomes-Tr; ETAE_r021-1.
DR   EnsemblGenomes-Tr; ETAE_r022-1.
DR   EnsemblGenomes-Tr; ETAE_r023-1.
DR   EnsemblGenomes-Tr; ETAE_r024-1.
DR   EnsemblGenomes-Tr; ETAE_t001-1.
DR   EnsemblGenomes-Tr; ETAE_t002-1.
DR   EnsemblGenomes-Tr; ETAE_t003-1.
DR   EnsemblGenomes-Tr; ETAE_t004-1.
DR   EnsemblGenomes-Tr; ETAE_t005-1.
DR   EnsemblGenomes-Tr; ETAE_t006-1.
DR   EnsemblGenomes-Tr; ETAE_t007-1.
DR   EnsemblGenomes-Tr; ETAE_t008-1.
DR   EnsemblGenomes-Tr; ETAE_t009-1.
DR   EnsemblGenomes-Tr; ETAE_t010-1.
DR   EnsemblGenomes-Tr; ETAE_t011-1.
DR   EnsemblGenomes-Tr; ETAE_t012-1.
DR   EnsemblGenomes-Tr; ETAE_t013-1.
DR   EnsemblGenomes-Tr; ETAE_t014-1.
DR   EnsemblGenomes-Tr; ETAE_t015-1.
DR   EnsemblGenomes-Tr; ETAE_t016-1.
DR   EnsemblGenomes-Tr; ETAE_t017-1.
DR   EnsemblGenomes-Tr; ETAE_t018-1.
DR   EnsemblGenomes-Tr; ETAE_t019-1.
DR   EnsemblGenomes-Tr; ETAE_t020-1.
DR   EnsemblGenomes-Tr; ETAE_t021-1.
DR   EnsemblGenomes-Tr; ETAE_t022-1.
DR   EnsemblGenomes-Tr; ETAE_t023-1.
DR   EnsemblGenomes-Tr; ETAE_t024-1.
DR   EnsemblGenomes-Tr; ETAE_t025-1.
DR   EnsemblGenomes-Tr; ETAE_t026-1.
DR   EnsemblGenomes-Tr; ETAE_t027-1.
DR   EnsemblGenomes-Tr; ETAE_t028-1.
DR   EnsemblGenomes-Tr; ETAE_t029-1.
DR   EnsemblGenomes-Tr; ETAE_t030-1.
DR   EnsemblGenomes-Tr; ETAE_t031-1.
DR   EnsemblGenomes-Tr; ETAE_t032-1.
DR   EnsemblGenomes-Tr; ETAE_t033-1.
DR   EnsemblGenomes-Tr; ETAE_t034-1.
DR   EnsemblGenomes-Tr; ETAE_t035-1.
DR   EnsemblGenomes-Tr; ETAE_t036-1.
DR   EnsemblGenomes-Tr; ETAE_t037-1.
DR   EnsemblGenomes-Tr; ETAE_t038-1.
DR   EnsemblGenomes-Tr; ETAE_t039-1.
DR   EnsemblGenomes-Tr; ETAE_t040-1.
DR   EnsemblGenomes-Tr; ETAE_t041-1.
DR   EnsemblGenomes-Tr; ETAE_t042-1.
DR   EnsemblGenomes-Tr; ETAE_t043-1.
DR   EnsemblGenomes-Tr; ETAE_t044-1.
DR   EnsemblGenomes-Tr; ETAE_t045-1.
DR   EnsemblGenomes-Tr; ETAE_t046-1.
DR   EnsemblGenomes-Tr; ETAE_t047-1.
DR   EnsemblGenomes-Tr; ETAE_t048-1.
DR   EnsemblGenomes-Tr; ETAE_t049-1.
DR   EnsemblGenomes-Tr; ETAE_t050-1.
DR   EnsemblGenomes-Tr; ETAE_t051-1.
DR   EnsemblGenomes-Tr; ETAE_t052-1.
DR   EnsemblGenomes-Tr; ETAE_t053-1.
DR   EnsemblGenomes-Tr; ETAE_t054-1.
DR   EnsemblGenomes-Tr; ETAE_t055-1.
DR   EnsemblGenomes-Tr; ETAE_t056-1.
DR   EnsemblGenomes-Tr; ETAE_t057-1.
DR   EnsemblGenomes-Tr; ETAE_t058-1.
DR   EnsemblGenomes-Tr; ETAE_t059-1.
DR   EnsemblGenomes-Tr; ETAE_t060-1.
DR   EnsemblGenomes-Tr; ETAE_t061-1.
DR   EnsemblGenomes-Tr; ETAE_t062-1.
DR   EnsemblGenomes-Tr; ETAE_t063-1.
DR   EnsemblGenomes-Tr; ETAE_t064-1.
DR   EnsemblGenomes-Tr; ETAE_t065-1.
DR   EnsemblGenomes-Tr; ETAE_t066-1.
DR   EnsemblGenomes-Tr; ETAE_t067-1.
DR   EnsemblGenomes-Tr; ETAE_t068-1.
DR   EnsemblGenomes-Tr; ETAE_t069-1.
DR   EnsemblGenomes-Tr; ETAE_t070-1.
DR   EnsemblGenomes-Tr; ETAE_t071-1.
DR   EnsemblGenomes-Tr; ETAE_t072-1.
DR   EnsemblGenomes-Tr; ETAE_t073-1.
DR   EnsemblGenomes-Tr; ETAE_t074-1.
DR   EnsemblGenomes-Tr; ETAE_t075-1.
DR   EnsemblGenomes-Tr; ETAE_t076-1.
DR   EnsemblGenomes-Tr; ETAE_t077-1.
DR   EnsemblGenomes-Tr; ETAE_t078-1.
DR   EnsemblGenomes-Tr; ETAE_t079-1.
DR   EnsemblGenomes-Tr; ETAE_t080-1.
DR   EnsemblGenomes-Tr; ETAE_t081-1.
DR   EnsemblGenomes-Tr; ETAE_t082-1.
DR   EnsemblGenomes-Tr; ETAE_t083-1.
DR   EnsemblGenomes-Tr; ETAE_t084-1.
DR   EnsemblGenomes-Tr; ETAE_t085-1.
DR   EnsemblGenomes-Tr; ETAE_t086-1.
DR   EnsemblGenomes-Tr; ETAE_t087-1.
DR   EnsemblGenomes-Tr; ETAE_t088-1.
DR   EnsemblGenomes-Tr; ETAE_t089-1.
DR   EnsemblGenomes-Tr; ETAE_t090-1.
DR   EnsemblGenomes-Tr; ETAE_t091-1.
DR   EnsemblGenomes-Tr; ETAE_t092-1.
DR   EnsemblGenomes-Tr; ETAE_t093-1.
DR   EnsemblGenomes-Tr; ETAE_t094-1.
DR   EnsemblGenomes-Tr; ETAE_t095-1.
DR   EuropePMC; PMC2764856; 19865481.
DR   EuropePMC; PMC3349661; 22590641.
DR   EuropePMC; PMC3651407; 23627759.
DR   EuropePMC; PMC4964492; 27420049.
DR   EuropePMC; PMC5427535; 28499353.
DR   EuropePMC; PMC5711410; 28441105.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00018; CsrB.
DR   RFAM; RF00021; Spot_42.
DR   RFAM; RF00022; GcvB.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00034; RprA.
DR   RFAM; RF00040; rne5.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00057; RyhB.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00078; MicA.
DR   RFAM; RF00079; OmrA-B.
DR   RFAM; RF00081; ArcZ.
DR   RFAM; RF00082; SraG.
DR   RFAM; RF00083; GlmZ_SraJ.
DR   RFAM; RF00101; SraC_RyeA.
DR   RFAM; RF00110; RybB.
DR   RFAM; RF00111; RyeB.
DR   RFAM; RF00112; CyaR_RyeE.
DR   RFAM; RF00114; S15.
DR   RFAM; RF00127; t44.
DR   RFAM; RF00128; GlmY_tke1.
DR   RFAM; RF00140; Alpha_RBS.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00368; sroB.
DR   RFAM; RF00383; IS1222_FSE.
DR   RFAM; RF00391; RtT.
DR   RFAM; RF00506; Thr_leader.
DR   RFAM; RF00514; His_leader.
DR   RFAM; RF00552; rncO.
DR   RFAM; RF00630; P26.
DR   RFAM; RF01055; MOCO_RNA_motif.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01394; isrK.
DR   RFAM; RF01497; ALIL.
DR   RFAM; RF01695; C4.
DR   RFAM; RF01707; JUMPstart.
DR   RFAM; RF01734; crcB.
DR   RFAM; RF01766; cspA.
DR   RFAM; RF01769; greA.
DR   RFAM; RF01770; rimP.
DR   RFAM; RF01771; rnk_leader.
DR   RFAM; RF01794; sok.
DR   RFAM; RF01796; frnS.
DR   RFAM; RF01830; StyR-44.
DR   RFAM; RF01852; tRNA-Sec.
DR   RFAM; RF01859; Phe_leader.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   RFAM; RF01988; SECIS_2.
DR   RFAM; RF01989; SECIS_3.
DR   RFAM; RF02029; sraA.
DR   RFAM; RF02030; tp2.
DR   RFAM; RF02031; tpke11.
DR   RFAM; RF02081; STnc550.
DR   RFAM; RF02221; sRNA-Xcc1.
DR   SILVA-LSU; CP001135.
DR   SILVA-SSU; CP001135.
XX
CC   Bacteria available from Prof. Yuanxing Zhang (yxzhang@ecust.edu.cn)
CC   of East China University of Science and Technology.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3760463
FT                   /organism="Edwardsiella tarda EIB202"
FT                   /strain="EIB202"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:498217"
FT   gene            1..1323
FT                   /gene="dnaA"
FT                   /locus_tag="ETAE_0001"
FT   CDS_pept        1..1323
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaA"
FT                   /locus_tag="ETAE_0001"
FT                   /product="ATPase involved in DNA replication initiation"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ACY82848"
FT                   /db_xref="GOA:D0Z8J2"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/TrEMBL:D0Z8J2"
FT                   /protein_id="ACY82848.1"
FT                   /translation="MWIRPLQAELSDNTLALYAPNRFVLDWVRDKYLNNINGLLNDFCG
FT                   SDAPVLRFEVGSKPVAPAAVSSAASSGVSVAPAAVRTSSPARPSWERVTAQPELSYRSN
FT                   VNPKHTFDNFVEGKSNQLARAAARQVADNPGGAYNPLFLYGGTGLGKTHLLHAVGNGIM
FT                   ARKPNAKVVYMHSERFVQDMVKALQNNAIEEFKRYYRSVDALLIDDIQFFANKERSQEE
FT                   FFHTFNALLEGNQQIILTSDRYPKEINGVEDRLKSRFGWGLTVAIEPPELETRVAILMK
FT                   KADENDIRLPGEVAFFIAKRLRSNVRELEGALNRVIANANFTGRAITIDFVREALRDLL
FT                   ALQEKLVTIDNIQKTVAEYYKIKVADLLSKRRSRSVARPRQMAMALAKELTNHSLPEIG
FT                   DAFGGRDHTTVLHACRKIEQLREESHDIKEDFSNLIRTLSS"
FT   gene            1348..2448
FT                   /gene="dnaN"
FT                   /locus_tag="ETAE_0002"
FT   CDS_pept        1348..2448
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaN"
FT                   /locus_tag="ETAE_0002"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ACY82849"
FT                   /db_xref="GOA:D0Z8J3"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:D0Z8J3"
FT                   /protein_id="ACY82849.1"
FT                   /translation="MKFIVEREHLIKPLQQVSSPLGGRPTLPILGNLLLQVEDGHLSLT
FT                   GTDLEMEMVARVPLVQPHEAGATTVPARKFLDICRGLPDGAEISVALDGDRMLVRSGRS
FT                   RFSLSTLPAADFPNLDDWQSEVEFTLPQATLKRLIEATQFSMAHQDVRYYLNGMLFETE
FT                   GEELRTVATDGHRLAVCSMPIGQSLPSHSVIVPRKGVIELMRLLDGGETPLRLQIGSNN
FT                   LRAHVGGFIFTSKLVDGRFPDYRRVLPKNPDKALEAGCDELKQAFARAAILSNEKFRGV
FT                   RLHVSHNQLKITANNPEQEEAEELLDVDYPGSDLEIGFNVSYVLDVLNALKCERVVMML
FT                   TDAVSSVQIEDAASQAAVYVVMPMRL"
FT   gene            2525..3601
FT                   /gene="recF"
FT                   /locus_tag="ETAE_0003"
FT   CDS_pept        2525..3601
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recF"
FT                   /locus_tag="ETAE_0003"
FT                   /product="recombinational DNA repair ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ACY82850"
FT                   /db_xref="GOA:D0Z8J4"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/TrEMBL:D0Z8J4"
FT                   /protein_id="ACY82850.1"
FT                   /translation="MALTRLVIRDFRNIEDADLALAPGFNFLVGANGSGKTSVLEAIYT
FT                   LGHGRAFRSLQAGRVIRHDCAAFVLHGRIDDGGGRELAVGLSKDRQGDSKVRIDGSDGH
FT                   KVAELAQMLPMQLITPEGFTLLNGGPKYRRAFLDWGCFHGDRGFFTAWNNLRRVLKQRN
FT                   AALRQVTRYAQIRPWDQELVPLAEQVSALRAAYSEAIAQDIAATCSQFLPEYALSFSFM
FT                   RGWDRESDYAALLERHFERDRALTYTALGPHKADFRIRADGTPVEDLLSRGQLKLLMCA
FT                   LRLAQGEYLTRHSGRQCLYLIDDFASELDAGRRRLLAERLKATGAQVFVSAVNADQVGD
FT                   MVDEKGKMFRVEQGKIAV"
FT   gene            3645..6059
FT                   /gene="gyrB"
FT                   /locus_tag="ETAE_0004"
FT   CDS_pept        3645..6059
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gyrB"
FT                   /locus_tag="ETAE_0004"
FT                   /product="DNA gyrase subunit B"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ACY82851"
FT                   /db_xref="GOA:D0Z8J5"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR034160"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR041423"
FT                   /db_xref="UniProtKB/TrEMBL:D0Z8J5"
FT                   /protein_id="ACY82851.1"
FT                   /translation="MSNTYDSSSIKVLKGLDAVRKRPGMYIGDTDDGTGLHHMVFEVVD
FT                   NAIDEALAGYCKDIIVTIHSDNSVSVQDDGRGIPTGIHPEEGVSAAEVIMTVLHAGGKF
FT                   DDNSYKVSGGLHGVGVSVVNALSEKLELVIRRDGHVHEQIYRHGVPAAPLKVVGDTEQT
FT                   GTRVRFWPSMETFSNVVEFQYDILAKRLRELSFLNSGVSIRLRDKRNDREDHFHYEGGI
FT                   KAFVEYLNKNKTPIHPNVFYFSTMKDDIGVEVALQWNDGFQENIYCFTNNIPQRDGGTH
FT                   LAGFRAAMTRTLNSYMENEGYTKKSKISATGDDAREGLIAVVSVKVPDPKFSSQTKDKL
FT                   VSSEVKSAVESLMNERLAEYLLENPSDAKIVVGKIIDAARAREAARKAREMTRRKGALD
FT                   LAGLPGKLADCQERDPAHSELYLVEGDSAGGSAKQGRNRKNQAILPLKGKILNVEKARF
FT                   DKMLSSQEVATLITALGCGIGRDEYNPDKLRYHSIIIMTDADVDGSHIRTLLLTFFYRQ
FT                   MPEIIERGHVYIAQPPLYKVKKGKQEQYIKDDEAMDQYQMSIALDGAALHINAAAPALA
FT                   GEPLEKLVAEHYQVQKLIGRMERRYPKAVLNQLIYQPTLSEADLGNQAQVEQWINSLVA
FT                   TLNEKEQHGSVYSARVLENRERQMFEPLVRVRTHGVDTDYAFDFDFVHGAEYRRICALG
FT                   EKLRDLLEESAFVERGERRQPVASFEQALDWLVKESRRGLAIQRYKGLGEMNPEQLWET
FT                   TMDPEGRRMLRVTIKDAVAADQLFTTLMGDAVEPRRAFIEENALKASNLDF"
FT   gene            6158..6976
FT                   /locus_tag="ETAE_0005"
FT   CDS_pept        6158..6976
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAE_0005"
FT                   /product="putative hydrolase of the HAD superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ACY82852"
FT                   /db_xref="GOA:D0Z8J6"
FT                   /db_xref="InterPro:IPR000150"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:D0Z8J6"
FT                   /protein_id="ACY82852.1"
FT                   /translation="MPIKLIAIDLDGTLLNEAREITPAVKAAIADARRRGVKVVLATGR
FT                   PLIGVRPYLRELALDVAGEYCLCNNGGLIVHADSGETLFETALDYGDYRYLEALAREVD
FT                   CHFHALDAERLFTANRDISKYTVHESFITGIPLYFCPVEQMAPSLRFPKVMMIDHPEVL
FT                   EAAIARIPAQAYQRYTLLRSSPFFLEILHRDVDKGKGIARLAEHLGIDRQHVMCIGDHG
FT                   NDLAMIDYAGLGVAMGNAEPAILAAAQYVTASNREDGVAQAIQRWVLNAA"
FT   gene            7062..8360
FT                   /gene="tolB1"
FT                   /locus_tag="ETAE_0006"
FT   CDS_pept        7062..8360
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tolB1"
FT                   /locus_tag="ETAE_0006"
FT                   /product="periplasmic component of the Tol biopolymer
FT                   transport system"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ACY82853"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR022223"
FT                   /db_xref="UniProtKB/TrEMBL:D0Z8J7"
FT                   /protein_id="ACY82853.1"
FT                   /translation="MRHPSELQLTDDARGHQLTNTHVWTPDSRWIAYDVRPRGSTFSGE
FT                   TIERVSVPDGQTQCLYRAVDGACVGVVTVAPTSPERYVFIHGPEHPDALWQYDFHHRRG
FT                   VIVSAEHPDVAETLDALDITPPYTPGALRGGSHVHVFSPDASRLSFTYNDHVMHEDCPE
FT                   RDQRNVGVALSGASVRSAKSHPREYDGSHFCVLVTHTTPAPRPGSDDITRAYEEGWVGH
FT                   RGYLKPDGLRQRWALAFIGDTLSEDGQRVPELFIVDLPEEDSAYRQAGVSPLQGTGSTL
FT                   PAPPAGVSQRRLTFTHSRRYPGLATLPRHWVRSAPDGGSLAFLMRDDNGVVQLWRVSPN
FT                   GGELRQVTHGGYDVQSAFNWHPDGRSVLMVMDNSVVRCDVASGAVTRITERTAQPPCAD
FT                   AVIPSPDGRWVAYMREVNGWAQIFVARLTTDDE"
FT   gene            complement(8367..8636)
FT                   /locus_tag="ETAE_0007"
FT   CDS_pept        complement(8367..8636)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAE_0007"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ACY82854"
FT                   /db_xref="InterPro:IPR010780"
FT                   /db_xref="UniProtKB/TrEMBL:D0Z8J8"
FT                   /protein_id="ACY82854.1"
FT                   /translation="MTRVGPHQGYYAGTKNDLQMIGSEESGWAMRPLLALDLPLSAVAD
FT                   TLLLPYDYYRADDDPATASPRARVQRAEQASAASGMAPPAALEN"
FT   gene            8993..9406
FT                   /gene="ibpA"
FT                   /locus_tag="ETAE_0008"
FT   CDS_pept        8993..9406
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ibpA"
FT                   /locus_tag="ETAE_0008"
FT                   /product="molecular chaperone (small heat shock protein)"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ACY82855"
FT                   /db_xref="GOA:D0Z8J9"
FT                   /db_xref="InterPro:IPR002068"
FT                   /db_xref="InterPro:IPR008978"
FT                   /db_xref="InterPro:IPR023728"
FT                   /db_xref="InterPro:IPR037913"
FT                   /db_xref="UniProtKB/TrEMBL:D0Z8J9"
FT                   /protein_id="ACY82855.1"
FT                   /translation="MRNFDLAPLYRSAIGFDRLFNLIESGQNNTNGGYPPYNVELVDDN
FT                   HYRISIAVAGFDEAELEITSHANSLMVKGSHQAIDKQRTYLYQGIAERNFERKFQLAEH
FT                   IHIKGARLENGLLFIDLERIIPESQQARKIAIK"
FT   gene            9522..9986
FT                   /gene="ibpB"
FT                   /locus_tag="ETAE_0009"
FT   CDS_pept        9522..9986
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ibpB"
FT                   /locus_tag="ETAE_0009"
FT                   /product="molecular chaperone (small heat shock protein)"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ACY82856"
FT                   /db_xref="InterPro:IPR002068"
FT                   /db_xref="InterPro:IPR008978"
FT                   /db_xref="InterPro:IPR037913"
FT                   /db_xref="UniProtKB/TrEMBL:D0Z8K0"
FT                   /protein_id="ACY82856.1"
FT                   /translation="MRNYDLSPLMRQWIGFDKLANAMQTSLEPQGFPPYNIEKSDDNHY
FT                   RISLALAGFRQSELDIEVEGPRLTVRGNPVKPEKPVEYLHQGLVCKAFELSFTLAEHLT
FT                   VEGAAFENGLLNIDLVRHVPEALQPQRIIIGAAQRDPAALECRDEPNTQQ"
FT   gene            10181..11440
FT                   /gene="avtA"
FT                   /locus_tag="ETAE_0010"
FT   CDS_pept        10181..11440
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="avtA"
FT                   /locus_tag="ETAE_0010"
FT                   /product="valine-pyruvate aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ACY82857"
FT                   /db_xref="GOA:D0Z8K1"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D0Z8K1"
FT                   /protein_id="ACY82857.1"
FT                   /translation="MTFSAFGERFTRYSAITRLMDDLNNGLRTPGAVMLGGGNPARIAQ
FT                   MDAYFTSLCGELLEEGTLGEALCNYDGPQGKDTLLEALARLLSEQYGWPIGPQNIALTN
FT                   GSQSAFFYLFNLFAGRCSDGTRRRVLFPLAPEYIGYADAGLEDDLFVALKPSIALLPQG
FT                   QFKYHIDFDRLKIEDDIGLICVSRPTNPTGNVLTDEELTRLDALARQHRVPLLIDNAYG
FT                   VPFPGIIFTEATPLWNPNTILCMSLSKLGLPGVRCGIVVADERTIQALSNMNGVISLSP
FT                   GSMGPALALRMIERGDLLRLSREVIRPFYQQRVDQTLAIIRRYLPEERCLIHRPEGAIF
FT                   LWLWFKDLPIGSEELYQRLKQRGVLMVPGDYFFPGLAQAWPHTRQCMRMNYVPDPTLIE
FT                   RGVQILAEEVERAYREAGAA"
FT   gene            complement(11510..12229)
FT                   /locus_tag="ETAE_0011"
FT   CDS_pept        complement(11510..12229)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAE_0011"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ACY82858"
FT                   /db_xref="InterPro:IPR021413"
FT                   /db_xref="UniProtKB/TrEMBL:D0Z8K2"
FT                   /protein_id="ACY82858.1"
FT                   /translation="MTFAVKTWAQRLLMPVMALFLVMQLSGCGDSDKEQQKAFIDYLQN
FT                   TVMRGSVTIPTLSEAQKQQLGHYAGDYAVLVTFSQNFNRAMEASMTPLFSTLQQIRTPQ
FT                   EYLTQRDRLQQELGALNMLGQQIQSAKAQADGAYATLKQPEEVKAVFDKAFTKIVTGPS
FT                   NAVMPMIPQAADVAQTLVQVGDFLQNLGPQARFDNQGVQLQTQAQVDQYNQLMRDLSAK
FT                   YQTLMAAKQQNAGLLQN"
FT   gene            complement(12362..14431)
FT                   /gene="glyS"
FT                   /locus_tag="ETAE_0012"
FT   CDS_pept        complement(12362..14431)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glyS"
FT                   /locus_tag="ETAE_0012"
FT                   /product="glycyl-tRNA synthetase, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ACY82859"
FT                   /db_xref="GOA:D0Z8K3"
FT                   /db_xref="InterPro:IPR006194"
FT                   /db_xref="InterPro:IPR008909"
FT                   /db_xref="InterPro:IPR015944"
FT                   /db_xref="UniProtKB/TrEMBL:D0Z8K3"
FT                   /protein_id="ACY82859.1"
FT                   /translation="MTQQTFLVEIGTEELPPKALRSLAQAFADNFRTELDNAGLAHGDI
FT                   EWFAAPRRLALKVAALNAAQPDREIEKRGPAIAQAFDADGKPTKAAEGWARGCGISVDQ
FT                   ADRLSTDKGEWLLYRALQKGQRAQDLLPTRVANALSRLPIPKLMRWGDSDTQFVRPVHT
FT                   VTLLLGSESIPATILGVPSDRVIRGHRFMGEAEFTIDSADQYPQILLERGKVIADYDAR
FT                   KALIKRDAEAAAARIGGVADLSDSLLEEVTSLVEWPVVLTAKFEEKFLAVPAEALVYTM
FT                   KGDQKYFPVYDAAGKLLPNFIFVANIDSKDAQQIISGNEKVVRPRLADAEFFFKTDRKQ
FT                   RLEDNLPRLETVLFQQQLGSLRDKTDRITALAGWIAQQIGADVNMATRAGLLSKCDLMT
FT                   NMVFEFTDTQGVMGMHYARHDGEADEVAVALNEQYMPRFAGDALPTSLVACAVAIADKM
FT                   DTLAGIFGIGQHPKGDKDPFALRRAALGVLRIVVEKKLPLDLLTLTQEAVRLYGDKLSN
FT                   ANVVDDVVEFMLGRFRAWYQEEGHAVDTIQAVLARRPTRPADFDARVRAVSHFRTLPEA
FT                   ATLAAANKRVSNILAKSGDVLAEQVQAVLLKEPAEIRLAANLITLQEKLAPLFADGRYQ
FT                   EALVELATLRQPVDDFFEQVMVMADDEQVRINRLTLLNKLRDLFLQVADISVLQ"
FT   gene            complement(14441..15349)
FT                   /gene="glyQ"
FT                   /locus_tag="ETAE_0013"
FT   CDS_pept        complement(14441..15349)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glyQ"
FT                   /locus_tag="ETAE_0013"
FT                   /product="glycyl-tRNA synthetase, alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ACY82860"
FT                   /db_xref="GOA:D0Z8K4"
FT                   /db_xref="InterPro:IPR002310"
FT                   /db_xref="InterPro:IPR006194"
FT                   /db_xref="UniProtKB/TrEMBL:D0Z8K4"
FT                   /protein_id="ACY82860.1"
FT                   /translation="MQKFDIKTFQGLILTLQDYWARQGCTIVQPLDMEVGAGTSHPMTC
FT                   LRALGPEPMATAYVQPSRRPTDGRYGENPNRLQHYYQFQVVIKPSPDNIQELYLGSLKA
FT                   LGLDPTVHDIRFVEDNWENPTLGAWGLGWEVWLNGMEVTQFTYFQQVGGLECKPVTGEI
FT                   TYGLERLAMYIQGVDSVYDLVWSDGPLGKTTYGDVFHQNEVEQSTYNFEYADVDFLFAC
FT                   FEQYEKEARMLLELEHPLPLPAYERILKAAHSFNLLDARKAISVTERQRYILRIRTLTK
FT                   MVAEAYYASREALGFPMCKKD"
FT   gene            15563..16162
FT                   /gene="tag"
FT                   /locus_tag="ETAE_0014"
FT   CDS_pept        15563..16162
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tag"
FT                   /locus_tag="ETAE_0014"
FT                   /product="3-methyladenine DNA glycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ACY82861"
FT                   /db_xref="GOA:D0Z8K5"
FT                   /db_xref="InterPro:IPR004597"
FT                   /db_xref="InterPro:IPR005019"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="UniProtKB/TrEMBL:D0Z8K5"
FT                   /protein_id="ACY82861.1"
FT                   /translation="MDDHAPPRCAWVSADPLYIAYHDHEWGRPLYDGQALFELLCLEGQ
FT                   QAGLSWLTVLKKRQRYRQAFHGFDPAKVAAMTAEDIADLLLDQGLIRNRRKLEAIVTNA
FT                   RALLAMAQRGEAFSAFIWSFVGGAPLAPPEGGWQALTHTSVSDALARALKQRGFTFVGT
FT                   TICYAFMQACGMVNDHMPGCCLYHDASPVSASGQAR"
FT   gene            16125..16628
FT                   /locus_tag="ETAE_0015"
FT   CDS_pept        16125..16628
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAE_0015"
FT                   /product="putative acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ACY82862"
FT                   /db_xref="GOA:D0Z8K6"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D0Z8K6"
FT                   /protein_id="ACY82862.1"
FT                   /translation="MRPLYLRPARPADTSALLALWLKLTIQAHPAIPPGYWRASLPWVR
FT                   DAYLPEGQTWLATDRGRIGGFICILPGHLLGALFVARRYRGRGVAQRLMRHAKRHHPWL
FT                   LLEAYCANLRAQAFYRRQGFHCIDRQIQAQTGQAVATLLWQRRAVLEKSERLDYTARSS
FT                   VMGE"
FT   gene            16824..17348
FT                   /locus_tag="ETAE_0016"
FT   CDS_pept        16824..17348
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAE_0016"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ACY82863"
FT                   /db_xref="GOA:D0Z8K7"
FT                   /db_xref="InterPro:IPR001727"
FT                   /db_xref="UniProtKB/TrEMBL:D0Z8K7"
FT                   /protein_id="ACY82863.1"
FT                   /translation="MSSVALAEIGDKTQLLTLLLVARFGKPFLILLAIILATLVNHYFA
FT                   ALIGELVTQFLSPQIMRWMVAAGFLAMAVWVLFPDKDDGEIRGGHPFWTSLVVFFLAEI
FT                   GDKTQIATVLLGAHYQHITWVVLGSTLGMVLANAPMLWFGARLQPYLKSGWGRRLSSLL
FT                   FAILGVVTLIL"
FT   gene            17497..18156
FT                   /gene="yiaD"
FT                   /locus_tag="ETAE_0017"
FT   CDS_pept        17497..18156
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yiaD"
FT                   /locus_tag="ETAE_0017"
FT                   /product="putative outer membrane lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ACY82864"
FT                   /db_xref="GOA:D0Z8K8"
FT                   /db_xref="InterPro:IPR006664"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR006690"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="InterPro:IPR039567"
FT                   /db_xref="UniProtKB/TrEMBL:D0Z8K8"
FT                   /protein_id="ACY82864.1"
FT                   /translation="MKKSRFCIAGLISAALILSGCTTNPYTGESQAGKSGVGAGLGALL
FT                   GAGVGALSSSKSDRGKGALIGAAAGAALGGGIGYYMDVQEAKLRDKMRGTGVSVTRQGD
FT                   NIVLNMPNNVTFDSNSSNLKPAGANTLTGVAMVLKEYQKTAVNVVGYTDSTGSRDLNMR
FT                   LSQQRADSVASALIVQGVSAGRIRTIGMGPANPIATNSTAAGKAQNRRVEITLSPL"
FT   gene            complement(18195..18497)
FT                   /locus_tag="ETAE_0018"
FT   CDS_pept        complement(18195..18497)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAE_0018"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ACY82865"
FT                   /db_xref="GOA:D0Z8K9"
FT                   /db_xref="InterPro:IPR001455"
FT                   /db_xref="InterPro:IPR022931"
FT                   /db_xref="InterPro:IPR036868"
FT                   /db_xref="UniProtKB/TrEMBL:D0Z8K9"
FT                   /protein_id="ACY82865.1"
FT                   /translation="MRLFIRATALNGAIQRPAMTDLFANPDKTLDALGLRCPEPVMMVR
FT                   KAVRHMAAGETLLIIADDPATTRDIPGFCRFMDHALLAQEIEQTPYRYLLRKGGA"
FT   gene            18723..19382
FT                   /locus_tag="ETAE_0019"
FT   CDS_pept        18723..19382
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAE_0019"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ACY82866"
FT                   /db_xref="GOA:D0Z8L0"
FT                   /db_xref="InterPro:IPR003744"
FT                   /db_xref="UniProtKB/TrEMBL:D0Z8L0"
FT                   /protein_id="ACY82866.1"
FT                   /translation="MFSFTPQQRFTALCWLSLFHVLIITSSNYLVQLPITVFGFHTTWG
FT                   AFTFPFIFLATDLTVRIFGAPLARRIILAVMVPALLISYCVSALFFQGQWQGFAALGSV
FT                   NLMVARIACASFMAYVLGQILDVHVFNRLRQTRAWWVAPTASTLFGNISDTLSFFFIAF
FT                   YRSSDAFMATHWVEIALVDYAFKLLISMVFFLPMYGVMLNMLLKRIAFRQQQASLA"
FT   gene            19574..21586
FT                   /locus_tag="ETAE_0020"
FT   CDS_pept        19574..21586
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAE_0020"
FT                   /product="putative beta-glucosidase-related glycosidase"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ACY82867"
FT                   /db_xref="GOA:D0Z8L1"
FT                   /db_xref="InterPro:IPR001764"
FT                   /db_xref="InterPro:IPR002772"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR036881"
FT                   /db_xref="InterPro:IPR036962"
FT                   /db_xref="UniProtKB/TrEMBL:D0Z8L1"
FT                   /protein_id="ACY82867.1"
FT                   /translation="MYRSVRMYKYPILICALLSPLTATTYAADAEQPPVVSRVHPLLHV
FT                   QGYTFRDANGNGRLDPYEDWRLSAEQRSADLVARMTLREKAGMMMIDTFRVAPQGAIRQ
FT                   EDAALIREQHMTRFIFRNPVVSQPQSGTNQLTPREVAEALNQAQEMAERTPHGIPALFK
FT                   SNARNHLDPQAREGINVISGAFSSWPKEAGLAATRDMSLIREFAGIMAQEWRAVGIRGM
FT                   YGYMMDLATEPRWYRVHETFTEDADLMSDIARQLILGLQGERLGRDSIALTIKHFPGGG
FT                   PQENGGDPHYAYGKNQNYAGQNFRYHLKPFITAIELGVSAIMPYYGIPVGQALTPNDVG
FT                   MAFSAGVITGLLREQLGFKGYVNSDTGIIGDRAWGIEHLPEQEQIAIAVNAGTDVLSGY
FT                   HSNAIVYDTIRAGKISQERVDLAVSRLLKEQFTLGLFENAYVDPERATQTLGNKAFQAL
FT                   ASLAQRKSIVLLKNGDDRAPLLPLAPAQTLYVVGMDKAIVEAYGFRVISGDRRGGALPA
FT                   IPPQTARAIVRVVVSNPYVEARRFGGAAEDELNDLAFSAMARAKTWQITPSLADIQTIM
FT                   ARVGAANTILSINYRQPFVLDRASGMDRAGAILATFGVSDHALMDVLSGRFNPQGRLPF
FT                   ALPNQAQAVVNQLSDMPGYRALDTWRPYGFGLRYQ"
FT   gene            21694..21858
FT                   /locus_tag="ETAE_0021"
FT   CDS_pept        21694..21858
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAE_0021"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ACY82868"
FT                   /db_xref="UniProtKB/TrEMBL:D0Z8Z4"
FT                   /protein_id="ACY82868.1"
FT                   /translation="MTPITLHSATPAAILALYRAIPEFAPRHSLADIQRRLAGRQASLL
FT                   IARSGGRDV"
FT   gene            21860..22141
FT                   /locus_tag="ETAE_0022"
FT   CDS_pept        21860..22141
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAE_0022"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ACY82869"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D0Z8Z5"
FT                   /protein_id="ACY82869.1"
FT                   /translation="MGYALDEQTFYSWLGGVLPGWRRKGIAQILLHAQQAWALNQGYRR
FT                   IEVKTRNGFSSMLMMLINNGYHIIQVQPQDEVVDYRLRLVRDLRLDAA"
FT   gene            22218..22793
FT                   /locus_tag="ETAE_0023"
FT   CDS_pept        22218..22793
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAE_0023"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ACY82870"
FT                   /db_xref="InterPro:IPR014894"
FT                   /db_xref="InterPro:IPR016123"
FT                   /db_xref="UniProtKB/TrEMBL:D0Z8Z6"
FT                   /protein_id="ACY82870.1"
FT                   /translation="MGNLVKLIGVGLLVTGLAACDGSSTAETNAPAQGASATQPSVPAG
FT                   AKVSLLDGKIGFTLPAGLSDQTSKLGSQTNNMSVYANKTGQQAVIVILAPMPQDNLNTL
FT                   STRLIDQQKSRDASLQLVSSESVKLGGKDVEKVVSMQQANGHAIYSSIILAQVGDQLMT
FT                   MQISLPGDNRQEAANIANGVLNTLSFAQ"
FT   gene            complement(22815..24512)
FT                   /locus_tag="ETAE_0024"
FT   CDS_pept        complement(22815..24512)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAE_0024"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ACY82871"
FT                   /db_xref="InterPro:IPR007844"
FT                   /db_xref="UniProtKB/TrEMBL:D0Z8Z7"
FT                   /protein_id="ACY82871.1"
FT                   /translation="MKVIGKLLLTLCVLILLALAAAYFIVQSRWGARQISDWVNQHTHY
FT                   RITLSALQHTLGQPATVQVNGFSLARAGQPPLIQSATLRLTFGWQQLSAPRHFSAISLS
FT                   GGKLTLTQDGIPPLPISAAALRLHDMQILWPHADWPLQASDVDGGIVPLRPGSTKVDFQ
FT                   FSAAALNIGEIPAKNVLVQGEYRDRQLWLNNLGADVANGQMTAQALRQADGTWRIDSLR
FT                   LSQIHWQSPQALRPFLHALQILPPLTLVRLDLLGANLEGKGWALGGLDATLRNVSLTDG
FT                   HWHSQRGSLAFNAADIVLGAVHLSDPLLSADLTPQGITLRQFNTRWSNALIRASGDWQR
FT                   DSGHLTLNDLAVVGLEYTLPSAWRTLWLRPLPAWLQEITLQRFSLSRTLLVDINPDFPF
FT                   QMTALDGFGSHVTLARQRRWGIWQGQMQFNASEATFNKVDLRRPSATLLADGGTVRVSD
FT                   LSAISQKGLLEASATLIQDDSLLTLALHGRGVPVSQLDAWGWPALTTLQGDMNLQLTLR
FT                   APLQAGTPFRQGVEATLQAQDGHGHTLHQRMVSGQLVAEPSPIATEGR"
FT   gene            complement(24711..26114)
FT                   /gene="uraA1"
FT                   /locus_tag="ETAE_0025"
FT   CDS_pept        complement(24711..26114)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="uraA1"
FT                   /locus_tag="ETAE_0025"
FT                   /product="putative xanthine/uracil permease"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ACY82872"
FT                   /db_xref="GOA:D0Z8Z8"
FT                   /db_xref="InterPro:IPR006042"
FT                   /db_xref="InterPro:IPR006043"
FT                   /db_xref="UniProtKB/TrEMBL:D0Z8Z8"
FT                   /protein_id="ACY82872.1"
FT                   /translation="MTTQTTDLDPMAQPTTPPTTHSELIYRLDDCPPLAQTLFAACQHL
FT                   LAMFVAVITPALLICQALGLPAQDTQHIISMSLFASGLASLLQIKTWGPVGSGLLSIQG
FT                   TSFNFVTPLIMGGMALKNGGADIPTMMATLFGTLMLASCTEIILSRFLHLARRIITPLV
FT                   SGIVVMIIGLSLIQVGLISIGGGYSAMGDHSFGAPRNLLLAGAVLLVIILLNRQRNPYL
FT                   RVASLVIAMAVGYGLAWLMDMLPASAAQPNTAPLVTIPTPLYYGLGIDWNLLIPLMLVF
FT                   MVTSLETIGDITATSDVSEQPVSGPLYMKRLKGGVLANGLNSMLSAIFNTFPNSCFGQN
FT                   NGVIQLTGVASRKVGFVVALMLVLLGLFPAVAGFVQHIPEPVLGGATIVMFGTIAASGV
FT                   RIVSREPLNRRAIMIMALSLAVGLGVSQQPEILQFAPQWLKTLLSSGIAAGGITAIVLN
FT                   LIFPHETHR"
FT   gene            26348..27562
FT                   /gene="gltS"
FT                   /locus_tag="ETAE_0026"
FT   CDS_pept        26348..27562
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gltS"
FT                   /locus_tag="ETAE_0026"
FT                   /product="Na+/glutamate symporter"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ACY82873"
FT                   /db_xref="GOA:D0Z8Z9"
FT                   /db_xref="InterPro:IPR004445"
FT                   /db_xref="UniProtKB/TrEMBL:D0Z8Z9"
FT                   /protein_id="ACY82873.1"
FT                   /translation="MYHLDIYGTLVAATLVLLLGRQMVQKIPLLTKYTIPEPVAGGLLV
FT                   ALALLILKKSIGFEVDFDMSLKDPLMLAFFATIGLNANLASLRAGGKALSIFLFVVVGL
FT                   LIVQNAIGISMAKLMGLDPLMGLLAGSITLSGGHGTGAAWSKLFIERYGFQNATEVAMA
FT                   CATFGLVLGGLIGGPVARYLVKHSSTPDGTPDDNAVPSAFEKPQSGRMITSLVLIETLA
FT                   LIVICLTVGQLIAGWLRGSALELPTFVCVLFVGVILSNTLSKIGFYQVFERAVSVLGNV
FT                   SLSLFLAMALMSLKLWELASLALPMLAILAVQTLVMALYAIFVTYRVMGKNYDAAVLAA
FT                   GHCGFGLGATPTAIANMQAITERFGPSHLAFLVVPMVGAFFIDIANAIIIKLYLMLPLF
FT                   AQAIG"
FT   gene            complement(27579..29660)
FT                   /gene="recG"
FT                   /locus_tag="ETAE_0027"
FT   CDS_pept        complement(27579..29660)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recG"
FT                   /locus_tag="ETAE_0027"
FT                   /product="ATP-dependent DNA helicase RecG"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ACY82874"
FT                   /db_xref="GOA:D0Z900"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR004609"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033454"
FT                   /db_xref="UniProtKB/TrEMBL:D0Z900"
FT                   /protein_id="ACY82874.1"
FT                   /translation="MQGRLLDAVPLTSLSGVGASQAGKLAKLGLVTIQDLLLHLPLRYE
FT                   DRTRLYRIGELQPGMVVTVEGEVLRTDVAFGRRRMLTSQISDGSGLLTLRFFNFSAAMK
FT                   NSLAPGKRVLAYGEIKRGHHGGEIIHPEYRMQGDDAAPALQEALTPVYPTTEGVRQATL
FT                   RKLSDQALALLDITPIPELLPDALKQGLLSLPDALRTLHRPPPDIHQEDLAQGRHPAQR
FT                   RLILEELLAHHLSMLAVRAGNQRHRALALATDDHLKQRFLAALPFTPTTAQRRVLGDIE
FT                   ADMAKSVPMMRLVQGDVGCGKTLVAALAALRAIAHGHQVALMAPTELLAEQHAANFRQW
FT                   FAPLGLSVGWLAGKQKGKARQTQMAAIAAGEVDMVVGTHALFQEQVQFAGLALVIIDEQ
FT                   HRFGVHQRLALWEKGEAQGFHPHQLIMTATPIPRTLAMTAYADLDTSVIDELPPGRTPV
FT                   TTVAIADTRRQQILDRVRHACLEEKRQAYWVCTLIEESDLLEAQAAEATAETLMQQLPE
FT                   LRIALVHGRMKAADKQRVMTQFKAGEVDLLVATTVIEVGVDVPNASLMIIENPERLGLA
FT                   QLHQLRGRVGRGAIASHCVLLYKAPLSQTAQRRLQVLRDSNDGFVIAQRDLEIRGPGEL
FT                   LGTRQTGNAEFRVADLLRDQALIPEVQRIARHLHSAYPQHARALIERWLPAGSRYSNA"
FT   gene            complement(29662..30321)
FT                   /gene="spoU"
FT                   /locus_tag="ETAE_0028"
FT   CDS_pept        complement(29662..30321)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="spoU"
FT                   /locus_tag="ETAE_0028"
FT                   /product="tRNA guanosine-2-O-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ACY82875"
FT                   /db_xref="GOA:D0Z901"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR022724"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="InterPro:IPR033671"
FT                   /db_xref="UniProtKB/TrEMBL:D0Z901"
FT                   /protein_id="ACY82875.1"
FT                   /translation="MMAARQPDLTVCMEQVHKPHNVSAVIRTADAVGVHQVHAVWPGKS
FT                   MRTLVSTAAGSNSWVNVKTHRDIATAVGELKGQGMQILATNLSATAVDFREIDYTRPTC
FT                   ILMGQEKRGISAEALQLADRDIIIPMVGMVQSLNVSVASALILYEAQRQRQQAGMYGRS
FT                   QPSLSEEEQQRLLWEGGYPVLASVARRKGLARPHIGDDGQIDAPQAWWDAMQAARS"
FT   gene            complement(30360..32453)
FT                   /gene="spoT"
FT                   /locus_tag="ETAE_0029"
FT   CDS_pept        complement(30360..32453)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="spoT"
FT                   /locus_tag="ETAE_0029"
FT                   /product="guanosine polyphosphate
FT                   pyrophosphohydrolase/synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ACY82876"
FT                   /db_xref="GOA:D0Z902"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR004095"
FT                   /db_xref="InterPro:IPR004811"
FT                   /db_xref="InterPro:IPR007685"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR012676"
FT                   /db_xref="InterPro:IPR033655"
FT                   /db_xref="UniProtKB/TrEMBL:D0Z902"
FT                   /protein_id="ACY82876.1"
FT                   /translation="MYLFESLNLLIQKYLPEEQIKRLKQAYLVARDAHEGQTRSSGEPY
FT                   ITHPVAVACILAEMRLDYETLMAALLHDVIEDTPATYQDMEQLFGKSVAELVEGVSKLD
FT                   KLKFRDKKEAQAENFRKMIMAMVQDIRVILIKLADRTHNMRTLGSLRPDKRRRIARETL
FT                   EIYSPLAHRLGIHHLKTELEELGFEALYPNRYRVIKEVVKAARGNRKEMIQKILAEIDG
FT                   RLTEAGMACQVNGREKHLYSIYRKMHLKEQRFHSIMDIYAFRVIVKDVDTCYRVLGQVH
FT                   SLYKPRPGRVKDYIAIPKANGYQSLHTSLIGPHGVPVEVQIRTEDMDQMAEMGVAAHWA
FT                   YKEGESSTTAQIRAQRWMQSLLELQQSAGNSFEFIESVKSDLFPDEIYVFTPEGRIVEL
FT                   PAGATPVDFAYAVHTDIGHACVGARVDRQPYPLSQALSSGQTIEVITAPGARPNAAWLN
FT                   FVVSSKARAKIRQMLKNLKRDDSVSLGRRLLTHALGNGRKLASIPAPNIQRELERMKLQ
FT                   SLDDLLAEIGLGNAMSVVVARNLLGEQDTPPGGRKLPIKGADGVLLTFAKCCRPIPGDP
FT                   IIAHVSPGKGLVIHHESCRNIRGYQKEPEKFMPVEWDKEIDQEFIAEIKVDMFNHQGAL
FT                   ANLTAAINATASNIQSMNTEEKDGRVYSVYIRLTTRDRVHLANIMRKIRIMPDVIKVTR
FT                   NRN"
FT   gene            complement(32473..32748)
FT                   /gene="rpoZ"
FT                   /locus_tag="ETAE_0030"
FT   CDS_pept        complement(32473..32748)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoZ"
FT                   /locus_tag="ETAE_0030"
FT                   /product="DNA-directed RNA polymerase, subunit omega"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ACY82877"
FT                   /db_xref="GOA:D0Z903"
FT                   /db_xref="InterPro:IPR003716"
FT                   /db_xref="InterPro:IPR006110"
FT                   /db_xref="InterPro:IPR012293"
FT                   /db_xref="InterPro:IPR036161"
FT                   /db_xref="UniProtKB/TrEMBL:D0Z903"
FT                   /protein_id="ACY82877.1"
FT                   /translation="MARVTVQDAVEKIGNRFDLVLVAARRARQMQTGGKEPLVPEENDK
FT                   TTVIALREIEEGLINNQILDVRERQEQQEQEAAELQAVTAIAEGRR"
FT   gene            complement(32803..33426)
FT                   /gene="gmk"
FT                   /locus_tag="ETAE_0031"
FT   CDS_pept        complement(32803..33426)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gmk"
FT                   /locus_tag="ETAE_0031"
FT                   /product="guanylate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ACY82878"
FT                   /db_xref="GOA:D0Z904"
FT                   /db_xref="InterPro:IPR008144"
FT                   /db_xref="InterPro:IPR008145"
FT                   /db_xref="InterPro:IPR017665"
FT                   /db_xref="InterPro:IPR020590"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D0Z904"
FT                   /protein_id="ACY82878.1"
FT                   /translation="MVQGTLYIVSAPSGAGKSSLIQALLKTQPTYDSRVSVSHTTRASR
FT                   PGEQHGEHYYFVSVDEFKAMIARDDFLEHAEVFGNYYGTSRQAIEKVLAQGIDVFLDID
FT                   WQGARQVRSKMPQARSIFILPPSREELARRLHGRGQDSDDVIAGRMAKAVSEMSHYSEY
FT                   DYLIINDDFDVALQDLRTIIRAERLRRERQQLRHDALISKLLAD"
FT   gene            complement(33547..34167)
FT                   /locus_tag="ETAE_0032"
FT   CDS_pept        complement(33547..34167)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAE_0032"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ACY82879"
FT                   /db_xref="GOA:D0Z905"
FT                   /db_xref="InterPro:IPR005115"
FT                   /db_xref="UniProtKB/TrEMBL:D0Z905"
FT                   /protein_id="ACY82879.1"
FT                   /translation="MLLSILYIVGITAEAMTGALAAGRRQMDTFGVIIIASATAIGGGS
FT                   VRDMLLGHYPLSWVKHPENIVIVACAAVLTTWVAPLMSHLRRLFLLLDAVGLIVFSIIG
FT                   AQVALEMGHGPIVAVIAAVVTGVFGGVLRDLFCNQIPLVFQKELYAGISFAAAWLYLGL
FT                   LYLQVPQDLTVIITLVAGFSARLLALRFHLSLPVFDYKQPERE"
FT   gene            35031..35150
FT                   /locus_tag="ETAE_0033"
FT   CDS_pept        35031..35150
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAE_0033"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ACY82880"
FT                   /db_xref="UniProtKB/TrEMBL:D0Z906"
FT                   /protein_id="ACY82880.1"
FT                   /translation="MSELKCMYTYHIACDVHFDLNRKININHMVTKLIDMLVW"
FT   gene            35599..35874
FT                   /locus_tag="ETAE_0034"
FT   CDS_pept        35599..35874
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAE_0034"
FT                   /product="putative iron-dependent peroxidase"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ACY82881"
FT                   /db_xref="GOA:D0Z907"
FT                   /db_xref="UniProtKB/TrEMBL:D0Z907"
FT                   /protein_id="ACY82881.1"
FT                   /translation="MSLLPIEVGDAVSVIWFFAVEVDDFRYVERVTFTGFLEGVQVSCW
FT                   EIPLDERVPAFSSIDTELPEPVKTQKASISVKRKDKKAENDDPNNG"
FT   gene            36217..37008
FT                   /locus_tag="ETAE_0035"
FT   CDS_pept        36217..37008
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAE_0035"
FT                   /product="putative Zn peptidase"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ACY82882"
FT                   /db_xref="InterPro:IPR010359"
FT                   /db_xref="UniProtKB/TrEMBL:D0Z908"
FT                   /protein_id="ACY82882.1"
FT                   /translation="MPENGFNLIDNSKIVELTPPLIEKIAEGARIRWGLTPDAPIDNMV
FT                   NVVENQGAIVTCFDGVSEKVDALSVNRKFPIIIRNTAKESACRMRFDLAHECGHLIMHD
FT                   GIETGCKQTEREADAFASAFLFPRKSFAREFPSCLGIGGMIDWKKVYALKTRWKVSAKA
FT                   IIYRAHFLGFINAQQYRSANVWFSQTRQTKKEKLDDQIPLEEPHVLEESLAILKEHLGI
FT                   SFDMLAEKIKVRPELLADISGIKYIPAIDDGYDEIVVPFKF"
FT   gene            complement(37050..40286)
FT                   /locus_tag="ETAE_0036"
FT   CDS_pept        complement(37050..40286)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAE_0036"
FT                   /product="putative helicase"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ACY82883"
FT                   /db_xref="GOA:D0Z909"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D0Z909"
FT                   /protein_id="ACY82883.1"
FT                   /translation="MFFNDNVPFLIKNKDITLNTKSDEVNKIITQEIISFDKSIYFTKK
FT                   NYQIGMLSNLAFKAGDWLFDKSHIKDNIYSLSNSNIGVSFLAELKGSTYHIRGDIKRLS
FT                   DNKTSFFDNVKINGKGESNKSLRPAQIGAIYALLSHWSLSSETCTVVLPTGTGKTETML
FT                   LASLADKATHTLVIVPSIDLKYQIADKFSSWGILRELGVIPNPTPNPTVLMLKEGLAFS
FT                   EESIGLLHESDVVITTPALIARASPTLQKTISDIFTHVYFDEAHHIQASEWDIIKKLFS
FT                   KSKIVQFTATPYRNDKKPIEGKIVYNYPLSHALKDNCFSRISLVAVDERHPRKKDLAIA
FT                   NAAMSRLITDRKNGWIRHKMMVRADNKKHAIELFDMYKELFPNERIAIVYTGIKNRRNL
FT                   ISDIKNGAYDIIVCVDMLKEGFDYPDFKIAAVHGIHKSLAVLLQFIGRFTRTQEGLGDA
FT                   SFVVNYADEKISIELENLFQEGSGWEEVISEIADAKKNEAETLLSFLQGCKPFSGFDSP
FT                   NIDLNPKLVYPALSTVCFKCKKAEWKNFKNAFNLNKYSLSQPFINKEENVFYFTTQKRE
FT                   KVKWARTDKMRDQTWDLIVMHYNISMNLLYIGYSEKKLDINFLVEKITEDKPTQLRGDC
FT                   VFRSFDNIKRLSIIHAGIFKPANHLHRYSRLSGADVTTELTKWKEGQRCQKSDFVGIGF
FT                   RDGFPVSVGASVKGKIWSPARVGDLKEWKSWCLEIGNLITDESIDANKLLEDSAQKTQL
FT                   LSYPENIIILATDWSEDLYERMHKITIERPQKESILLAECALKNISHNNNHAFFEIIIS
FT                   DEKIPFSIVLGGERGHSIEGLDETDIYIEGLKSNTLSLKQFFEENPPTMFLLDGCTISG
FT                   CIHTNYGESFEVQIPSERITTLEWDDVNYTVESLYKGDKIRNNSIQEYMMIHLKKNGAR
FT                   IIFNDDNAGESSDIVAIFVEDDLIRFEMIHCKYSKETSGARLSDLYEVCGQAVVSLRYK
FT                   WKPEELLKHMERRNGMGILKNKRFYHGSPDDLENIRKALKYSNVEFEFSIAQPGVEKSK
FT                   LSIDMRNFLGSIYSTIIEMTETKLKCYFNR"
FT   gene            complement(40424..40981)
FT                   /locus_tag="ETAE_0037"
FT   CDS_pept        complement(40424..40981)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAE_0037"
FT                   /product="putative permease"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ACY82884"
FT                   /db_xref="UniProtKB/TrEMBL:D0Z910"
FT                   /protein_id="ACY82884.1"
FT                   /translation="MSPKNLKRLETSYISKKLGIDEDDVKSFRFSTIFSAGSVSLSFKS
FT                   VSKKRLNKRLGEAEADRVLKRWKKLMKPLRKDLKRLIDDYLSSGKTNRYGLCVRNAVGQ
FT                   NFNCTWRNARKERKWQPMQMRRKLLAHMLQGLESRAVYDYVACHDGVCALEHDGFVSLS
FT                   KLSDDDWKHPYLRIVLKNEVYT"
FT   gene            complement(41082..41864)
FT                   /gene="istB1"
FT                   /locus_tag="ETAE_0038"
FT   CDS_pept        complement(41082..41864)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="istB1"
FT                   /locus_tag="ETAE_0038"
FT                   /product="IS100 transposase orfB"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ACY82885"
FT                   /db_xref="GOA:D0Z7M1"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR002611"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028350"
FT                   /db_xref="UniProtKB/TrEMBL:D0Z7M1"
FT                   /protein_id="ACY82885.1"
FT                   /translation="MMVELQHQRLMVLAEQLQLDSLISAAPALSQQAVEQEWSYMDFLE
FT                   HLLHEEKLARHQRKQAMYTRMAAFPAVKTFEEYDFTFATGAPQKQIQSLRSLSFIERNE
FT                   NIVLLGPSGVGKTHLAIAMGYEAVRAGIKVRFTTAADLLLQLSTAQRQGRYKTTLHRGV
FT                   MAPKLLIIDEIGYLPFSQEEAKLFFQVIAKRYEKSAMILTSNLPFGQWDQTFAGDAALT
FT                   SAMLDRILHHSHVVQIKGESYRLKQKRKAGVIAEANPE"
FT   gene            complement(41861..42883)
FT                   /locus_tag="ETAE_0039"
FT   CDS_pept        complement(41861..42883)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAE_0039"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ACY82886"
FT                   /db_xref="GOA:D0Z7M0"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR006120"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR017894"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:D0Z7M0"
FT                   /protein_id="ACY82886.1"
FT                   /translation="MVTFETVMEIKILHKQGMSSRAIARELGISRNTVKRYLRAQSEPP
FT                   KYTPRPATASLLDEYRDYIRQRIADAHPYKIPATVIAREITEQGYRGGMTILREFIRSL
FT                   AIPQEQEPVVRFETEPGRQMQVDWGTMRNGKSPLHVFVAVLGFSRMLYIEFTDNMRYDT
FT                   LEECHRNAFSFFGGVPREVLYDNMKTVVLQRDAYRAGQHRFNPSLWQFGKEMGFSPRLC
FT                   RPFRAQTKGKVERMVQYTRNSFYIPLMTRLRPLGITVDVETANRYGLRWLHDVANQRRH
FT                   ETIQTRPCDRWIEEQQSMLALPTEKKQYDVQVDESLVTFDRQPLHHPLSIYDTFCRGAA
FT                   "
FT   gene            complement(42947..43885)
FT                   /locus_tag="ETAE_0040"
FT   CDS_pept        complement(42947..43885)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAE_0040"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ACY82887"
FT                   /db_xref="UniProtKB/TrEMBL:D0Z913"
FT                   /protein_id="ACY82887.1"
FT                   /translation="MKAYCTKNNILVTEKTLGIFRESIFSVPFDSNCDRRCKPTYYISI
FT                   AIFIQHLICSATASKNTRKKAIFESDDEWTCSVPFPYSLGEKEAPAVFKQSRGLPFGRA
FT                   LEKLEAAGLIKIIRHDPSKHKCREFALSKQLLKALFPGDRKAYLRRKDRYSYLTDLYGK
FT                   RQKPLTLEEIIAQASIQKPVVCHQISKRKIPDTAFRERVTQVYGQLDYLHINLDTLRDY
FT                   CNAHPTPVNMMYYHNFISHLCGVGVKIINTSPLIVAYRQSYKTARLGGRSFEVGKGFQY
FT                   LPKGMKWACLARGYNYDIKSSQLEMLPTVRK"
FT   gene            complement(44245..45345)
FT                   /locus_tag="ETAE_0041"
FT   CDS_pept        complement(44245..45345)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAE_0041"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ACY82888"
FT                   /db_xref="UniProtKB/TrEMBL:D0Z914"
FT                   /protein_id="ACY82888.1"
FT                   /translation="MKNTYDSKRVDSLKNAVRLMRNSAGNLCYAHIDKMSWITDLGSVQ
FT                   NKVLVERLNDLKSDGGYLVKCRPAGKKECDALYRSVVEIRLADKRSVHPVLMMLYFSPT
FT                   SKIRGAMRMEFSPQHYTPEQITDLFLWLGRKGRLGKYLYRGLRSAWVTTIHYALDVVGM
FT                   QQHDYLIGLSKVHGGEYHDLNGPEEGLRLGSSTLVASVYAKVNVPSLSVEERYAAALLT
FT                   LEESQLEHFLRLELRFSPGKQKLMLRNLSHMTNLVSRLVIYRRDMLEDKGLDPDFVRLL
FT                   GEMPIPAARAKFKPASKLNGKAVSTTKEAANKRVDKRMKKYRVALFDAEAIWDRLPLVL
FT                   DTLGILAQPQNWELKHRQKWLKSRGK"
FT   gene            complement(45495..45689)
FT                   /locus_tag="ETAE_0042"
FT   CDS_pept        complement(45495..45689)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAE_0042"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ACY82889"
FT                   /db_xref="InterPro:IPR010260"
FT                   /db_xref="UniProtKB/TrEMBL:D0Z915"
FT                   /protein_id="ACY82889.1"
FT                   /translation="MYQERILRKKEVLQRIGISNASLYRLIAKGLFPTGIKLTGQEGRA
FT                   VGWLSSDIDNWISNRERVK"
FT   gene            45879..46448
FT                   /locus_tag="ETAE_0043"
FT   CDS_pept        45879..46448
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAE_0043"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ACY82890"
FT                   /db_xref="UniProtKB/TrEMBL:D0Z916"
FT                   /protein_id="ACY82890.1"
FT                   /translation="MKNNRIRKSDKRDAEWHRNVYDRNKEFNVFQKEFYLGDNTLKKMA
FT                   VMYREFFGQTMNLSNVDRHKASEIVSFCINHCFNEFFCKQGSESVEHDLPVRIETAFTP
FT                   DGRELYDKYQYAKGYFDRLMTGDSDKEKIRSVAERLNKAEIPPLGLVRFNGARSWTPDM
FT                   VEWLLDTANLNKVIGTYNRTSKEAEF"
FT   gene            complement(46445..47365)
FT                   /locus_tag="ETAE_0044"
FT   CDS_pept        complement(46445..47365)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAE_0044"
FT                   /product="putative integrase"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ACY82891"
FT                   /db_xref="GOA:D0Z917"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:D0Z917"
FT                   /protein_id="ACY82891.1"
FT                   /translation="MPQQRRTSSHTTINPASVWLDGLAPSGRRSMRSLLNLSATILRHN
FT                   ATADSHDWSALRYVHVATLRATLAEQGYAVATINMVLAALKGVAQTAFNLGQMDADALA
FT                   RIKAVKGMRSDSEAAGRALSKEEVRLLLNATKTHPCKVRQNRDRALLLTLCGAGLRAGE
FT                   LVTLESHDYDVATRTLTVRQGKGRKKRAVVVAPPVGKALAAWIKVSADHDSLFCRIHRS
FT                   GSVTGQPLTTAGLAGILRQLQETAQIHLFTPHDLRRTFITRLLEQGTDLNIVRQLAGHS
FT                   DISTTALYDRRSTTMLTHASSALRF"
FT   gene            complement(47408..47851)
FT                   /gene="radC1"
FT                   /locus_tag="ETAE_0045"
FT   CDS_pept        complement(47408..47851)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="radC1"
FT                   /locus_tag="ETAE_0045"
FT                   /product="DNA repair protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ACY82892"
FT                   /db_xref="GOA:D0Z918"
FT                   /db_xref="InterPro:IPR001405"
FT                   /db_xref="InterPro:IPR020891"
FT                   /db_xref="InterPro:IPR025657"
FT                   /db_xref="InterPro:IPR037518"
FT                   /db_xref="UniProtKB/TrEMBL:D0Z918"
FT                   /protein_id="ACY82892.1"
FT                   /translation="MTTSERLLIEQARKLLRATVRRGRALTSPDEVRDFLLFTLALREN
FT                   EVFGVLLLDNRNRVLLWRELFYGTLNQTAVYPREVVKLALQHNAAAVILVHNHPSGHPE
FT                   ASDADIALTRRLQQAMALIDVRIPDHFIVAGDHTVSMAERGLL"
FT   gene            complement(47838..47993)
FT                   /locus_tag="ETAE_0046"
FT   CDS_pept        complement(47838..47993)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAE_0046"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ACY82893"
FT                   /db_xref="UniProtKB/TrEMBL:D0Z919"
FT                   /protein_id="ACY82893.1"
FT                   /translation="MDSEWLYFFDSYTYRRIHRSRWSLREERGKHQLYRQAIYFIERGA
FT                   SNHDHE"
FT   gene            complement(48475..48897)
FT                   /locus_tag="ETAE_0047"
FT   CDS_pept        complement(48475..48897)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAE_0047"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ACY82894"
FT                   /db_xref="InterPro:IPR021248"
FT                   /db_xref="UniProtKB/TrEMBL:D0Z920"
FT                   /protein_id="ACY82894.1"
FT                   /translation="MKENMTVHQSGLHLPVSRAFINIITEYLPPPPLFPPAVTLNFRDP
FT                   KYSAESGGFHPVEIRLTRHADGWYFDYVTDFSYMGHPWPELEKEFDVCWSQSYIWHILI
FT                   GDTDAEEGGALFELWQRNFIRYCRMKIYTVTVQQER"
FT   gene            48874..48990
FT                   /locus_tag="ETAE_0048"
FT   CDS_pept        48874..48990
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAE_0048"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ACY82895"
FT                   /db_xref="UniProtKB/TrEMBL:D0Z921"
FT                   /protein_id="ACY82895.1"
FT                   /translation="MNSHILFHDELRLLMTDIWHRVMHIYGENGRLLYGNIF"
FT   gene            49133..49288
FT                   /locus_tag="ETAE_0049"
FT   CDS_pept        49133..49288
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAE_0049"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ACY82896"
FT                   /db_xref="UniProtKB/TrEMBL:D0Z922"
FT                   /protein_id="ACY82896.1"
FT                   /translation="MGDIWRHAMNADTYKIDVCQHSQYSKMAYVMQCHFENKVFLFSTL
FT                   QQDGYF"
FT   gene            complement(49279..49692)
FT                   /locus_tag="ETAE_0050"
FT   CDS_pept        complement(49279..49692)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAE_0050"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ACY82897"
FT                   /db_xref="GOA:D0Z923"
FT                   /db_xref="InterPro:IPR003314"
FT                   /db_xref="UniProtKB/TrEMBL:D0Z923"
FT                   /protein_id="ACY82897.1"
FT                   /translation="MKYFMVKDAQNSSGRVRTGSEEENDWLTAEQFAKAEIEGMPGTAK
FT                   GVRLRLEKLAELHPEIRRKRTRGKGFVYHISAAGMSLKSEREAVKLPSDDKLSLWIQLF
FT                   RTMSPASRDRMLKLALAQVAEDLEQGQSSASQK"
FT   gene            49958..50074
FT                   /locus_tag="ETAE_0051"
FT   CDS_pept        49958..50074
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAE_0051"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ACY82898"
FT                   /db_xref="GOA:D0Z924"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR038722"
FT                   /db_xref="UniProtKB/TrEMBL:D0Z924"
FT                   /protein_id="ACY82898.1"
FT                   /translation="MERHYPRAERLIAQALDMRPEDIWPQRYRNKKTDGEKE"
FT   gene            50242..50592
FT                   /locus_tag="ETAE_0052"
FT   CDS_pept        50242..50592
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAE_0052"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ACY82899"
FT                   /db_xref="UniProtKB/TrEMBL:D0Z925"
FT                   /protein_id="ACY82899.1"
FT                   /translation="MPGILPGALRGSGRLDFLIGDVAVEFAVRRRYDRACTLRPEYQAT
FT                   EVKKLLKYDGKGVLILFDLSYSPLTLSVIREYRSLPAMGNHIKTSFHVAYFYRNENGGT
FT                   DHIRRHVRIFRK"
FT   gene            50606..50974
FT                   /locus_tag="ETAE_0053"
FT   CDS_pept        50606..50974
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAE_0053"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ACY82900"
FT                   /db_xref="UniProtKB/TrEMBL:D0Z926"
FT                   /protein_id="ACY82900.1"
FT                   /translation="MNTMQFEGQCVFNEGDSFIFNTFRITERGDILVEISGDSITDRYA
FT                   LSCRLQKENGRYSGCGVIEYSGNKSIRTDTVFLSIQESDISFSDDICMIKRGQWELKTP
FT                   DGSEIYYFSGELERIMAD"
FT   gene            51194..51511
FT                   /locus_tag="ETAE_0054"
FT   CDS_pept        51194..51511
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAE_0054"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ACY82901"
FT                   /db_xref="UniProtKB/TrEMBL:D0Z927"
FT                   /protein_id="ACY82901.1"
FT                   /translation="MTDYVCSQYYILNNPVVRINVRGGNTKLRNQVVTIDIMGRYMNSG
FT                   NPAFVRLARISQTQFQPLQSESKNFTPASNLENVKELVSGLQSSGYSYVDSAFMNPSNT
FT                   W"
FT   gene            complement(51630..51755)
FT                   /locus_tag="ETAE_0055"
FT   CDS_pept        complement(51630..51755)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAE_0055"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ACY82902"
FT                   /db_xref="GOA:D0Z928"
FT                   /db_xref="UniProtKB/TrEMBL:D0Z928"
FT                   /protein_id="ACY82902.1"
FT                   /translation="MAFKYIQKKDWNLYLLFLLCIITPVLAPLYFLCYKSATHVV"
FT   gene            complement(51745..51864)
FT                   /locus_tag="ETAE_0056"
FT   CDS_pept        complement(51745..51864)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAE_0056"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ACY82903"
FT                   /db_xref="UniProtKB/TrEMBL:D0Z929"
FT                   /protein_id="ACY82903.1"
FT                   /translation="MKINPGRDSQPSASLCVKTYITIYIGKFTAFNMVTPNGF"
FT   gene            52237..52449
FT                   /locus_tag="ETAE_0057"
FT   CDS_pept        52237..52449
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAE_0057"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ACY82904"
FT                   /db_xref="UniProtKB/TrEMBL:D0Z930"
FT                   /protein_id="ACY82904.1"
FT                   /translation="MNMSQSLRLSFSTLEALPAGLSIPGDLSIKNTRISQLPDDLCVGG
FT                   NLNITGTTISIIPETGFIGGEILRD"
FT   gene            complement(52901..53881)
FT                   /locus_tag="ETAE_0058"
FT   CDS_pept        complement(52901..53881)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAE_0058"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ACY82905"
FT                   /db_xref="UniProtKB/TrEMBL:D0Z931"
FT                   /protein_id="ACY82905.1"
FT                   /translation="MKFKPRNLRAIAEMIIGDAEYFPYRSSSYITQFFEECDLDFTHDG
FT                   STRWAWTVDRISELLEEPQPAANTLPERFVNVLRVLMAKADAEDHDPERELALESLNKP
FT                   LNREGYEAFYGEDRLLYIRHSGTKTVSIISNPHRPFTLQEIKRRELLANYLTSCSEDDL
FT                   IEEILIPLFRQLGYHRITAAGHKDKALEYGKDIWMRFVLPTQHVLYFGIQAKKGKLDAS
FT                   GMGRSTNANIAEIYNQVLMMLGHEIFDPETNRKVLVDHAFIVAGGEITKQAKNWLGGKL
FT                   DATKRSQILFMDRDDIINLYTVSNLSLPDSILKKQTPSSDDDYPF"
FT   gene            complement(53927..55195)
FT                   /locus_tag="ETAE_0059"
FT   CDS_pept        complement(53927..55195)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAE_0059"
FT                   /product="putative integrase"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ACY82906"
FT                   /db_xref="GOA:D0Z932"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR025166"
FT                   /db_xref="InterPro:IPR038488"
FT                   /db_xref="UniProtKB/TrEMBL:D0Z932"
FT                   /protein_id="ACY82906.1"
FT                   /translation="MAKLTDIQIKAWVRSGERFDGRSDGNGLYLCFPKNYAIPFWRFRY
FT                   RFVGKQRAMVIGTYSELSLAKARETAKELSARVALGYDVAGEKQERKAEALKKIEEEKN
FT                   ALKVAELAQEYFERQILGNWKHPDILRRRIEKDINPNIGHLKIEDVRPRHIDDMLQKII
FT                   ARNAPTVANDVLRWTRRIFNYGIKRHMLESNPTTAFEIADAGGKEKSRERWLTREELIK
FT                   FFQAMRITQGFSRQNELTMKLLLALCCRKMELCAAQWVEFDLDNAIWHLPAERVKNGDA
FT                   IDIPLPTITVEWLKELRQMSLNSQWVLPARKMQHRMIPHIQESTLPVALAKVRSNLPEV
FT                   PNFTIHDFRRTGRSHLAALGVDPVVAERCLNHRIKGVEGIYNRYEYFQERKAALDQWAA
FT                   LLVSLERGEDYNVMPIKNNKKIS"
FT   gene            complement(55394..56257)
FT                   /gene="yicC"
FT                   /locus_tag="ETAE_0060"
FT   CDS_pept        complement(55394..56257)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yicC"
FT                   /locus_tag="ETAE_0060"
FT                   /product="conserved YicC domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ACY82907"
FT                   /db_xref="InterPro:IPR005229"
FT                   /db_xref="InterPro:IPR013527"
FT                   /db_xref="InterPro:IPR013551"
FT                   /db_xref="UniProtKB/TrEMBL:D0Z933"
FT                   /protein_id="ACY82907.1"
FT                   /translation="MIRSMTAYARREVKGNWGSAAWELRSVNQRYLETYIRLPEQFRSL
FT                   EPVIRERLRTRLTRGKVECNLRFELDPSAQSALILNESLAKQLVDAANWVKLQSDEGEI
FT                   NPLDVLRWPGVMAAAEQDLDAIGSELLAALDGTIDDFIDAREREGSALKQLIEQRLEAV
FT                   SAEVAKVRSRMPEILQWQRERLVSKLEEAQVQLENNRLEQELVLMAQRIDVAEELDRLD
FT                   AHVKETYVILKKKEAVGRRLDFMMQEFNRESNTLASKSINADITASAIELKVLIEQMRE
FT                   QIQNIE"
FT   gene            56390..57106
FT                   /gene="rph"
FT                   /locus_tag="ETAE_0061"
FT   CDS_pept        56390..57106
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rph"
FT                   /locus_tag="ETAE_0061"
FT                   /product="RNase PH"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ACY82908"
FT                   /db_xref="GOA:D0Z934"
FT                   /db_xref="InterPro:IPR001247"
FT                   /db_xref="InterPro:IPR002381"
FT                   /db_xref="InterPro:IPR015847"
FT                   /db_xref="InterPro:IPR018336"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027408"
FT                   /db_xref="InterPro:IPR036345"
FT                   /db_xref="UniProtKB/TrEMBL:D0Z934"
FT                   /protein_id="ACY82908.1"
FT                   /translation="MRPEGRAAGQIRPLRLTRHYTKHAEGSVLVEFGDTKVLCTASVDE
FT                   GVPRFLKGQGQGWVTAEYGMLPRSTHSRMAREAAKGKQGGRTMEIQRLIARSLRAAVDL
FT                   KKLGEFTITLDCDVIQADGGTRTASITGACVALADALGALVAAGKLKESPLKGMVAAVS
FT                   VGIVADEAVCDLEYVEDSAAETDMNVVMMEDGRMIEVQGTAEGEPFSHEELLTLLALAR
FT                   DGIGQIIQAQKTALEQ"
FT   gene            57189..57830
FT                   /gene="pyrE"
FT                   /locus_tag="ETAE_0062"
FT   CDS_pept        57189..57830
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyrE"
FT                   /locus_tag="ETAE_0062"
FT                   /product="orotate phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ACY82909"
FT                   /db_xref="GOA:D0Z935"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR004467"
FT                   /db_xref="InterPro:IPR023031"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:D0Z935"
FT                   /protein_id="ACY82909.1"
FT                   /translation="MKAYQRRFIEFALSKQVLKFGEFTLKSGRTSPYFFNAGLFNTGRD
FT                   LALLGRFYAEALVDSGIAFDVLFGPAYKGIPIATTTAVALAEHHDRDMPYCFNRKEAKD
FT                   HGEGGTLVGSALVGRVMLVDDVITAGTAIRESMSIIQANGAALAGVLISLDRQERGRGE
FT                   LSAIQEVERDYGCRVISIITLGDLIRYLEEQPEMAQHLAAVKAYRAQYGV"
FT   gene            complement(57868..58464)
FT                   /gene="slmA"
FT                   /locus_tag="ETAE_0063"
FT   CDS_pept        complement(57868..58464)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="slmA"
FT                   /locus_tag="ETAE_0063"
FT                   /product="TetR-family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ACY82910"
FT                   /db_xref="GOA:D0Z936"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR023769"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:D0Z936"
FT                   /protein_id="ACY82910.1"
FT                   /translation="MAEKENTKRNRREEILQALAQMLESSDGSQRITTAKLAANVGVSE
FT                   AALYRHFPSKTRMFDSLIEFIEDTLTSRINLILQDEKDTFNRLRLILLLILGFAERNPG
FT                   LTRIMTGHALMFEQDRLQGRINQLFERIEAQLRQVLKERRLREGSGFDHDETLLASQLL
FT                   AFCEGMLSRFVRSEFRYRPTQEFETRWPLLACQLQ"
FT   gene            complement(58570..59028)
FT                   /gene="dut"
FT                   /locus_tag="ETAE_0064"
FT   CDS_pept        complement(58570..59028)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dut"
FT                   /locus_tag="ETAE_0064"
FT                   /product="deoxyuridine 5-triphosphate nucleotidohydrolase,
FT                   dUTP pyrophosphatase (dUTPase)"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ACY82911"
FT                   /db_xref="GOA:D0Z937"
FT                   /db_xref="InterPro:IPR008181"
FT                   /db_xref="InterPro:IPR029054"
FT                   /db_xref="InterPro:IPR033704"
FT                   /db_xref="InterPro:IPR036157"
FT                   /db_xref="UniProtKB/TrEMBL:D0Z937"
FT                   /protein_id="ACY82911.1"
FT                   /translation="MKKKIDVKILDARIGQQFPLPTYATPGSAGLDLRACLDRAVVLAP
FT                   GETTLLPTGLAIHIADPSLAAVILPRSGLGHKHGIVLGNLVGLIDSDYQGQLMISVWNR
FT                   GQTPFTIEPGERIAQLVLVPVVQADFNLVESFEGSARGDGGFGHSGRH"
FT   gene            complement(59006..60268)
FT                   /gene="dfp"
FT                   /locus_tag="ETAE_0065"
FT   CDS_pept        complement(59006..60268)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dfp"
FT                   /locus_tag="ETAE_0065"
FT                   /product="bifunctional phosphopantothenoylcysteine
FT                   decarboxylase/phosphopantothenate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ACY82912"
FT                   /db_xref="GOA:D0Z938"
FT                   /db_xref="InterPro:IPR003382"
FT                   /db_xref="InterPro:IPR005252"
FT                   /db_xref="InterPro:IPR007085"
FT                   /db_xref="InterPro:IPR035929"
FT                   /db_xref="InterPro:IPR036551"
FT                   /db_xref="UniProtKB/TrEMBL:D0Z938"
FT                   /protein_id="ACY82912.1"
FT                   /translation="MIKSCQPWAFNGTNTMTVLRGKRILLGISGGIAAYKCPEIVRRLR
FT                   ERGAEVRVVMTKGAQAFITPLTLQAVSGYPVADDLFDPAAEASMGHIALGKWADLVLLA
FT                   PATADLMARLAAGMADDLLATLCLASAAPLAIAPAMNQQMFRAAATQDNLATLARRGAL
FT                   IWGPDSGEQACGDVGPGRMLDPLTLVSLTEQHFSQSQDLAAYRLIITAGPTREALDPVR
FT                   FISNHSSGKMGFAIAEAAARRGAQVTLISGPVALPTPPGVARVDVQSALDMQAAVAQRA
FT                   RDCDIFIACAAVADYRAQQIAPEKMKKQQGDTLTLTLVKNPDIVAGVAAMTEARPFVVG
FT                   FAAETQNVEEYAKQKLARKGLDLICANDVSQDGQGFNSDTNALHLFWPQGDKRLPLSSK
FT                   SRLGCTLINEIVRHYEEKNRR"
FT   gene            60413..61099
FT                   /gene="radC2"
FT                   /locus_tag="ETAE_0066"
FT   CDS_pept        60413..61099
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="radC2"
FT                   /locus_tag="ETAE_0066"
FT                   /product="DNA repair protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ACY82913"
FT                   /db_xref="GOA:D0Z939"
FT                   /db_xref="InterPro:IPR001405"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR020891"
FT                   /db_xref="InterPro:IPR022820"
FT                   /db_xref="InterPro:IPR025657"
FT                   /db_xref="InterPro:IPR037518"
FT                   /db_xref="UniProtKB/TrEMBL:D0Z939"
FT                   /protein_id="ACY82913.1"
FT                   /translation="MAQGKGEGGWPQGALPREKLLALGAAALSDRELLALFLRTGLPGV
FT                   HVIQLAERLLQRFGSLQGVLRADVDTFCASQGLGIAKFAQLQAVIELSRRVLRHRIGEE
FT                   SAITSPDLTALYLQNLFVSLEREIFVVLFLDNQHRVIRSEQMFSGTINCVDVYPREIVR
FT                   EALKLNAVALILAHNHPSGNPEPSVADRLLTERVAKACALVDIQVLDHMVIGHGQRVSF
FT                   AERGWI"
FT   gene            61374..61574
FT                   /gene="rpmB"
FT                   /locus_tag="ETAE_0067"
FT   CDS_pept        61374..61574
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmB"
FT                   /locus_tag="ETAE_0067"
FT                   /product="ribosomal protein L28"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ACY82914"
FT                   /db_xref="GOA:D0Z940"
FT                   /db_xref="InterPro:IPR001383"
FT                   /db_xref="InterPro:IPR026569"
FT                   /db_xref="InterPro:IPR034704"
FT                   /db_xref="InterPro:IPR037147"
FT                   /db_xref="UniProtKB/TrEMBL:D0Z940"
FT                   /protein_id="ACY82914.1"
FT                   /translation="MTGNNRSHALNATKRRFLPNLHSHRFWVEGEKRFVTLRVSAKGMR
FT                   VIDKKGIEAVLADLRARGEKY"
FT   gene            61586..61753
FT                   /gene="rpmG"
FT                   /locus_tag="ETAE_0068"
FT   CDS_pept        61586..61753
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmG"
FT                   /locus_tag="ETAE_0068"
FT                   /product="ribosomal protein L33"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ACY82915"
FT                   /db_xref="GOA:D0Z941"
FT                   /db_xref="InterPro:IPR001705"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="InterPro:IPR018264"
FT                   /db_xref="InterPro:IPR038584"
FT                   /db_xref="UniProtKB/TrEMBL:D0Z941"
FT                   /protein_id="ACY82915.1"
FT                   /translation="MAKGIREKIKLVSSAGTGHYYTTTKNKRTKPEKLELKKFDPVVRQ
FT                   HVIYKEAKIK"
FT   gene            61847..62656
FT                   /gene="mutM"
FT                   /locus_tag="ETAE_0069"
FT   CDS_pept        61847..62656
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mutM"
FT                   /locus_tag="ETAE_0069"
FT                   /product="formamidopyrimidine-DNA glycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ACY82916"
FT                   /db_xref="GOA:D0Z942"
FT                   /db_xref="InterPro:IPR000214"
FT                   /db_xref="InterPro:IPR010663"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR012319"
FT                   /db_xref="InterPro:IPR015886"
FT                   /db_xref="InterPro:IPR015887"
FT                   /db_xref="InterPro:IPR020629"
FT                   /db_xref="InterPro:IPR035937"
FT                   /db_xref="UniProtKB/TrEMBL:D0Z942"
FT                   /protein_id="ACY82916.1"
FT                   /translation="MPELPEVETSRRGIAPFLEGKTLSHLTVRQPRLRWPVSETLLTLR
FT                   DRPILSVQRRAKYLLLALPEGWIVIHLGMSGSVRILPAQTPPQKHDHVDLLLTDGMMLR
FT                   YTDPRRFGAWLWYDDLATASVLAHLGPEPLSEAFSAEYLLERARGRRTAVKPWLMDNTL
FT                   VVGVGNIYASESLFSAQIHPDRLAGSLSADEASLLVQTIKAVLQRSIDQGGTTLRDFLQ
FT                   ADGKPGYFAQQLQVYGRAGEACLTCGTTIKSSKHGQRTTFYCPHCQR"
FT   gene            complement(62653..63138)
FT                   /gene="coaD"
FT                   /locus_tag="ETAE_0070"
FT   CDS_pept        complement(62653..63138)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="coaD"
FT                   /locus_tag="ETAE_0070"
FT                   /product="phosphopantetheine adenylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ACY82917"
FT                   /db_xref="GOA:D0Z943"
FT                   /db_xref="InterPro:IPR001980"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:D0Z943"
FT                   /protein_id="ACY82917.1"
FT                   /translation="MSRTAIYPGTFDPLTNGHLDIVTRAAHMFDRVILAIAASPGKRPL
FT                   FTLEERVAMAREVTAHLANVEVQGFSELMAHFAQRQRANILVRGLRAVSDFEYELQLAN
FT                   MNRHLMPTLESVFLMPAEAWSFISSSLVKEVARHGGDVDAFLPEPVARTLMARLRNA"
FT   gene            complement(63135..63911)
FT                   /gene="waaE"
FT                   /locus_tag="ETAE_0071"
FT   CDS_pept        complement(63135..63911)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="waaE"
FT                   /locus_tag="ETAE_0071"
FT                   /product="glycosyltransferase involved in cell wall
FT                   biogenesis"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ACY82918"
FT                   /db_xref="GOA:D0Z944"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D0Z944"
FT                   /protein_id="ACY82918.1"
FT                   /translation="MPPRLSVVLICKNAADLLPECLASVAWADEIIVLDSGSSDETQRI
FT                   AQAAGAKVYESRDWQGFGIQRQRAQQYASGDYILMIDSDERVTPALKEAIAQVLTQPVT
FT                   ERVYSIARRNLFLGRFMRHSGWYPDRVIRLYPRQRYGYDTSPVHESLACRGASVTPLQG
FT                   DLLHLTCRDFTGFQQKQLCYATAWAHERHARGKKTSMLGIFSHTVGALLKTLLLRGGVL
FT                   DGKQGWLLAVVNAQYTFNKYAELWALQHGYTEKTPL"
FT   gene            complement(63914..65188)
FT                   /gene="waaA"
FT                   /locus_tag="ETAE_0072"
FT   CDS_pept        complement(63914..65188)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="waaA"
FT                   /locus_tag="ETAE_0072"
FT                   /product="3-deoxy-D-manno-octulosonic-acid transferase"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ACY82919"
FT                   /db_xref="GOA:D0Z945"
FT                   /db_xref="InterPro:IPR007507"
FT                   /db_xref="InterPro:IPR038107"
FT                   /db_xref="InterPro:IPR039901"
FT                   /db_xref="UniProtKB/TrEMBL:D0Z945"
FT                   /protein_id="ACY82919.1"
FT                   /translation="MESLYTVLLYIIQPLIWLRLLLRSRKAPAYRKRWGERYGFCRNKV
FT                   APGGILLHSVSVGETLAAVPLVRALRHRYPTLPITVTTMTPTGSERVMSAFGNDVHHVY
FT                   LPYDLPGAMRRFLNTVRPKLVIVMETELWPNMISALHQRQIPLVIANARLSARSAKGYG
FT                   KLGGFMRRLLRKVTLIAAQNQEDGERFIALGLKRSQLAVTGSIKFDISVTPELAARAVT
FT                   LRRQWAPHRKVWIAASTHQGEEAIILQAHRRLLAQFPDLLLILVPRHPERFKETELLTQ
FT                   KEGFTYLMRSGGEIPTPQTQVVIGDSMGELMLLYGIADLAFVGGSLIERGGHNPLEPAA
FT                   HAIPVLMGPHTFNFKDICAKLHQADGLISVADGDALVNEVSTLLTDEDYRLWYGRHAVE
FT                   VLHQNQGALQRLLQLLLPYLPLRSH"
FT   gene            complement(65362..66456)
FT                   /gene="wabH"
FT                   /locus_tag="ETAE_0073"
FT   CDS_pept        complement(65362..66456)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="wabH"
FT                   /locus_tag="ETAE_0073"
FT                   /product="putative glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ACY82920"
FT                   /db_xref="GOA:D0Z946"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:D0Z946"
FT                   /protein_id="ACY82920.1"
FT                   /translation="MRILMIIDGLPGGGAEKVVLTLAQYFLAQGDSVSLFSLRDVCHYP
FT                   LPDGLDYRVIRDTCRAPWRKLSELSRRARQLDEAIASAEQKGRYDLVLSNLHKTDRIVA
FT                   RSHLLRDHNLWFCLHGVFSTSYLGHRHGFSRWLKREKIRRIYQGRQIVAVSHAVGEDLC
FT                   QQFNVTPAQLQTIPNPFDLEAIRRAADAPCPLEGQDYLIHVGRFHPAKRHDRLLEAYAQ
FT                   SGLSAPLVLLGQGSPEQEHTLRALAKTLNVAERVHFAGFQANPYPWIRHARLLVVSSDS
FT                   EGFGNVLVEALTLGTAVVSTRCPGGPAEIMTGDLARGLCRPDAASLAQTLQDIYRHPPA
FT                   IDDTQLQQYGVAAVCTRYRQLGKA"
FT   gene            complement(66460..67587)
FT                   /gene="wabG"
FT                   /locus_tag="ETAE_0074"
FT   CDS_pept        complement(66460..67587)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="wabG"
FT                   /locus_tag="ETAE_0074"
FT                   /product="glucuronic acid transferase"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ACY82921"
FT                   /db_xref="GOA:D0Z947"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:D0Z947"
FT                   /protein_id="ACY82921.1"
FT                   /translation="MTQFRLALVRQKYRPDGGAERFVSRALEALDSHDIELNVITRQWQ
FT                   GPVKPAWHIHLCNPWKWGRISRERGFAHAARTLWQQQRFDLVQSHERIPGCDLYRAGDG
FT                   VHQRWLTQRARILPGWKARMLWHDRYHRYVMNAEQAMYQAPELRAVICNADMIKQEIIA
FT                   DFGVPESKIHVIYNAIDHHRFLPPDEAQRAALRRRWQIPQSASCLIYVGSGFERKGLRA
FT                   AIEAIAPTERYLLVVGKDKEEARYRALANTLGCAQRVRFLGMQPETLPFYQMADGLLLP
FT                   TLYDPFPNVILEAMACGLPVITSTGCGGAEFIRSGDNGYVCDALDIAALRDAAMALPAQ
FT                   ALGSHAGRLARERIMECTAERLSAQLIGLYRQLVK"
FT   gene            complement(67584..68660)
FT                   /gene="waaQ"
FT                   /locus_tag="ETAE_0075"
FT   CDS_pept        complement(67584..68660)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="waaQ"
FT                   /locus_tag="ETAE_0075"
FT                   /product="heptosyl III transferase"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ACY82922"
FT                   /db_xref="GOA:D0Z948"
FT                   /db_xref="InterPro:IPR002201"
FT                   /db_xref="InterPro:IPR011916"
FT                   /db_xref="UniProtKB/TrEMBL:D0Z948"
FT                   /protein_id="ACY82922.1"
FT                   /translation="MVSNSTLPAAFSPQRILVIKLRHHGDMLLVTPVISTLKRHYPSAQ
FT                   IDVLLYAETRDMLSANQDIHQLYCIDRQWKKQGVRHQLSQEWRLLRTLRAQRYDLVVNL
FT                   ADQWRSAIVTALSAAPVRIGFDFTKRRHPLWRTSHTHLASTAEHGKQHTVEQNLSILAP
FT                   LGLADDDSRVTMGYSEQDWQSASALIPTAWQAGYVVIQPTSRWFFKCWQEARMSEVINA
FT                   LSQAGYPILLTSGPDARERAMIDAIMQGCPTAQVTSLAGQLTLRQLAAIIDHARLFIGV
FT                   DSVPMHMAAALQTPLVALFGPSKLVFWRPWQARGDVIWAGDFGTLPDPDAIDTQTAERY
FT                   LDLIPSSAVIAAAKRLLE"
FT   gene            68793..69764
FT                   /gene="wabN"
FT                   /locus_tag="ETAE_0076"
FT   CDS_pept        68793..69764
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="wabN"
FT                   /locus_tag="ETAE_0076"
FT                   /product="deacetylase"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ACY82923"
FT                   /db_xref="GOA:D0Z949"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:D0Z949"
FT                   /protein_id="ACY82923.1"
FT                   /translation="MSHPAFIITIDTEGDNLWQNHDRITTENARYLPRFQQLCEKYGFK
FT                   PVYLTNYEMASDPVYVEFAQDVIARGCGEVGMHLHAWNSPPEIPLTDNDWANKPYLIEY
FT                   PAEVIQQKVDYMTHLLEDTFQTKMVSHRAGRWAMNAFYLQLLLAHGYQVDCSVTPRVDW
FT                   RGARGAPQGNGGSDYSGYPDNAYFVDADDLRREGTSTLLEVPMSTRLKHAPLFNHLRGA
FT                   YDRLRGKRRPASVQWLRPRGGNLQEMQRVAEYHLSQGRDYVEFMLHSSEFMPGGSPTFR
FT                   NEQDIERLYHDLEALFDWLAPQVMGQTLAEYYQIKRGQRPAM"
FT   gene            complement(69850..71061)
FT                   /gene="wabK"
FT                   /locus_tag="ETAE_0077"
FT   CDS_pept        complement(69850..71061)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="wabK"
FT                   /locus_tag="ETAE_0077"
FT                   /product="putative glycosyltransferase WabK"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ACY82924"
FT                   /db_xref="GOA:D0Z950"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:D0Z950"
FT                   /protein_id="ACY82924.1"
FT                   /translation="MIDLRKVGGVETMFCDFLRYATQAYPHIQHTLIMEHSGIANALRP
FT                   RLQGLQQVSIQTIKRCGSFSLPNRPKLFRAWNRLRLIRDSAPDIVLIWNQFTEWHLSGS
FT                   RTARYLRCPVVYYEHGMSWYQHTPTLPQRFFAQVTHCLAVSHACKRMLELKHHITQPIA
FT                   VELNAPRSLPAHATPKPARHRGQPIIFGSAGRWVPLKCLGLLLLTSQVLQQRGIPHHCY
FT                   IAGEGKEADYLQHLRTALGVEKETTLLGFVSDMEAFYAKLDLYICPSMHETASLTALEA
FT                   GTYGIPTITSNIDGLPETVRHQQTGLCLTPTLSVEQYAHISAASTDFSPLVYDPVQDRL
FT                   TPPLILSPEQLADSIEDLYNNPETYQQLSDGAREYAAASRRFNDLAQALCQRLLTLAPP
FT                   RPHD"
FT   gene            complement(71268..72374)
FT                   /gene="walR"
FT                   /locus_tag="ETAE_0078"
FT   CDS_pept        complement(71268..72374)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="walR"
FT                   /locus_tag="ETAE_0078"
FT                   /product="putative glycosyltransferase WalR"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ACY82925"
FT                   /db_xref="GOA:D0Z951"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:D0Z951"
FT                   /protein_id="ACY82925.1"
FT                   /translation="MNIAHFETSMDWGGQELRIVEQAEWLNQNGYPTWIIARPGSAILA
FT                   KAQEKNLPTFAIRVRGSVHPKTLAPLLKFIRAQRIDILDCHGSRDAVYGALVKLLTGVK
FT                   VIRSRHVTDPIKMSGLHGLVWRHGNHGIITTAKKIQEMLETQGIPNKDKTLVAPAGVDP
FT                   QRFSPEHDAQQLRARLGIAADSLVIANIGMIRPDKGQNYYVEACKQLLDKGVPITCIQV
FT                   GEATSQTADFKRQVLELAQPYVDKQIRFLGYHNDIENYLAIADIVVVASVATEAQTRLV
FT                   SQAFLMKKNVVATTTGGLPEMIAHEQTGLLCPPHDAKALADAVCRLIEQPPLRAQLREN
FT                   AYQHALQYMTFDYMIKEMVKFYQATLHQ"
FT   gene            complement(72378..73535)
FT                   /locus_tag="ETAE_0079"
FT   CDS_pept        complement(72378..73535)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAE_0079"
FT                   /product="putative glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ACY82926"
FT                   /db_xref="GOA:D0Z952"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="UniProtKB/TrEMBL:D0Z952"
FT                   /protein_id="ACY82926.1"
FT                   /translation="MAEKSIVHLVNLRDFGGVERLILDYVINGKEHNWVIINTANSLNK
FT                   RFNEHANSIIFCNRAIQSAAIQIPSFIRKKALWNKIKKINPSHVVIWNQIVSLEDKPDS
FT                   IKAIYYDHGAVWEVEKNKKTIDFFKRIDGCICVSQASKKILENKFEHRCDISVILNRTS
FT                   VESRDSIIADEKKKTFTIGCAARFSPLKALGLLPLIAEETALRGFNFNFIIAGTGEEES
FT                   ALASLIDKKNLKKSIKTIGFLDNLNDFYKHIDVYISTSAHETCSLSCIEAMSFGIPIIS
FT                   ANIDGQPEIISNGHTGFCISPTLSMEDYCKKTGMSLPFQKDIYYPENDTIGPPRLLSPK
FT                   DAADKIIEIYLHGVDDYKKNSRHRAKELFDDKTFEENLIKIVRNF"
FT   gene            complement(73537..74670)
FT                   /gene="waaL"
FT                   /locus_tag="ETAE_0080"
FT   CDS_pept        complement(73537..74670)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="waaL"
FT                   /locus_tag="ETAE_0080"
FT                   /product="lipid A core-O-antigen ligase and related enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ACY82927"
FT                   /db_xref="GOA:D0Z953"
FT                   /db_xref="InterPro:IPR007016"
FT                   /db_xref="UniProtKB/TrEMBL:D0Z953"
FT                   /protein_id="ACY82927.1"
FT                   /translation="MKTNFIDKLPIYISALFCAFISLLSISDDNNIVSNIYYVSFALFI
FT                   VWCIRERKNIFNKASLLLGAFLLLSAISTYWSDHSKDTSRYIQHAVYIFIFSSIIYELR
FT                   GTLFFKNILFKSYVATCSIFVIINGFLFYSKYNLYDRFYPILGPSNTIDYAGILCLAII
FT                   FCCYLYQHEKNKAPYVIAGIVLLAGVILSQSRTPIIALAISLMVLFIKSKRSAIISLVT
FT                   ILAIIFLIHTVYPSIFTRDAVNGAPTPRIFTWLYTIQQVSEHHPWLGFGYNDTFAHYFK
FT                   PRNFTYNNAHSVFMSMLYYSGIIGVILFFSYILNIFFAAIKVFNENRYPIAFILISLIF
FT                   SSTQGYLYIYHPREIWLVLWLPLFLAIPMSKISSEQV"
FT   gene            complement(74660..75625)
FT                   /gene="waaC"
FT                   /locus_tag="ETAE_0081"
FT   CDS_pept        complement(74660..75625)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="waaC"
FT                   /locus_tag="ETAE_0081"
FT                   /product="ADP-heptose:LPS heptosyltransferase I"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ACY82928"
FT                   /db_xref="GOA:D0Z954"
FT                   /db_xref="InterPro:IPR002201"
FT                   /db_xref="InterPro:IPR011908"
FT                   /db_xref="UniProtKB/TrEMBL:D0Z954"
FT                   /protein_id="ACY82928.1"
FT                   /translation="MRILMVKTSSMGDVIHTLPALTDAQQAIPGLCVDWVVEEGFAQIP
FT                   SWHAAVDRVIPVAIRRWRKNLLSAQTRQEWRTFKQQLRQERYDAVIDAQGLLKSALLVT
FT                   HNALGTRHGFDRRSAREPLASLFYDRRHRVARDQHAVERTRQLVAQSLGYPLPAQRGDY
FT                   AIARHFTQQLPMDAGQYMVFLHATTRDEKHWPEAHWRELIAWVGRHTTQRIKLPWGAEH
FT                   EHQRALRLAEGFPHVDVLPKMALSDVATVLAGASQVISVDTGLSHLAAALDRPNITLYG
FT                   PTDPGLIGGYGKNQLEIIEPTHSLDALPSLAVVEYLKNEN"
FT   gene            complement(75613..76674)
FT                   /gene="rfaF"
FT                   /locus_tag="ETAE_0082"
FT   CDS_pept        complement(75613..76674)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rfaF"
FT                   /locus_tag="ETAE_0082"
FT                   /product="ADP-heptose:LPS heptosyltransferase II"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ACY82929"
FT                   /db_xref="GOA:D0Z955"
FT                   /db_xref="InterPro:IPR002201"
FT                   /db_xref="InterPro:IPR011910"
FT                   /db_xref="UniProtKB/TrEMBL:D0Z955"
FT                   /protein_id="ACY82929.1"
FT                   /translation="MKILVIGPSWVGDMMMSQSLYRTLKATYPEAEIDVMAPNWCRPLL
FT                   ERMPEVHQAIPMPLGHGTLGLGERYRLGRQLREREYDRAYVLPNSFKSALIPFFARIPV
FT                   RTGWKGELRYGLLNDLRQLDKSAFPLMVERYAALAYPATQIRRAADLPQPLLWPALQVR
FT                   DEEIAETAAAFNLTDHRPVIGFCPGAEFGPAKRWPHYHYAALAQRLIGQGYQIALFGSA
FT                   KDTDAGEEIRRTLDEESREYCLNLAGHTSLDQAVALIAACQAIVSNDSGLMHIAAALDK
FT                   PLVALYGPSSPDFTPPLSQHARVIRLISGYHKVRRGEGETGYHQSLIDITPDRVEQTLQ
FT                   ALLHDEKESGCVS"
FT   gene            complement(76698..77627)
FT                   /gene="rfaD"
FT                   /locus_tag="ETAE_0083"
FT   CDS_pept        complement(76698..77627)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rfaD"
FT                   /locus_tag="ETAE_0083"
FT                   /product="ADP-L-glycero-D-manno-heptose-6-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ACY82930"
FT                   /db_xref="GOA:D0Z956"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR011912"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D0Z956"
FT                   /protein_id="ACY82930.1"
FT                   /translation="MIIVTGGAGMIGSNIVKALNDKGYTDILVVDNLKDGTKFVNLVDL
FT                   DITDYMDKEDFIAGIVAGDDFGDIDAVFHEGACSSTTEWDGKYVMDNNYQYSKELLHFC
FT                   LERQIPFLYASSAATYGMTDKFVEDRRYEGPLNVYGYSKFLFDQYVRRILPHAESQICG
FT                   FRYFNVYGPREGHKGGMASVAFHLNTQINNGEQPKLFEGSENFRRDFIYVGDVADVNLW
FT                   FWENGVSGIFNCGTGNAESFQAVADAVVAYHQKGSVTYIPFPDKLKGRYQAFTQADTTQ
FT                   LRAAGYSRPFKTVAQGVREYMEWLNRKP"
FT   gene            77918..79114
FT                   /gene="kbl"
FT                   /locus_tag="ETAE_0084"
FT   CDS_pept        77918..79114
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kbl"
FT                   /locus_tag="ETAE_0084"
FT                   /product="2-amino-3-ketobutyrate coenzyme A ligase"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ACY82931"
FT                   /db_xref="GOA:D0Z957"
FT                   /db_xref="InterPro:IPR001917"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR011282"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D0Z957"
FT                   /protein_id="ACY82931.1"
FT                   /translation="MSADFYQQLAQQLVATRAEGLYKNERIITSAQQAEIAVADGSRVL
FT                   NFCANNYLGLADHPALIAAAKAGMDSHGFGMASVRFICGTQDSHKALEQQLADFLGMED
FT                   AILYSSCFDANGGLFETLLGPEDAIISDALNHASIIDGVRLCKARRYRYANNDMAELKA
FT                   RLELARAEGARHIMIATDGVFSMDGVIADLRSICDLADEYDALVMVDDSHAVGFVGAHG
FT                   RGTPEYCGVMGRVDIITGTLGKALGGASGGYTAARKEVVEWLRQRSRPYLFSNSLAPAI
FT                   VAASSQVLTLLAQGDDLRARLWDNARLFREKMTAAGFTLAGADHAIIPVMLGEAKLAQR
FT                   FADLLLQEGIYVTGFFYPVVPQGQARIRTQMSAAHTPAQIEQAVAAFIRVGKQLGVIA"
FT   gene            79124..80149
FT                   /gene="tdh"
FT                   /locus_tag="ETAE_0085"
FT   CDS_pept        79124..80149
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tdh"
FT                   /locus_tag="ETAE_0085"
FT                   /product="L-threonine 3-dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ACY82932"
FT                   /db_xref="GOA:D0Z958"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR004627"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D0Z958"
FT                   /protein_id="ACY82932.1"
FT                   /translation="MKALSKLKAEEGIWMTDVPLPALGHNDIMIKIRKTAICGTDVHIY
FT                   NWDAWSQKTIPVPMVVGHEYVGEVVAVGQEVSGFRIGDRVSGEGHITCGHCRNCRAGRT
FT                   HLCRNTIGVGVNRQGAFAEYLVIPAFNAFKIPDNIPDTLAAIFDPFGNAVHTALSFDLV
FT                   GEDVLVSGAGPIGIMAAAVCRHVGARHVVITDVNDYRLDLARKMGVTRAVNVSRESLPE
FT                   VMQALGMSEGFDVGLEMSGAPPAFRTMLDTMNHGGKIAMLGIPPGDMAIDWNQVIFKGL
FT                   LIKGIYGREMFETWYKMAALIQSGLDLTPIITHQYAIDDFQKGFDAMRSGHSGKVILNW
FT                   S"
FT   gene            complement(80205..81725)
FT                   /locus_tag="ETAE_0086"
FT   CDS_pept        complement(80205..81725)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAE_0086"
FT                   /product="putative ATPase with chaperone activity"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ACY82933"
FT                   /db_xref="GOA:D0Z959"
FT                   /db_xref="InterPro:IPR000523"
FT                   /db_xref="InterPro:IPR001208"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004482"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR025158"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D0Z959"
FT                   /protein_id="ACY82933.1"
FT                   /translation="MTLATVYTRAALGIQAPEVRIEAHIGNGLPGFTLVGLPETAVREA
FT                   KDRVRCAMLNSGFQFPPKRITLNLAPADLPKEGGRYDLPMALALLLASEQLAPRVSVGD
FT                   YEFIGELALSGDLRSVQGTLPAALSAARAKRTLIAPSDNAAELGLLAAPRPPVAPSLLA
FT                   VCAFLSGQASLETAPAGKMTSDCAGAGDMADIIGQAQARRALEIAAAGGHNLLLIGPPG
FT                   TGKTMLACRLPGLLPPMTPDEALEQAAISSLAYPGAMPPRYGMRPFRAPHHSASMAALI
FT                   GGGPLPKPGEISLAHHGVLFLDELAEFDRRTLDALREPLESGVVHLSRARIKVSFPARV
FT                   QLVAAMNPSSGGHADGRDRRAAPQQVLRYLSRLSGPLLDRFDLSIDVPPLSPGLLARQR
FT                   ADGEDSATLRRRVCAARARQYARGGRLNAHLEGAARDRDCRLAPDDALYLEQALTRLAL
FT                   SVRAWHRLLKVARTLADLEGCDDIARRHLAEALSYRAMDRLLLSLQRG"
FT   gene            82013..83248
FT                   /locus_tag="ETAE_0087"
FT   CDS_pept        82013..83248
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAE_0087"
FT                   /product="putative major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ACY82934"
FT                   /db_xref="GOA:D0Z960"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D0Z960"
FT                   /protein_id="ACY82934.1"
FT                   /translation="MLGWSAQQRNVAIASFLSWTLDSFDFFILVFLLSDIARTFHVGVE
FT                   QVTLAILLTLAVRPIGALIFGRAAEKYGRRPILMLNIICFSLFELLSAAAPSLLIFLLL
FT                   RALYGVAMGGIWGVASSLTMETIPDRSRGLMSGIFQAGYPFGYLLAAVIYGLCAQTLGW
FT                   RGMFIVGAVPIVLLPFIYFYVPESPVWLAARAQHQSVALLPVLRRHWTLCVYLVALMAA
FT                   FNFFSHGTQDLYPTFLRVQHGFSTNVISIIAVAYNIASIIGGVFFGILSERIGRKRAIM
FT                   LAALLALPVIPLWAFSSGSLMLGVGAFLMQFMVQGAWGVIPTYLNELVPANARAVLPGF
FT                   VYQLGNLIASVNATMQASIAADHGQNYALAMAITAACVALTIVALIAFGRDTRGVSMAE
FT                   KIPRQDKSIKIS"
FT   gene            83612..85261
FT                   /gene="ilvG"
FT                   /locus_tag="ETAE_0088"
FT   CDS_pept        83612..85261
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ilvG"
FT                   /locus_tag="ETAE_0088"
FT                   /product="acetolactate synthase 2 catalytic subunit"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ACY82935"
FT                   /db_xref="GOA:D0Z961"
FT                   /db_xref="InterPro:IPR000399"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR012846"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR039368"
FT                   /db_xref="UniProtKB/TrEMBL:D0Z961"
FT                   /protein_id="ACY82935.1"
FT                   /translation="MNGAQWVVQALRAQGVNQVFGYPGGAIMPLYDALYDGGVAHLLCR
FT                   HEQGAVMAAIGYARASGRVGVCIATSGPGATNLITGLADAMMDSVPLVAITGQVASALI
FT                   GTDAFQEMDVLGLSLACTKHSFMVTSLAELPEVMDRAFAIAMQGRPGPVLIDIPKDIQL
FT                   AQGELATPLCSVASAQAPCQPAALAQARAMLAQAQRPVLYVGGGVGMADAVLALRSLVS
FT                   RSGMPVAATLKGLGAADDRHPAYLGMLGMHGCKAANLAVQQCDLLIAVGARFDDRVTGR
FT                   LDAFAPQAQVIHLDIDPAELGKLRQAHVSLCGDLNPLLSALTMPLDIAPWLQQVAALKA
FT                   QHAWRYDHPGEAIYAPLFLRQLSECKPPQAVVTTDVGQHQMWSAQHMQFSLPQDFITSS
FT                   GLGTMGFGIPAAVGAQVARPDDCVICVSGDGSFMMNVQELGTIKRARLPLKIVLLDNQR
FT                   LGMVRQWQQLFFDARYSETDLSDNPDFLTLAQAFDIPGQRISCKAQVAGALEALFSTPG
FT                   PYLLQVAIDEFENVWPLVPPGAGNESMLENVS"
FT   gene            85258..85548
FT                   /gene="ilvM"
FT                   /locus_tag="ETAE_0089"
FT   CDS_pept        85258..85548
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ilvM"
FT                   /locus_tag="ETAE_0089"
FT                   /product="acetolactate synthase (isozyme II), small
FT                   (regulatory) subunit"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ACY82936"
FT                   /db_xref="UniProtKB/TrEMBL:D0Z962"
FT                   /protein_id="ACY82936.1"
FT                   /translation="MMQSPSFQHHLAIQARRRPEILERVLRVVRHRGFEIHAMNMAQDG
FT                   DCDSVSIELTVASTRPVTLLSSQLSKLLDVARVDVSAPRSLRMLPRRQALG"
FT   gene            85601..86530
FT                   /gene="ilvE"
FT                   /locus_tag="ETAE_0090"
FT   CDS_pept        85601..86530
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ilvE"
FT                   /locus_tag="ETAE_0090"
FT                   /product="branched-chain amino acid aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ACY82937"
FT                   /db_xref="GOA:D0Z963"
FT                   /db_xref="InterPro:IPR001544"
FT                   /db_xref="InterPro:IPR005785"
FT                   /db_xref="InterPro:IPR018300"
FT                   /db_xref="InterPro:IPR033939"
FT                   /db_xref="InterPro:IPR036038"
FT                   /db_xref="UniProtKB/TrEMBL:D0Z963"
FT                   /protein_id="ACY82937.1"
FT                   /translation="MTTKKADYIWFNGDMVPWGEARVHVMSHALHYGTSVFEGVRCYDT
FT                   HRGPAVFRHREHMQRLHDSARIYRMPLAYSVDELMAACRETLRRNQLSSAYIRPLVFIG
FT                   DVGMGVNPPAGYSTDVILAAFPWGAYLGEEALEQGIDAMVSSWHRAAPNTIPTAAKAGG
FT                   NYLSSLLVGSEARRHGYQEGIALDVHGYVSEGAGENLFMVKNGVIFTPPFTSAALPGIT
FT                   RDAIITLAQAQGLEVREQVLSREALYLADEIFMSGTAAEITPVRSVDGIQVGIGRCGPI
FT                   TKRVQQAFFGLFNGQTEDRFGWLDPVNP"
FT   gene            86632..88482
FT                   /gene="ilvD"
FT                   /locus_tag="ETAE_0091"
FT   CDS_pept        86632..88482
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ilvD"
FT                   /locus_tag="ETAE_0091"
FT                   /product="dihydroxyacid dehydratase/phosphogluconate
FT                   dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ACY82938"
FT                   /db_xref="GOA:D0Z964"
FT                   /db_xref="InterPro:IPR000581"
FT                   /db_xref="InterPro:IPR004404"
FT                   /db_xref="InterPro:IPR020558"
FT                   /db_xref="InterPro:IPR037237"
FT                   /db_xref="InterPro:IPR042096"
FT                   /db_xref="UniProtKB/TrEMBL:D0Z964"
FT                   /protein_id="ACY82938.1"
FT                   /translation="MPKYRSATTTHGRNMAGARALWRATGMTDADFGKPIIAVVNSFTQ
FT                   FVPGHVHLRDLGRLVAAQIEAAGGVAKEFNTIAVDDGIAMGHGGMLYSLPSRELIADSV
FT                   EYMVNAHCADAMVCISNCDKITPGMMMAALRLNIPVIFVSGGPMEAGKTKLSDRLIKLD
FT                   LVDAMIQGANPQVSDAQSEQIERAACPTCGSCSGMFTANSMNCLTEALGLALPGNGSLL
FT                   ATHADRRALFEEAGRRIVALTHRYYEQDDASALPRSIAGKAAFENAMTLDIAMGGSTNT
FT                   VLHLLAAAQEGEIDFTLADIDRLSRQVPHLCKVAPSTPDYHMEDVHRAGGVMGLLGELD
FT                   RAGLLNRGVVNVLGLDLNETLARYDIMRSDDEALRRLYSAGPAGLRTVEPFSQSCRWDA
FT                   LDRDRQHGCIRAREHAYSQDGGLAVLSGNLAQDGCIVKTAGVDPESLIFRGPARVFESQ
FT                   EGAVEAILGGRIQPGDVLVIRYEGPKGGPGMQEMLYPTAYLKSMGLGKQCALITDGRFS
FT                   GGTSGLSIGHVSPEAASGGAIALVRDGDPIEIDIPARHIRIAIAESELALRRQQEQARG
FT                   AQAWTPRDRRRAVSLALRAYASLATSADRGAVRDRAKLGG"
FT   gene            88485..90029
FT                   /gene="ilvA"
FT                   /locus_tag="ETAE_0092"
FT   CDS_pept        88485..90029
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ilvA"
FT                   /locus_tag="ETAE_0092"
FT                   /product="threonine dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ACY82939"
FT                   /db_xref="GOA:D0Z965"
FT                   /db_xref="InterPro:IPR000634"
FT                   /db_xref="InterPro:IPR001721"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR005787"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="InterPro:IPR038110"
FT                   /db_xref="UniProtKB/TrEMBL:D0Z965"
FT                   /protein_id="ACY82939.1"
FT                   /translation="MTSKPLISSAPDGAEYLRAVLRSPVYEVAQVTPLQAMEKLSGRLG
FT                   NHILVKREDRQPVHSFKLRGAYAMIAGLSEAQRACGVITASAGNHAQGVALSASRLGIA
FT                   ATIVMPRATAEIKVEAVRGFGGRVLLYGANFDEAKAHAIQMAQETGMTFIPPFDHPAVI
FT                   AGQGTLALELLQQDAHLDRIFVPVGGGGLAAGVAVLIKQLMPQVKVIGVEAEDSACLRA
FT                   ALDAGQPVDLPRVGLFAEGVAVKRIGDETFRLCQRYLDDVITVDSDAICAAVKDLFEDV
FT                   RAVAEPSGALALAGLKQYVQRHALRGERLAHVLSGANLNFHGLRYVSERCELGEQREAL
FT                   LAVTIPERKGSFLAFCQLLGGRSVTEFNYRYADADSACIFVGVRLTNGRGEREEIIASL
FT                   RGGGYQVVDLSDDEMAKLHVRYMVGGRPSKPLQERLYSFEFPEAPGALLKFLHTLGTHW
FT                   NISLFHYRSHGTDFGRVLAAFERPDSDASFEARLKELGYECHDETGNPAFRFFLQG"
FT   gene            complement(90033..90929)
FT                   /gene="ilvY"
FT                   /locus_tag="ETAE_0093"
FT   CDS_pept        complement(90033..90929)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ilvY"
FT                   /locus_tag="ETAE_0093"
FT                   /product="transcriptional activator IlvY"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ACY82940"
FT                   /db_xref="GOA:D0Z966"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037404"
FT                   /db_xref="UniProtKB/TrEMBL:D0Z966"
FT                   /protein_id="ACY82940.1"
FT                   /translation="MDIRDLKLFLHLSESRHFGRTAAAVHVSPSTLSRQIQRLEEELGQ
FT                   PLLLRDNRDVRLTAAGEQLQDFARQTLLHYRQLRGGLDSHGAALCGELHLFCSVTAAYS
FT                   HLPPILDRFRAHHPQVDIRLTTGDAADAVSKVQGGAADLAIAGRPQSLPAHVEFCPIGE
FT                   IPLRLIAPAQPCPVRRQAQSPRPDWAQIPFILPQHGPARQRIDQWFRRRRIPAPRIYAT
FT                   VAGHEAIVSMVALGCGIALLPEVVIDNSPDSVRARIVTLDNDVAIAPFELGVCVQHKRL
FT                   REPPIAAFWSLLARATP"
FT   gene            91128..92606
FT                   /gene="ilvC"
FT                   /locus_tag="ETAE_0094"
FT   CDS_pept        91128..92606
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ilvC"
FT                   /locus_tag="ETAE_0094"
FT                   /product="ketol-acid reductoisomerase"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ACY82941"
FT                   /db_xref="GOA:D0Z967"
FT                   /db_xref="InterPro:IPR000506"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013023"
FT                   /db_xref="InterPro:IPR013116"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D0Z967"
FT                   /protein_id="ACY82941.1"
FT                   /translation="MTNYFNTLNLRQQLAQLGKCRFMARAEFADGVNALRGKKVVIVGC
FT                   GAQGLNQGLNMRDSGLDVAYALRAEAIAERRDSYRRATEHGFSVGDYQTLIPQADLVIN
FT                   LTPDKQHAAVVSAVQPLMKQGAALGYSHGFNIVEVGQQIRPDITVVMVAPKCPGTEVRE
FT                   EYKRGFGVPTLIAVHPENDPRGEGMAIAKAWASATGGDRAGVLVSSFVAEVKSDLMGEQ
FT                   TILCGMLQTGSLLCYERLVAEGADPAWAGKLIQFGWETITEALKQGGITLMMDRLSNPA
FT                   KLRAYALAEQLKTLMAPLFAKHMDDILSGAFSQGMMADWAADDDHLLTWRAETGESAFE
FT                   KAPPFEGKIDEQTYFDRGVLLVAMVKAGVELAFETMVASGIVAESAYYESLHELPLIAN
FT                   TIARRRLYEMNVVISDTAEYGNYLFANAAVPLLRQAFMATLQPGDLGQSLPAEAVDNAA
FT                   LREVNQAIRQHPIETVGERLRGYMTDMKRVAVAG"
FT   gene            complement(92603..92884)
FT                   /gene="ppiC"
FT                   /locus_tag="ETAE_0095"
FT   CDS_pept        complement(92603..92884)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ppiC"
FT                   /locus_tag="ETAE_0095"
FT                   /product="parvulin-like peptidyl-prolyl isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ACY82942"
FT                   /db_xref="GOA:D0Z968"
FT                   /db_xref="InterPro:IPR000297"
FT                   /db_xref="UniProtKB/TrEMBL:D0Z968"
FT                   /protein_id="ACY82942.1"
FT                   /translation="MARRAAALHILVESQAEAESLLQKLKRGAQFQTLARRHSRCPSKR
FT                   QGGDLGEFTKGSMVPEFDRAVFSGPLLTPIGPIKTRFGYHIIKVLYRS"
FT   gene            92945..95125
FT                   /gene="rep"
FT                   /locus_tag="ETAE_0096"
FT   CDS_pept        92945..95125
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rep"
FT                   /locus_tag="ETAE_0096"
FT                   /product="ATP-dependent DNA helicase Rep"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ACY82943"
FT                   /db_xref="GOA:D0Z969"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR005752"
FT                   /db_xref="InterPro:IPR013986"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="UniProtKB/TrEMBL:D0Z969"
FT                   /protein_id="ACY82943.1"
FT                   /translation="MRSPAGAMKTCVVYGGGAAQAMRRRRGFFSAVAFCYNRLPPTGVI
FT                   ISRNIVMRLNPGQQQAVEFVTGPCLVLAGAGSGKTRVITNKIAHLIRVCGYQARHIAAV
FT                   TFTNKAAREMKERVAQTLGRKEARGLMISTFHTLGLEIIKREYKALGMKSNFSLFDDQD
FT                   QLALLTDLTERWLEKDKTQLQQLIATISNWKNDLIDPAQAAAQARSARERLFADCYGLY
FT                   DTQLKSCNVLDFDDLILLPTLLLRRDPEVRERWQQRIRYLLVDEYQDTNTSQYELVKLL
FT                   VGTRARFTVVGDDDQSIYSWRGARPQNLVLLKEDFPALQVVKLEQNYRSSQRILKAANI
FT                   LIANNPHVFEKRLFSELGYGEPLKVITANNEDHEAERVVGELIAHHFIHKTAYSDYAIL
FT                   YRGNHQSRVFEKMLMQNRIPYKISGGTSFFSRAEIKDLLSYLRVLTNPDDDSAFLRIVN
FT                   TPRREIGPSTLQKLGAWANQRGISLFRASFDVGLEQTLSGRGLASLQHFTRWMDELSQL
FT                   CERDATAAVRDLIHGIDYESWLFETSASPRAAEMRMKNVNQLFGWMTDMLQGSDLDEPM
FT                   TLTQVVNRFTLRDMMERGESEEEADQVQLMTLHASKGLEFPYVYLVGMEEGLLPHQSSI
FT                   DEDNVDEERRLAYVGITRAQKELVFTLCRERRQYGELMRPEPSRFLLELPQDDLSWESA
FT                   RKVVSPQERMQRGQSHLANLKAQLARAKSAQD"
FT   gene            complement(95196..96698)
FT                   /gene="gppA"
FT                   /locus_tag="ETAE_0097"
FT   CDS_pept        complement(95196..96698)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gppA"
FT                   /locus_tag="ETAE_0097"
FT                   /product="guanosine pentaphosphate phosphohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ACY82944"
FT                   /db_xref="GOA:D0Z970"
FT                   /db_xref="InterPro:IPR003695"
FT                   /db_xref="InterPro:IPR023709"
FT                   /db_xref="InterPro:IPR030673"
FT                   /db_xref="UniProtKB/TrEMBL:D0Z970"
FT                   /protein_id="ACY82944.1"
FT                   /translation="MSKSAALYAAIDLGSNSFHMLVVREMAGGIQTLARIKRKVRLAAG
FT                   LDADNILSPDAMQRGWQCLHLFAERLQDIPTDHIRVVATATLRIARNADAFIARAQEIL
FT                   GRPVRIISGEEEARLIYQGVAHTTGGARRRLVVDIGGGSTELACGEGAKADVLFSLQMG
FT                   CVTWLERYFSDRHLTQANFARAGDAAHAMIAPVRDTLLRHGWQACVGASGTVQALQEIM
FT                   VAQGMDERITLDKLCQLRDRAIECGKLEELEIDGLTLERALVFPSGLAILIALFEALHI
FT                   DSMTLSGGALREGLVYGMLALPVGCDVRTRTLHNIQRRFLIDEGQAERVWRLADGLARQ
FT                   LSTPWPLDSCAHTLLHAACLLHELGLSVDVRQAPQHAAYLVRHLDLPGFTPAQKKLLAT
FT                   LLANQSGPLNLALFGQQNAVPLRTAQRLCRLLRLAIIFASQRHDGALPPLLTQVCEEDA
FT                   LRLILPVDWLADHPLRAESLQQESLWQGYAHWPLQIVDATSA"
FT   gene            complement(96704..97978)
FT                   /gene="rhlB"
FT                   /locus_tag="ETAE_0098"
FT   CDS_pept        complement(96704..97978)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rhlB"
FT                   /locus_tag="ETAE_0098"
FT                   /product="ATP-dependent RNA helicase RhlB"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ACY82945"
FT                   /db_xref="GOA:D0Z971"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR023554"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D0Z971"
FT                   /protein_id="ACY82945.1"
FT                   /translation="MTEQKFADFALHPMVIKALESKGFHSCTPIQALALPLAIAGRDVA
FT                   GQAQTGTGKTLAFLASTFHYLLTHPAIAERKTNQPRALIMAPTRELAVQIHSDAEPLAQ
FT                   ETGLRLGLAYGGDGYDKQLRVLEQGVDILIGTTGRLIDYAKQGHVDLGAIQVVVLDEAD
FT                   RMFDLGFIKDIRWLFRRMPPTAQRLNMLFSATLSYRVRELAFEHMNNAEYVEVEPEQKT
FT                   GHRIQEELFYPSNEEKMRLLQTLLEEEWPDRCIIFANTKHRCEDIWGHLAADGHRVGLL
FT                   TGDVPQKKRLRILEDFTKGHIDILVATDVAARGLHIPAVTHVFNYDLPDDCEDYVHRIG
FT                   RTGRAGASGKSISLACEEYVLNLPAIESYIGHSIPVSKYNSDALLKDLPAPKRLSRSRN
FT                   GAGARRPGSPRRGSGAPRPNRKRSG"
FT   gene            98139..98465
FT                   /gene="trxA"
FT                   /locus_tag="ETAE_0099"
FT   CDS_pept        98139..98465
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trxA"
FT                   /locus_tag="ETAE_0099"
FT                   /product="thioredoxin domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ACY82946"
FT                   /db_xref="GOA:D0Z972"
FT                   /db_xref="InterPro:IPR005746"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:D0Z972"
FT                   /protein_id="ACY82946.1"
FT                   /translation="MSDKIVHLSDSGFEADVLKAEGPILVDFWAEWCGPCKMIAPILDE
FT                   IAAEYAGKLTIAKLNIDENPATAPKYGIRGIPTLLLFKNGAVAATKVGALSKTQLKEFL
FT                   DANL"
FT   gene            98899..100158
FT                   /gene="rho"
FT                   /locus_tag="ETAE_0100"
FT   CDS_pept        98899..100158
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rho"
FT                   /locus_tag="ETAE_0100"
FT                   /product="transcription termination factor"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ACY82947"
FT                   /db_xref="GOA:D0Z973"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004665"
FT                   /db_xref="InterPro:IPR011112"
FT                   /db_xref="InterPro:IPR011113"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036269"
FT                   /db_xref="InterPro:IPR041703"
FT                   /db_xref="UniProtKB/TrEMBL:D0Z973"
FT                   /protein_id="ACY82947.1"
FT                   /translation="MNLTELKNTPVSELITLGESMGLENLARMRKQDIIFAILKQHAKS
FT                   GEDIFGDGVLEILQDGFGFLRSADSSYLAGPDDIYVSPSQIRRFNLRTGDTISGKIRPP
FT                   KEGERYFALLKVNEVNYDKPENARSKILFENLTPLHANSRLRMERGNGSTEDLTARVLD
FT                   LASPIGRGQRGLIVAPPKAGKTMLLQNIAQSIAYNHPDCVLMVLLIDERPEEVTEMQRL
FT                   VKGEVVASTFDEPASRHVQVAEMVIEKAKRLVEHKKDVIILLDSITRLARAYNTVVPAS
FT                   GKVLTGGVDANALHRPKRFFGAARNVEEGGSLTIIATALIDTGSKMDEVIYEEFKGTGN
FT                   MELHLSRKIAEKRVFPAIDYNRSGTRKEELLTTPEELQKMWILRKIIHPMGEIDAMEFL
FT                   INKLAMTKTNDEFFDMMKRS"
FT   gene            100435..101523
FT                   /gene="rfe"
FT                   /locus_tag="ETAE_0101"
FT   CDS_pept        100435..101523
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rfe"
FT                   /locus_tag="ETAE_0101"
FT                   /product="UDP-N-acetylmuramyl pentapeptide
FT                   phosphotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ACY82948"
FT                   /db_xref="GOA:D0Z974"
FT                   /db_xref="InterPro:IPR000715"
FT                   /db_xref="InterPro:IPR012750"
FT                   /db_xref="UniProtKB/TrEMBL:D0Z974"
FT                   /protein_id="ACY82948.1"
FT                   /translation="MNLLTLSSKFFLIFIFSMAFLLVARRVAKKIGLVDKPNYRKRHQG
FT                   LIPLVGGISVYAGICFTFLFFKPYIPHATLYLICAGILVLVGALDDRFDISVKFRATVQ
FT                   ALIAIAMMVAGGLYLRSLGFVLGPWEMILGPFGYLVTLFAVWAAINAFNMVDGIDGLLG
FT                   GLSCVTFAAMGILLQWDGQPDLALWCFAIIAATLPYILLNLGVVGPRFKVFMGDAGSTL
FT                   IGFTVIWILLESTQGRGHPMNPVTALWVIAIPLMDMIAIMYRRLRKGMSPFSPDRQHIH
FT                   HLIMRAGFTSRQAFVLITLAAALLAAIGVLGEIWLPEYVMMALFLLAFALYGYCIKRAW
FT                   RVARMVKRFKRRLRRKSAGMHV"
FT   gene            101554..102591
FT                   /gene="wzzE"
FT                   /locus_tag="ETAE_0102"
FT   CDS_pept        101554..102591
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="wzzE"
FT                   /locus_tag="ETAE_0102"
FT                   /product="lipopolysaccharide biosynthesis protein WzzE"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ACY82949"
FT                   /db_xref="GOA:D0Z975"
FT                   /db_xref="InterPro:IPR003856"
FT                   /db_xref="InterPro:IPR032895"
FT                   /db_xref="UniProtKB/TrEMBL:D0Z975"
FT                   /protein_id="ACY82949.1"
FT                   /translation="MVSQNPMPVENELDVRGLCRALWRGKPWIVGTAALFAALALGVSL
FT                   LMPQKWSAAAITASPGVNSLGGYYSQQQFLRNLAQLSAPSGAVAQGSIADEAYAEFTTQ
FT                   LASYDTRREFWLHSPYYQSHKEGSAQADAALLDELINQIVFTPGDAAKHSDDSIRLTAD
FT                   GAAQANQLLRQYVAFATHRASANLNESLQGAWAARSIFLKAQVKRQEAVAQAIYQRELN
FT                   GLEQGLKIAAQQGITRSMATTAQVEVPDAELFMLGQPMLRARLEALRAVGPSYDIDYDR
FT                   NRAMLTTLSVGPVLDAAFQPYRYLRTPEEPVKRDSPRRLFMMVMWGAIGALVGAGIALS
FT                   RRARI"
FT   gene            102675..103805
FT                   /gene="wecB"
FT                   /locus_tag="ETAE_0103"
FT   CDS_pept        102675..103805
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="wecB"
FT                   /locus_tag="ETAE_0103"
FT                   /product="UDP-N-acetylglucosamine 2-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ACY82950"
FT                   /db_xref="GOA:D0Z976"
FT                   /db_xref="InterPro:IPR003331"
FT                   /db_xref="InterPro:IPR029767"
FT                   /db_xref="InterPro:IPR032892"
FT                   /db_xref="UniProtKB/TrEMBL:D0Z976"
FT                   /protein_id="ACY82950.1"
FT                   /translation="MKVLTVFGTRPEAIKMAPLVHALAADAAFDARVCVTAQHREMLDQ
FT                   VLGLFQIVPDYDLNIMRPGQDLSDITCRILEGLKPVLAEFRPDVVLVHGDTTTTLAASL
FT                   AAFYQRIPVGHVEAGLRTGDLYSPWPEEANRTLTGHLASLHFAPTLTARANLLREGIRE
FT                   QTIHLTGNSVVDALLWVRDRICADAALQTRLAASYPFLAADKPLLLVTGHRRESFGGGF
FT                   ERICGALAQIARSHPQVQVVYPVHLNPNVSEPVNRILRDIENVFLIPPQDYLPFVYLMG
FT                   RAQLILTDSGGIQEEAPSLGKPVLVMRETTERPEAVQAGTVRLVGTDTATIVSQVSQLL
FT                   EDEQQYRAMSHATNPYGDGQACQRILSALKNYRATL"
FT   gene            103802..105064
FT                   /gene="wecC"
FT                   /locus_tag="ETAE_0104"
FT   CDS_pept        103802..105064
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="wecC"
FT                   /locus_tag="ETAE_0104"
FT                   /product="UDP-N-acetyl-D-mannosaminuronate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ACY82951"
FT                   /db_xref="GOA:D0Z977"
FT                   /db_xref="InterPro:IPR001732"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR014026"
FT                   /db_xref="InterPro:IPR014027"
FT                   /db_xref="InterPro:IPR017476"
FT                   /db_xref="InterPro:IPR028359"
FT                   /db_xref="InterPro:IPR032891"
FT                   /db_xref="InterPro:IPR036220"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D0Z977"
FT                   /protein_id="ACY82951.1"
FT                   /translation="MSFDTISVIGLGYIGLPTAVAFAGCRKQVIGVDVSQHAVETINRG
FT                   EIHIVEPDLDRAVKRAVEGGFLRAVMRPEPADAFLIAVPTPFKGDHEPDLTYVEAAARS
FT                   IAPVLKKGDLVILESTSPVGATEQMCAWLAECRTDLRFPHQDGEQADIRVAYCPERVLP
FT                   GKIMVELLRNDRVIGGMTPTCSAQACALYKLFLEGECVETNARTAEMCKLTENSFRDVN
FT                   IAFANELSLICDAQGIDVWQLIALANRHPRVNILQPGPGVGGHCIAVDPWFIVAQNPQL
FT                   ARLIHTARLVNDGKPLWVVDRVKAALADCLAAEDKRASEATIACFGLAFKPDIDDLRES
FT                   PAMEIAEMVAQWHSGTTLVVEPNIHQLPARLAGMAQLTDCATALAQADVVVLLVDHQPF
FT                   RALAPQAVTQRFVVDTKGVWR"
FT   gene            105055..106125
FT                   /gene="rffG"
FT                   /locus_tag="ETAE_0105"
FT   CDS_pept        105055..106125
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rffG"
FT                   /locus_tag="ETAE_0105"
FT                   /product="dTDP-D-glucose 4,6-dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ACY82952"
FT                   /db_xref="GOA:D0Z978"
FT                   /db_xref="InterPro:IPR005888"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D0Z978"
FT                   /protein_id="ACY82952.1"
FT                   /translation="MAVRRILVTGGAGFIGSAVVRHIIMDTADSVVVVDKLTYAGNLAS
FT                   LAPAAGSDRYAFERADIGDRAAMDRILAQYRPDAIMHLAAESHVDRSIDGPADFIQTNI
FT                   VGTYTLLEATRRYWSALPAAPRAAFRFHHISTDEVYGDLHGPQALFREDTPYAPSSPYS
FT                   ASKAASDHLVRAWLRTYGLPTLITNCSNNYGPYHFPEKLIPLTIINALAAKPLPVYGNG
FT                   LQVRDWLYVEDHARALYRVLMTGRVGETYNIGGHNERRNIDVVTTLCALLQEMVPEKPA
FT                   GVRHFADLITYVADRPGHDVRYAIDASKIERELGWRPQETFESGIRKTVAWYLANERWW
FT                   RAVMDGSYAGERLGLA"
FT   gene            106158..107039
FT                   /gene="rffH"
FT                   /locus_tag="ETAE_0106"
FT   CDS_pept        106158..107039
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rffH"
FT                   /locus_tag="ETAE_0106"
FT                   /product="glucose-1-phosphate thymidylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ACY82953"
FT                   /db_xref="GOA:D0Z979"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR005907"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D0Z979"
FT                   /protein_id="ACY82953.1"
FT                   /translation="MKGIILAGGSGTRLYPITRGVSKQLLPIYDKPMIYYPLSVLMLAG
FT                   IRDILLISTPQDLPAFQRLLGDGSDIGVRLQYAEQPRPEGLAQAFLIGESFLDGDSCCL
FT                   VLGDNIFFGQGFSPKLRQVAQRERGATVFGYQVMDPERFGVVEFDDDFRALSIEEKPQR
FT                   PRSNWAVTGLYFYDAQVVDFARRVTPSVRGELEITSINQMYLQRGELNVELLGRGFAWL
FT                   DTGTHDSLLEASAFVQTVEKRQGFKIACLEEIAWRNGWLDDHGVARAAASLGKTAYGAY
FT                   LRELLHVRPRQY"
FT   gene            107017..107712
FT                   /gene="wecD"
FT                   /locus_tag="ETAE_0107"
FT   CDS_pept        107017..107712
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="wecD"
FT                   /locus_tag="ETAE_0107"
FT                   /product="TDP-D-fucosamine acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ACY82954"
FT                   /db_xref="GOA:D0Z980"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR012752"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D0Z980"
FT                   /protein_id="ACY82954.1"
FT                   /translation="MSVHASIEPLAWESAFFALRSGRLRFDDRAPPLQASACDAYQLLQ
FT                   AKVDARDLARCDALQALGFRLAEGEADFVLPVSSAPTFGGQRQAQAQDCLWLRALARNA
FT                   FALSRFRAPWYRAEDSARFYAEWVEKAVYGTFDHACLLALDDEGTPQGFVTLRRQVDGS
FT                   ARIGLLAVDNASFRCGVGRRLVAQAQAWCHAQSLSRLYVATQIGNLAAQRLYLGCGAQL
FT                   AATAYWLYR"
FT   gene            107738..108868
FT                   /gene="wecE"
FT                   /locus_tag="ETAE_0108"
FT   CDS_pept        107738..108868
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="wecE"
FT                   /locus_tag="ETAE_0108"
FT                   /product="TDP-4-oxo-6-deoxy-D-glucose transaminase"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ACY82955"
FT                   /db_xref="GOA:D0Z981"
FT                   /db_xref="InterPro:IPR000653"
FT                   /db_xref="InterPro:IPR012749"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR032894"
FT                   /db_xref="UniProtKB/TrEMBL:D0Z981"
FT                   /protein_id="ACY82955.1"
FT                   /translation="MIPFNAPPVTGSESDYMQAAMASGKLCGDGGFTRRCQQWMEQRFG
FT                   SAKVLLTPSCTASLEMAALLLDIQPGDEVIMPSFTFVSTANAFVLRGARIVFVDVRPDT
FT                   MNIDETRIEAAITEKTRAIVPVHYAGVACEMDTIMALAQQYGLYVVEDAAQGVMATYKG
FT                   RALGTIGHIGCYSFHETKNYTAGGEGGATLINDAALIERAEIIREKGTNRSQFFRGQVD
FT                   KYTWRDIGSSYLMSDLQAAYLWAQLEVADRINQRRLQLWQQYHDALAPLAEAGRLTLPT
FT                   TPAHCGHNAHMFYLKLRDMRERSAFIDFLKEAEIMAVFHYIPLHCSPAGARFGRFVGED
FT                   RYTTCESERLVRLPLFYNLPDVNQRTVINSIQSFFR"
FT   gene            108868..110118
FT                   /gene="wzxE"
FT                   /locus_tag="ETAE_0109"
FT   CDS_pept        108868..110118
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="wzxE"
FT                   /locus_tag="ETAE_0109"
FT                   /product="membrane protein involved in the export of
FT                   O-antigen and teichoic acid"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ACY82956"
FT                   /db_xref="GOA:D0Z982"
FT                   /db_xref="InterPro:IPR002797"
FT                   /db_xref="InterPro:IPR032896"
FT                   /db_xref="UniProtKB/TrEMBL:D0Z982"
FT                   /protein_id="ACY82956.1"
FT                   /translation="MSLARASLWTAGSTLIKIGAGLVVVKLLAVAFGPVGVGQAANFRQ
FT                   VITVLGVLSGAGIFNGITKYVAEYRQQPQRLRALLGTASTMILGFSLLLALIFTLGAAP
FT                   ISVALFGHDRYQAVIRLVALLQMGIACANYCLAVIKGYRDARGNALAVSLGSLLGVAAY
FT                   TLSYFLGGYRGALAGLALVPAAATLPALWVLWRQRHIPWRYVRPSWDRPLAASLGKFTL
FT                   MAVMTAVTMPVAYVMMRNQLAALDGWEAVGIWQGVSGISDAYLQFITASFSVYLLPTLA
FT                   GLHSRQAVGQEILRALRFVLPAVAAVSFTVWLLRDLVIWLLLSGKFSAMRDLFAWQLTG
FT                   DVFKVGAYVFGYLVIAKASLRFYLLCEISQFILLTLLSRILIPLHGALGAAQAYMATYI
FT                   IYFLLCGSVFWIYRNRA"
FT   gene            110115..111191
FT                   /gene="wecF"
FT                   /locus_tag="ETAE_0110"
FT   CDS_pept        110115..111191
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="wecF"
FT                   /locus_tag="ETAE_0110"
FT                   /product="4-alpha-L-fucosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ACY82957"
FT                   /db_xref="GOA:D0Z983"
FT                   /db_xref="InterPro:IPR009993"
FT                   /db_xref="UniProtKB/TrEMBL:D0Z983"
FT                   /protein_id="ACY82957.1"
FT                   /translation="MTTLIHVLGADIPHHNLTLLRFFDGMLSQRAATAPRRRFMVVARD
FT                   AAPFADLTTLDIEVWPDKRALARALLARASADRALRFFLHGQFNPWLWLALLCGRLRPQ
FT                   QVLWHVWGADLYEEARGWKYRLYYGLRRRAQGRVGHVFATLGDLDYYRRRHPRVATSTL
FT                   YFPTRMDPALTCNQRARVTSGALTVLVGNSGDRSNRHLVALQRLHDTFGAQTRVIVPLG
FT                   YPANNQAYIAQVRERAEGLFGHNATLLTQQVAFTDYLALLARCDLGYFIFERQQGIGTL
FT                   CLLLQQGIPLVLSRQNPFWRDMVDQQLPVLFDDDAPDDAAVRAAQRQLAQRDLSRLAFF
FT                   DPNYTDGWLQALALGERP"
FT   gene            111188..112576
FT                   /gene="wzyE"
FT                   /locus_tag="ETAE_0111"
FT   CDS_pept        111188..112576
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="wzyE"
FT                   /locus_tag="ETAE_0111"
FT                   /product="putative enterobacterial common antigen
FT                   polymerase"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ACY82958"
FT                   /db_xref="GOA:D0Z984"
FT                   /db_xref="InterPro:IPR010691"
FT                   /db_xref="UniProtKB/TrEMBL:D0Z984"
FT                   /protein_id="ACY82958.1"
FT                   /translation="MTLMQFAGLALVYFFSLLFVAFLTYKEFRRVRFNFNVFFSLLFLL
FT                   TFYFGFPLTCTLVFRFDVATVPAEEMLYALLSATAFYAIYYVTYKTRLRSATSASSGGS
FT                   AWLQLNRVEAQLTWILLALVALVTVTIFFLNNGFLLFKLHSYSQIFSSGVSGVALKRFF
FT                   YFFIPAMLVVYFLRQTQAAWLFFLVSTVVFGLLTYVIVGGTRANIIIAFALFLFIGIQR
FT                   GWITLWMLALAGVVGVVGMFWLALKRYGLAVSGDEAFYTFLYLTRDTFSPWENLALLLQ
FT                   HYTQIDFQGLAPIARDFYVFIPGWMWPDRPHLVLNSANYFTWQVLDNHSGLAISPTLIG
FT                   SLVVMGGAAFIPLGAIAVGLIIKWFDWLYTRGCAASNRYRGAVIQAFCFGAVFNMIVLA
FT                   REGLDAFVSRVVFFCIIFGCCLLLAKLLYWLFDAAGLIRARAAIAAPSVGKGSPARKDR
FT                   NDGE"
FT   gene            112566..113306
FT                   /gene="wecG"
FT                   /locus_tag="ETAE_0112"
FT   CDS_pept        112566..113306
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="wecG"
FT                   /locus_tag="ETAE_0112"
FT                   /product="UDP-N-acetyl-D-mannosaminuronic acid transferase"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ACY82959"
FT                   /db_xref="GOA:D0Z985"
FT                   /db_xref="InterPro:IPR004629"
FT                   /db_xref="InterPro:IPR023085"
FT                   /db_xref="UniProtKB/TrEMBL:D0Z985"
FT                   /protein_id="ACY82959.1"
FT                   /translation="MESNGSIPHYAIRGIDIWGFRDSDQFLRHLLTETAVRPGTLVAIN
FT                   AEKVMTAEDDAALRALIAAAEYKYADGISIVRAIRRKYPGAQVSRIAGADLWEALMQRA
FT                   GELGIPVFLVGGQPDVLAQTEAALRRRWGVNVVGAQDGYFSPEQRNALFERIHASGAQI
FT                   VTVAMGSPRQEILMRDCRAYYPQALYMGVGGTYDVFTGRVRRAPHLWRRFGLEWLYRLL
FT                   SQPTRWRRQVKLLRFVAYYYARKL"
FT   gene            complement(113288..113440)
FT                   /locus_tag="ETAE_0113"
FT   CDS_pept        complement(113288..113440)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAE_0113"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ACY82960"
FT                   /db_xref="UniProtKB/TrEMBL:D0Z986"
FT                   /protein_id="ACY82960.1"
FT                   /translation="MLSSAFLQKYRVWLHFAHSAVKAHAAEPKPTVRSRRHGLREATAR
FT                   YSFLA"
FT   gene            113481..113557
FT                   /locus_tag="ETAE_t001"
FT   tRNA            113481..113557
FT                   /locus_tag="ETAE_t001"
FT                   /product="tRNA-Arg"
FT   gene            113616..113691
FT                   /locus_tag="ETAE_t002"
FT   tRNA            113616..113691
FT                   /locus_tag="ETAE_t002"
FT                   /product="tRNA-His"
FT   gene            113706..113792
FT                   /locus_tag="ETAE_t003"
FT   tRNA            113706..113792
FT                   /locus_tag="ETAE_t003"
FT                   /product="tRNA-Leu"
FT   gene            113817..113893
FT                   /locus_tag="ETAE_t004"
FT   tRNA            113817..113893
FT                   /locus_tag="ETAE_t004"
FT                   /product="tRNA-Pro"
FT   gene            complement(114086..114205)
FT                   /locus_tag="ETAE_0114"
FT   CDS_pept        complement(114086..114205)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAE_0114"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ACY82961"
FT                   /db_xref="UniProtKB/TrEMBL:D0Z987"
FT                   /protein_id="ACY82961.1"
FT                   /translation="MPTLKPAAHRPCCARAARRCRLSETPIWRFIFYCFKTYS"
FT   gene            complement(114500..115699)
FT                   /gene="hemY"
FT                   /locus_tag="ETAE_0115"
FT   CDS_pept        complement(114500..115699)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemY"
FT                   /locus_tag="ETAE_0115"
FT                   /product="uncharacterized enzyme of heme biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ACY82962"
FT                   /db_xref="GOA:D0Z988"
FT                   /db_xref="InterPro:IPR005254"
FT                   /db_xref="InterPro:IPR010817"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:D0Z988"
FT                   /protein_id="ACY82962.1"
FT                   /translation="MLKVLLLFIILIAGIVLGPMLAGHQGYVLIQTDSYNIETSVTSLV
FT                   IMLILLMLVLFALEWLLRRLLRTGARTRGWFMGRKRTRARRQTRAGLLKLTEGDYGQVE
FT                   KLLARNADHADQPLVNYLLAAEAAQQRGDELRANQYLERAAEVAGSDPLPVDITRVRLQ
FT                   LARGENHAARHGVDALLNYAPRHPEVLRLAEQAYLRTDAFGPLLEILPTLAKQGLHSDD
FT                   DIEKLQIRAYIGLMDQAMANGGSEGLKQWWKAQARKTRHETALQVALAEHLIECDDHGA
FT                   AQQIVVDGLKRRFDERLVQLMPRLKSGNPEQLEKLLQQQIRQHGASALLNSTLGQLLMR
FT                   HGEWQQAAEALRAALKQRPDAYDYAWLADTLDKLHRPEEAAQMRRDGLLLTLHQDQPTT
FT                   "
FT   gene            complement(115702..116850)
FT                   /gene="hemX"
FT                   /locus_tag="ETAE_0116"
FT   CDS_pept        complement(115702..116850)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemX"
FT                   /locus_tag="ETAE_0116"
FT                   /product="putative uroporphyrinogen III
FT                   C-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ACY82963"
FT                   /db_xref="GOA:D0Z989"
FT                   /db_xref="InterPro:IPR007470"
FT                   /db_xref="UniProtKB/TrEMBL:D0Z989"
FT                   /protein_id="ACY82963.1"
FT                   /translation="MTEPTTPPDKAAAAETTTEQAQPLERAHKQDKQIVKKSAAGGPAL
FT                   GAIAIVLVIALGAGLYYHGHQQAQRQQASEQSLQEQLSALHTAQAQEKLRMEALLNKQA
FT                   KALDVATQLQASQSQQLKELEQKVAAISGNDANTWKLAQADFMVKLAERKLWSDQDVTT
FT                   AIALLKSADATLAGLDDPSLLGVRRALTEDISTLSTLNQIDFDGIILQLNQLANQVDDL
FT                   RLADNDSDEAPMDQDDGELSASLSQWRQNLAKSWHSFISEFITIRRRDSSAEPLLAPSQ
FT                   DVYLRENIRSRLLIAAQAVPRHQNQIYQQSLESVSAWVRAYFDVNDPSTKAFLNQIDAL
FT                   SQQSVSMILPDALKSQPLLDKLLHARSNALTAAPAAPATQGE"
FT   gene            complement(116869..117615)
FT                   /gene="hemD"
FT                   /locus_tag="ETAE_0117"
FT   CDS_pept        complement(116869..117615)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemD"
FT                   /locus_tag="ETAE_0117"
FT                   /product="uroporphyrinogen-III synthase"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ACY82964"
FT                   /db_xref="GOA:D0Z990"
FT                   /db_xref="InterPro:IPR003754"
FT                   /db_xref="InterPro:IPR036108"
FT                   /db_xref="InterPro:IPR039793"
FT                   /db_xref="UniProtKB/TrEMBL:D0Z990"
FT                   /protein_id="ACY82964.1"
FT                   /translation="MSILVTRPSPAGEQLVERLRALGMEAWHTPLIDVAPGRQLALLPE
FT                   AVAALQRGDLLLAVSRHAVLYAAEALRLAGRGWPTTPRYAAIGHSTAQSLGAACHQSVI
FT                   FPPAPETSEALLALPAIRQLRARRALILRGNGGRDLIADALRARGVSVTLCECYRRVAI
FT                   AYPGDELCARWRQQKVSTLVVTSGEMLQQLYDLVPEYDRQRWLLSCRLIVVSERLAQRA
FT                   RDLGWQEIRVAESANNDALLRTLQIN"
FT   gene            complement(117622..118575)
FT                   /gene="hemC"
FT                   /locus_tag="ETAE_0118"
FT   CDS_pept        complement(117622..118575)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemC"
FT                   /locus_tag="ETAE_0118"
FT                   /product="porphobilinogen deaminase"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ACY82965"
FT                   /db_xref="GOA:D0Z991"
FT                   /db_xref="InterPro:IPR000860"
FT                   /db_xref="InterPro:IPR022417"
FT                   /db_xref="InterPro:IPR022418"
FT                   /db_xref="InterPro:IPR022419"
FT                   /db_xref="InterPro:IPR036803"
FT                   /db_xref="UniProtKB/TrEMBL:D0Z991"
FT                   /protein_id="ACY82965.1"
FT                   /translation="MQSMTTATQPTLRIATRQSPLALWQAHYVRDQLLTHWPQLTIELV
FT                   PMVTRGDVLLDTPLAKVGGKGLFVKELELALLEGRADIAVHSMKDVPVAFPDGLGLVTI
FT                   CQREDPRDAFVSPRFASLEQLPPGSVVGTSSLRRQCQLRAARPDLQIRDLRGNVGTRLA
FT                   KLDAGDYDAIILAAAGLKRLQLDDRIRTPLTPEQSLPAVGQGAVGIECRLADDATRRLL
FT                   APLNHADTALRVCAERAMNTRLEGGCQVPIGSYAEIDGDQLWLRALVGAPDGSRIIRGE
FT                   RRGPLTQAEAMGTALADELLARGARTILDAVYCQKA"
FT   gene            118878..121433
FT                   /gene="cyaA"
FT                   /locus_tag="ETAE_0119"
FT   CDS_pept        118878..121433
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cyaA"
FT                   /locus_tag="ETAE_0119"
FT                   /product="adenylate cyclase"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ACY82966"
FT                   /db_xref="GOA:D0Z992"
FT                   /db_xref="InterPro:IPR000274"
FT                   /db_xref="InterPro:IPR024685"
FT                   /db_xref="InterPro:IPR024686"
FT                   /db_xref="UniProtKB/TrEMBL:D0Z992"
FT                   /protein_id="ACY82966.1"
FT                   /translation="MYLYIETLKQRLDAINQLRVDRALSAMGPAFQQVYTLLPTLLHFH
FT                   HPLMPGYLEGNVPHGICFFTPDEPQQNYLLHLEQRAPGSIPPVTGSDQMPITGLYTMGS
FT                   TSSIGQSCSSDLDIWVCHHSWLDASERSQLQQKCTLLEEWAASLGVEVSFFLIDENRFR
FT                   HNESGSLGGEDCGSTQHILLLDEFYRTAVRLAGKRILWSMVPGEEEEHYDEYVLSLYAQ
FT                   GALTPNEWLDLGGLSSLSAEEYFGASLWQLYKSIDSPYKAVLKTLLLEAYSWEYPNTEL
FT                   LAMDIKQRLHKGEIVSFGLDPYCMMLDRVTHYLEQIGDHARLDLARRCFYLKVCEKMSR
FT                   ARACVGWRREILSQLVAHWGWDEALIRSLDNRANWKIGQVREAHNELLDAMMQSYRNLI
FT                   RFARRNNLSVSASPQDIGVLTRKLYAAFEALPGKVTLVNPQISPDLSERDLTFIYVPVG
FT                   RANRSGWYLYNQAPTIDSIVSHQPLEYNRYLNKLVAWAYFNGLLTEETRLHIKANSSQC
FT                   DLNKLRELVRDVSNHFPLRLSAPTPKALYSPCEIRHLAIIVNLEHDPTATFSNQVVHFD
FT                   FRQLDVFSFGEQQQCLVGSVDLLYRNSWNEVRTLHFSGEQAVLEALKTILGKMHQDAAP
FT                   PEAVEVFCYSRHLRGLIRTRLQQLVSECIDLRLSSSRQEPGRFKAVRVAGQTWGLFFER
FT                   LSVSVQKLENAVEFYGAISNNKLHGLSMQVETDQAHLPAVVDGYASEGIIQFFFEDGER
FT                   DGFNIYILDESNRVEVYHHCEGSKEELVRDVSRFYSSSHDRFTYGSSFINFNLPQFYQI
FT                   VTVEGRAQVIPFRSKAVTPPGAETEGDGDAAPRQQFKVY"
FT   gene            complement(121441..121764)
FT                   /gene="cyaY"
FT                   /locus_tag="ETAE_0120"
FT   CDS_pept        complement(121441..121764)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cyaY"
FT                   /locus_tag="ETAE_0120"
FT                   /product="frataxin-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ACY82967"
FT                   /db_xref="GOA:D0Z993"
FT                   /db_xref="InterPro:IPR002908"
FT                   /db_xref="InterPro:IPR020895"
FT                   /db_xref="InterPro:IPR036524"
FT                   /db_xref="UniProtKB/TrEMBL:D0Z993"
FT                   /protein_id="ACY82967.1"
FT                   /translation="MNDSEFHLLADGLMQALEEALDACQSDADIDCETNGGVMTLSFEN
FT                   GSKIVINRQEPLHQIWLATRAGGYHFDYRDGQWRCSRSGAPLHQVLNEACSAQAGVPVT
FT                   LDR"
FT   gene            121842..122069
FT                   /locus_tag="ETAE_0121"
FT   CDS_pept        121842..122069
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAE_0121"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ACY82968"
FT                   /db_xref="InterPro:IPR032831"
FT                   /db_xref="UniProtKB/TrEMBL:D0Z994"
FT                   /protein_id="ACY82968.1"
FT                   /translation="MNRQFRSALLVLCAATLGGCGLKGPLYFPPAQQAPAAQKAPDAYS
FT                   VQAPSHEPVAQTPNTQTPNTAPAAEAGKAH"
FT   gene            122127..122951
FT                   /gene="dapF"
FT                   /locus_tag="ETAE_0122"
FT   CDS_pept        122127..122951
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dapF"
FT                   /locus_tag="ETAE_0122"
FT                   /product="diaminopimelate epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ACY82969"
FT                   /db_xref="GOA:D0Z995"
FT                   /db_xref="InterPro:IPR001653"
FT                   /db_xref="InterPro:IPR018510"
FT                   /db_xref="UniProtKB/TrEMBL:D0Z995"
FT                   /protein_id="ACY82969.1"
FT                   /translation="MQFAKMHGLGNDFMVVDAVTQNVYFSPELIRRLADRHTGVGFDQL
FT                   LVVEPPYDPDLDFHYRIFNADGSEVAQCGNGARCFARFVRIKGLTNRRDIRVSTQNGRM
FT                   TLHVGEDDRVTVNMGEPQFEPGRIPFKAAKAEKTYILRVAQQTVLCGAVSMGNPHCVLQ
FT                   VEDVSRAQVELLGPVLESHERFPERVNVGFMQVVERDHIRLRVYERGAGETQACGSGAC
FT                   AAVAVGIQQGLLDEQVQVDLPGGTLHIRWPGPGTPLLMTGPAAHVYDGFIHL"
FT   gene            122965..123669
FT                   /locus_tag="ETAE_0123"
FT   CDS_pept        122965..123669
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAE_0123"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ACY82970"
FT                   /db_xref="InterPro:IPR007435"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="UniProtKB/TrEMBL:D0Z996"
FT                   /protein_id="ACY82970.1"
FT                   /translation="MSERDSRDLLQPSLADEQVVAYLQQHPDFFIRNARQVEQMMIPHP
FT                   VRGAVSLLEWQLGRQRRQIAALDQEIEQLITLARDNERLFGSLLALQSHLASAQDMDDF
FT                   LQRLQRWARSLGLSGAYIRLFADRWRLGAPSRFSHLAIARSDVELLRIQRLGDANHYLG
FT                   SLNGQELLLLLPQARHVGSVALSLMGDFADLGLLVFTSADAQHYQQGMGTALLEQLARL
FT                   IPPMLTRWIERQ"
FT   gene            123666..124577
FT                   /gene="xerC"
FT                   /locus_tag="ETAE_0124"
FT   CDS_pept        123666..124577
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="xerC"
FT                   /locus_tag="ETAE_0124"
FT                   /product="site-specific recombinase XerC"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ACY82971"
FT                   /db_xref="GOA:D0Z997"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR011931"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR023009"
FT                   /db_xref="UniProtKB/TrEMBL:D0Z997"
FT                   /protein_id="ACY82971.1"
FT                   /translation="MTSLPEALSTPVAAFLQMMRVERQLSPRTVETYRRQLAASAALLL
FT                   EGGLCDWAALDTTRVRSLVARSRRQGLEPASLALRLSALRSFLDWQVSRGALTANPAKG
FT                   VAAPRQGRHLPKNLDVDDVNRLLDIDEGDTLAVRDRAMLEVMYGGGLRLSELVGLDCRH
FT                   VDLTTGEVWVLGKGSKERRLPVGREAVRWLQTWLSLRLSLQPQDDALFVSRLGGRISPR
FT                   SVQKRFAEWGVKQGVTSHIHPHKLRHSFATHMLESSGDLRAVQELLGHANLSTTQIYTH
FT                   LDFQHLATVYDAAHPRAKRGKT"
FT   gene            124577..125293
FT                   /locus_tag="ETAE_0125"
FT   CDS_pept        124577..125293
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAE_0125"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ACY82972"
FT                   /db_xref="GOA:D0Z998"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:D0Z998"
FT                   /protein_id="ACY82972.1"
FT                   /translation="MHFYRPLQRPAALTFDLDDTLYDNHPVIVRSEQAALDFLRRRFPA
FT                   LQDFQSADWQRLRAELRASDPEIYHDVTQWRWRTVYEALWRAGLSPTYCHDGADEAMAH
FT                   FAQWRSRITVSTETHQILAALAARLPLAAITNGNADPARCGLGAYFRFVLRAGPDGRAK
FT                   PYSDMYLAAARHFNLAPGQILHVGDDLTTDVAGAVRSGMQACWVNDRGRSLLCAADGRL
FT                   LPHVEISRLDSLLALI"
FT   gene            125370..127529
FT                   /gene="uvrD"
FT                   /locus_tag="ETAE_0126"
FT   CDS_pept        125370..127529
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="uvrD"
FT                   /locus_tag="ETAE_0126"
FT                   /product="DNA-dependent helicase II"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ACY82973"
FT                   /db_xref="GOA:D0Z999"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR005753"
FT                   /db_xref="InterPro:IPR013986"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="UniProtKB/TrEMBL:D0Z999"
FT                   /protein_id="ACY82973.1"
FT                   /translation="MDVSDLLDSLNDKQREAVAAPRSNLLVLAGAGSGKTRVLVHRIAW
FT                   LLAVENCSPFSIMAVTFTNKAAAEMRHRIEALIGTSQGGMWIGTFHGLAHRLLRAHHLD
FT                   AGLPQDFQILDSEDQLRLLKRLIKAMNLDEKQWPARQGMWYINGKKDDGLRPQHIESYG
FT                   NPVEQTWLRIYQAYQEACDRAGLVDFAELLLRAHELWLHKPQILEHYRARFNNILVDEF
FT                   QDTNRIQYAWIRMLAGDSGRVMIVGDDDQSIYGWRGAQVENIQKFLDDFPGAQTIRLEQ
FT                   NYRSSGNILRAANALIENNDGRLGKKLWTEDGEGEPISLYCAFNELDEARFVVNRIKAW
FT                   QDNGGALKECAILYRSNAQSRVLEEALLQAATPYRIYGGMRFFERQEIKDALAYLRLLS
FT                   NRNDDAAFERVVNTPVRGIGDRTLDVVRQTARDRQLTLWQATRALLQEQVFPGRAANAL
FT                   RRFLELIEALAQDSDDLPLHVQTDRVIRDSGLRQMYEQEKGEKGQTRIENLEELVTATR
FT                   QFSYEDDDDLSPLQAFLSHAALESGEGQADAYQDAVQLMTLHSAKGLEFPQVFIVGMEE
FT                   GMFPSQMSLDEGGRLEEERRLAYVGVTRAMRKLTLTYAESRRLYGKEVYHRPSRFVGEL
FT                   PETCVEEVRLRASVTRPVSHARMGTPLSQSDSGYRLGQRVAHAKFGEGTIINLEGSGEH
FT                   TRLQIAFKGEGIKWLVAAYARLEVL"
FT   gene            127875..128783
FT                   /gene="corA"
FT                   /locus_tag="ETAE_0127"
FT   CDS_pept        127875..128783
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="corA"
FT                   /locus_tag="ETAE_0127"
FT                   /product="magnesium/nickel/cobalt transporter CorA"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ACY82974"
FT                   /db_xref="GOA:D0Z9A0"
FT                   /db_xref="InterPro:IPR002523"
FT                   /db_xref="InterPro:IPR004488"
FT                   /db_xref="UniProtKB/TrEMBL:D0Z9A0"
FT                   /protein_id="ACY82974.1"
FT                   /translation="MELDDTDHLTASLWVDLVEPEEDERRRVQSELGQSLATRPELDDI
FT                   EASARFFEDEDGLHIHSFFYYEDAEDHAGNSTVAFTIREGRLFTLRERELPAFRLYRMR
FT                   ARNQMLVDGNAYELLLDLFETKIEQLADEIENIYSDLEKLSRVIMEGQQGDEYDDALST
FT                   LAELEDIGWKVRLCLMDTQRALNFLVRKARLPASQLEQAREVLRDIESLLPHNESLFQK
FT                   VNFLMQAAMGFINIEQNRIIKIFSVVSVVFLPPTLVASSYGMNFEFMPELKWSFGYPGA
FT                   ILLMILAGLAPYLYFKRKKWL"
FT   gene            128894..129949
FT                   /locus_tag="ETAE_0128"
FT   CDS_pept        128894..129949
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAE_0128"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ACY82975"
FT                   /db_xref="GOA:D0Z9A1"
FT                   /db_xref="InterPro:IPR007820"
FT                   /db_xref="InterPro:IPR017516"
FT                   /db_xref="UniProtKB/TrEMBL:D0Z9A1"
FT                   /protein_id="ACY82975.1"
FT                   /translation="MERLAHAEQWSILAVLSLGLGGLFLWLRLPAALLLGPMLAAVALG
FT                   LRGATIRVHRLAMPIAQAILGCMIARALSLSLLSPLLDDWPVVLLVLLCTQLCSAITGW
FT                   LLVRLSDLPGPTGAWGSSPGGASAMVAMAGEFGADVRLVAFMQYLRVLFVAAAAALVVR
FT                   VGLGDAPQGVPLAPPWFPALGWAFVATLLLAGGGAWLGRRLRIPAGALLLPMLIGALCN
FT                   TTGVMTPQTPEWLLAIAYALIGWQVGLLFTRTLFVLALRALPQIILSIAALMLCCALMA
FT                   WGLTQVLPIDPLSAYLATSPGGLDTIAIIAAGSQVNLAFVMALQMLRLFTILLMGPAVA
FT                   RWISRHAASAP"
FT   gene            complement(129938..130828)
FT                   /gene="rarD1"
FT                   /locus_tag="ETAE_0129"
FT   CDS_pept        complement(129938..130828)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rarD1"
FT                   /locus_tag="ETAE_0129"
FT                   /product="putative chloramphenical resistance permease"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ACY82976"
FT                   /db_xref="GOA:D0Z9A2"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="InterPro:IPR004626"
FT                   /db_xref="UniProtKB/TrEMBL:D0Z9A2"
FT                   /protein_id="ACY82976.1"
FT                   /translation="MDTQHTRQGVILALTAYLIWGIAPIYFKLLQQVPATEILTHRVIW
FT                   SFFFMLILLAIGRSWRQLYALRHTPYKIALLALSACLIGGNWLLYIWAVNHNHMLEASL
FT                   GYFINPLVNVLLGMLFLGERFRRMQWLAVALAIVGVMVQLWQFGSVPVIALGLAFSFAF
FT                   YGLLRKKIAIDAQSGMLMETLWLLPLALYYLFVAADSPTSHLSANPLSLNLLLIAAGVV
FT                   TTVPLLCFTAAATRLRLSTLGFFQYLGPTLMFLLATLCYGEQMTRDKLIAFGFIWSALL
FT                   LFIIDALYTQRRLRR"
FT   gene            131036..131923
FT                   /gene="pldA"
FT                   /locus_tag="ETAE_0130"
FT   CDS_pept        131036..131923
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pldA"
FT                   /locus_tag="ETAE_0130"
FT                   /product="outer membrane phospholipase A"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ACY82977"
FT                   /db_xref="GOA:D0Z9A3"
FT                   /db_xref="InterPro:IPR003187"
FT                   /db_xref="InterPro:IPR036541"
FT                   /db_xref="UniProtKB/TrEMBL:D0Z9A3"
FT                   /protein_id="ACY82977.1"
FT                   /translation="MNACKKYLMAGVAALPLVAQAAPSASESGAAPALSDNEGVIANML
FT                   RHYDNPFTLYPYSTNYVLYTQTSDINKEAISSYDWGDQAKKNEIKFQISLAFPIWRGIA
FT                   GDNSVLGAAYTQQSWWQAFNRSESSPFRETNYEPRLFLGWATDYPLFGGWVLRDIEAGG
FT                   VHQSNGRSDPTSRSWNRVYTRFLAQNGNFQVQLMPWYRIPESPNKDDNPDITKYMGYYE
FT                   AEMGYRLGESVFSLRGRYNWNSGYGAAELGWSYPLTRHVRFYTQLFSGYGESLIDYNFR
FT                   QTRFGVGVMLNDIL"
FT   gene            131992..133821
FT                   /gene="recQ"
FT                   /locus_tag="ETAE_0131"
FT   CDS_pept        131992..133821
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recQ"
FT                   /locus_tag="ETAE_0131"
FT                   /product="ATP-dependent DNA helicase RecQ"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ACY82978"
FT                   /db_xref="GOA:D0Z9A4"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR002121"
FT                   /db_xref="InterPro:IPR004589"
FT                   /db_xref="InterPro:IPR006293"
FT                   /db_xref="InterPro:IPR010997"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR018982"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:D0Z9A4"
FT                   /protein_id="ACY82978.1"
FT                   /translation="MATAAVINTERLAEGVLKDTFGYQQFRPGQQAIVEAAIAGRDCLV
FT                   VMPTGGGKSLCYQIPALVRDGLTIVVSPLISLMKDQVDQLQANGVNAACLNSTLNREQQ
FT                   QAVYAGCRSGEIRLLYIAPERLMMDNLLDTLPQWNPTLLAVDEAHCISQWGHDFRPEYS
FT                   ALGQIKRRFPQMPVIALTATADDATRQDILGLLDLRDPLVQVSSFDRPNIRYTLIEKFK
FT                   PLDQLWHFVQSQRGKSGIIYCNSRAKVEDTAARLQSRGLSVGAYHAGLDNGRRAEVQEA
FT                   FQRDDLQIVVATVAFGMGINKPNVRFVVHFDIPRNIESYYQETGRAGRDGLPAEALLFY
FT                   DPADMAWLRRCLEEKPEGAQKEIERHKLNAMNAFAEAQTCRRLVLLNYFGEGRQESCDN
FT                   CDICLDPPKRYDGLLDAQKALSTVARVGQRFGIGYVVEVLRGANSARIREWGHDKLSVY
FT                   GIGREHSTEHWVSILRQLIHLGLVTQNIALHSALQLTEAARPVLRGEVALPLAVPRVIN
FT                   LKARSSAQKSYGGNYDRKLFAKLRKLRKAIADEENIPPYVVFNDATLLEMAEQMPLRAG
FT                   DLLSINGVGQRKLERFGAPFMTLIREHLDEGQD"
FT   gene            complement(133828..134727)
FT                   /locus_tag="ETAE_0132"
FT   CDS_pept        complement(133828..134727)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAE_0132"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ACY82979"
FT                   /db_xref="InterPro:IPR002747"
FT                   /db_xref="InterPro:IPR023227"
FT                   /db_xref="InterPro:IPR023228"
FT                   /db_xref="UniProtKB/TrEMBL:D0Z9A5"
FT                   /protein_id="ACY82979.1"
FT                   /translation="MRIIRLTLLLLGTLYIHGALAAQALVLQTDFSLRDGAVSAMKGVA
FT                   FGVDSQIHLFDLTHEIPPYDIWQAAYRLHQTARYWPAGTVFVSVVDPGVGSERRSVVLK
FT                   TKNGQFFVSPDNGTLTLVAQTLGIDSVREIDEQTNRLQGSEKSYTFHGRDVYAYTGARL
FT                   ASGTIRFEQVGPRLPNQITEIPYQQAQWQPGKVSGTIAILDVQYGNLWSNIGDEMLEKA
FT                   GIALNDRLCITIAQQGQTRYQGHAPYVHSFADVPPGQPLVYLNSLLNVAVALNMDSFAE
FT                   KQRIAAGAEWQITLQKCR"
FT   gene            134883..135491
FT                   /gene="rhtC"
FT                   /locus_tag="ETAE_0133"
FT   CDS_pept        134883..135491
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rhtC"
FT                   /locus_tag="ETAE_0133"
FT                   /product="threonine efflux system"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ACY82980"
FT                   /db_xref="GOA:D0Z9A6"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="InterPro:IPR004778"
FT                   /db_xref="UniProtKB/TrEMBL:D0Z9A6"
FT                   /protein_id="ACY82980.1"
FT                   /translation="MMLFLTVAVVHLLALMTPGPDFFFVSQTALSRSRAEALRGVAGIS
FT                   LGIVIWAGVALMGLHLLLMKMAWLHSIITVGGGLYLCWMGLQMLRAARRPQGDAPQGVT
FT                   SLHGGAFWRGFLTNLSNPKAVIYFGSVFSLFVGDEVTGAQRIGLFILIVSETFIWFSLV
FT                   ASVFALPVMRRGYQRMARWIDGVAGTLFAAFGLHLILSR"
FT   gene            complement(135565..136902)
FT                   /gene="gntU"
FT                   /locus_tag="ETAE_0134"
FT   CDS_pept        complement(135565..136902)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gntU"
FT                   /locus_tag="ETAE_0134"
FT                   /product="gluconate transporter, low affinity GNT 1 system"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ACY82981"
FT                   /db_xref="GOA:D0Z9A7"
FT                   /db_xref="InterPro:IPR003474"
FT                   /db_xref="UniProtKB/TrEMBL:D0Z9A7"
FT                   /protein_id="ACY82981.1"
FT                   /translation="MSTLTLVMTAVGSVLLLLFLVMKARMHAFVALMLVSIGAGIFSGM
FT                   PIDKIAQTMQNGMGGTLGFLSIVVALGAMFGKILHETGALDQIAARLLKSFGEKRAHYA
FT                   LGIAGLVCALPLFFDVAIVLLIGVVFAVARRTGGNVVKLAIPLFAGVAGAAAFLLPGPT
FT                   PMLLASQMGADYGWMILIGLCAAIPGMILAGPLYGNFISKHVTLALPKDIQEPSLGKGQ
FT                   LPSFSFSLALVLFPLVLVGLKTIGARFVEQGSELYKWLEFIGHPFTAILLACLVATYGL
FT                   AIRRGMSKEKVMDICSAAIQPAGIILLVTGAGGVFKQVLVDSGVGPALGNSLIGAGLPI
FT                   AVACFVLAAAVRVIQGSATVACLTTVGLVLPVIGELGYSGAQLAALSVCIAGGSIVLSH
FT                   VNDSGFWLYGKFTGATEAQTLKTWSVMETILGTTGAIVGMLFFMAL"
FT   gene            complement(136914..137444)
FT                   /gene="gntK"
FT                   /locus_tag="ETAE_0135"
FT   CDS_pept        complement(136914..137444)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gntK"
FT                   /locus_tag="ETAE_0135"
FT                   /product="gluconate kinase 1"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ACY82982"
FT                   /db_xref="GOA:D0Z9A8"
FT                   /db_xref="InterPro:IPR006001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031322"
FT                   /db_xref="UniProtKB/TrEMBL:D0Z9A8"
FT                   /protein_id="ACY82982.1"
FT                   /translation="MSESQQQKHVFVLMGVSGSGKSAVANAVAQRLGAAFLDGDFLHPR
FT                   ANISKMADGHALNDDDRTPWLQALNDAVFAMQRTNDVSLIVCSALKKRYRDMLRDGNTN
FT                   LSFIYLQGDFALIESRLLARKGHFFKPQMLVSQFAALEEPTTEERDVYAIDISQPLDSV
FT                   VADTLNTIKSIIA"
FT   gene            complement(137664..138668)
FT                   /gene="gntR"
FT                   /locus_tag="ETAE_0136"
FT   CDS_pept        complement(137664..138668)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gntR"
FT                   /locus_tag="ETAE_0136"
FT                   /product="transcriptional regulator GntR"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ACY82983"
FT                   /db_xref="GOA:D0Z9A9"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR001761"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:D0Z9A9"
FT                   /protein_id="ACY82983.1"
FT                   /translation="MKMKKKRPVLQDIADRVGVTKMTVSRYLRNPELVSLPLRGKIAAA
FT                   LDELGYIPNRAPDILSNATSRAIGVLLPSLTNQVFAEVLRGIESVTDQHHYQTMLAHYG
FT                   YRKEKEEERLTSLLSYNIDGLILAERDHTPRTLKMIEVAGIPVVELMDSVSPCLDMAVG
FT                   FDNVEAARAMTQAIIARGHRRTVYFGARLDERTVMKQRGYEAAMRAADLTPRSVMIPRS
FT                   SSYSVGGELLREALKRYPDMDSIFCTNDDLAVGAAFECQRLGLRIPQDMAIAGFHGHDI
FT                   GQVMEPQLASVLTPRQRMGQLAAERLLARLRGERSVEAAAIDVGFTLLHGGSI"
FT   gene            138886..141192
FT                   /gene="zntA"
FT                   /locus_tag="ETAE_0137"
FT   CDS_pept        138886..141192
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="zntA"
FT                   /locus_tag="ETAE_0137"
FT                   /product="zinc/cadmium/mercury/lead-transporting ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ACY82984"
FT                   /db_xref="GOA:D0Z9B0"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR017969"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:D0Z9B0"
FT                   /protein_id="ACY82984.1"
FT                   /translation="MTHKHIHSGGPDAACGCGHQHAAMQHGCSRPAHGALKISMASPLT
FT                   PAADGACCMAIHDHDGVEEDADPHPLPPLASGRQRFSWRVEGMDCPSCARKIETAVAQI
FT                   SGVERAAVLFATQKLVVDAQQDLSPTIERAVRQAGFSLQAVGAKRAESAALRWHEVMPP
FT                   IALALLMLLSYGLTLMDPSLGRVAFIATTLVGLAPIMLKAMRLMRSGSYFAIETLMSIA
FT                   ALGALFIGATQEAAMVLLLFMLGERLESYAANRARKGVSALMALVPDDAVVIEQERRRT
FT                   LAVSALRPGMEIEVAPGGRLPADAELLQESVSFDESALTGESLPVDRQPGARVPAGALV
FT                   VDRVCRLRVISQPGQNAIDRILQLIEEAEERRAPIERFLDRFSRYYTPAIMALALLVIL
FT                   IPPLAFAQPWDTWIYRGLTLLLIGCPCALVISTPAAITSGLAAASRHGALIKGGAALEQ
FT                   LGRVRTIAFDKTGTLTQGTPQVSGVFGVEGVSAERLLTLAAAVEVGSHHPLAKAVILAC
FT                   EQRGLPVVQAQARQAQAGIGVAGEVDGVAVQVAAPSRLAPETLSEALLTQIAAWEALGQ
FT                   TVVAVLLDGVAIGAIAMSDTLRPDAAEALDALRALGIEAVMLTGDNPRAAAAIAGSLGI
FT                   DFRAGLLPQDKVHQVEALSRRADTAMVGDGINDAPAMKAASIGIAMGGGTDVALETADA
FT                   ALTHNRLIGLAQMIALSRATHANIRQNITLALGLKGVFLITSLLGITGLWLAVLADSGA
FT                   TALVTANALRLLRRR"
FT   gene            141249..142406
FT                   /locus_tag="ETAE_0138"
FT   CDS_pept        141249..142406
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAE_0138"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ACY82985"
FT                   /db_xref="UniProtKB/TrEMBL:D0Z9B1"
FT                   /protein_id="ACY82985.1"
FT                   /translation="MLHEVTLIYCYTPHPAFISTHFITLNNMNNRALLSCLSGVLMSGV
FT                   THAATQDNTTELSSTLPTYYGLPQSQAHAADSVPTAQTSAPEAQKGSILPIWGDEARAR
FT                   GYDLPEPFGINVNYMNMRQNIVVDSISFSGLGWDSYSLPTDLFNIKVGSTRQRSVTQTI
FT                   KLDAWVLPFMNVYGIVGKTRGSSLSKVSVDADPSQYPLGSMDWIIATVVKGMNKSGQLR
FT                   DLDFQLNFKGTTYGAGTVLAGGYGNWFGLVDMNYTQTRFDILDGSIDAFTLSPRVGYRF
FT                   TTPGIDAVGLPDGKLSLWVGSMYQDVQQEFKGSLSDLSMPGGLSALMEIANKQGQGRFD
FT                   VRQHLSSPWNVLIGAQYEITRNFNLTTEVGFAERNSFFIAGEYRF"
FT   gene            142406..143539
FT                   /locus_tag="ETAE_0139"
FT   CDS_pept        142406..143539
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAE_0139"
FT                   /product="putative outer membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ACY82986"
FT                   /db_xref="GOA:D0Z9B2"
FT                   /db_xref="InterPro:IPR000184"
FT                   /db_xref="InterPro:IPR039910"
FT                   /db_xref="UniProtKB/TrEMBL:D0Z9B2"
FT                   /protein_id="ACY82986.1"
FT                   /translation="MRRPLMTLALVCALSPLAGQAALLPTRAQIDEWLGHLGGDDRFDP
FT                   DKGIDWGILPGPFFNPELGLGIGAAVAGLYRPDPSDTTSQNSSITLSGYLSSTGAFGLG
FT                   VRSYSFFDNDRWRIFVTGGISDTPTYYWGQGFRAGADDDGRQKYTAQSLRLQPEVLYRV
FT                   ASQTYLGVGWSLSAMHAADVKQTDRLAQIHYGRSVFSSGPSLSLQYDSRDFVPNPRRGM
FT                   LASLRYTHYTPETGSDTRFDNLTTRFSTYHALDETRVLAWEIDGEFTQGAVPWNMLPSL
FT                   GGDQRMRGYYQGRYRDRNLISSQLEYRQKLSWRHGVVAWAGAGTMGPNVRELGSSRWLP
FT                   TVGVGYRFAFKPGINIRLDYGIGRGSSGFYFQVGEAF"
FT   gene            143539..144672
FT                   /locus_tag="ETAE_0140"
FT   CDS_pept        143539..144672
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAE_0140"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ACY82987"
FT                   /db_xref="InterPro:IPR025130"
FT                   /db_xref="UniProtKB/TrEMBL:D0Z9B3"
FT                   /protein_id="ACY82987.1"
FT                   /translation="MAVVRGCCVALLAWCGLAGAFGLPMSLDLAQLQPLQAAHAWPVSA
FT                   PLPPPDGLRPCCAFGYDLNAEALGVPIPFYRLNNVVEADALGGHRYNDSLFGALASLAG
FT                   LGSERNGLVYTRRGGFLDLAHVRDSADMTVYIFSHLYPRLGQPFHLALGDELAQRQLVF
FT                   SAFTPPSAARERYTLAAYLAARLAFEVAAWHEIAQWYGYESIPGFSEGVSAFSPEDLYS
FT                   NLLGTRLALTLILNGHAASLGQYSAALTTLLPQALCQLQAQPAVLTRFQFDMLDGKWWD
FT                   SRQAVPQKFLVLKRNYDTRDDRLPTPVSGELTPPLRLMLPGQVYRYDLATLAELRLLPG
FT                   TSMKRLPAPPHYYTWRDFAHLAAFAGTQDALQLSRKR"
FT   gene            144792..145691
FT                   /locus_tag="ETAE_0141"
FT   CDS_pept        144792..145691
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAE_0141"
FT                   /product="permeases of the drug/metabolite transporter
FT                   (DMT) superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ACY82988"
FT                   /db_xref="GOA:D0Z9B4"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="InterPro:IPR004779"
FT                   /db_xref="UniProtKB/TrEMBL:D0Z9B4"
FT                   /protein_id="ACY82988.1"
FT                   /translation="MFLLLATTLLWAFSFSLIGVYLAGQVDSWFAVLVRVALATLVFLP
FT                   FLRWRGVRPRQALAYMLVGAFQLGLMYLFYYPAFLYLTVPEVLLFTILTPLYVTLIYDL
FT                   LQGRRLRPGYLGSALLAVLGALIIRYNPLSSQFLLGFALIQGANLCFALGQVGYKRLME
FT                   VMPLPQYRAFSWFYLGALTVALPAWWLYGNPQMLPTTSLQWGILLWLGVGASGLGYFMW
FT                   NYGATQVDAGTLAIMNNALIPAGLLVNLAIWQQHPDWFRLTLGGTVIALSLWVHRRWIV
FT                   PHHGQTAGRRRRGGAPAE"
FT   gene            146656..148932
FT                   /gene="metE"
FT                   /locus_tag="ETAE_0142"
FT   CDS_pept        146656..148932
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metE"
FT                   /locus_tag="ETAE_0142"
FT                   /product="5-methyltetrahydropteroyltriglutamate--homocysteine
FT                   methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ACY82989"
FT                   /db_xref="GOA:D0Z9B5"
FT                   /db_xref="InterPro:IPR002629"
FT                   /db_xref="InterPro:IPR006276"
FT                   /db_xref="InterPro:IPR013215"
FT                   /db_xref="InterPro:IPR038071"
FT                   /db_xref="UniProtKB/TrEMBL:D0Z9B5"
FT                   /protein_id="ACY82989.1"
FT                   /translation="MQVISHTLGFPRIGLQRELKKALEAYWSGSAPQSALLACGAELRA
FT                   RHWRQQHQAGIDLLPVGDFAWYDHVLATSLMLGNVPARHRRADGVIDLDTLFGIARGRA
FT                   PGGKPAAAAEMTKWFNTNYHYIVPEFTRGQRFSFGWRQLLEEVDEALALGYRVKPVLLG
FT                   PLTYLWLGKVKGAPFDRLSLLEEVLAVYRQVLAALAERGVEWVQVDEPALVLTLPPAWR
FT                   DAYQHAYQALRGPVKLLLTTYFGDIGHHLPTICALPVQGLHVDLVQGAGDALALHRQLP
FT                   ADWVLSLGAIGGRNVWRADLADWQTRLQPLVGQRPVWLGSSCSLLHTPIDLSAETQLDE
FT                   EVKSWFAFALQKCSELALLTQALNDPASRREALLSYSAPLYLRRRSERVHNPAVTERLA
FT                   ALSDADTQRTSAYPQRARRQRQRFALPLWPTTTIGSFPQTPAIRTLRLDFRRGQLTPQH
FT                   YHRGIAEHIRQAIREQERLGLDVLVHGEAERNDMVEYFGEQLAGFVFTCNGWVQSYGSR
FT                   CVKPPVIVGDISRPAPLTVEWTTFAQAQTSRPVKGMLTGPITMLCWSFAREDVPREVIA
FT                   RQLALALRDEVDDLQRAGIGIIQIDEPALREGLPLRQDEWQAYLAWAVAAFRLTAAVAY
FT                   DDTQIHTHMCYCEFNDIMAAIAALDADVITIETARSDMELLEAFSRFDYPNEVGPGVYD
FT                   IHSPNVPTQAAMVSLLRRAAQHIPAERLWVNPDCGLKTRGWEETRRALSNMVAAARLLR
FT                   AQTQA"
FT   gene            complement(148979..149746)
FT                   /gene="udp"
FT                   /locus_tag="ETAE_0143"
FT   CDS_pept        complement(148979..149746)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="udp"
FT                   /locus_tag="ETAE_0143"
FT                   /product="uridine phosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ACY82990"
FT                   /db_xref="GOA:D0Z9B6"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR010058"
FT                   /db_xref="InterPro:IPR018016"
FT                   /db_xref="InterPro:IPR035994"
FT                   /db_xref="UniProtKB/TrEMBL:D0Z9B6"
FT                   /protein_id="ACY82990.1"
FT                   /translation="MSKPEVFHLGLAKSDLHGATLAIVPGDPERVEKIAKLMENPVKLA
FT                   SHREFTSWRAELDGKAVIVCSTGIGGPSTSIAVEELAQLGIRTFLRVGTTGAIQPHINV
FT                   GDVLVTTASVRLDGASLHFAPMEFPAVADFTCTTALVDAARAVGAATHVGITASSDTFY
FT                   PGQERYDTFSGRVTRRFRGSMKEWQEMGVMNFEMESATLLTMCSSQGLRAGMVAGVIVN
FT                   RTQQEIPNAETMKQTESHAVKIVVDAARRLLQD"
FT   gene            150114..151922
FT                   /gene="cstA1"
FT                   /locus_tag="ETAE_0144"
FT   CDS_pept        150114..151922
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cstA1"
FT                   /locus_tag="ETAE_0144"
FT                   /product="carbon starvation protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ACY82991"
FT                   /db_xref="GOA:D0Z9Q1"
FT                   /db_xref="InterPro:IPR003706"
FT                   /db_xref="InterPro:IPR025299"
FT                   /db_xref="UniProtKB/TrEMBL:D0Z9Q1"
FT                   /protein_id="ACY82991.1"
FT                   /translation="MQHAITFVLATLCILAICYRLYGLFFVRKVLRADDSEVTPSHTYE
FT                   DGKDYVPTKKWVNFGSHFAAIAAAGPLVGPVLAAQFGYLPGFLWLLIGCVIGGAVHDTV
FT                   VLFASMKHQGKSLSEVAKSELGPIAGWCTGLAMLFIITITMAGLSMVVVHALERNPWGT
FT                   FAVFMTIPIAICVGLWERITGSMKGATYAGIAAIILCVFAGPYIQHTTFGEWLTWKSST
FT                   VSLLLPAYAFFATALPVWMLLTPRGYLSSFMKIGVFGALVVGVVFINPEIQFPAITQFI
FT                   HGGGPVLSGPVWPFISITIACGAISGFHAFIGSGTTPKQIDKWSDILPVGFGAMLAECV
FT                   VGVMALIAATSLHPADYFAINSSAQAWAGLGMEVVHLPQLSQEIGLDLYGRTGGAVTLA
FT                   VGMTDIFIRVPWFSSLASYFFQFVIMFEAVFILTAVDSGTRVARYLLQDFLGDLWAPLK
FT                   RTDWLPGSIFCSVVACLLWGYLLNSGDINSVWALFGVSNQLMASVGLIIGATIILRLAT
FT                   KRIYMLTCIIPLVYLFITVNYAGYWMVKHVYFNPQAAGYNLFNGTISIIMLVLGMVILL
FT                   SALRKWRELWIKRGDELAAAQAEATA"
FT   gene            152041..152568
FT                   /locus_tag="ETAE_0145"
FT   CDS_pept        152041..152568
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAE_0145"
FT                   /product="uncharacterized membrane-associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ACY82992"
FT                   /db_xref="GOA:D0Z9Q2"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="InterPro:IPR032818"
FT                   /db_xref="UniProtKB/TrEMBL:D0Z9Q2"
FT                   /protein_id="ACY82992.1"
FT                   /translation="MLDSIIQGTIEFVRLHQGWAVPLVFFLAFGESLAFISLLLPATVI
FT                   LFALSALLGEGGVPFVPVWLAAAGGAFLGDWLSYWLGYHYQHQIGHMWPLSRSPQILQR
FT                   GHRYFARWGFWGVFFGRFLGPLRAAVPLVAGICAMRQRYFQLANLLSALIWGAGILAPG
FT                   MLGIRWLGQWIG"
FT   gene            152671..154080
FT                   /gene="rumC"
FT                   /locus_tag="ETAE_0146"
FT   CDS_pept        152671..154080
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rumC"
FT                   /locus_tag="ETAE_0146"
FT                   /product="putative DNA recombination protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ACY82993"
FT                   /db_xref="InterPro:IPR003798"
FT                   /db_xref="UniProtKB/TrEMBL:D0Z9Q3"
FT                   /protein_id="ACY82993.1"
FT                   /translation="MENVTLWILAASLAGMAIGWLAAALRAQQARVAHEQALGALDSQL
FT                   AAAQERIAQQRLWHEECERLNQELRAQRDVNSAQEAELREVTIRLEETRMGAEEKQRLL
FT                   LNAEQRLNVQFENLANRIFEHSGRRVEEQNRQSLDALLTPLREQLDGFRRQINDSFGQE
FT                   ARERHTLTHEIRSLQQMNAQMAREALNLTRALKGDNKMQGNWGEVVLSRVLESSGLREG
FT                   HEYRTQVSVQTEESGRMQPDVVVHLPQGKDVVVDAKMSLVAYERFFNAEDERERELALQ
FT                   QHILSLRAHIRQLGRKDYQRLPGLRTLDYVLMFIPLEPAFLAAIERDPELISEALRHNI
FT                   MLVSPTTLLVALRTINNLWRYEYQSQNAQKIADRAAKLYDKVRLFVDDMSTLGQSLERA
FT                   QSSYRQAMNKLSHGRGNLIGQVESFRGLGVEVKRPISPALVQEACQLPQDGDPAAVSGE
FT                   VVAHHGTPSVQ"
FT   gene            154203..154958
FT                   /gene="ubiE"
FT                   /locus_tag="ETAE_0147"
FT   CDS_pept        154203..154958
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ubiE"
FT                   /locus_tag="ETAE_0147"
FT                   /product="ubiquinone/menaquinone biosynthesis
FT                   methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ACY82994"
FT                   /db_xref="GOA:D0Z9Q4"
FT                   /db_xref="InterPro:IPR004033"
FT                   /db_xref="InterPro:IPR023576"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D0Z9Q4"
FT                   /protein_id="ACY82994.1"
FT                   /translation="MVDQTPETTHFGYKTVAAADKAGKVAQVFHSVAGKYDLMNDLMSF
FT                   GIHRLWKRFTIDCSGVRQGQRVLDLAGGTGDLAAKFSRMVGEQGEVVLADINDSMLKIG
FT                   REKLRNMGIAGNLNYVQANAEALPFPENYFDCITIAFGLRNVTDKDKALRSMFRVLKPG
FT                   GRLLVLEFSKPQFAALSKAYDAYSFHILPRIGEMVAHDGDSYRYLAESIRMHPDQETLK
FT                   GMMASAGFENTTYDNLTGGIVALHRGYKF"
FT   gene            154974..155579
FT                   /locus_tag="ETAE_0148"
FT   CDS_pept        154974..155579
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAE_0148"
FT                   /product="hypothetical protein conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ACY82995"
FT                   /db_xref="GOA:D0Z9Q5"
FT                   /db_xref="InterPro:IPR003033"
FT                   /db_xref="InterPro:IPR036527"
FT                   /db_xref="InterPro:IPR038989"
FT                   /db_xref="UniProtKB/TrEMBL:D0Z9Q5"
FT                   /protein_id="ACY82995.1"
FT                   /translation="MLTPLCTALLETALNAALYRDRALQSARQRLAGRVLQISLAELED
FT                   PFFLIFSQRQVDVLAQWEGAVDCQVTTRLSVLPQLRARRQLAALMQCGDLRVDGDIQVV
FT                   QQLVALLDLAEWAPAELLAPYTGDIVAQGLCSVAQRSGHALLGSLRRQRHYARDALIEE
FT                   WRLAPGTLEFTWFQEEAAALQRQASALEQRLARLEKCV"
FT   gene            155576..157207
FT                   /gene="ubiB"
FT                   /locus_tag="ETAE_0149"
FT   CDS_pept        155576..157207
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ubiB"
FT                   /locus_tag="ETAE_0149"
FT                   /product="putative ubiquinone biosynthesis protein UbiB"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ACY82996"
FT                   /db_xref="GOA:D0Z9Q6"
FT                   /db_xref="InterPro:IPR004147"
FT                   /db_xref="InterPro:IPR010232"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:D0Z9Q6"
FT                   /protein_id="ACY82996.1"
FT                   /translation="MTPSELRRLCLIIRVFLAYGLDELIPPMRITLPLRIGRRCLFWMR
FT                   NRHGDKPLGERLRLALQTLGPVWIKFGQMLSTRRDLFAPAIADQLALLQDRVAPFDGAL
FT                   ARRQIEAALGGPLEQWFDDFDSQALASASIAQVHTATLRENGREVVLKVIRPDIQPIIR
FT                   ADVRLMYRLAGWVPKLLPDGRRLRPREVVREYEKTLLDELNLLREAANAIQLRRNFDAS
FT                   PMLYVPEVFSDYCRESVLVMERIYGVPVSDIAALRAQNTNMKLLAERGVQVFFTQVFRD
FT                   SFFHADMHPGNIFVSYEHPQDPQYIGIDCGIVGSLNKADKRYLAENFIAFFNRDYRKVA
FT                   ELHVDSGWVPPDTNVEEFEFAIRTVCEPIFEKPLDQISFGHVLLNLFNTARRFNMEVQP
FT                   QLVLLQKTLLYVEGLGRQLYPQLDLWTTAKPFLENWLHDQVGLPALMRALKAKAPYWSE
FT                   KLPELPELLYDSLQQQRRLQHSMDSMTHRLGQQGNRQGRARYLFGIGATLLLSGTILTM
FT                   ANIALWPIGLYVAGVVIWLAGWRYTR"
FT   gene            157320..157589
FT                   /gene="tatA"
FT                   /locus_tag="ETAE_0150"
FT   CDS_pept        157320..157589
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tatA"
FT                   /locus_tag="ETAE_0150"
FT                   /product="Sec-independent protein translocase"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ACY82997"
FT                   /db_xref="GOA:D0Z9Q7"
FT                   /db_xref="InterPro:IPR003369"
FT                   /db_xref="InterPro:IPR006312"
FT                   /db_xref="UniProtKB/TrEMBL:D0Z9Q7"
FT                   /protein_id="ACY82997.1"
FT                   /translation="MGGISIWQLLIIAVIVVLLFGTNKLRTLGSDLGASIKGFKKAIGD
FT                   EEKTPPSTNANSSAAPQDADFKSIVEQQPEVKKEESKSQNKEQV"
FT   gene            157593..158117
FT                   /gene="tatB"
FT                   /locus_tag="ETAE_0151"
FT   CDS_pept        157593..158117
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tatB"
FT                   /locus_tag="ETAE_0151"
FT                   /product="Sec-independent protein secretion pathway
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ACY82998"
FT                   /db_xref="GOA:D0Z9Q8"
FT                   /db_xref="InterPro:IPR018448"
FT                   /db_xref="UniProtKB/TrEMBL:D0Z9Q8"
FT                   /protein_id="ACY82998.1"
FT                   /translation="MFDIGFSELLLVMVIGLVVLGPERLPVAVRTVAGWIRALRSLATS
FT                   VQNELSQELKLQELQDSLKKAESAGLQNLTPELKASMDELKQAAESMKRSYHSEITGSD
FT                   TEKEPSAAETIPHADMPKPEADAALAPRQSAVQEAPAAQAAPATHADAVTASAQPASSP
FT                   STSHDSSQHGR"
FT   gene            158107..158895
FT                   /gene="tatC"
FT                   /locus_tag="ETAE_0152"
FT   CDS_pept        158107..158895
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tatC"
FT                   /locus_tag="ETAE_0152"
FT                   /product="twin arginine-targeting protein translocase TatC"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ACY82999"
FT                   /db_xref="GOA:D0Z9Q9"
FT                   /db_xref="InterPro:IPR002033"
FT                   /db_xref="InterPro:IPR019820"
FT                   /db_xref="UniProtKB/TrEMBL:D0Z9Q9"
FT                   /protein_id="ACY82999.1"
FT                   /translation="MAVEDTQPLISHLIELRKRLLNAIICILVVFLALVYFANDIYHLV
FT                   SAPLINQLPHGASMIATDVASPFFTPIKLTMIVSVFVSAPFILYQVWAFVAPALYKHER
FT                   RMLTPLLVSSTLLFYIGMAFAYFVVFPLAFGFFAKTAPAGVTIATDINNYLDFVMALFM
FT                   AFGVSFEVPVAIILLCWTGVTTPAELKKKRPYVVVGAFVVGMLLTPPDVFSQTLLAIPM
FT                   CLLFEVGVFFARFYVGKRRRDPEEEDEDEASHDEEQPKAS"
FT   gene            159069..159851
FT                   /gene="tatD"
FT                   /locus_tag="ETAE_0153"
FT   CDS_pept        159069..159851
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tatD"
FT                   /locus_tag="ETAE_0153"
FT                   /product="deoxyribonuclease TatD"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83000"
FT                   /db_xref="GOA:D0Z9R0"
FT                   /db_xref="InterPro:IPR001130"
FT                   /db_xref="InterPro:IPR018228"
FT                   /db_xref="InterPro:IPR024918"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/Swiss-Prot:D0Z9R0"
FT                   /protein_id="ACY83000.1"
FT                   /translation="MLDIGVNLTNGQFSGDVPQVVARARQAGLNGMIITGTNLTESAQA
FT                   LHLAQAYPDFCWATAGVHPHDAHRWNENSAADLEPLLRSPAVVAVGECGLDFARNFSTP
FT                   AQQEAAFEAQLALAAQIGKPVFLHCREAHARFIALLRPWLSRLPGAVLHCFTGTRDELD
FT                   ACLSLGLYIGITGWICDERRGMPLRALLPHIPAERLLLETDAPYLLPRDIQPKPKSRRN
FT                   EPCFLPHIAEQAARWRQQDANWLKQVTENNARQLFRLA"
FT   gene            159867..160889
FT                   /gene="hemB"
FT                   /locus_tag="ETAE_0154"
FT   CDS_pept        159867..160889
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemB"
FT                   /locus_tag="ETAE_0154"
FT                   /product="delta-aminolevulinic acid dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83001"
FT                   /db_xref="GOA:D0Z9R1"
FT                   /db_xref="InterPro:IPR001731"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR030656"
FT                   /db_xref="UniProtKB/TrEMBL:D0Z9R1"
FT                   /protein_id="ACY83001.1"
FT                   /translation="MSYAFPGAFPGRRLRRLRRHDFSRRLCAENVLTVDDLIYPVFVME
FT                   GNNHQEAVSSMPGVQRMTIDVLVREAEAVAKLGVPVLSLFPVVGTDKKSLYAEEAYSSD
FT                   GLVQRAVRALKDAVPELGILTDVALDPYTTHGQDGVIDEDGYVVNDITKEILVRQALSH
FT                   AEAGADIVAPSDMMDGRIGAIRSMLESQKLVNTQIMAYSAKYASCYYGPFRDALGSSGN
FT                   LKGGNKKTYQMDPANGDEALQEVAQDLQEGADMVMVKPGMPYLDVLRRVKDTFGVPTFA
FT                   YQVSGEYAMHMAAIQNGWLQEKPAIMESLICFKRAGADGVLTYFAKRVAQWLHDAEMTR
FT                   "
FT   gene            complement(160961..161452)
FT                   /gene="rfaH"
FT                   /locus_tag="ETAE_0155"
FT   CDS_pept        complement(160961..161452)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rfaH"
FT                   /locus_tag="ETAE_0155"
FT                   /product="transcriptional activator RfaH"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83002"
FT                   /db_xref="GOA:D0Z9R2"
FT                   /db_xref="InterPro:IPR006645"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR010215"
FT                   /db_xref="InterPro:IPR036735"
FT                   /db_xref="UniProtKB/TrEMBL:D0Z9R2"
FT                   /protein_id="ACY83002.1"
FT                   /translation="MESWYLLYCKRGQLTRAREHLTRQEIPCVTPMITLEKVVRGKRTQ
FT                   VQEPMFPNYMFIELDPERIHTTTVQSTRGVSHFVRFGKLPATVPFSIVKQLMMAPTPTA
FT                   IAPQTPIPGDRVRITQGAFSGMEAIYRESDGEKRAILLLNLLNQEVSHTLSNSAFEKIL
FT                   "
FT   gene            161703..162428
FT                   /gene="pepE"
FT                   /locus_tag="ETAE_0156"
FT   CDS_pept        161703..162428
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pepE"
FT                   /locus_tag="ETAE_0156"
FT                   /product="peptidase E"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83003"
FT                   /db_xref="GOA:D0Z9R3"
FT                   /db_xref="InterPro:IPR005320"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:D0Z9R3"
FT                   /protein_id="ACY83003.1"
FT                   /translation="MELFLLSNGKVSGESELLGYAKGMIQSMLLEKKIRRALLIPYALI
FT                   RSSYDARAAELEHSLGITVESIHHHADPVKALEEAECILISGGNTWVLNQMLHEHGLIV
FT                   PIQRAVRERGIPYIGWSAGCNVATPSIRTTNDMPVRNSVVLPSLGLFPVQINPHYIDAH
FT                   LSGHMGETRDERIAEFCAVNPSESVIALREGSLLHVSGETLQYYSAKAQGYKVFRHGEE
FT                   THEYHDTQALAALVPFHCR"
FT   gene            162547..164034
FT                   /gene="ubiD"
FT                   /locus_tag="ETAE_0157"
FT   CDS_pept        162547..164034
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ubiD"
FT                   /locus_tag="ETAE_0157"
FT                   /product="3-octaprenyl-4-hydroxybenzoate decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83004"
FT                   /db_xref="GOA:D0Z9R4"
FT                   /db_xref="InterPro:IPR002830"
FT                   /db_xref="InterPro:IPR023677"
FT                   /db_xref="UniProtKB/TrEMBL:D0Z9R4"
FT                   /protein_id="ACY83004.1"
FT                   /translation="MKYRDLREFIALLEQRGELKRIQQSIDPYLEMTEIADRTLRAGGP
FT                   ALLFENPKGYDIPVLCNLFGTPQRVALGMGQEEVGALRDVGKLLAFLKEPDPPKGFRDL
FT                   VEKLPQFKQILNMPTKRLSKAPCQARVFQGDDVDLATLPVMHCWPQDVAPLVSWGLTVT
FT                   RGPCKSRQNLGIYRQQVLGKNKLIMRWLSHRGGALDFQEWCQAHPGERFPVAVALGADP
FT                   ATLLAAVTPVPDSLSEYAFAGLLRGHKSEVVKCLSCDLEVPASAEIVLEGYIEPGETAP
FT                   EGPYGDHTGYYNEVERFPVFTVTHLTQRDRPIYHSTYTGRPPDEPAVLGLALNEVFVPL
FT                   LQKQFPEIVDFYLPPEGCSYRMAVVTMKKQYPGHAKRVMMGVWSFLRQFMYTKFVIVCD
FT                   DDINARDWQDVIWALTTRMDPARDTLLIENTPIDYLDFASPVSGLGSKMGLDATNKWPG
FT                   ETQREWGHPIVMDEAVRVRVDTLWNELDIFANDKDAQ"
FT   gene            164124..164774
FT                   /gene="fre"
FT                   /locus_tag="ETAE_0158"
FT   CDS_pept        164124..164774
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fre"
FT                   /locus_tag="ETAE_0158"
FT                   /product="FMN reductase"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83005"
FT                   /db_xref="GOA:D0Z9R5"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:D0Z9R5"
FT                   /protein_id="ACY83005.1"
FT                   /translation="MYRVRLVPGRAVDFRAGQYLMVVMDERDKRPFSMASTPLQSDCIE
FT                   LHIGASELNLYAMAVMDRILQDRTLCVDMPHGDAWLREDSLRPLVLIAGGTGFSYTRSI
FT                   LLMALSQQPQREISLYWGGRELKHLYDLNELYALSARYPQLKVIPTVEQPDADWQGRSG
FT                   TVISAVMQDFGSLAQHDIYIAGRFEMAKIARERFCAEREANPDHIYGDAFAFI"
FT   gene            164917..166248
FT                   /gene="pepQ"
FT                   /locus_tag="ETAE_0159"
FT   CDS_pept        164917..166248
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pepQ"
FT                   /locus_tag="ETAE_0159"
FT                   /product="proline dipeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83006"
FT                   /db_xref="GOA:D0Z9R6"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001131"
FT                   /db_xref="InterPro:IPR022846"
FT                   /db_xref="InterPro:IPR029149"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:D0Z9R6"
FT                   /protein_id="ACY83006.1"
FT                   /translation="MDTLASLYTKHLATLQQRARTILERHQLDALLIHSGEPIARFLDD
FT                   QDYPFKINPHFKAWVPVTQVPNCWLWIDGVNKPKLWFYAPQDYWHSVSPLPQAFWTEQV
FT                   EMTALRHADDIAALLPAARGNVAYIGPNADRARSLGIDEAHQNPQAVLNFLHYHRAYKS
FT                   EYEQACMREAQKIAVDGHQAALEAFRAGMSEFDINLAYLSATGQGENDVPYDNIIALNR
FT                   HAAVLHYTHLERRAPSEMHSFLIDAGAEFHGYAADLTRTYAANGQSDFAALVAEVNQAQ
FT                   QALIATLQTGVRYTDYNLQFHQRLAAILRHHHILTGISDEAAVAQGLTTPFLPHGLGHP
FT                   LGLQVHDVAGFMQDELGTQMAAPDRYPYLRCTRIMEPGMVMTIEPGLYFIDTLLAPWLE
FT                   GEFGQHFNRSRIDALRPYGGIRIEDNVIFHAHGVENMTRDLHLA"
FT   gene            166266..166862
FT                   /locus_tag="ETAE_0160"
FT   CDS_pept        166266..166862
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAE_0160"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83007"
FT                   /db_xref="InterPro:IPR001498"
FT                   /db_xref="InterPro:IPR015269"
FT                   /db_xref="InterPro:IPR015796"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020569"
FT                   /db_xref="InterPro:IPR023582"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR036956"
FT                   /db_xref="UniProtKB/TrEMBL:D0Z9R7"
FT                   /protein_id="ACY83007.1"
FT                   /translation="MPAQPVSVCEEIKKSRFITLLAHTPGVDAAKAFVQETRRAHPDAR
FT                   HHCWAFVAGAPGDTQRLGFSDDGEPSGTAGKPMLAQLMGSGVGEVCAVVVRYYGGIKLG
FT                   TGGLVRAYGSGVQQALQALVRRQKVPMAAYTLCCDYAQLTLVEGIVAQAGGSVLDSAFS
FT                   AQVMLRLSLPLGSQDEVDEKLRNASRGALQLQATS"
FT   gene            166915..168366
FT                   /gene="trkH1"
FT                   /locus_tag="ETAE_0161"
FT   CDS_pept        166915..168366
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trkH1"
FT                   /locus_tag="ETAE_0161"
FT                   /product="Trk-type K+ transport system, membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83008"
FT                   /db_xref="GOA:D0Z9R8"
FT                   /db_xref="InterPro:IPR003445"
FT                   /db_xref="InterPro:IPR004772"
FT                   /db_xref="UniProtKB/TrEMBL:D0Z9R8"
FT                   /protein_id="ACY83008.1"
FT                   /translation="MHFRAIIRIVGLLVILFSGTMFVPGLVALIYRDGAGRAFVETFFV
FT                   ALGIGMLLWWPQRKQKHELKPREGFLIVVLFWTVLGSVGALPFLFSERPNLSVTDAFFE
FT                   SFSGLTTTGATTLVGLDALPKAILFYRQMLQWLGGMGIIVLAVAILPILGVGGLQLYRA
FT                   EMPGPLKDNKMRPRIAETAKTLWLIYVMLTIACAIALWGAGMDVFDAISHSFSTIAIGG
FT                   FSTHDASIGYFNSPTINTIIAVFLLISGCNFSLHFAFLSGRSPRVYWRDPEFRMFIAVQ
FT                   LTLVSVCTLVLWLHNVYASGWQTLNQAFFQVVSMATTAGFTTDSIAKWPLFLPVLLLCS
FT                   AFIGGCAGSTGGGLKVIRILLLFLQGSRELKRLVHPNAVYTIKLGNRALPERILEAVWG
FT                   FFSAYALVFIISMLAIIATGVDDFSAFAAVVATLNNLGPGLGVVADNFTSMNDVAKWIL
FT                   VVTMLFGRLEVFTLLVLFTPTFWRN"
FT   gene            168384..168932
FT                   /gene="hemG"
FT                   /locus_tag="ETAE_0162"
FT   CDS_pept        168384..168932
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemG"
FT                   /locus_tag="ETAE_0162"
FT                   /product="protoporphyrinogen oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83009"
FT                   /db_xref="GOA:D0Z9R9"
FT                   /db_xref="InterPro:IPR001226"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR026816"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:D0Z9R9"
FT                   /protein_id="ACY83009.1"
FT                   /translation="MKTLVLYSSHDGQTKAIATAIATAMSETLDCELRDLEQAGDIDLN
FT                   AYQAVAIGAAVRYGHFPRALYRFASDHTSQLNTMPSAFFAINLTARKPEKRTPQTNGYT
FT                   RKFLLSTPWKPAQCVVFAGALRYPRYGWLDRTMIKMIMKMTGGETDTTKEVEYTDWQQV
FT                   DRFARDFARFVSTLAKETA"
FT   gene            169318..170854
FT                   /locus_tag="ETAE_r001"
FT   rRNA            169318..170854
FT                   /locus_tag="ETAE_r001"
FT                   /product="16S ribosomal RNA"
FT   gene            170934..171009
FT                   /locus_tag="ETAE_t005"
FT   tRNA            170934..171009
FT                   /locus_tag="ETAE_t005"
FT                   /product="tRNA-Glu"
FT   gene            171209..174118
FT                   /locus_tag="ETAE_r002"
FT   rRNA            171209..174118
FT                   /locus_tag="ETAE_r002"
FT                   /product="23S ribosomal RNA"
FT   gene            174195..174316
FT                   /locus_tag="ETAE_r003"
FT   rRNA            174195..174316
FT                   /locus_tag="ETAE_r003"
FT                   /product="5S ribosomal RNA"
FT   gene            complement(174809..174946)
FT                   /locus_tag="ETAE_0163"
FT   CDS_pept        complement(174809..174946)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAE_0163"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83010"
FT                   /db_xref="UniProtKB/TrEMBL:D0Z9S0"
FT                   /protein_id="ACY83010.1"
FT                   /translation="MLIWRAGLCVMLWKHDRVMAVCCFIQIKVFNIKAINTEGYSGVMG
FT                   "
FT   gene            complement(175418..175735)
FT                   /locus_tag="ETAE_0164"
FT   CDS_pept        complement(175418..175735)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAE_0164"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83011"
FT                   /db_xref="GOA:D0Z9S1"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:D0Z9S1"
FT                   /protein_id="ACY83011.1"
FT                   /translation="MLKTRRTKRTFSPEFQLEAIEQVVKYQRDVREVALALELNPDHLR
FT                   KWIRLYKQELQGIEPTGNAITPEQREIQQLKAQIKRLEMEKEILKQAAVLMSEIPGKLS
FT                   R"
FT   gene            175993..177030
FT                   /gene="murB"
FT                   /locus_tag="ETAE_0165"
FT   CDS_pept        175993..177030
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murB"
FT                   /locus_tag="ETAE_0165"
FT                   /product="UDP-N-acetylenolpyruvoylglucosamine reductase"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83012"
FT                   /db_xref="GOA:D0Z9S2"
FT                   /db_xref="InterPro:IPR003170"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR011601"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="InterPro:IPR036635"
FT                   /db_xref="UniProtKB/TrEMBL:D0Z9S2"
FT                   /protein_id="ACY83012.1"
FT                   /translation="MSKHLTSLTEFTTFGLPARAEQILTADSSAALLSHWQAATARRQP
FT                   VLILGGGSNVLFMEDFAGSVILNRIPGIQVDEDEESWHLHVGAGENWHDLVRYTLDHGM
FT                   AGLENLALIPGCVGSAPIQNIGAYGVELQHVCDYVDAMDLRNGTLQRLPAAACGFGYRE
FT                   SIFKHRYRDGYAIVAVGLRLSKRWQPMLSYGDLTRLDAMTATPRAVFDAVCHMRRTKLP
FT                   DPAQQGNAGSFFKNPVVSAEAAEAIRARYPQAPCYPQENGEVKLAAGWLIDRCELKGYQ
FT                   IGGAAVHRQQALVLINQHQASAQDVIALARYVRRRVGEAFSVWLEPEVRFIAAQGEVNA
FT                   VEVLS"
FT   gene            177027..177986
FT                   /gene="birA"
FT                   /locus_tag="ETAE_0166"
FT   CDS_pept        177027..177986
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="birA"
FT                   /locus_tag="ETAE_0166"
FT                   /product="biotin--protein ligase"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83013"
FT                   /db_xref="GOA:D0Z9S3"
FT                   /db_xref="InterPro:IPR003142"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="InterPro:IPR004408"
FT                   /db_xref="InterPro:IPR004409"
FT                   /db_xref="InterPro:IPR008988"
FT                   /db_xref="InterPro:IPR013196"
FT                   /db_xref="InterPro:IPR030855"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D0Z9S3"
FT                   /protein_id="ACY83013.1"
FT                   /translation="MKDITVPLKLISQLADGDFHSGEHLGESLGMSRAGINKHIQTLRD
FT                   WGIDVFTVPGKGYCLPTPMQLLNADTIGTLLPQGRVTVLPVVDSTNQYLLERIGELASG
FT                   DACVAEYQQAGRGRRGRHWFSPFGANLYLSMYWKLEQGPAAAMGLSLVIGIVMAEVLQA
FT                   LGAAGVKVKWPNDLYLNDRKLAGILVELTGKTGDAANIVVGAGINLMMRNPDTSVVDQQ
FT                   WINLQEAGVNIDRNQLVACLLSRLRSTLADFEVRGLSPFIARWRALDNFIDRPVRLIIG
FT                   EQVIHGIARGIDAQGALLLERDGVITPFIGGEISLRAG"
FT   gene            complement(178062..179009)
FT                   /gene="coaA"
FT                   /locus_tag="ETAE_0167"
FT   CDS_pept        complement(178062..179009)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="coaA"
FT                   /locus_tag="ETAE_0167"
FT                   /product="panthothenate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83014"
FT                   /db_xref="GOA:D0Z9S4"
FT                   /db_xref="InterPro:IPR004566"
FT                   /db_xref="InterPro:IPR006083"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D0Z9S4"
FT                   /protein_id="ACY83014.1"
FT                   /translation="MKKEQSLATPYLQFDRHQWAALRNSVPLTLTEEEIARLKGINEDL
FT                   SLDEVAQIYLPLSRLLNFYFSSSVSRQAVLEKFLGTHSPRIPYIIGIAGSVAVGKSTTA
FT                   RVLQALLSQWPEHRRVELITTDGFLHPNKVLQERGLMKKKGFPQSYDMHRLVKFVSDIK
FT                   SGVPRVTAPQYSHLIYDVIPDSRKVIEQPDILILEGLNVLQSGMDYPHDPHRVFVSDFV
FT                   DFSIYVDADEHQLQAWYINRFLKFREGAFSNPDSYFHHYSQLPESEAIAIATGLWNEIN
FT                   GLNLRQNILPTRERASLIMTKGSNHAIESVRLRK"
FT   gene            179440..179515
FT                   /locus_tag="ETAE_t006"
FT   tRNA            179440..179515
FT                   /locus_tag="ETAE_t006"
FT                   /product="tRNA-Thr"
FT   gene            179537..179621
FT                   /locus_tag="ETAE_t007"
FT   tRNA            179537..179621
FT                   /locus_tag="ETAE_t007"
FT                   /product="tRNA-Tyr"
FT   gene            179746..179820
FT                   /locus_tag="ETAE_t008"
FT   tRNA            179746..179820
FT                   /locus_tag="ETAE_t008"
FT                   /product="tRNA-Gly"
FT   gene            179828..179903
FT                   /locus_tag="ETAE_t009"
FT   tRNA            179828..179903
FT                   /locus_tag="ETAE_t009"
FT                   /product="tRNA-Thr"
FT   gene            180031..181215
FT                   /gene="tuf1"
FT                   /locus_tag="ETAE_0168"
FT   CDS_pept        180031..181215
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tuf1"
FT                   /locus_tag="ETAE_0168"
FT                   /product="elongation factor Tu"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83015"
FT                   /db_xref="GOA:D0Z9S5"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004160"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004541"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR033720"
FT                   /db_xref="InterPro:IPR041709"
FT                   /db_xref="UniProtKB/TrEMBL:D0Z9S5"
FT                   /protein_id="ACY83015.1"
FT                   /translation="MSKEKFERSKPHVNVGTIGHVDHGKTTLTAAITTVLAKTYGGSAR
FT                   AFDQIDNAPEEKARGITINTSHVEYDTPTRHYAHVDCPGHADYVKNMITGAAQMDGAIL
FT                   VVAATDGPMPQTREHILLGRQVGVPYIIVFLNKCDMVDDEELLELVEMEVRELLSQYDF
FT                   PGDDTPVIRGSALKALEGEAEWEAKIIELAETLDSYIPEPERDIDKPFLLPIEDVFSIS
FT                   GRGTVVTGRVERGIIKVGDEVEIVGIKATTKTTCTGVEMFRKLLDEGRAGENVGVLLRG
FT                   TKRDEIERGQVLAKPGSITPHTKFESEVYILSKDEGGRHTPFFKGYRPQFYFRTTDVTG
FT                   TIELPEGVEMVMPGDNIKMVVTLIHPIAMDDGLRFAIREGGRTVGAGVVAKVIE"
FT   gene            complement(181263..181421)
FT                   /locus_tag="ETAE_0169"
FT   CDS_pept        complement(181263..181421)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAE_0169"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83016"
FT                   /db_xref="UniProtKB/TrEMBL:D0Z9S6"
FT                   /protein_id="ACY83016.1"
FT                   /translation="MWISHLYLQKAMLLACLRGNPQFGTIRRIARAYLTSNYVEKTTDE
FT                   IGSCQTA"
FT   gene            181558..181893
FT                   /gene="secE"
FT                   /locus_tag="ETAE_0170"
FT   CDS_pept        181558..181893
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secE"
FT                   /locus_tag="ETAE_0170"
FT                   /product="preprotein translocase subunit SecE"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83017"
FT                   /db_xref="GOA:D0Z9S7"
FT                   /db_xref="InterPro:IPR001901"
FT                   /db_xref="InterPro:IPR005807"
FT                   /db_xref="InterPro:IPR038379"
FT                   /db_xref="UniProtKB/TrEMBL:D0Z9S7"
FT                   /protein_id="ACY83017.1"
FT                   /translation="MKWLVVAVLLIVAIVGNYIYRDVSLPLRALAVVVIIAAAGGIALM
FT                   TAQGKATVAFAREARTEMRKVIWPTRQEALHTTLIVAAVTAVMALILWGLDGILVRLVS
FT                   FITGLRF"
FT   gene            181895..182440
FT                   /gene="nusG"
FT                   /locus_tag="ETAE_0171"
FT   CDS_pept        181895..182440
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nusG"
FT                   /locus_tag="ETAE_0171"
FT                   /product="transcription antiterminator"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83018"
FT                   /db_xref="GOA:D0Z9S8"
FT                   /db_xref="InterPro:IPR001062"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR006645"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR015869"
FT                   /db_xref="InterPro:IPR036735"
FT                   /db_xref="UniProtKB/TrEMBL:D0Z9S8"
FT                   /protein_id="ACY83018.1"
FT                   /translation="MSEAPKKRWYVVQAFSGFEGRVAQSLREHIKLHNMEELFGEVMVP
FT                   TEEVVEIRGGQRRKSERKFFPGYVLVQMVMNDASWHLVRSVPRVMGFIGGTSDRPAPIS
FT                   DKEVDAIMNRLQQVGDKPRPKTLFEPGEMVRVNEGPFADFNGVVEEVDYEKSRLKVSVS
FT                   IFGRATPVELDFSQVEKA"
FT   gene            182601..183029
FT                   /gene="rplK"
FT                   /locus_tag="ETAE_0172"
FT   CDS_pept        182601..183029
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplK"
FT                   /locus_tag="ETAE_0172"
FT                   /product="50S ribosomal protein L11"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83019"
FT                   /db_xref="GOA:D0Z9S9"
FT                   /db_xref="InterPro:IPR000911"
FT                   /db_xref="InterPro:IPR006519"
FT                   /db_xref="InterPro:IPR020783"
FT                   /db_xref="InterPro:IPR020784"
FT                   /db_xref="InterPro:IPR020785"
FT                   /db_xref="InterPro:IPR036769"
FT                   /db_xref="InterPro:IPR036796"
FT                   /db_xref="UniProtKB/TrEMBL:D0Z9S9"
FT                   /protein_id="ACY83019.1"
FT                   /translation="MAKKVQAYVKLQVAAGMANPSPPVGPALGQQGVNIMEFCKAFNAK
FT                   TDSIEKGLPIPVVITVYSDRSFTFVTKTPPAAVLLKKAAGVKSGSGKPNKDKVGKVTRA
FT                   QVREIAETKAADMTGSDVEAMARSIEGTARSMGLVVED"
FT   gene            183033..183737
FT                   /gene="rplA"
FT                   /locus_tag="ETAE_0173"
FT   CDS_pept        183033..183737
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplA"
FT                   /locus_tag="ETAE_0173"
FT                   /product="50S ribosomal protein L1"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83020"
FT                   /db_xref="GOA:D0Z9T0"
FT                   /db_xref="InterPro:IPR002143"
FT                   /db_xref="InterPro:IPR005878"
FT                   /db_xref="InterPro:IPR016095"
FT                   /db_xref="InterPro:IPR023673"
FT                   /db_xref="InterPro:IPR023674"
FT                   /db_xref="InterPro:IPR028364"
FT                   /db_xref="UniProtKB/TrEMBL:D0Z9T0"
FT                   /protein_id="ACY83020.1"
FT                   /translation="MAKLTKRMRVIREKVDATKQYDINEAVALLQELATAKFVESVDVA
FT                   VNLGIDARKSDQNVRGATVLPHGTGRTVRVAVFTQGPNAEAAKAAGADLVGMEDLADQI
FT                   KKGEMNFDVVIASPDAMRVVGQLGQILGPRGLMPNPKVGTVTPNVAEAVKNAKAGQVRY
FT                   RNDKNGIIHSTIGKASFSAEQLKENLEALMVALKKAKPATAKGVYIKKVCLSTTMGAGV
FT                   TIDQATLSAVAN"
FT   gene            184054..184551
FT                   /gene="rplJ"
FT                   /locus_tag="ETAE_0174"
FT   CDS_pept        184054..184551
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplJ"
FT                   /locus_tag="ETAE_0174"
FT                   /product="50S ribosomal protein L10"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83021"
FT                   /db_xref="GOA:D0Z9T1"
FT                   /db_xref="InterPro:IPR001790"
FT                   /db_xref="InterPro:IPR002363"
FT                   /db_xref="InterPro:IPR022973"
FT                   /db_xref="UniProtKB/TrEMBL:D0Z9T1"
FT                   /protein_id="ACY83021.1"
FT                   /translation="MALNLQDKQAIVAEVTEVAKGALSAVVADSRGVTVDKMTELRKAG
FT                   REAGVYMRVVRNTLMRRVVEGSQFECLKDTFVGPTLIAFSMEHPGAAARLFKAFAKDNA
FT                   KFEVKAAAFEGELIPAAQIDRLATLPTYEEAIARLMATMKEAAAGKLVRTLAALRDQKE
FT                   AA"
FT   gene            185318..189346
FT                   /gene="rpoB"
FT                   /locus_tag="ETAE_0175"
FT   CDS_pept        185318..189346
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoB"
FT                   /locus_tag="ETAE_0175"
FT                   /product="DNA-directed RNA polymerase, beta subunit/140 kD
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83022"
FT                   /db_xref="GOA:D0Z9T2"
FT                   /db_xref="InterPro:IPR007120"
FT                   /db_xref="InterPro:IPR007121"
FT                   /db_xref="InterPro:IPR007641"
FT                   /db_xref="InterPro:IPR007642"
FT                   /db_xref="InterPro:IPR007644"
FT                   /db_xref="InterPro:IPR007645"
FT                   /db_xref="InterPro:IPR010243"
FT                   /db_xref="InterPro:IPR014724"
FT                   /db_xref="InterPro:IPR015712"
FT                   /db_xref="InterPro:IPR019462"
FT                   /db_xref="InterPro:IPR037033"
FT                   /db_xref="InterPro:IPR037034"
FT                   /db_xref="UniProtKB/TrEMBL:D0Z9T2"
FT                   /protein_id="ACY83022.1"
FT                   /translation="MVYSYTEKKRIRKDFGKRPQVLDVPYLLSIQLDSFQKFIEQDPEG
FT                   QYGLEAAFRSVFPIQSYSGNSELQYVSYRLGEPVFDVKECQIRGVTYSAPLRVKLRLVI
FT                   YEREAPEGTVKDIKEQEVYMGEIPLMTENGTFVINGTERVIVSQLHRSPGVFFDSDKGK
FT                   THSSGKVLYNARIIPYRGSWLDFEFDPKDNLFVRIDRRRKLPATIILRALDFTTEQILD
FT                   LFFDKVIFEIRDNKLQMELVPERLRGETASFDIEANGKVYVEKGRRITARHIRQLEKDD
FT                   VKLIEVPVEYIVGKVAAKDYIDESTGELICAANMELSLDLLAKLSQSGYKRIETLFTND
FT                   LDHGPYMSETLRVDPTNDRLSALVEIYRMMRPGEPPTREAAENLFENLFFSEDRYDLSA
FT                   VGRMKFNRSLMRDEIEGSGILSKDDIIEVMKKLIDIRNGKGEVDDIDHLGNRRIRSVGE
FT                   MAENQFRVGLVRVERAVKERLSLGDLDMLMPQDMINAKPISAAVKEFFGSSQLSQFMDQ
FT                   NNPLSEITHKRRISALGPGGLTRERAGFEVRDVHPTHYGRVCPIETPEGPNIGLINSLS
FT                   VYAQTNEYGFLETPYRRVRDGIVTDEIHYLSAIEEGNFVIAQANSNLDEEGRFVEDLVT
FT                   CRSKGESSLFSRDQVDYMDVSTQQVVSVGASLIPFLEHDDANRALMGANMQRQAVPTLR
FT                   ADKPLVGTGMERAVAVDSGVTSVAKRGGMVQYVDASRIVIKVNEDEMFPGEAGIDIYNL
FT                   TKYTRSNQNTCISQMPCVSLGEPIERGDVLADGPSTDLGELALGQNMRVAFMPWNGYNF
FT                   EDSILVSERVVQEDRFTSIHIQELACVSRDTKLGPEEITADIPNVGEAALSKLDESGIV
FT                   YIGAEVKGGDILVGKVTPKGETQLTPEEKLLRAIFGEKASDVKDSSLRVPNSVSGTVID
FT                   VQVFTRDGVEKDKRALEIEEMQLKQAKKDLTEELQILEAGLFARIHDVLVAGGVEAEKL
FT                   EKLPRDRWLELGLADEAKQNQLEQLAEQYDELKAEFEKKLEAKRRKITQGDDLAPGVLK
FT                   IVKVYLAVKRQIQPGDKMAGRHGNKGVISKINPIEDMPYDENGTPVDIVLNPLGVPSRM
FT                   NIGQILETHLGMAAKGIGDKINAMLKQQQEVAKLREFIQKAYDLGDHTRQQVDLNTFTD
FT                   EEVLRLAENLKKGLPVATPVFDGAKEREIKGLLELGGIPTSGQITLYDGRTGERFERQV
FT                   TVGYMYMLKLNHLVDDKMHARSTGSYSLVTQQPLGGKAQFGGQRFGEMEVWALEAYGAA
FT                   YTLQEMLTVKSDDVNGRTKMYKNIVDGSHQMEPGMPESFNVLLKEIRSLGINIELEDE"
FT   gene            189426..193646
FT                   /gene="rpoC"
FT                   /locus_tag="ETAE_0176"
FT   CDS_pept        189426..193646
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoC"
FT                   /locus_tag="ETAE_0176"
FT                   /product="DNA-directed RNA polymerase, beta subunit/160 kD
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83023"
FT                   /db_xref="GOA:D0Z9T3"
FT                   /db_xref="InterPro:IPR000722"
FT                   /db_xref="InterPro:IPR006592"
FT                   /db_xref="InterPro:IPR007066"
FT                   /db_xref="InterPro:IPR007080"
FT                   /db_xref="InterPro:IPR007081"
FT                   /db_xref="InterPro:IPR007083"
FT                   /db_xref="InterPro:IPR012754"
FT                   /db_xref="InterPro:IPR038120"
FT                   /db_xref="InterPro:IPR042102"
FT                   /db_xref="UniProtKB/TrEMBL:D0Z9T3"
FT                   /protein_id="ACY83023.1"
FT                   /translation="MKDLLKFLKAQTKTEEFDAIKIALASPDMIRSWSFGEVKKPETIN
FT                   YRTFKPERDGLFCARIFGPVKDYECLCGKYKRLKHRGVICEKCGVEVTQTKVRRERMGH
FT                   IELASPTAHIWFLKSLPSRIGLLLDMPLRDIERVLYFESYVVVEGGMTNLERRQILTEE
FT                   QYLDALEEFGDEFDAKMGAEAIQALLKGMDLEAECEQLREELGETNSETKRKKLTKRIK
FT                   LLEAFILSGNKPEWMILTVLPVLPPDLRPLVPLDGGRFATSDLNDLYRRVINRNNRLKR
FT                   LLDLAAPDIIVRNEKRMLQEAVDALLDNGRRGRAITGSNKRPLKSLADMIKGKQGRFRQ
FT                   NLLGKRVDYSGRSVITVGPYLRLHQCGLPKKMALELFKPFIYGKLELRGLATTIKAAKK
FT                   MVEREEAVVWDILDEVIREHPVMLNRAPTLHRLGIQAFEPLLIEGKAIQLHPLVCAAYN
FT                   ADFDGDQMAVHVPLTLEAQLEARALMMSTNNILSPANGDPIIVPSQDVVLGLYYMTRDC
FT                   VNAKGEGMVLSGPKEAERIYRAGLASLHARVKVRITQYSKSADGEMVPNTGLIDTTVGR
FT                   AILWMIVPKGLPYTIVNQPLGKKAISKMLNACYRALGLKPTVIFADQIMYTGFAYAARS
FT                   GASVGIDDMVIPEKKAGIIAEAEAEVAEIQEQFQSGLVTAGERYNKVIDIWAAANERVA
FT                   KAMMENLSTETVINRDGEEERQVSFNSIFMMADSGARGSAAQIRQLAGMRGLMAKPDGS
FT                   IIETPITANFREGLNVLQYFISTHGARKGLADTALKTANSGYLTRRLVDVAQDLVVIED
FT                   DCGTHNGIVMTPVIEGGDVKEPLRDRVLGRVTAEEVLKPGTADILVPRNTLLNEKWCDL
FT                   LEEHSVDSVKVRSVVSCETDFGVCAHCYGRDLARGHLVNKGEAIGVIAAQSIGEPGTQL
FT                   TMRTFHIGGAASRAAAESSIQVKNKGNLKLTNAKFVVNTDGKLVITSRNTELKLIDEFG
FT                   RTKESYKVPYGATLAKGDGAEVNGGETVANWDPHTMPVITEVSGFIRFADMIDGQTVTR
FT                   QTDELTGLSSQVVLDSAERTGSGKDLRPALKIVDANGDDVLLPGTDMPAQYFLPGKAIV
FT                   QLEDGIAISAGDTLARIPQESGGTKDITGGLPRVADLFEARRPKEPAILAEISGVVSFG
FT                   KETKGKRRLVITPLDGSDAYEEMIPKWRQLNVFEGERVERGDVISDGPESPHDILRLRG
FT                   VNAVTRYIVNEVQDVYRLQGVKINDKHIEVIVRQMLRKATIANAGSSEFLEGEQVEVSR
FT                   VKIANRLLESDGKIAATYMRDLLGITKASLATESFISAASFQETTRVLTEAAVAGKRDE
FT                   LRGLKENVIVGRLIPAGTGYAYHQDRMRRRAADTSSAPQVSAEEASANLAELLNAGLLG
FT                   GNDE"
FT   gene            complement(193758..194402)
FT                   /gene="thiE"
FT                   /locus_tag="ETAE_0177"
FT   CDS_pept        complement(193758..194402)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiE"
FT                   /locus_tag="ETAE_0177"
FT                   /product="thiamine-phosphate pyrophosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83024"
FT                   /db_xref="GOA:D0Z9T4"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022998"
FT                   /db_xref="InterPro:IPR034291"
FT                   /db_xref="InterPro:IPR036206"
FT                   /db_xref="UniProtKB/TrEMBL:D0Z9T4"
FT                   /protein_id="ACY83024.1"
FT                   /translation="MRQPLFAPVPTRLGLYPVVDSVEWIERLLRAGVRTLQLRIKDCRE
FT                   DQIGDELAQAIALGHHYQARLFINDYWRQAIRLGAYGVHLGQEDLDRADLAAIRRAGLR
FT                   LGLSTHDDAEMDRALAAGPSYVALGHVFPTDSKQMATAPQGLSDLRRQVARLGTYPSVA
FT                   IGGISIARVPDVLACGVGSIALVSAITRAPDWLAATDTLLQLIEGRHANDA"
FT   gene            complement(194402..196333)
FT                   /gene="thiC"
FT                   /locus_tag="ETAE_0178"
FT   CDS_pept        complement(194402..196333)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiC"
FT                   /locus_tag="ETAE_0178"
FT                   /product="thiamine biosynthesis protein ThiC"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83025"
FT                   /db_xref="GOA:D0Z9T5"
FT                   /db_xref="InterPro:IPR002817"
FT                   /db_xref="InterPro:IPR025747"
FT                   /db_xref="InterPro:IPR037509"
FT                   /db_xref="InterPro:IPR038521"
FT                   /db_xref="UniProtKB/TrEMBL:D0Z9T5"
FT                   /protein_id="ACY83025.1"
FT                   /translation="MSTLTHRDAPRRQRRAQAQAFIDNLQAQAYPSSQRIYLQGSRADI
FT                   RVPLREISLSPTLIGGTPEQPQWRDNEAIAVYDTSGAYGDPQAEIDLRRGLPAIRSAWI
FT                   AERNDSEILPGRSSDYTRRRQADRDLETLRFEQRSSARRARPGHRVTQLYYARQGIITP
FT                   EMEFIALRENMGRERIRSAVLRQQHPGIAFGAHLPDNITPAFVRDEVAAGRAIIPANIN
FT                   HPESEPMIIGRNFLVKVNANIGSSSVTSSIEEEVEKLVWATRWGADTVMDLSTGRYIHE
FT                   TREWILRNSPVPIGTVPIYQALEKVNGIAENLDWPLVRDTLLEQAEQGVDYFTLHAGLL
FT                   LRFIPMTAERLTGIVSRGGAIMAKWCLSHHQENFLYTHFREICEICSAYDIALSLGDGL
FT                   RPGSIQDANDPAQFAELHTLGELTRIAWEYDVQVMIEGPGHVPMHMIQRNMEEELSHCH
FT                   EAPFYTLGPLTTDIAPGYDHFTSGIGAAMIGWFGCAMLCYVTPKEHLGLPDKDDVKQGL
FT                   ITYKIAAHAADLAKGHPGAQIRDNAMSKARFEFRWEDQFNLALDPVTARAYHDATLPQA
FT                   SGKLAHFCSMCGPKFCSMKISREVREHAARQQAADPGMAQMAQQFRDQGGEIYLADVTD
FT                   SAPSRKES"
FT   gene            196727..197500
FT                   /gene="nudC"
FT                   /locus_tag="ETAE_0179"
FT   CDS_pept        196727..197500
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nudC"
FT                   /locus_tag="ETAE_0179"
FT                   /product="NADH pyrophosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83026"
FT                   /db_xref="GOA:D0Z9T6"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015376"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR022925"
FT                   /db_xref="UniProtKB/TrEMBL:D0Z9T6"
FT                   /protein_id="ACY83026.1"
FT                   /translation="MAQQLSDSDSGWWVVSDRGRIWLPEGELPYGSAAQWHLVGETAYR
FT                   IGEWQGMPVWLLCLTYPQDMTSVRQLIDADRGLFQLAGRGVQLAEFFQSHRFCGSCGHP
FT                   MHASQQEWARLCAHCQQRYYPQIAPCIIVAIRRDDHILLARHNRHRNGIYTVLAGFVEV
FT                   GETLEQAAAREIFEESRLQVKNLRYVTSQPWPFPHSLMMAFLADYAAGDLCHDPKELQE
FT                   ADWYRYDRLPQLPPAGTVARRLIEDTVALCRAQHE"
FT   gene            197548..198612
FT                   /gene="hemE"
FT                   /locus_tag="ETAE_0180"
FT   CDS_pept        197548..198612
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemE"
FT                   /locus_tag="ETAE_0180"
FT                   /product="uroporphyrinogen decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83027"
FT                   /db_xref="GOA:D0Z9T7"
FT                   /db_xref="InterPro:IPR000257"
FT                   /db_xref="InterPro:IPR006361"
FT                   /db_xref="InterPro:IPR038071"
FT                   /db_xref="UniProtKB/TrEMBL:D0Z9T7"
FT                   /protein_id="ACY83027.1"
FT                   /translation="MTELKNDRYLRALLRQPVDVTPVWMMRQAGRYLPEYNATRAQAGN
FT                   FIALCKNAELACEVTLQPLRRFPLDAAILFSDILTVPDAMGLGLYFEAGEGPRFTHPVT
FT                   CHADIQRLPIPDPEQELGYVMDAVRTIRRDLRGDVPLIGFSGSPWTLATYMVEGGSSKA
FT                   FTKIKKMMYSDPAALHLLLDKLAQSVILYLNAQIRAGAQAVMIFDTWGGVLTGRDYREF
FT                   SLRYMHQIVDGLQRESEGRRVPVTLFTKGGGQWLEAMADTGCDALGLDWTCDIADARRR
FT                   VGDRVALQGNMDPSLLYAPPARIEQEVATILAGFGQGEGHVCNLGHGIHPDVPPEHAGV
FT                   FVDAVHRLSVPYHR"
FT   gene            198627..199313
FT                   /locus_tag="ETAE_0181"
FT   CDS_pept        198627..199313
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAE_0181"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83028"
FT                   /db_xref="GOA:D0Z9T8"
FT                   /db_xref="InterPro:IPR007581"
FT                   /db_xref="UniProtKB/TrEMBL:D0Z9T8"
FT                   /protein_id="ACY83028.1"
FT                   /translation="MDLQALRSEQRARAVQVERADRWEAPVLIAGADVGFEQDGAVTRA
FT                   ALAVLCYPELTLVEYQVARIETQMPYIPGFLSFREYPALLQSWGQLRHRPQLVMVDGHG
FT                   IAHPRRLGIASHFGLLVDVPTIGVAKRRLCGQFAPLDETPGSTVALMDGGEQLGWVLRS
FT                   KARCNPLFISGGHRVSTDSALAWVQRCLRGYRLPEPTRWADAIASRRPAFLRWQSAQPR
FT                   SAVQVE"
FT   gene            199419..200009
FT                   /locus_tag="ETAE_0182"
FT   CDS_pept        199419..200009
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAE_0182"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83029"
FT                   /db_xref="InterPro:IPR007338"
FT                   /db_xref="InterPro:IPR023381"
FT                   /db_xref="UniProtKB/TrEMBL:D0Z9T9"
FT                   /protein_id="ACY83029.1"
FT                   /translation="MLRNPIHKRLEKLESWQQLTFMACLTERMYPNYQAFCQQSAFGEA
FT                   AVYRRILDLVWELLTVKDVKINFDSQLEKLEAAIPDADAYDMYGVYPAIDACVALSEIL
FT                   HAQLGGEMLAHAIAVSETSLYTVSMLEMTQSGREMSDDELKALPAIQDELDIQWEIYRL
FT                   LSEAEERDLELIKGLRADLREAGVSNIGIELAQ"
FT   gene            200199..200471
FT                   /gene="hupA"
FT                   /locus_tag="ETAE_0183"
FT   CDS_pept        200199..200471
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hupA"
FT                   /locus_tag="ETAE_0183"
FT                   /product="transcriptional regulator HU subunit alpha"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83030"
FT                   /db_xref="GOA:D0Z9U0"
FT                   /db_xref="InterPro:IPR000119"
FT                   /db_xref="InterPro:IPR010992"
FT                   /db_xref="InterPro:IPR020816"
FT                   /db_xref="UniProtKB/TrEMBL:D0Z9U0"
FT                   /protein_id="ACY83030.1"
FT                   /translation="MNKTQLIDVIADKADLSKTQAKAALESTLAAITESLKAGDAVQLV
FT                   GFGTFKVNHRNERTGRNPQTGNEIKIAAANVPAFVSGKALKDAVK"
FT   gene            200533..201189
FT                   /locus_tag="ETAE_0184"
FT   CDS_pept        200533..201189
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAE_0184"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83031"
FT                   /db_xref="InterPro:IPR010858"
FT                   /db_xref="UniProtKB/TrEMBL:D0Z9U1"
FT                   /protein_id="ACY83031.1"
FT                   /translation="MCRRVRGLLPVALLLTGCHSTAPVAPFTATGYIADGGIVRLWRLE
FT                   GAGHQPQAMMRVFTPLDGTETQIDRYTYRDGHLYQIRQQTGQGNDDVLQLRFDMQGSLS
FT                   YMQRLRNGSKEMPGSDEVAKAQYQARHAQEMATTLAAGGVNLIQGRWQGGIFTRCDGQV
FT                   APLPLSGWQAAQLARREANSRGPLWVAWLSAPEGAQLLQVANHNICAWAPTEKTV"
FT   gene            complement(201224..202501)
FT                   /gene="purD"
FT                   /locus_tag="ETAE_0185"
FT   CDS_pept        complement(201224..202501)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purD"
FT                   /locus_tag="ETAE_0185"
FT                   /product="phosphoribosylamine-glycine ligase"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83032"
FT                   /db_xref="GOA:D0Z9U2"
FT                   /db_xref="InterPro:IPR000115"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR020559"
FT                   /db_xref="InterPro:IPR020560"
FT                   /db_xref="InterPro:IPR020561"
FT                   /db_xref="InterPro:IPR020562"
FT                   /db_xref="InterPro:IPR037123"
FT                   /db_xref="UniProtKB/TrEMBL:D0Z9U2"
FT                   /protein_id="ACY83032.1"
FT                   /translation="MNILIIGSGGREHALAWKAAQSPLAERVFVAPGNAGTALEPALEN
FT                   IDIAATDIDALVAFALRHQVGLTIVGPEAPLVLGVVDAFRAAGLPIFGPSQSAARLEGS
FT                   KAFSKDFLARQRIPTAAYRNFTEVEPALAYVREQGAPIVIKADGLAAGKGVIVAMTREE
FT                   AEAAVHDMLAGNAFGDAGHRIVIEEFLEGEEASFIVMVDGEHVLPMATSQDHKRVGDGD
FT                   SGPNTGGMGAYSPAPVVSDAVHQRVMEQVIWPTVRGMAQEGAPYTGFLYAGLMISADGA
FT                   PKVIEFNCRFGDPETQPIMMRMQSDLVALCLAGANGTLDQQSSAWDPRPALGVVLAAGG
FT                   YPGDYRQGDVIHGLTQGTAQAKVFHAGTRLNAQGEVETCGGRVLCATALGEDIAEAQRN
FT                   AYRLADALSWEGGFCRRDIGYRALQR"
FT   gene            complement(202543..204132)
FT                   /gene="purH"
FT                   /locus_tag="ETAE_0186"
FT   CDS_pept        complement(202543..204132)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purH"
FT                   /locus_tag="ETAE_0186"
FT                   /product="bifunctional
FT                   phosphoribosylaminoimidazolecarboxamide
FT                   formyltransferase/IMP cyclohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83033"
FT                   /db_xref="GOA:D0Z9U3"
FT                   /db_xref="InterPro:IPR002695"
FT                   /db_xref="InterPro:IPR011607"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR024051"
FT                   /db_xref="InterPro:IPR036914"
FT                   /db_xref="UniProtKB/TrEMBL:D0Z9U3"
FT                   /protein_id="ACY83033.1"
FT                   /translation="MQHSRPVRRALLSVSDKSGIVEFAQALHLRGVELLSTGGTARLLS
FT                   QAGLPVTEVSDYTGFPEMMDGRVKTLHPKVHGGILGRRDRDAAVMQQHGIQPIDMVVVN
FT                   LYPFAQTVARPDCTLEEAVENIDIGGPTMVRSAAKNHNDVAIVVNNGDFDNIIAEMDAH
FT                   HGALTQATRFDLAIKAFEHTAAYDSMIANYFGTLVAPYHGDTQSPSGRFPRTLNLNLIK
FT                   KQDMRYGENGHQQAAFYIEEPQVEACIATAQQLQGKALSYNNIADTDAALECVKSFAEP
FT                   ACVIVKHANPCGVALGDDPLDAYERAYQTDPTSAFGGIIAFNRTLDAKTAQAIIARQFV
FT                   EVIIAPHVTEDALDLLSAKQNVRVLACGEWDARIPGLDFKRVNGGLLVQDRDLGMVDVA
FT                   DLRVVTERQPSEQELRDALFCWKVAKFVKSNAIVYARDNMTVGIGAGQMSRVYSAKIAG
FT                   IKAADEGLPVAGSVMASDAFFPFRDGIDAAAAVGIRCVIQPGGSIRDDEVIAAANEHGI
FT                   AMIFTGMRHFRH"
FT   gene            204704..206240
FT                   /locus_tag="ETAE_r004"
FT   rRNA            204704..206240
FT                   /locus_tag="ETAE_r004"
FT                   /product="16S ribosomal RNA"
FT   gene            206320..206395
FT                   /locus_tag="ETAE_t010"
FT   tRNA            206320..206395
FT                   /locus_tag="ETAE_t010"
FT                   /product="tRNA-Glu"
FT   gene            206595..209504
FT                   /locus_tag="ETAE_r005"
FT   rRNA            206595..209504
FT                   /locus_tag="ETAE_r005"
FT                   /product="23S ribosomal RNA"
FT   gene            209581..209702
FT                   /locus_tag="ETAE_r006"
FT   rRNA            209581..209702
FT                   /locus_tag="ETAE_r006"
FT                   /product="5S ribosomal RNA"
FT   gene            complement(209979..210542)
FT                   /locus_tag="ETAE_0187"
FT   CDS_pept        complement(209979..210542)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAE_0187"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83034"
FT                   /db_xref="GOA:D0Z9U4"
FT                   /db_xref="InterPro:IPR000791"
FT                   /db_xref="UniProtKB/TrEMBL:D0Z9U4"
FT                   /protein_id="ACY83034.1"
FT                   /translation="MHNELANPAPLGLMGFGMTTVLLNMHNAGIFALDAMILAMGIFFG
FT                   GLAQIFAGLLEFRKGNTFGLTAFTAYGAFWLTLVTLLLLPKMGLADAVTPPSLAAYLAL
FT                   WGIFTLFMFFGTLRANRALQFVFASLTLLFFMLAYGNLTGNAGLLHIAGVEGIICGASA
FT                   IYLAMAEVINGQLGRCVLPIGEPR"
FT   gene            complement(210628..212583)
FT                   /gene="acs"
FT                   /locus_tag="ETAE_0188"
FT   CDS_pept        complement(210628..212583)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="acs"
FT                   /locus_tag="ETAE_0188"
FT                   /product="acyl-coenzyme A synthetase/AMP-(fatty) acid
FT                   ligase"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83035"
FT                   /db_xref="GOA:D0Z9U5"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR011904"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR032387"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:D0Z9U5"
FT                   /protein_id="ACY83035.1"
FT                   /translation="MSQIHTYPVPADIARHAFINAEMYREMYLASVEDPEAFWAEQGQI
FT                   ISWITPYSRVKNTSFDPGHINIRWFEDGTLNLAANCLDRHLAERGEQTAIIWEGDDPQE
FT                   SRRVTYRQLHGEVCRFANVLKSLQVEKGDVVAIYMPMVVEAAVAMLACARIGAVHSVIF
FT                   GGFSPEAVAGRIIDSGAKLVITADEGVRAGRTIPLKRNVDEALQHPQVNSVHHVVVFRR
FT                   TGGAGEWDSGRDRWWHELMAQADEHCPAVEMNAEDPLFILYTSGSTGKPKGVLHSTGGY
FT                   LVYAATTFKYVFDYHPGDIYWCTADVGWVTGHSYLLYGPLANGAITLMFEGVPNYPGIN
FT                   RLSQIVDKHQVNILYTAPTAIRALMAEGQRAVADTQRTSLRIMGSVGEPINPEAWEWYY
FT                   HTIGNGHCPIMDTWWQTETGGFMITPLPGATELKAGSATRPFFGVQPALVDNSGEILEG
FT                   ASEGNLVILDSWPGQARTLFGAHERFEQTYFSTFKGMYFSGDGARRDEDGYYWITGRVD
FT                   DVLNVSGHRLGTAEIESALVAHPKIAEAAVVGIPHSIKGQAIYAYITLNVGEEPSPALY
FT                   AEVRDWVRKEIGPIATPDILHWTDALPKTRSGKIMRRILRKIASGDISNLGDTSTLADP
FT                   GVVEKLLEEKQAMQPR"
FT   gene            212823..212957
FT                   /locus_tag="ETAE_0189"
FT   CDS_pept        212823..212957
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAE_0189"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83036"
FT                   /db_xref="UniProtKB/TrEMBL:D0Z9U6"
FT                   /protein_id="ACY83036.1"
FT                   /translation="MARCAIVKIASGFIHRRIIGYITAYCSFIQVELSPSGVICRLVA"
FT   gene            213081..214403
FT                   /gene="gltP"
FT                   /locus_tag="ETAE_0190"
FT   CDS_pept        213081..214403
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gltP"
FT                   /locus_tag="ETAE_0190"
FT                   /product="glutamate/aspartate:proton symporter"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83037"
FT                   /db_xref="GOA:D0Z9U7"
FT                   /db_xref="InterPro:IPR001991"
FT                   /db_xref="InterPro:IPR018107"
FT                   /db_xref="InterPro:IPR033380"
FT                   /db_xref="InterPro:IPR034703"
FT                   /db_xref="InterPro:IPR036458"
FT                   /db_xref="UniProtKB/TrEMBL:D0Z9U7"
FT                   /protein_id="ACY83037.1"
FT                   /translation="MMKRFTLTLAWQIVIALILGIAVGAALHDQTESRQWLVSNVLGPA
FT                   GDIFIRLIKMIVIPIVISTLIVGIAGVGDAKKLGRIGLKTILYFELITTVAIVVGITLA
FT                   NLFQPGLGVDMSHLAAVDISQYERTTEQVQSGAHSLVGTLLALIPANLFSAMAKGEILP
FT                   IIFFSVLFGLGLSSLPADHKEPLLRVFRAVSESMFKVTHMIMRYAPIGVFGLISVTVAN
FT                   FGFASLIPLAKLVLLVYAAILFFALVVLGTVARLCHLRIWTLIVILKDELILAYSTASS
FT                   ETVLPRIMEKMEAYGAPKSITSFVVPTGYSFNLDGSTLYQSIAAIFIAQLYGIQLSLGQ
FT                   EIILVLTLMVTSKGIAGVPGVSFVVLLATLGSVGIPLEGLAFIAGVDRILDMARTALNV
FT                   VGNALAVLVVAKWEHQFDRTKAHAYEARMHTPQGVAQQDLL"
FT   gene            complement(214478..215905)
FT                   /gene="tolC"
FT                   /locus_tag="ETAE_0191"
FT   CDS_pept        complement(214478..215905)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tolC"
FT                   /locus_tag="ETAE_0191"
FT                   /product="outer membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83038"
FT                   /db_xref="GOA:D0Z9U8"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="InterPro:IPR010130"
FT                   /db_xref="UniProtKB/TrEMBL:D0Z9U8"
FT                   /protein_id="ACY83038.1"
FT                   /translation="MKKLLPLLIGLSLSGFSALSQAENLMQVYQQAKESNPDLRQAAAN
FT                   RDAAFEKINESRSPLLPQLGLGADYTYTNGFRDSSGLNSNNYGASLALTQTIFDMSKWR
FT                   QLSLTEKQAGIQDVSYQSSEQTLMLNTATAYFNVLRAIDQLTYTEANKQAIYNQLDQTT
FT                   QRFNVGLVAITDVQNARAQYDQVLAQEVSARNNLDNSLEALRQITGQYYPQLSALNIDR
FT                   FSTKRPDDVKALLQEAEKRNLQLLSARLSQDLARQQIKYAETGYMPTLNLTASTGVSNT
FT                   DYNSLSNAQKETLRGGNGSSYQGQNTVGLSFNLPLYSGGATNSQVKQAQYNFVGASEAL
FT                   DSAHRSVVQNVRSSFNNISAAISGVSAYKQAVVSAQSSLDATQAGYQVGTRTIVDVLNA
FT                   TTALYNAKQNLANARYDYLISQLNIKYALGTLNQNDLLALNGDLSKPVPTAADSIAPDD
FT                   AAQAAKANGPIPGGGVR"
FT   gene            216121..216750
FT                   /gene="nudF"
FT                   /locus_tag="ETAE_0192"
FT   CDS_pept        216121..216750
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nudF"
FT                   /locus_tag="ETAE_0192"
FT                   /product="ADP-ribose pyrophosphatase NudF"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83039"
FT                   /db_xref="GOA:D0Z9U9"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR004385"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="UniProtKB/TrEMBL:D0Z9U9"
FT                   /protein_id="ACY83039.1"
FT                   /translation="MCVDKPSPVTFGKDDVEIIARETCYRGFFSLDRYRFRHRLFNGEM
FT                   SGEVVREVFERGHAAVLLPYDPRRDEVVLIEQLRMPAYTSSRTPWLLEMVAGMIEVGES
FT                   VEQVARREAQEEAGITVGRCQPVLSYLASPGGTSERLSIVVGEVDAATASGVHGLAEEH
FT                   EDIRVHVVSREQAYRWVEQGVIDNAASVIALQWLALNHSRLRAQWA"
FT   gene            217177..218004
FT                   /gene="icc"
FT                   /locus_tag="ETAE_0193"
FT   CDS_pept        217177..218004
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="icc"
FT                   /locus_tag="ETAE_0193"
FT                   /product="cyclic 3,5-adenosine monophosphate
FT                   phosphodiesterase"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83040"
FT                   /db_xref="GOA:D0Z9V0"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR026575"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:D0Z9V0"
FT                   /protein_id="ACY83040.1"
FT                   /translation="MESLFHLAVASGAPVRILQITDTHLFAGQQETLLGVNTYRSYQAV
FT                   LAAIRAEAHPFDLIVATGDLAQDHSAAAYQHFAAGVAALHRPCLWLPGNHDFQPAMVDA
FT                   LAQAGVHANKRALLGDRWQIVLLDSQVVGVPHGELSDYQLEWLEQTLASEPQRHTMLLL
FT                   HHHPLPSGCTWLDQHSLRNAHALDEILRRYPQVNTLVCGHIHQELDLDWNGCRLLATPS
FT                   TCVQFKPLCTNFTIDTISPGWRYLTLYPDGRVTTAVHRLASSEFRPDLDADGY"
FT   gene            218007..218588
FT                   /gene="yqiA"
FT                   /locus_tag="ETAE_0194"
FT   CDS_pept        218007..218588
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yqiA"
FT                   /locus_tag="ETAE_0194"
FT                   /product="esterase YqiA"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83041"
FT                   /db_xref="InterPro:IPR008886"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D0Z9V1"
FT                   /protein_id="ACY83041.1"
FT                   /translation="MPTLLYLHGFNSSPRSAKATALQRWLAEYHPQITMLIPQLPPYPA
FT                   DAAQMLEELVMERAGRPLGLVGSSLGGYYATWLSQCFTLPAVVINPAVKPFELLLDFLG
FT                   QNENPYTGQQYVLESRHVFDLKVMQVDPLESPDLIWLLQQTGDEVLDYRQAVTYYTPCR
FT                   QTIEEGGNHAFVGIERFFPQIIDFLGLSAE"
FT   gene            complement(218557..218691)
FT                   /locus_tag="ETAE_0195"
FT   CDS_pept        complement(218557..218691)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAE_0195"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83042"
FT                   /db_xref="UniProtKB/TrEMBL:D0Z9V2"
FT                   /protein_id="ACY83042.1"
FT                   /translation="MIRKSRCLSIRWEKQGRPLAHPLLYPPVGIGRWRAIPRSAPKSL"
FT   gene            218695..220590
FT                   /gene="parE"
FT                   /locus_tag="ETAE_0196"
FT   CDS_pept        218695..220590
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="parE"
FT                   /locus_tag="ETAE_0196"
FT                   /product="DNA topoisomerase IV subunit B"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83043"
FT                   /db_xref="GOA:D0Z9V3"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR005737"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D0Z9V3"
FT                   /protein_id="ACY83043.1"
FT                   /translation="MTQSSYNADAIEVLSGLEPVRRRPGMYTDTTRPNHLGQEVIDNSV
FT                   DEALAGHATRIEVILHPDQSLEVIDNGRGMPVDIHPEEGVPAIELILCRLHAGGKFSNK
FT                   NYQFSGGLHGVGISVVNALSRRVEVSVRRDGQIYQMAFENGEKVEDLHVSGTVGRRNTG
FT                   TSVHFWPDAQFFDSARFSVSRLTHLLKAKAVLCPGVEILFRDLVNGSEQRWCYQDGLTD
FT                   YLMESVNGLVTLPEQPFTGTFASDTEAVDWALLWLPEGGELLTESYVNLIPTPQGGTHV
FT                   NGLRQGLLDAMREFCEFRNLLPRGVKLTADDIWERCAYVLSVKMQDPQFAGQTKERLSS
FT                   RQCAAFVSGVVKDAFSLWLNQNVQSAELLAELAINSAQRRMRAAKKVVRKKLTSGPALP
FT                   GKLADCSAQDLNRTELFLVEGDSAGGSAKQARDREYQAIMPLKGKILNTWEVSSDEVLA
FT                   SQEVHDISVAIGIDPDSDDLSQLRYGKICILADADSDGLHIATLLCALFVRHFRPLVQA
FT                   GHVYVAMPPLYRIDLGKEVFYALSEEEKAGVLEQLKRKKGKPNVQRFKGLGEMNPLQLR
FT                   ETTLDPNTRRLVQLTIEDEDMERTVAVMDMLLAKKRAEDRRNWLQENGNLAELDV"
FT   gene            220776..223052
FT                   /gene="parC"
FT                   /locus_tag="ETAE_0197"
FT   CDS_pept        220776..223052
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="parC"
FT                   /locus_tag="ETAE_0197"
FT                   /product="DNA topoisomerase IV subunit A"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83044"
FT                   /db_xref="GOA:D0Z9V4"
FT                   /db_xref="InterPro:IPR002205"
FT                   /db_xref="InterPro:IPR005742"
FT                   /db_xref="InterPro:IPR006691"
FT                   /db_xref="InterPro:IPR013757"
FT                   /db_xref="InterPro:IPR013758"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR035516"
FT                   /db_xref="UniProtKB/TrEMBL:D0Z9V4"
FT                   /protein_id="ACY83044.1"
FT                   /translation="MSDLTHDNSERVALHAFTEDAYLQYSMYVIMDRALPFIGDGLKPV
FT                   QRRIVYAMSELGLSASAKFKKSARTVGDVLGKYHPHGDSACYEAMVLMAQPFSYRYPLV
FT                   DGQGNWGAPDDPKSFAAMRYTESRLSRYAEILLSELGQGTVDYVANFDGTLQEPKFLPA
FT                   RLPNILLNGTTGIAVGMATDIPPHNAREVAAALVALLDNPQSSLDDLLTHIQGPDFPTE
FT                   AEIITPRDEIRKIYRTGRGSVRMRAVWRKEESEIVISALPHQTSGAKVLEQIASQMRAK
FT                   KLPMVDDLRDESDHENPTRLVIVPRSNRVDLDQLMNHLFATTDLEKSYRINMNMIGLDR
FT                   RPAVKDLREILSEWLSYRRETVRRRLNYRLEKVLKRLHILEGLLCAFLNIDEVIHIIRS
FT                   EDEPKPVLVARFGLSDTQAEAILELKLRHLARLEEVKIRGEQDALAQERDRLQTLLASE
FT                   RKLGTLIKKEIMADAETYGDARRSPLQERSEARAMSEHDFVPSEPVTIVLSEGGWVRSA
FT                   KGHDIDPSGLNYKAGDAFRAAARGKSNQPVVFIDSSGRSYALDPLTLPSARGQGEPLTG
FT                   KLTPPPGATIEHVLMAADNQKLLMASDAGYGFVCTFSDLVARNRAGKAMLTLPENAKVL
FT                   TPLEINGDDDMLLAITEAGRMLMFPVHDLPQLSKGKGNKIVSIPAAQAAAGEDTLKWLL
FT                   VLAPQTSLTLHVGKRKLVMKPQDLQKFRAERGRKGTLLPRGLQRIERVDVDAPQSLRLD
FT                   ADGDA"
FT   gene            223143..223886
FT                   /gene="plsC"
FT                   /locus_tag="ETAE_0198"
FT   CDS_pept        223143..223886
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="plsC"
FT                   /locus_tag="ETAE_0198"
FT                   /product="1-acyl-sn-glycerol-3-phosphate acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83045"
FT                   /db_xref="GOA:D0Z9V5"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="InterPro:IPR004552"
FT                   /db_xref="UniProtKB/TrEMBL:D0Z9V5"
FT                   /protein_id="ACY83045.1"
FT                   /translation="MLFIFRVILITLLCLVICIVGSLYCLFSPRNPRHVARFGHWFGRL
FT                   SPLFGLKVETRLPPDAATYGNAIYIANHQNNYDMVTASNAVQPNTVTVGKKSLAWIPFF
FT                   GQLYWLTGNLLIDRKNRTKAHNTIAAVVEQFRTRRISFWMFPEGTRSRGRGLMPFKTGA
FT                   FHAALAAGVPIVPICVSSTHDKVKLNRWNNGVVIVEMLPPIDTSRWGKDQVRELAEHCR
FT                   TLMAKKIEQLDAEVAAREAQAGKRA"
FT   gene            223935..225353
FT                   /gene="sufI"
FT                   /locus_tag="ETAE_0199"
FT   CDS_pept        223935..225353
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sufI"
FT                   /locus_tag="ETAE_0199"
FT                   /product="repressor protein for FtsI"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83046"
FT                   /db_xref="GOA:D0Z9V6"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR011706"
FT                   /db_xref="InterPro:IPR011707"
FT                   /db_xref="InterPro:IPR026589"
FT                   /db_xref="UniProtKB/TrEMBL:D0Z9V6"
FT                   /protein_id="ACY83046.1"
FT                   /translation="MSLSRRRFIQASGLALCAGGLPLQARASGAQAVLPVPPLLESRRG
FT                   QPLFLSLERTHWAFMGGRKVGTWGVNGVYLGPTVRVHSGDDVKLIYSNRLSESVAMEVA
FT                   GLLVPGPLAGGPARQMSPGVDWSPVLPIRQAAATLWYHADTPRHMAPQVYSGLAGLWLV
FT                   EDQYSKNAPLPNHYGVDDFPLILQDKRLDNFGVPEYDPPSSGGFLGDTLLVNGVQDPYV
FT                   EVSRGWVRLRLLNASNARRYLLQLSDGRPFFVIASDQGLLPAPLQADTLPLAPGERREV
FT                   LIDMSKGEEISITAGEAAGIMDRLRGLFEPSSMLVSTRVLTLRPTGLLPLMTDTLPARL
FT                   AADPLPEGDVVNNRSIMLGSASSPGINGALWDPGRIDVQARQGTWERWTVRADTPQSFY
FT                   IQGAQFLVKSVNNAPPLVEDRGWKDSVWVDGEVSLLVYFPQPSSEHFPFLFYSGTLELA
FT                   DRGSVGQMVVQPAQ"
FT   gene            225637..229320
FT                   /gene="metH"
FT                   /locus_tag="ETAE_0200"
FT   CDS_pept        225637..229320
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metH"
FT                   /locus_tag="ETAE_0200"
FT                   /product="12-dependent methionine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83047"
FT                   /db_xref="GOA:D0Z9V7"
FT                   /db_xref="InterPro:IPR000489"
FT                   /db_xref="InterPro:IPR003726"
FT                   /db_xref="InterPro:IPR003759"
FT                   /db_xref="InterPro:IPR004223"
FT                   /db_xref="InterPro:IPR006158"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="InterPro:IPR011822"
FT                   /db_xref="InterPro:IPR033706"
FT                   /db_xref="InterPro:IPR036589"
FT                   /db_xref="InterPro:IPR036594"
FT                   /db_xref="InterPro:IPR036724"
FT                   /db_xref="InterPro:IPR037010"
FT                   /db_xref="UniProtKB/TrEMBL:D0Z9V7"
FT                   /protein_id="ACY83047.1"
FT                   /translation="MNTTLERLRRRLEKRILVLDGGMGTMIQRYGLSEQDFRAERFADW
FT                   PCDLKGNNDLLALTRPDIISAIHYAYLEAGADILETNTFNATRIAMADYRMEALAPEIN
FT                   YRAACLARACADEWTARTPHQPRFVAGVLGPTNRTASISPEVNDPACRNITFDQLVAAY
FT                   RESARALIEGGVDLLMIETVFDTLNAKAAVYALECEFAALGVTLPVMISGTITDASGRT
FT                   LSGQTTEAFYNALRHARPLSFGLNCALGPEDLRQYVAELSRVAECHVSAHPNAGLPNAF
FT                   GEYDLSPQAMAQQIAEWARAGYLNIVGGCCGTTPEHIAAISRAVQGITPRALPTLPVAC
FT                   RLSGLEPLTIDETSLFVNVGERTNVTGSAKFKRLIKENKYDEALDVARQQVASGAQIID
FT                   INMDEGMLDAEAAMVRFLNLIAGEPDIARVPLMIDSSRWSVIEAGLKCIQGKGIVNSLS
FT                   LKEGEANFLEHARQVRRFGAALVVMAFDEQGQADTRERKVAICRRAYQLLTERIGFPPE
FT                   DIIFDPNIFAVATGIEEHSNYAVDFIASCAEIKAQLPHALISGGVSNVSFSFRGNEAVR
FT                   EAIHAVFLYHAIRHGMDMGIVNAGQLAIYDDLPDDLRTAAEAVILNQSPDATDRLLALA
FT                   ERYRDTQGSAQAEAQQAEWRSWPVAQRLEYALVKGIGEFIAQDTEAARLEADRPIAVIE
FT                   GPLMAGMNRVGDLFGDGKMFLPQVVKSARVMKQAVAYLSPFIEASKQRGSSAGKVLLAT
FT                   VKGDVHDIGKNIVGVVLQCNNYEIIDLGVMVPAERILRVAREERVDIIGLSGLITPSLD
FT                   EMVNVASEMERQGFTLPLLIGGATTSKAHTAVKIAPAYGGPTVYVQNASRTVGVVAALL
FT                   SEAQRGPFIDRTRREYEAARAQHGRQTPRTPPVTLAQARANGVVTDWSACPPPVPLRLG
FT                   VQTVQPGIARLRDYIDWTPFFLTWSLAGKYPRILQDEVVGEEARRLLADANGLLDRLEA
FT                   SGSLTPRGVFGLFAANRRGDDVLIYRDESRREVLAVSHHLRQQSDKRVGPNYCLADFVA
FT                   AADEGIADYIGAFAVTGGLEEEALAQAFDAQHDDYHKIMVKALADRLAEAFAEYLHQQV
FT                   RKVHWGYAADEALDNEQLIRENYRGIRPAPGYPACPEHSEKATLWRLLDVERHTGMRLT
FT                   ESYAMWPGASVSGWYFSHPHSKYFAVARVQRDQVADYAARKGMTLAEAERWLAPNLGYE
FT                   VA"
FT   gene            complement(229368..230717)
FT                   /gene="lysC"
FT                   /locus_tag="ETAE_0201"
FT   CDS_pept        complement(229368..230717)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lysC"
FT                   /locus_tag="ETAE_0201"
FT                   /product="aspartate kinase III"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83048"
FT                   /db_xref="GOA:D0Z9V8"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001341"
FT                   /db_xref="InterPro:IPR005260"
FT                   /db_xref="InterPro:IPR018042"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="UniProtKB/TrEMBL:D0Z9V8"
FT                   /protein_id="ACY83048.1"
FT                   /translation="MQQTIIAKFGGTSVADADAMLRCADIILSNPAVRVVVLSAAAGVT
FT                   NHLIALAEGQEAAERLRLIGEVRRIHDAILAALPDGVVVRSEIERMLENIAMLAEAAAL
FT                   ATSAALTDELVSHGELMSTLLFSELLRVRGVSVEWFDIRRIMRTDDRFGKAEPDREQLQ
FT                   ALAQQSLAPRLTTHLIITQGFIGSERKGRTTTLGRGGSDYTAALLAEALDAARVDIWTD
FT                   VPGIYTTDPRIVPAARRIDEIAFSEAAEMATFGAKVLHPATLLPAVRSDIPVFVGSSRD
FT                   PGAGGTLVCNKSAQPPLFRALALRRSQTLLTLHSLNMLHARGFLAEVFGILARHRISVD
FT                   LITTSEVSIALTLDTTGSCTGGASLLTSALLTELSAQCRVEVEEDLALVALIGNQLSSA
FT                   CGVGRQVFGAMEPFNIRMICYGASSHNLCFLVPGNDADAVVRTLHARLFE"
FT   gene            230718..231014
FT                   /locus_tag="ETAE_0202"
FT   CDS_pept        230718..231014
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAE_0202"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83049"
FT                   /db_xref="UniProtKB/TrEMBL:D0Z9V9"
FT                   /protein_id="ACY83049.1"
FT                   /translation="MMPRVRGRCPCCPAGQSISPAPGALNGTGRRMRAPQVLHLTVPST
FT                   EAGGRGDSPRGCPEGRCALARRSGAALLKGDAGGGVPPRFAQTGLYTGCTGHF"
FT   gene            230996..231148
FT                   /locus_tag="ETAE_0203"
FT   CDS_pept        230996..231148
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAE_0203"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83050"
FT                   /db_xref="UniProtKB/TrEMBL:D0Z9W0"
FT                   /protein_id="ACY83050.1"
FT                   /translation="MYRAFLEITAYAGCVNGIGMSDFQFDPRSITVTDYCFYRIEIYEI
FT                   KIITW"
FT   gene            231541..233190
FT                   /gene="pgi"
FT                   /locus_tag="ETAE_0204"
FT   CDS_pept        231541..233190
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pgi"
FT                   /locus_tag="ETAE_0204"
FT                   /product="glucose-6-phosphate isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83051"
FT                   /db_xref="GOA:D0Z9W1"
FT                   /db_xref="InterPro:IPR001672"
FT                   /db_xref="InterPro:IPR018189"
FT                   /db_xref="InterPro:IPR023096"
FT                   /db_xref="InterPro:IPR035476"
FT                   /db_xref="InterPro:IPR035482"
FT                   /db_xref="UniProtKB/TrEMBL:D0Z9W1"
FT                   /protein_id="ACY83051.1"
FT                   /translation="MKNINPTRTAAWQALQQHFEQMKSVQMRDLFAADADRFSKFSATF
FT                   DDQMLVDYSKNRINAETLEKLQALARETDLQGAIAAMFAGEKINRTEDRAVLHIALRNR
FT                   SNTPIYVDGKDVMPEVNAVLAKMKQFCVRVIDGEWRGYTGKTITDVVNIGIGGSDLGPY
FT                   MVTEALRPYKNHLAMHFVSNVDGTHIAETLQRLNPETTLFLVASKTFTTQETMTNAHSA
FT                   RDWFLQAAGDERHVAKHFAALSTNAQAVAAFGIDTANMFEFWDWVGGRYSLWSAIGLSI
FT                   ALSIGYDNFEQLLAGAHAMDRHFASAPLQQNLPVLLALIGIWYNNFFGAETEAILPYDQ
FT                   YMHRFPAYFQQGNMESNGKYVDRNGQAVDYQTGPIIWGEPGTNGQHAFYQLIHQGTKLI
FT                   PCDFIAPAISHNPLGDHHSKLLSNFFAQTEALAFGKSREAVEEEFAKAGKSAAEVQHIV
FT                   PFKVFEGNRPTNSILLREITPYSLGMLIALYEHKIFTQGAILNIFSFDQWGVELGKQLA
FT                   NRILPELEDAQPVRSHDSSTNALINRFKAWRA"
FT   gene            complement(233251..234498)
FT                   /locus_tag="ETAE_0205"
FT   CDS_pept        complement(233251..234498)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAE_0205"
FT                   /product="putative Na+/H+-dicarboxylate symporter"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83052"
FT                   /db_xref="GOA:D0Z9W2"
FT                   /db_xref="InterPro:IPR001991"
FT                   /db_xref="InterPro:IPR036458"
FT                   /db_xref="UniProtKB/TrEMBL:D0Z9W2"
FT                   /protein_id="ACY83052.1"
FT                   /translation="MHILRHYTFTLCLLLGIILGGLAGILFGERATLVQPIGELFLNLM
FT                   FVVIVPLVFLSIASSIADMRQMSRLGKIMGTVFSVFIATALFAALIGFVATHLFNPFHN
FT                   VDTQSLIAHLPPAPQEQSKGLGEVIVSTFTVPDFLQLFTKSNLLPLIVFSILFGLATAF
FT                   SGEQGRPVAQFLSAGTTVILRMVKIIMYAAPLGLGCYFAATVGALGPQIIHGYLNAFLL
FT                   YVVLTVIYFFGANTLYAFIAGGRPAVRLFWGNVFTPAITAIATASSAACIPVNLVASKK
FT                   MGVPADIAETVIPLGANTHKDGSVIGGIIKIVFLFTLFGRDMSDPMSIAAIISVAFLVG
FT                   AVMGAIPSGGMTGELMICAVFGFSPELVGTIMIISTIIDIPATLLNSTGNTVCAMLVTR
FT                   FVEGKAWLQRQWETAE"
FT   gene            234555..234695
FT                   /locus_tag="ETAE_0206"
FT   CDS_pept        234555..234695
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAE_0206"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83053"
FT                   /db_xref="UniProtKB/TrEMBL:D0Z9W3"
FT                   /protein_id="ACY83053.1"
FT                   /translation="MILADYANYLPLSPPAPNLCDARRAACDVGGFLAPGDRRQNGNIV
FT                   N"
FT   gene            234732..235139
FT                   /gene="psiE"
FT                   /locus_tag="ETAE_0207"
FT   CDS_pept        234732..235139
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="psiE"
FT                   /locus_tag="ETAE_0207"
FT                   /product="phosphate-starvation-inducible protein PsiE"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83054"
FT                   /db_xref="GOA:D0Z9W4"
FT                   /db_xref="InterPro:IPR009315"
FT                   /db_xref="InterPro:IPR020948"
FT                   /db_xref="UniProtKB/TrEMBL:D0Z9W4"
FT                   /protein_id="ACY83054.1"
FT                   /translation="MPGTERANRVATVLQWILNIGLMALAAILVIFLAKETFTLAGVLF
FT                   DANQNASTYMLVEGIVIYFLYFEFIALIVKYFQSGYHFPLRYFIYIGITAIIRLIIVDH
FT                   ESPNDTLIYSFAILVLVIALYLANTDRLKRE"
FT   gene            complement(235228..236118)
FT                   /gene="malG"
FT                   /locus_tag="ETAE_0208"
FT   CDS_pept        complement(235228..236118)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="malG"
FT                   /locus_tag="ETAE_0208"
FT                   /product="ABC-type maltose transport system, permease
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83055"
FT                   /db_xref="GOA:D0Z9W5"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D0Z9W5"
FT                   /protein_id="ACY83055.1"
FT                   /translation="MAMVQPQSLRYRLWLTHLLMILFIALIMFPLLMVIAISLRAGNFA
FT                   TGSLIPDQISWEHWKLALGISVTAPDGRVTPPPFPVLLWLWNSIKVAVTTALGILTLST
FT                   TCAYAFARMRFRGKSSLLKGMLIFQMFPAVLSLVALYALFDRIGQYVPFLGLNTLGGVI
FT                   FAYMGGIALHVWTIKGYFETIDGSLEEAAALDGATPWQAFRLVLLPLSVPILAVVFILS
FT                   FIAAITEVPVASLLLRDVNTYTLAVGMQQYLNPQNYLWGDFAAAAVLSAMPITAVFLLA
FT                   QRWLVGGLTAGGVKG"
FT   gene            complement(236133..237704)
FT                   /gene="malF"
FT                   /locus_tag="ETAE_0209"
FT   CDS_pept        complement(236133..237704)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="malF"
FT                   /locus_tag="ETAE_0209"
FT                   /product="ABC-type sugar transport system, permease
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83056"
FT                   /db_xref="GOA:D0Z9W6"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR029345"
FT                   /db_xref="InterPro:IPR030156"
FT                   /db_xref="InterPro:IPR035277"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D0Z9W6"
FT                   /protein_id="ACY83056.1"
FT                   /translation="MSLSQTEYPASEPRRLCPRTGLKWLAVGLLTLLTGYLTIVMYAQG
FT                   EYLFAMLTLILLGGGLYIFANRRAYAWRYVYPGLAGMGLFVLFPLICTIAIAFTNYSST
FT                   NQLSQERAQSVLLQRMFTSGQTYAFSLYPDGDQWRLQLTDAQNGQRYLSGPFTLSQSDL
FT                   QISMAPADGAPQGSAATLRTVTQHRQTLNSLVALLPDGAALRMSSLRQFAASRPLYTLG
FT                   DDGRTLTDNQSGIAYRPNMQSGFYQAVNADGNWRSERLSPGFTVTTGWKNFLRVLDDEG
FT                   IRQPFISIFIWTLVFSVLTVIFTVAVGMVLACVVQWEALRGRAAYRVLLILPYAVPAFI
FT                   SILIFKGLFNQSFGEINMMLSQLFGIRPAWFSDPLTAKCMILIVNTWLGYPYMMILCMG
FT                   LLKAIPEDLYEASAMDGAGPLQNFFRITLPMLIKPLTPLMIASFAFNFNNFVLIQLLTN
FT                   GGPDMLGTSTPAGYTDLLVSYTYRIAFEGGGGQDFGLAAAIATLIFLLVGALAILNLKA
FT                   SKMNFD"
FT   gene            complement(237842..239035)
FT                   /gene="malE"
FT                   /locus_tag="ETAE_0210"
FT   CDS_pept        complement(237842..239035)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="malE"
FT                   /locus_tag="ETAE_0210"
FT                   /product="maltose ABC transporter periplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83057"
FT                   /db_xref="GOA:D0Z9W7"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="InterPro:IPR006060"
FT                   /db_xref="InterPro:IPR006061"
FT                   /db_xref="UniProtKB/TrEMBL:D0Z9W7"
FT                   /protein_id="ACY83057.1"
FT                   /translation="MTKTSAIKTIALSALAALVISAPALAKIEEGKLVIWINGDKGYNG
FT                   LADVGKKFEQETGIKVTVEHPDKLEEKFPQVAATGDGPDIIFWAHDRFGGYAQSGLLAE
FT                   IHPSKAFQEKLYPFTWDAVRYNGKLIAYPIAVEALSLIYNKDLLPNPPKSWEEIPALDS
FT                   KLRAQGKSAIMWNLQEPYFTWPLIAADGGYAFKYANGRYETNNVGVDNAGSRAGLQFLV
FT                   DMVKNKHINADTDYSIAEAAFNKGQTAMTINGPWAWSNIDKSGINYGITLLPTFKGHPS
FT                   KPFVGVLSAGINAASPNKELATEFIENYLLTDSGLAMVNQDKPLGAVALKSYQEILEKD
FT                   PRIAATMQNSQNGEIMPNIPQMSAFWYAERAAIINAINGRQSVTQALESAKERILKK"
FT   gene            239090..239239
FT                   /locus_tag="ETAE_0211"
FT   CDS_pept        239090..239239
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAE_0211"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83058"
FT                   /db_xref="UniProtKB/TrEMBL:D0Z9W8"
FT                   /protein_id="ACY83058.1"
FT                   /translation="MAAYRTLRSWGYRRVPAGRRGQERRCCVIVRESRPILILPRSTPC
FT                   GAFL"
FT   gene            complement(239358..239492)
FT                   /locus_tag="ETAE_0212"
FT   CDS_pept        complement(239358..239492)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAE_0212"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83059"
FT                   /db_xref="UniProtKB/TrEMBL:D0Z9W9"
FT                   /protein_id="ACY83059.1"
FT                   /translation="MAAARRRRRGKGRCASMNGHDSARKTRTRGSSIGAFLLAEEAGG"
FT   gene            239519..240628
FT                   /gene="malK"
FT                   /locus_tag="ETAE_0213"
FT   CDS_pept        239519..240628
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="malK"
FT                   /locus_tag="ETAE_0213"
FT                   /product="maltose/maltodextrin transporter ATP-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83060"
FT                   /db_xref="GOA:D0Z9X0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="InterPro:IPR015855"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D0Z9X0"
FT                   /protein_id="ACY83060.1"
FT                   /translation="MANVSLRNVYKAYGEAVISRDINLDIEDGEFVVFVGPSGCGKSTL
FT                   LRMIAGLEDITSGELQIAGVRMNDVPPAKRGIGMVFQSYALYPHLSVADNMSFGLKLAG
FT                   VNKAEIQRRVNQVAEILQLAHLLDRRPKALSGGQRQRVAIGRTLVAEPDVFLLDEPLSN
FT                   LDAALRVQMRIEISRLHKRLQRTMIYVTHDQVEAMTLADKIVVLDAGRIAQVGKPLALY
FT                   HYPADRFVAGFIGSPKMNFLPVKVSEAQPQRVRVELPNGQHIWLPVAGEGLRPGSNLSL
FT                   GIRPEHLVPSAAADVTLSGEVQVVEQLGNETQIHIQIPALRQNLVYRQNDVVLVDEGAT
FT                   LAIGLPAERCHLFREDGSACQRLYQEPGV"
FT   gene            240696..241973
FT                   /gene="lamB"
FT                   /locus_tag="ETAE_0214"
FT   CDS_pept        240696..241973
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lamB"
FT                   /locus_tag="ETAE_0214"
FT                   /product="maltoporin"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83061"
FT                   /db_xref="GOA:D0Z9X1"
FT                   /db_xref="InterPro:IPR003192"
FT                   /db_xref="InterPro:IPR036998"
FT                   /db_xref="UniProtKB/TrEMBL:D0Z9X1"
FT                   /protein_id="ACY83061.1"
FT                   /translation="MMNMRKLPLALAVASVVLSAQAMAVDFHGYARSGIGWSSKGGDQK
FT                   CFQADGAGSKYRLGNECDTYAELKLGQELWKSGDQSFYLDTNVAYGIDQANDWESTSPA
FT                   FREINVQGKNVITWLPGSTLWAGKRYYQRHDVHMIDFYYWDISGPGAGLENIDLGFGKL
FT                   SLAVTRNTESGGSYSYFVNQSNEKYIRNTANDVYDIRLAGLQTNPGGSLELGFDYGRAN
FT                   LDDGYHLAPGATKDGYMFTAEHTQSLWGGFNKFVVQYATDAMSNTNNAGHSSGSSVNND
FT                   GHLIRVLDHGAMDFNDKWGLMYVAMYQDVDHDVQNGSTWYTAGVRPMYKWTPTMSTLFE
FT                   AGYDNVKSQKTGARNELYKLTLAQQWQAGDSVWSRPAIRIFATYANGKNNWNTDKDGIQ
FT                   VNTQPGDIRAEGVPGWSFGAQMEAWW"
FT   gene            242070..242975
FT                   /gene="malM"
FT                   /locus_tag="ETAE_0215"
FT   CDS_pept        242070..242975
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="malM"
FT                   /locus_tag="ETAE_0215"
FT                   /product="maltose regulon periplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83062"
FT                   /db_xref="GOA:D0Z9X2"
FT                   /db_xref="InterPro:IPR010794"
FT                   /db_xref="UniProtKB/TrEMBL:D0Z9X2"
FT                   /protein_id="ACY83062.1"
FT                   /translation="MMKTALNRLSRGVLLACALCSAPQAFADTLLPTDVAAAPELSHTA
FT                   LQALRWQPLTPPVDTTITLGPDSQTLAQGDIQGAVAALALPANRGSLEITLSSRLHNKR
FT                   LYVPNVLVLDQHLRPAAYYPGSYFTYRQPGVMSGDRLEGTLKLTPVLGQQQIYLLIYTT
FT                   RQDLATTTRMVNPAKAYAAGVGNAVPDIPDPQAAHASQGGLSIQARVERQSGNVMIGGL
FT                   LPGGDTPADVAVGSPASAAAVAAPATPMLDDTAAYFDRSIRSAVRQGDIDKALRLMNEA
FT                   QRLGSTTARETFIRSVKGKG"
FT   gene            243232..243744
FT                   /gene="ubiC"
FT                   /locus_tag="ETAE_0216"
FT   CDS_pept        243232..243744
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ubiC"
FT                   /locus_tag="ETAE_0216"
FT                   /product="chorismate pyruvate lyase"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83063"
FT                   /db_xref="GOA:D0Z9X3"
FT                   /db_xref="InterPro:IPR007440"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="UniProtKB/TrEMBL:D0Z9X3"
FT                   /protein_id="ACY83063.1"
FT                   /translation="MYGMAEHSAALANIDWQPLADAAAPADYGSWLAEQGSMTRRLEQR
FT                   CDRLQVTVLREGPVDATQLSDDERGQLSPCAQYWLREVILLGDGIPWLFGRTLTPSSTL
FT                   QGEGEALRRLGNTPLGRYLFSGVALERESLRVGCLGPLWARRSRLRVAGQPLLLTELFL
FT                   ADAPIYG"
FT   gene            243770..244633
FT                   /gene="ubiA"
FT                   /locus_tag="ETAE_0217"
FT   CDS_pept        243770..244633
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ubiA"
FT                   /locus_tag="ETAE_0217"
FT                   /product="4-hydroxybenzoate polyprenyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83064"
FT                   /db_xref="GOA:D0Z9X4"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR006370"
FT                   /db_xref="InterPro:IPR030470"
FT                   /db_xref="InterPro:IPR039653"
FT                   /db_xref="UniProtKB/TrEMBL:D0Z9X4"
FT                   /protein_id="ACY83064.1"
FT                   /translation="MEGCVTQSKWLAYCRLMRIDKPIGSLLLLWPTYWALWLAGGAAPG
FT                   GKLLLVFTCGVFFMRAAGCVINDFADRHFDGHVKRTCQRPLPCGALSEREAKTLFVLLV
FT                   ALSFALVLTLNAMTIWLSVAALTLAWLYPFMKRFSHLPQVILGMAFGWSIPMAYAAVGE
FT                   SLPLSCWLLFVANICWTVAYDTQYAMVDRDDDLRIGIKSTAILFGRYDRLMIGLLQFAT
FT                   LLLLLWVGDLNQLQGAYYWGVLLAAALFVYQQRLIARRARTSCFRAFMNNNYVGLILFL
FT                   GILLAL"
FT   gene            244922..246598
FT                   /locus_tag="ETAE_0218"
FT   CDS_pept        244922..246598
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAE_0218"
FT                   /product="putative major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83065"
FT                   /db_xref="GOA:D0Z9X5"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D0Z9X5"
FT                   /protein_id="ACY83065.1"
FT                   /translation="MSVDNSVPTPRDGERRAADVRPGFFSKARIIARPGFNRWLVPPAA
FT                   LAIHLCIGMAYGFSVFWLPLSQALGDGAARACPAPMSAWQELFTTQCDWRISMLGWTYT
FT                   LFFIFLGCSAALWGSWLEKAGPRKVGVVAACCWCGGLMFSALGVYLHQLWMLWLGSGVI
FT                   GGIGLGLGYISPVSTLIRWFPDRRGMATGLAIMGFGGGAMVGAPLANSLMHFYAAAGGV
FT                   GVWQTFLTLALIYWVFMLSGALAYRIPPIGWRPQGMAAATATPAARGFTHVEVHVSVAC
FT                   RTPQFWLVWAVLCLNVSAGIGIIGMASPLLQEVFAGRLLGGSQTFAELSSAQLAQIAAI
FT                   AAGFTGLLSLFNIGGRFFWASLSDRIGRKRTFFLFFTLGVALYSLLPTLGALGSVTLFV
FT                   LAFCLIVSMYGGGFATVPAYLADLFGTQMVGAIHGRLLTAWSAAGILGPVLVNYLREYQ
FT                   LSRGVARAQAYSETLYILAGLLLVGLVCNLLIRPVDRRHSMSEAQLAQARSLYKVNPNA
FT                   QLSWAADAGSRPWVALSWLAVGLPLLWGCWITLLQAGQLFG"
FT   gene            complement(246656..249112)
FT                   /gene="plsB"
FT                   /locus_tag="ETAE_0219"
FT   CDS_pept        complement(246656..249112)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="plsB"
FT                   /locus_tag="ETAE_0219"
FT                   /product="glycerol-3-phosphate O-acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83066"
FT                   /db_xref="GOA:D0Z9X6"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="InterPro:IPR022284"
FT                   /db_xref="InterPro:IPR028354"
FT                   /db_xref="InterPro:IPR041728"
FT                   /db_xref="UniProtKB/TrEMBL:D0Z9X6"
FT                   /protein_id="ACY83066.1"
FT                   /translation="MSGWRKIYYKLLNLPLKLLVKSKVIPTDPVAELRLDTTRPVFYVL
FT                   PYNSKADLLTLRDRCLALDLPDPLDDNEIDGVILPRYVFIDDGPRVFRYYAPKQASVKL
FT                   FLDYLDLHRGNPALDIQMIPVSVMFGRAPGREDHKGAPQLRLLNGIQKFFAVLWLGRDS
FT                   FVRFSNTVSLRYMADEHGTDKTIAQKLARVARMHFSRLRLAAVGPRLPDRQALFNKLLG
FT                   SKAIEKAVEDEARSKKISREKAQQNAVALMEEIAADFTYEAVRLSDRVLSWTWNRLYQG
FT                   INVHNAERVRQLAQDGHEIVYVPCHRSHMDYLLLSYVLYHQGLVPPHIAAGINLNFWPA
FT                   GPIFRRLGAFFIRRTFKGNKLYSTVFREYLGELFSRGYSVEYFMEGGRSRTGRLLEPKT
FT                   GTLAMTLQAMLRGGKRPITLVPVYIGYEHVMEVATYAKELRGATKEKESLPQMVRGLRK
FT                   LRNLGQGYVNFGEPISLNVWLNQHVPEWREAIDPIEAQRPHWLTPSVNSIAGEVMVNIN
FT                   KAAAANAMNLCATALLASRQRALTREQLLEQLECYLQLLRNVPYAPDATLPQRTPQELL
FT                   DHALQMNKFEVEKDNIGDLIILPREQAVLMTYYRNNIQHMLVLPSLVASMVIHHRQISR
FT                   GELLRQAAVIYPMLKQELFMHYAPETLPQVLSPVIDELCRQQLISLQDDTLSINPPRIR
FT                   ALQLLAAGVRETLQRYAITFSLLSANPSISRGALEKESRILAQRLSVLHGINAPEFFDK
FT                   AVFATLVTTLRAEGYINDVGDAVREQTLEIYNLLADLLTPEIRLTIESVSIAALEDASG
FT                   ASDGAA"
FT   gene            249205..249600
FT                   /gene="dgkA"
FT                   /locus_tag="ETAE_0220"
FT   CDS_pept        249205..249600
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dgkA"
FT                   /locus_tag="ETAE_0220"
FT                   /product="diacylglycerol kinase"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83067"
FT                   /db_xref="GOA:D0Z9X7"
FT                   /db_xref="InterPro:IPR000829"
FT                   /db_xref="InterPro:IPR033718"
FT                   /db_xref="InterPro:IPR036945"
FT                   /db_xref="UniProtKB/TrEMBL:D0Z9X7"
FT                   /protein_id="ACY83067.1"
FT                   /translation="MPANAHRYGLSMNSTTGLTRIIKAAGYSIKGLQAAWRHEAAFRQE
FT                   SLLLAAAVALACWLDVTAVERILLIGSVTLVVILEILNSAIEAVVDRIGSERHELSGRA
FT                   KDMGSAAVFVALWLALFVWVSILWTHW"
FT   gene            complement(249723..251180)
FT                   /gene="ybdS"
FT                   /locus_tag="ETAE_0221"
FT   CDS_pept        complement(249723..251180)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybdS"
FT                   /locus_tag="ETAE_0221"
FT                   /product="citrate carrier/transporter"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83068"
FT                   /db_xref="GOA:D0Z9X8"
FT                   /db_xref="InterPro:IPR001898"
FT                   /db_xref="InterPro:IPR030676"
FT                   /db_xref="UniProtKB/TrEMBL:D0Z9X8"
FT                   /protein_id="ACY83068.1"
FT                   /translation="MSKEKIGKLLAPLVVMGIMFMIPVPDGMPPQAWHYFAVFVAMIVG
FT                   MILEPIPATAISFIAVTIVVIGNQFLLFDAKELADPAFNASKQALKWGLAGFSSTTVWL
FT                   VFGAFIFALGYEVSGLGRRIALLLVKFMGKRTLTLGYAIVIIDILLAPFTPSNTARTGG
FT                   TVFPVIKNLPPLFDSHPNDPSSRRIGSYLMWMMVISTSISSSMFVTGAAPNVLGLEFVS
FT                   KIAGIQISWMQWFLGFLPVGLLLLIVAPWLSYVLYKPTVTHSEQVATWAGSALKEMGAL
FT                   TRREITLICLVLLSLALWVFGDDFINATAVALLAVALMLALHVVPWKDVTKYSGAWNTL
FT                   VNLSTLVVMANGLTRSGFIEWFAKTMSTHLAGFSPTATVIALVLVFYFAHYLFASLTAH
FT                   TATMLPVILAVAQSIPGVPMDQLCLLLVLSIGLMGCLTPYATGPGIIIYGCGYVKSQDY
FT                   WRLGAIFGVIYIAALLGIGWPIMAMWN"
FT   gene            complement(251210..252121)
FT                   /gene="citG"
FT                   /locus_tag="ETAE_0222"
FT   CDS_pept        complement(251210..252121)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="citG"
FT                   /locus_tag="ETAE_0222"
FT                   /product="triphosphoribosyl-dephospho-CoA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83069"
FT                   /db_xref="GOA:D0Z9X9"
FT                   /db_xref="InterPro:IPR002736"
FT                   /db_xref="InterPro:IPR017551"
FT                   /db_xref="UniProtKB/TrEMBL:D0Z9X9"
FT                   /protein_id="ACY83069.1"
FT                   /translation="MQHPTTYSPHRLSLSQACRHYATLGWRAMLAEVNLTPKPGLVDRH
FT                   NSGAHRDMAHSDFVRSADAIAPWLARFVEYGADSAALDGGSVLPGLRALGIACEADMFR
FT                   ATAGVNTHKGSIFSLGLLCAAAGRSHQRGHPITPARLCGYAAQFCRGLVARELAPLRPA
FT                   QASTAGQRLFMTLGITGARGEAEAGYPLVLNLALPHYQRTLAAGRDPELALLDTLVQLM
FT                   AHNQDTNVAARGGEGGLRWMQQRAAALLATGGIRTPADLQALHRFDAECIDRHLSPGGS
FT                   ADLLILTWFLAHLCYPILQAEH"
FT   gene            complement(252099..252650)
FT                   /gene="citX"
FT                   /locus_tag="ETAE_0223"
FT   CDS_pept        complement(252099..252650)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="citX"
FT                   /locus_tag="ETAE_0223"
FT                   /product="2-(5-triphosphoribosyl)-3-dephospho-CoA:apo-citrate
FT                   lyase"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83070"
FT                   /db_xref="GOA:D0Z9Y0"
FT                   /db_xref="InterPro:IPR005551"
FT                   /db_xref="UniProtKB/TrEMBL:D0Z9Y0"
FT                   /protein_id="ACY83070.1"
FT                   /translation="MMTLLPHLAASHTVTLPELLLSRECRQSRQAAWLTRHTCTLISFT
FT                   VVAPGPVKDSPLTRRIFNAGIAALNQLAQRQEWPLREQRSLELATGPEGLMAIDAPAEQ
FT                   VKRAAIALEQAHPLGRLWDMDVLASDGQILSRSDYQLPARRCLICQRPAVLCARERRHD
FT                   VAQLLAHMEALVHDATPDNV"
FT   gene            complement(252654..254174)
FT                   /gene="citF"
FT                   /locus_tag="ETAE_0224"
FT   CDS_pept        complement(252654..254174)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="citF"
FT                   /locus_tag="ETAE_0224"
FT                   /product="citrate lyase alpha chain/citrate-ACP
FT                   transferase"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83071"
FT                   /db_xref="GOA:D0Z9Y1"
FT                   /db_xref="InterPro:IPR006472"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:D0Z9Y1"
FT                   /protein_id="ACY83071.1"
FT                   /translation="MTQDTQRNARVAAFSQRDGALPAFNDVSKAQYHDGRARDRKLCTS
FT                   LEEAIRRSGLRDGMTISFHHAFRGGDLTLNQVMDAIAAMGFKDLTLASSSLSDCHAPLV
FT                   GHIRNGVVRKIYTSGLRGPLADAVSHGLLDEPVQIHSHGGRVHLIDSGELSIDVAFLGV
FT                   PACDAFGNANGYTGNACCGSLGYARADAEAANSVVLLTEEILPYPHNPASLTQDQVDLI
FT                   VQIDHVGDASKIGADATRMTSNPRELLIARSAAEVIAHSGYFNEGFSLQTGTGGASLAV
FT                   TRFLEDKMRRADIRADFALGGITSTIVDLHEKGYIRKLLDVQSFDRAAAGSLARNPNHI
FT                   EISANQYANWSSKGASVDRLDVVVLSALEVDTHFNVNVLTGSDGVLRGASGGHCDTAIG
FT                   SALSIIVAPLVRGRIPTIVDSVLTCVTPGSSIDILVTDHGIAVNPARPELAQRLRDAGL
FT                   PLVSIEWLRDRALSLTGEPKPIAFTDKVVAVVRYRDGSVIDVVRQVKE"
FT   gene            complement(254185..255081)
FT                   /gene="citE"
FT                   /locus_tag="ETAE_0225"
FT   CDS_pept        complement(254185..255081)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="citE"
FT                   /locus_tag="ETAE_0225"
FT                   /product="citrate lyase beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83072"
FT                   /db_xref="GOA:D0Z9Y2"
FT                   /db_xref="InterPro:IPR005000"
FT                   /db_xref="InterPro:IPR006475"
FT                   /db_xref="InterPro:IPR011206"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:D0Z9Y2"
FT                   /protein_id="ACY83072.1"
FT                   /translation="MTPQQKTRTRRSMLFVPGSNAAMLSNAFIYKADALMFDLEDSVVL
FT                   REKDAARRLVYHALQHPLYHDIETIVRVNALDSAYGVADLEAVVRAGVDVVRLPKTDSA
FT                   DDVIAIENEIARIERACGREVGSTGLLAAIESAQGITQAVAIAHASPRLIGIALGAEDY
FT                   VRNLRTERSAEGIELLFARCSILQAARSAGIQAFDTVYSDANNDEGFLREASHIKQLGF
FT                   DGKSLINPRQIELLHNLYAPTQKEVDHARLVVDAAEASAREGRGVVSLNGKMVDSPVIE
FT                   RARLVLSRAALSGIREE"
FT   gene            complement(255078..255377)
FT                   /gene="citD"
FT                   /locus_tag="ETAE_0226"
FT   CDS_pept        complement(255078..255377)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="citD"
FT                   /locus_tag="ETAE_0226"
FT                   /product="citrate lyase, gamma subunit"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83073"
FT                   /db_xref="GOA:D0Z9Y3"
FT                   /db_xref="InterPro:IPR006495"
FT                   /db_xref="InterPro:IPR023439"
FT                   /db_xref="UniProtKB/TrEMBL:D0Z9Y3"
FT                   /protein_id="ACY83073.1"
FT                   /translation="MKINHAAVAGTLESSDVMVRIAPIEDDQALDLQISSSVEKQFGDA
FT                   IRATVLDVLNRYQVRGVQLIVDDKGALDCVLRARLETLLARAADLVSLPWEDRA"
FT   gene            complement(255374..256450)
FT                   /gene="citC"
FT                   /locus_tag="ETAE_0227"
FT   CDS_pept        complement(255374..256450)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="citC"
FT                   /locus_tag="ETAE_0227"
FT                   /product="citrate lyase synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83074"
FT                   /db_xref="GOA:D0Z9Y4"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR005216"
FT                   /db_xref="InterPro:IPR013166"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D0Z9Y4"
FT                   /protein_id="ACY83074.1"
FT                   /translation="MFSNTVFTQIKRSEQKRIADITHFLRENGLNIDTSVEIFICAQRD
FT                   NKIIACGGIAGDIIKCVAISATARGEGLALTLATELVNLAYELGRNNLFIYTKEENEEM
FT                   FHQCGFSTITRVPGIMVLMENSKVRLQRYAETLATLRHPGKKIGAIVMNANPFTNGHRY
FT                   LVRQAASQCDWLHLFLVREDTSRFPYEDRLALVRSGVSDIANITLHPGSEYIISRATFP
FT                   CYFIKEQGVADNCYTEIDIKIFRQYLAPALGITHRFVGTEPFCPVTAKYNQDMRYWLET
FT                   PALPSPPIHLVEVARLTYHNTPISASWVRKLLVRKDLPAITPLVPDATRAYLARLIASM
FT                   PAGAERRPQESVLVTGDK"
FT   gene            256838..258481
FT                   /gene="citA"
FT                   /locus_tag="ETAE_0228"
FT   CDS_pept        256838..258481
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="citA"
FT                   /locus_tag="ETAE_0228"
FT                   /product="sensor histidine kinase DpiB"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83075"
FT                   /db_xref="GOA:D0Z9Y5"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR016120"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR033463"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR039506"
FT                   /db_xref="UniProtKB/TrEMBL:D0Z9Y5"
FT                   /protein_id="ACY83075.1"
FT                   /translation="MVRMPNNSAVNFFRRMAFPLRIFLLLLLVSCCLFAALGKYLSASF
FT                   EDYMMRQVRDMAMNQAKIIASMDSIVDGVKDRDTHRLALIADRLGTGTDFDYVVIGDRN
FT                   AIRLYHPNPAKIGHKMQFNKPGAIEKGESYFISGKGSLGQALRAKTPIFDHQGQVIGVV
FT                   SLGYLVSKIDSWRLDFLLPMAGVFVCVLLLLMLLSWLFAAHIRRQMMGMEPRQIARVVR
FT                   QMEALFGAVFEGLIAVDPDGQITAINRNARKMLGLSAPGRQWLGQPISQVVSPSGFFTD
FT                   RINEDRRDAILTFNGLSVIANRATIRSDDGDTLLGAIISFRSKDDINTLNAQLTQIRQY
FT                   VDSLRTVRHEHLNWMSTLSGLLQMKEYDRALEMVRGASQAQQQLIDRLRDAFSDKVVAG
FT                   LLFGKVHRARELGLTLTIVDGSQLHALPAGLDSTEFAAVLGNLLDNAFDASLKNPQGGG
FT                   CVEVYLSDEGSEVIIEVADQGCGVPDTLKDKIFEQGVSTKAEEPGEHGIGLYLIARYVG
FT                   RCGGTITLEDNQPYGTLFSVFIPKVKSEHE"
FT   gene            258474..259160
FT                   /gene="citB"
FT                   /locus_tag="ETAE_0229"
FT   CDS_pept        258474..259160
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="citB"
FT                   /locus_tag="ETAE_0229"
FT                   /product="DNA-binding response regulator DipA"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83076"
FT                   /db_xref="GOA:D0Z9Y6"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR024187"
FT                   /db_xref="InterPro:IPR028141"
FT                   /db_xref="UniProtKB/TrEMBL:D0Z9Y6"
FT                   /protein_id="ACY83076.1"
FT                   /translation="MNKINILIVEDETPLAEMHAEFIRNHPCCGQLWLAGNLAQARAMI
FT                   KSFHPDLVLLDNYLPDGVGVHLLHELTQQRYPGGVVLTTAASDMDTVSEAVRSGAFDYL
FT                   IKPIAYERLGQTLERYQQRNSMLSGHQNASQRQIDSMYNAYARGDSKEDLPVGIDALTL
FT                   EKVQGLFVDDTVRHTAESVAQSLMLSRTTARRYLEFCAARQQIVAEIVYGKVGRPQRIY
FT                   RAQGKS"
FT   gene            259281..259889
FT                   /gene="lexA"
FT                   /locus_tag="ETAE_0230"
FT   CDS_pept        259281..259889
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lexA"
FT                   /locus_tag="ETAE_0230"
FT                   /product="SOS-response transcriptional repressor
FT                   (RecA-mediated autopeptidase)"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83077"
FT                   /db_xref="GOA:D0Z9Y7"
FT                   /db_xref="InterPro:IPR006197"
FT                   /db_xref="InterPro:IPR006199"
FT                   /db_xref="InterPro:IPR006200"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR039418"
FT                   /db_xref="UniProtKB/TrEMBL:D0Z9Y7"
FT                   /protein_id="ACY83077.1"
FT                   /translation="MKALTARQQQVYDLIRDHIEQTGMPPTRAEIAQRLGFRSPNAAEE
FT                   HLKALQRKGVIEIVSGASRGIRLLMEDETGLPLIGQVAAGEPLLAQQHIEGFYQVDPSL
FT                   FKPSADFLLRVNGMSMRDIGILDGDLLAVHKTQDVRNGQVVVARIEDEVTVKRLKKQGN
FT                   MVQLLPENSDFQPIVVDLREQNFTIEGLAVGVIRNGDWI"
FT   gene            260045..261376
FT                   /locus_tag="ETAE_0231"
FT   CDS_pept        260045..261376
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAE_0231"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83078"
FT                   /db_xref="GOA:D0Z9Y8"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:D0Z9Y8"
FT                   /protein_id="ACY83078.1"
FT                   /translation="MRGFFQEDKALWRLALPMILSNVSVPLLGIVDTAVIGHLDSPVYL
FT                   GGVAVGSMATTFLFMLLLFLRMSTTGLCAQAFGAADRPALARALVQPLIMALLAGVGII
FT                   LLRQPLSALMLQIVGAEAAIQTQAQLFMQIRWLSAPATLANLVILGWLLGVQYARAPVL
FT                   LLIVGNAVNIALDLWLVVGLGWKVAGAAWATVIADYVTLLMGVALLLHVMRLRGLRRAH
FT                   FRRAWRGNLRRLLALNRDIMLRSLLLQLCFASLTVIGARMGADVVAVNAVLMNLLTFTA
FT                   YALDGFAYAVEAYSGQAYGARDASALRRVWRAACRQAGAVALLFALAYGLFGRDIVNLL
FT                   TSLPQVQSLALDYLPWQVVLPLLGVWCYLLDGMFIGATRGADMRNSMAVAALGYGMTLL
FT                   SIPWLGNHGLWLALAVFLTLRGLSLWLIWRRCWRAQRWFPAGAA"
FT   gene            complement(261393..261866)
FT                   /gene="zur"
FT                   /locus_tag="ETAE_0232"
FT   CDS_pept        complement(261393..261866)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="zur"
FT                   /locus_tag="ETAE_0232"
FT                   /product="zinc uptake transcriptional repressor"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83079"
FT                   /db_xref="GOA:D0Z9Y9"
FT                   /db_xref="InterPro:IPR002481"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D0Z9Y9"
FT                   /protein_id="ACY83079.1"
FT                   /translation="MTTPTLQRLLAQAEQICRQRNVRLTPQRMEVLRLMAAQQGAISAY
FT                   DLLDLLRVSEPQAKPPTIYRALDFLLEQGFIHKVESTNSYVMCHHLDEPCHTSALFICH
FT                   RCGQVHERSADLLQQQLETLAQQAGFTLQHSVIEAHGLCHACAQAPDGETSAR"
FT   gene            262308..262979
FT                   /locus_tag="ETAE_0233"
FT   CDS_pept        262308..262979
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAE_0233"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83080"
FT                   /db_xref="UniProtKB/TrEMBL:D0Z9Z0"
FT                   /protein_id="ACY83080.1"
FT                   /translation="MDLILAIEHWPLRQAIVALYRRQFTIISLPDAVPFSPRILSALQR
FT                   TGSLLVTDRQRNHLLQTVERVRRHSLTPVIIINRRESYLTQLIARFFNNAHALSYDGFY
FT                   RHIQRRTFHPLDLYFLPYSRGAPDACWGAGETVHARLNAFGLMTLYQRGVTLREAAVLL
FT                   SLSYHNSTAMTARLLGIHEQAVVYCKRTLGNKLGLDHNRPDFISHIFLSPGARQGARAT
FT                   E"
FT   gene            263097..264155
FT                   /gene="yjbN"
FT                   /locus_tag="ETAE_0234"
FT   CDS_pept        263097..264155
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yjbN"
FT                   /locus_tag="ETAE_0234"
FT                   /product="tRNA-dihydrouridine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83081"
FT                   /db_xref="GOA:D0Z9Z1"
FT                   /db_xref="InterPro:IPR001269"
FT                   /db_xref="InterPro:IPR004653"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018517"
FT                   /db_xref="InterPro:IPR035587"
FT                   /db_xref="UniProtKB/TrEMBL:D0Z9Z1"
FT                   /protein_id="ACY83081.1"
FT                   /translation="MGYGEQAMTQAAHIEQATGARGRDQAGVFPSQRFSIAPMLDWTDR
FT                   HCRYFHRLLSRQTLLYTEMVTTGAIIHGKGDYLAYSEEEHPLALQLGGSNPADLARCAH
FT                   LAEARGYDEINLNVGCPSDRVQNGRFGACLMGEAQLVADCVKAMRDVVSIPVTVKTRIG
FT                   IDAQDSYPFLCDFIGTVAGQGECDTFIVHARKAWLSGLSPKENREVPPLDYPRVYRLKQ
FT                   DFPQFTIALNGGVKRLDEALTHLQHVDGVMMGREAYHNPGILAQVDRQLFDADAAVPDS
FT                   VAVVRALYPYIERELAQGTYLGHITRHILGLFQGIPGARQWRRHLSENAHRPGAGIDVV
FT                   EQALRFVDRRAE"
FT   gene            264319..264531
FT                   /gene="pspG"
FT                   /locus_tag="ETAE_0235"
FT   CDS_pept        264319..264531
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pspG"
FT                   /locus_tag="ETAE_0235"
FT                   /product="phage shock protein G"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83082"
FT                   /db_xref="GOA:D0Z9Z2"
FT                   /db_xref="InterPro:IPR014318"
FT                   /db_xref="UniProtKB/TrEMBL:D0Z9Z2"
FT                   /protein_id="ACY83082.1"
FT                   /translation="MLEVMFVLAFFMMLLLTGISLLGVIAALAVAALLLVFGGLFVLVI
FT                   KLLPWLALAIVVVWLYRALRKPASY"
FT   gene            264620..265003
FT                   /locus_tag="ETAE_0236"
FT   CDS_pept        264620..265003
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAE_0236"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83083"
FT                   /db_xref="InterPro:IPR005220"
FT                   /db_xref="InterPro:IPR036700"
FT                   /db_xref="UniProtKB/TrEMBL:D0Z9Z3"
FT                   /protein_id="ACY83083.1"
FT                   /translation="MYKKGAVLLVLLLSVHAYAGFNGSAAGYGSGGFSGPAAGAVSTAE
FT                   INGYTWMQDDKPVVLEGKIVRSLGGEHYVFSDAKGETMVEIDNDEWRGIQVTPQNRLRL
FT                   YGTVDKEMAEQSSVDVDRIEILR"
FT   gene            265185..266597
FT                   /gene="dnaB"
FT                   /locus_tag="ETAE_0237"
FT   CDS_pept        265185..266597
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaB"
FT                   /locus_tag="ETAE_0237"
FT                   /product="replicative DNA helicase"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83084"
FT                   /db_xref="GOA:D0Z9Z4"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR007692"
FT                   /db_xref="InterPro:IPR007693"
FT                   /db_xref="InterPro:IPR007694"
FT                   /db_xref="InterPro:IPR016136"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036185"
FT                   /db_xref="UniProtKB/TrEMBL:D0Z9Z4"
FT                   /protein_id="ACY83084.1"
FT                   /translation="MAGNNPGSKSREAPRDRQMEGLKLPPHSLEAEQSVLGGLMLDNER
FT                   WDHVAERVVSNDFYSRPHRLIFGEMQRLLEQGRPIDLITLSESLEQQGHLDSVGGFAYL
FT                   AELSKNTPSAANINAYADIVRERAVVREMIAVANEIADAGYDPQGRSSEDLLDLAESRV
FT                   FQIAENRASKDEGPKSIDRILEDTVSRIEQLYQRPHDGVTGVSTGYQDLDKKTAGLQKS
FT                   DLIIVAARPSMGKTTFAMNLCENAAMTQEKPVLIFSLEMPGEQIMMRMLASLSRVDQTR
FT                   IRTGQLDDEDWARISSTMGLLLEKRNMYIDDSSGLTPTEVRSRARRIFREHDGLSLIMI
FT                   DYLQLMRVPSLSDNRTLEIAEISRSLKALAKELQVPVVALSQLNRSLEQRADKRPVNSD
FT                   LRESGSIEQDADLIMFIYRDEVYHENSDLKGIAEIILGKQRNGPIGTVRLTFNGQWSRF
FT                   DNYAGPAYNDED"
FT   gene            complement(266670..266783)
FT                   /locus_tag="ETAE_0238"
FT   CDS_pept        complement(266670..266783)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAE_0238"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83085"
FT                   /db_xref="UniProtKB/TrEMBL:D0Z9Z5"
FT                   /protein_id="ACY83085.1"
FT                   /translation="MSQSAAINDGGCRFHVASLVPLMSLVGYRVGRTAPGS"
FT   gene            266739..267830
FT                   /gene="alr"
FT                   /locus_tag="ETAE_0239"
FT   CDS_pept        266739..267830
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="alr"
FT                   /locus_tag="ETAE_0239"
FT                   /product="alanine racemase"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83086"
FT                   /db_xref="GOA:D0Z9Z6"
FT                   /db_xref="InterPro:IPR000821"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR011079"
FT                   /db_xref="InterPro:IPR020622"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:D0Z9Z6"
FT                   /protein_id="ACY83086.1"
FT                   /translation="MKAATAIIDRRALRHNFQQIRKFAPHSRLIAVVKANAYGHGLLET
FT                   AKILHQADCYGVARIGEALMLRSGGIVKPILLLEGFFSASDLPVLVANNIETAVHSEEQ
FT                   LQALENARLERPIKVWMKLDTGMHRLGVRPEQAEAFYRRLCTCPNVAQPVNFMSHFSRA
FT                   DEPECGRTEQQLACFDDFVQGKAGEQSIAASGGILLWPQSHRDMVRPGIIMYGVSPQAD
FT                   LSLAADHYGLQPAMTLQSSLIAVREHKAGEPVGYGGAWVAQRDTRLGVVAIGYGDGYPR
FT                   SAPSGTPVLINGREVPIVGRVSMDMISVDLGPQAADRVGDNVIMWGPGLPVEKVAACTG
FT                   ISAYELITKLTSRVAMEYIGEEA"
FT   gene            complement(267903..269060)
FT                   /locus_tag="ETAE_0240"
FT   CDS_pept        complement(267903..269060)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAE_0240"
FT                   /product="putative iron-containing alcohol dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83087"
FT                   /db_xref="GOA:D0Z9Z7"
FT                   /db_xref="InterPro:IPR001670"
FT                   /db_xref="InterPro:IPR018211"
FT                   /db_xref="UniProtKB/TrEMBL:D0Z9Z7"
FT                   /protein_id="ACY83087.1"
FT                   /translation="MENFVLHTPTKILFGRDQIANLRDEIPPQARVLITYGGGSIKRNG
FT                   VLDQVHAALHGRHVFEFGGIEPNPHYETLMQAVEMVHNEKIDYLLAVGGGSVIDGTKFI
FT                   AAAADYVGDPWHIMETVGSDVTRAIPMGVVLTLPATGSEMNMGAVITRSATGDKLHFMS
FT                   PFVMPRFAVLDPQVTYTLPPRQIANGVVDAFVHIVEQYLTYPVDARVQDRFAEGLLQTL
FT                   IEEGPRALQEPENYGVRANIMWCATMALNGLIGAGVPQDWSTHMLGHELTAMHGLDHAQ
FT                   TLAIVLPNVLQLKRDKKHTKLLQYAERVWNIHSGSDEQRIDAAIDATRAFFEQMGVKTR
FT                   LSDYGLDGSTIPALLDKLQEHRMTALGEHGDITLEQSRQIYHAAR"
FT   gene            269059..269178
FT                   /locus_tag="ETAE_0241"
FT   CDS_pept        269059..269178
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAE_0241"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83088"
FT                   /db_xref="UniProtKB/TrEMBL:D0Z9Z8"
FT                   /protein_id="ACY83088.1"
FT                   /translation="MMQPSLIYLKSMNMSGVSAGMKFECYCGRIAPSAQCTFL"
FT   gene            complement(269243..269359)
FT                   /locus_tag="ETAE_0242"
FT   CDS_pept        complement(269243..269359)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAE_0242"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83089"
FT                   /db_xref="UniProtKB/TrEMBL:D0Z9Z9"
FT                   /protein_id="ACY83089.1"
FT                   /translation="MLDRRGLDPRLLMQALNLCGQLFPSIVDNHAVVSIQPT"
FT   gene            269405..270181
FT                   /locus_tag="ETAE_0243"
FT   CDS_pept        269405..270181
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAE_0243"
FT                   /product="AraC family transcription regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83090"
FT                   /db_xref="GOA:D0ZA00"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR009594"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZA00"
FT                   /protein_id="ACY83090.1"
FT                   /translation="MYQPSLIIILQGRKVGYLGERVFHYDPSNYLLMTLPLPCECETFA
FT                   SPQEPLIGLALRVDVQMLQDLLMDIGDGMRTAVRPHADGVRSVALDDAMLCACERLVEA
FT                   MEDPLHARVLGPQIVREMLFHALCGAGGDALLALASRHSHFSQIAKALRLIEQNYASSL
FT                   NVDRLAQSVNMSISSFHHNFKAVTATSPLQYIKSYRLHKARMMILHDGLKASTAASRVG
FT                   YESPSQFSREYKRFFGNTPSDQASRYRSGGLRIAEL"
FT   gene            270240..271529
FT                   /locus_tag="ETAE_0244"
FT   CDS_pept        270240..271529
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAE_0244"
FT                   /product="putative prolyl aminopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83091"
FT                   /db_xref="GOA:D0ZA01"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR002410"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZA01"
FT                   /protein_id="ACY83091.1"
FT                   /translation="MIERAFLVPGMAVREFRTEVPLNWRDPSDGRRLTLFARELCAPGR
FT                   EADEMPCLLFLQGGPGGKCPRPTSHSGWLAEALRDYRVILMDQRGTGNSSRIEASVLRD
FT                   MTPEQAADYLSHFRADAIVRDAEHLRLRHFGGRRWTTLGQSYGGFITLTYLSQAPQGLH
FT                   ACYITGGLPAIAPDATRLYEATYRLVAQRNQHFFTRYPQAREQLDRIVALLREQAVYLP
FT                   DGDLLSVERLLTLGLDMGMSEGYERLLWLLDEAFNQEGELSDTFLNQVMQRSGFADNPL
FT                   YAVLHESIYADADSGATRWVAQRVRDDLPAFSPERSSPLLTGEMIYPWMFDQMQSLRPF
FT                   RAAVELLARRETWPVLYDAARLRDNDIPVMAAVYYHDMYVDVGLSLESAAQIGNLQTWI
FT                   TSEYDHNGLRVAPVFRRLRDMMAERGVATE"
FT   gene            complement(271576..272208)
FT                   /locus_tag="ETAE_0245"
FT   CDS_pept        complement(271576..272208)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAE_0245"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83092"
FT                   /db_xref="GOA:D0ZA02"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="InterPro:IPR027385"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZA02"
FT                   /protein_id="ACY83092.1"
FT                   /translation="MKAFTKLALFVGLVSGATLANAAGINNTGYYAGAKMGISAEHLFD
FT                   QKDVNGNGMSNDNKGVGNAGLVFGYNFENQFSLPVRAELDYTFRANATSSHTNDAAETN
FT                   DSRLGLQTLMVNGYYDIKTGTPFTPYVGAGIGYANVSLKNDMNGDNVQSNSNNFAWSVG
FT                   TGVIYNVNERLDLDLGYKYLDAGKASAGNSQAKVTTHDVTLGVNYYF"
FT   gene            complement(272320..272439)
FT                   /locus_tag="ETAE_0246"
FT   CDS_pept        complement(272320..272439)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAE_0246"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83093"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZA03"
FT                   /protein_id="ACY83093.1"
FT                   /translation="MSARKPFLSRSLPRFSCYFQRMENIRYNFIFPFDFIHIK"
FT   gene            273143..273670
FT                   /gene="sodC"
FT                   /locus_tag="ETAE_0247"
FT   CDS_pept        273143..273670
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sodC"
FT                   /locus_tag="ETAE_0247"
FT                   /product="copper-zinc superoxide dismutase"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83094"
FT                   /db_xref="GOA:D0ZA04"
FT                   /db_xref="InterPro:IPR001424"
FT                   /db_xref="InterPro:IPR018152"
FT                   /db_xref="InterPro:IPR024134"
FT                   /db_xref="InterPro:IPR036423"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZA04"
FT                   /protein_id="ACY83094.1"
FT                   /translation="MKKMKILVLATALMSGAAYSASESITLYEAGPQGAGPAIGEVTVS
FT                   ETPYGLLFTPSLHGLPQGIHGFHVHENASCLPGVKEGKPVPALMAGGHWDPEKRGKHMG
FT                   PYSDAGHLGDLPGLVVNADGTANYAVLAPRLKSLSQLKGHALMVHVGGDNYDDHPHALG
FT                   GGGARMACGVIQ"
FT   gene            complement(273730..274410)
FT                   /gene="narI"
FT                   /locus_tag="ETAE_0248"
FT   CDS_pept        complement(273730..274410)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="narI"
FT                   /locus_tag="ETAE_0248"
FT                   /product="nitrate reductase gamma subunit"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83095"
FT                   /db_xref="GOA:D0ZA05"
FT                   /db_xref="InterPro:IPR003816"
FT                   /db_xref="InterPro:IPR023234"
FT                   /db_xref="InterPro:IPR036197"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZA05"
FT                   /protein_id="ACY83095.1"
FT                   /translation="MSALSYFLFNIYPYIAITVLLLGCLYRFDYGQYTWKSGSSLLMAN
FT                   GRYSRYALNLFHVGMLGVFFGHVAGLLTPRSWYDAYISSQTHQILELIAGSFFGTLLLI
FT                   GALMLLARRLFCARVAATSSFSDKLILILLTIQICLGMLTIPVDLLHPSGATLQNLISW
FT                   SQGIVTFRPDPAQYLQEVNWLFKVHMVLGLTIFLIFPFTRLVHICSLPLGYLLRRRQVV
FT                   KTLR"
FT   gene            complement(274421..275077)
FT                   /gene="narJ"
FT                   /locus_tag="ETAE_0249"
FT   CDS_pept        complement(274421..275077)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="narJ"
FT                   /locus_tag="ETAE_0249"
FT                   /product="nitrate reductase delta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83096"
FT                   /db_xref="GOA:D0ZA06"
FT                   /db_xref="InterPro:IPR003765"
FT                   /db_xref="InterPro:IPR020945"
FT                   /db_xref="InterPro:IPR036411"
FT                   /db_xref="InterPro:IPR042290"
FT                   /db_xref="InterPro:IPR042291"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZA06"
FT                   /protein_id="ACY83096.1"
FT                   /translation="MLSLLMLARLLDYPDEALWQARGELEAALPQCREMTAAQQKRLQA
FT                   FIAHYWEAPLASRQSDYIAQFDHTRRCALYLCEHQLAESKNRGQAMVNILSHYRQAALE
FT                   PAPRELPDYLPMVLEFAYLRSQQQPEEGRRILTQIAEVAEILYRRTHDGMYGVLFQLLL
FT                   QLAGRETDGLVPEADGTPTAAIDAEWDRAHAPARVELPDIPQGRPAPVHYLDLER"
FT   gene            complement(275081..276601)
FT                   /gene="narH"
FT                   /locus_tag="ETAE_0250"
FT   CDS_pept        complement(275081..276601)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="narH"
FT                   /locus_tag="ETAE_0250"
FT                   /product="nitrate reductase beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83097"
FT                   /db_xref="GOA:D0ZA07"
FT                   /db_xref="InterPro:IPR006547"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR029263"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZA07"
FT                   /protein_id="ACY83097.1"
FT                   /translation="MKIRAQVSMVLNLDKCIGCHTCSVVCKNVWTSREGIEYGWFNNVE
FT                   TKPGRGFPRDWEDQDKWHGGWQRVNGQLTPRMGGKLSLLAKIFANPHMPAVGDYYEPYS
FT                   FDYAHLHNAPAGARHQPTARPYSLLTGKTLEKIEGSANWEDDLGGEARVRQGDRNLDGL
FT                   DKQLYAQFEQTFMMYLPRLCEHCLNPACVASCPSGAIYKRAEDGVVLINQDQCRGWRMC
FT                   VSACPYKKIYYNWKSGKSEKCIFCYPRIEAGLPTLCSESCVGRIRYIGVMLYDAEAIPA
FT                   AAAEEDPQALYDAQMKIFLDPNDPDILAQARRDGISDEILAHAQRSPVYRLIKEWRLAL
FT                   PLHPEFRTLPMVWYVPPLSPIRFDDASLAEPHDIRLAELAQMRIPIDYLANLLCAGNRK
FT                   PVEAALTRLIALRHYRRSLLSPQAPQWLQQADLSAPQAEAMYRLLALAPYHERFVIPTG
FT                   MHRPGSDREYIEHGSCGFSFNTPHDTDGTNLTGYRPDDRLVINTHSKE"
FT   gene            complement(276628..280299)
FT                   /gene="narG"
FT                   /locus_tag="ETAE_0251"
FT   CDS_pept        complement(276628..280299)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="narG"
FT                   /locus_tag="ETAE_0251"
FT                   /product="nitrate reductase alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83098"
FT                   /db_xref="GOA:D0ZA08"
FT                   /db_xref="InterPro:IPR006468"
FT                   /db_xref="InterPro:IPR006655"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR006963"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="InterPro:IPR028189"
FT                   /db_xref="InterPro:IPR037943"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZA08"
FT                   /protein_id="ACY83098.1"
FT                   /translation="MSTFLKKIRYFTAGKPMAANAHELYLQDSSDWEQSYRSRWQYDKV
FT                   VRSTHGVNCTGSCSWKIYVKSGLITWETQYTDYPETPIDLPNHEPRGCPRGASYSWYIY
FT                   SANRIKYPLMRRALLDLWREQRAQHPDAVDAWQAILDNPELSQRYKRERGMGGLVRVSW
FT                   QEANELIAASNVATVKRFGPDRVAGFSPIPAHAMLSFASGSRYLSLIGGTCLSFYDWYC
FT                   DLPPSSPQTWGEQTDVPESADWYNAQYLVMWGSNVPQTRTPDAHFMTEARYNGTKVVAV
FT                   SADYAENCKFADEWLAPRAGTDAALALALGQVILQQFYLQQPCDYFIRYAKRFTDFPML
FT                   VMLTPCAGQENTYQSGRYLRAADLATWQDQPLAQWKTLAFDQDSQQIVIPRGSAGFRWD
FT                   QGGQWNTVQQDALSGAAIDPLLSLQTLGEDEVCVVQPDFSHDNANDRYTLGQVPVHWIT
FT                   TTRGERVAVATVFDLMLAHYGLRPRAGEIPAEDAPCSPAWAEAITGVPRQQIIRLAQEF
FT                   ATNARITHGRSLIIVGAGINHWFHSDMTYRSIINVLMMCGTIGVNGGGWAHYVGQEKLR
FT                   PLAGWAPVALAGDWQSPARLMNGTSFFYNHTSQWRYENVDAHTLLSPLAERDQFPHSLI
FT                   DFNVIAERLGWLPSSPQLDRNPLTLAAEAADGDVKAEVAQALKQGTLRIASEDPDAPGN
FT                   YPRVLFVWRANLLGSSSKGHEYFLKHLLGTRHGVMEQDLQQKGLPLPQQVAWRDSVEGK
FT                   LDLLVTLDFRMSTTCLYSDVILPSATWYEKEDLSSTDMHPYVHPFTRAIDPMWEARSDW
FT                   EIFKGIARQFSALCAGHLGKERDVMLTPLLHDSPAELGQACGVSDWKNDPQTFVAGKTA
FT                   PAIAVVERDYPQTYFKYTHLGPALAAHGNGGKGVHWDTRPEIDSLCARHGSETLDGVGP
FT                   CANMQDATQALETILTLAPETNGQVADRAWRDLAAKTGQQEIADLAADKKGVHYRFADI
FT                   QRQPGRVIASPLWSGIDSDRHAYTAGSLNITHAVPWRTLTGRQQAYQDHAWMQAFGEGF
FT                   ACYKPPLDTQSCRSVREHTANGQPELVLNFGTAHQKWGIHSTYTDNQIMQTLSRGGPLI
FT                   WISEHDAQRGAIADNDWVELFNGNGAMVARAVVSQRIPAGLALMYHAQERTLNMPLSEV
FT                   TGERGGIHNSITRICPNPIHMIGGYAHLSWGYNYYGTIGSNRDETVIIRRLNRVEWD"
FT   gene            complement(280318..281721)
FT                   /gene="narK"
FT                   /locus_tag="ETAE_0252"
FT   CDS_pept        complement(280318..281721)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="narK"
FT                   /locus_tag="ETAE_0252"
FT                   /product="nitrate/nitrite transporter"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83099"
FT                   /db_xref="GOA:D0ZA09"
FT                   /db_xref="InterPro:IPR004737"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZA09"
FT                   /protein_id="ACY83099.1"
FT                   /translation="MQKKGVDMSNQPLESQNARVLKNWDPEDETFWNATGNSIAKRNLW
FT                   VSVFCLVLAFCIWMVFSSVVIKLNHIGFDFTTNQLFWLAALPSISGALLRIPFSFVVPI
FT                   FGGRRWTTISTALLLIPSIWLGFAIQDPQTSFYSFACIAILCGIGGGNFASSMANISFF
FT                   FPKRLQGYGLGINGGLGDGGIGVVQLCVPLVIGIGLFGSLGGAPQHVDYNTMIWLQNAA
FT                   FLWVPFIIIACLLSWFMMNDIAGMQSSLSSQFVILGKKDTWITSLIYLATFGSFVGFSA
FT                   GFALLTKTQFPDIDIIDYAFVGPLLGAIARPIGGRLSDKFSGYRITQVAFFFMIIFSLL
FT                   IVPTLPSEHSSGSFILFYIVFMGLFIFTNLGSGSSFQLISQIFHQKSAQEAQQQGMQGK
FT                   HVDQYADVMSSAALGFTSAIGAFGGFIIPKTFGSAITLTHSVLLPLVCFSVFYLLCMGV
FT                   TWLSYGRHH"
FT   gene            complement(282045..282206)
FT                   /locus_tag="ETAE_0253"
FT   CDS_pept        complement(282045..282206)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAE_0253"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83100"
FT                   /db_xref="GOA:D0ZA10"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZA10"
FT                   /protein_id="ACY83100.1"
FT                   /translation="MDIADDATLIYGKKIIILIFINISFIQSHGAVLINLCGKKSCHIA
FT                   PYYIDISH"
FT   gene            282731..284185
FT                   /locus_tag="ETAE_0254"
FT   CDS_pept        282731..284185
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAE_0254"
FT                   /product="putative tartrate:succinate antiporter"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83101"
FT                   /db_xref="GOA:D0ZA11"
FT                   /db_xref="InterPro:IPR001898"
FT                   /db_xref="InterPro:IPR030676"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZA11"
FT                   /protein_id="ACY83101.1"
FT                   /translation="MKKGYSILIPFIVGGALACLPAPAGLSHHAWLYFSIFIGSIVGLI
FT                   IEPLPGAVIGLIAIVIIAGLGRWVLFSPEQVALPHFHAASAAFKWAVSGFSNSTVWLIF
FT                   SAFMFALGYEKTGLGRRISLLLVKSLGRRSLTLGYAIAIADLVLAPFTPSNTARSAGTI
FT                   YPVISNLPPLYDSKPNDPSARRIGSYLMWVSISITCVTSSMFLSALAPNLLSSALINQM
FT                   TGLQISWGSWFIAFLPCGIVLWLLTPLLGYWLYTPEVKINDEVPKWAKQELENLGGLSR
FT                   REKLLLLFVALALLLWVFGGGLINSAIAALLVIALMLITNVISWDDVIGNKAAWNTLFW
FT                   FGTLVSLASGLSTVGFVHWFGLVISHYLNGMSVAVASVSLLLCFYLLHYFFASTTAHAT
FT                   ALIPVMIAAAMDIHGINMMEFSLAISLSLGIMGIITPYGTGPSPIYFGSGYLPSKDFWR
FT                   LGAIFGLVNLLAYLFICLPWINYLYR"
FT   gene            complement(285239..286213)
FT                   /locus_tag="ETAE_0255"
FT   CDS_pept        complement(285239..286213)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAE_0255"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83102"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZA12"
FT                   /protein_id="ACY83102.1"
FT                   /translation="MHHTIEGTKTMDKKNKEVYIASLRQGTFHSELSSERAKDQSIQDY
FT                   VSKEINFRANYVIEQVIEATRNKDKNIPLFFTLPEFFWNVRLNVLRSKDELYFLTDHML
FT                   EKLSDAQEFIMLNLPESQFGKIVLLAGTLAVLTEIDDSELFESLNYCLISNNFKKTQDG
FT                   RFEKSVWPKRATSHIDYGVKDKITDNGFIFTIAKNLTIEVLNQSSFISEHDSSKGFDLL
FT                   LDNKVLDDFPFSINICLDYIAVKQGARDDEMYEKEPVIDFLLSCGMSLSFDYTYPLSVK
FT                   YAVMNDGMGDGSISYYSVYNKHLLSEIPSKRIHPALTLTKLSF"
FT   gene            complement(286296..287111)
FT                   /locus_tag="ETAE_0256"
FT   CDS_pept        complement(286296..287111)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAE_0256"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83103"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZAE4"
FT                   /protein_id="ACY83103.1"
FT                   /translation="MLSSQDAAHKEKFIALVNDNLAQANILDGRQISSNSDIKTEYTSE
FT                   FSLDKIANVVIKALDAVAKATDPLVPNPATSPDALAAYGDLVNSVAEAAKSSSKAAASL
FT                   SFSMTRLSPGMFSFLYATTVNILDEDTYGTEAVCSTAVYYCFIQSIDDIKSQAEFNSAL
FT                   IDAQSLIHMKTLQAALIDELSDGSIDINVWTAKDTAYSAAIQRLQERLDAHKFKGKPPL
FT                   LGGSNTLLQQSPSEASLVANAAVEKLEKMGPVFNIAIERTKNRLNNFYF"
FT   gene            complement(288061..288136)
FT                   /locus_tag="ETAE_t011"
FT   tRNA            complement(288061..288136)
FT                   /locus_tag="ETAE_t011"
FT                   /product="tRNA-Phe"
FT   gene            complement(288205..288354)
FT                   /locus_tag="ETAE_0257"
FT   CDS_pept        complement(288205..288354)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAE_0257"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83104"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZAE5"
FT                   /protein_id="ACY83104.1"
FT                   /translation="MNKYSCLLFYILFYSVIKIVEIAITTSVRRASLANAAATHRQRQR
FT                   QRNK"
FT   gene            288585..288758
FT                   /locus_tag="ETAE_0258"
FT   CDS_pept        288585..288758
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAE_0258"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83105"
FT                   /db_xref="InterPro:IPR021237"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZAE6"
FT                   /protein_id="ACY83105.1"
FT                   /translation="MYHSSPLAVGYNRASFQVKEEIKMENNNRFWPHIRRVTHIMMMAH
FT                   RSCFDFHLFNAR"
FT   gene            289065..290084
FT                   /gene="speF2"
FT                   /locus_tag="ETAE_0259"
FT   CDS_pept        289065..290084
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="speF2"
FT                   /locus_tag="ETAE_0259"
FT                   /product="ornithine decarboxylase isozyme"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83106"
FT                   /db_xref="GOA:D0ZAE7"
FT                   /db_xref="InterPro:IPR000310"
FT                   /db_xref="InterPro:IPR005308"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR027464"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZAE7"
FT                   /protein_id="ACY83106.1"
FT                   /translation="MNSLKIAVSLNVIAYFNTSRTTVDINDSDLTDVAAVVLSVQDALG
FT                   GALDKVEQSAFGLPVFVAEACDQRLPAEYLPRLTGVFACGDGNQDFYGKQLESAAQKYE
FT                   AELLPPFFGSLQAYVQQGNAAFDCPGHQGGQFFRRHPTGRQFFDYFGEALFRADLCNAD
FT                   VSMGDLLIHEGAPCAAQQHAAKVFNADKTYFVLNGTSSSNKVVLNALLAPGDLVLFDRN
FT                   NHKSNHHGALIQAGATPVYLETARNPFGFIGGIDAHCFEEKYLRDLVRDVAPARAGERR
FT                   PFRLAVIQLGTYDGTIYNARQVVDKIGHLCDYILFDSAWVGYEQFIPMMKECSRCCWS"
FT   gene            290060..291226
FT                   /gene="speF"
FT                   /locus_tag="ETAE_0260"
FT   CDS_pept        290060..291226
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="speF"
FT                   /locus_tag="ETAE_0260"
FT                   /product="ornithine decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83107"
FT                   /db_xref="GOA:D0ZAE8"
FT                   /db_xref="InterPro:IPR000310"
FT                   /db_xref="InterPro:IPR008286"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036633"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZAE8"
FT                   /protein_id="ACY83107.1"
FT                   /translation="MLPLLLELNENDPGILVTQSVHKQQAGFSQTSQIHKKDRHIKGQA
FT                   RYVNHKRLNNAFMMHASTSPFYPLFAALDVNARMHAGDSGKRMWMECVRVGIETRKLLL
FT                   QTCQHIRPFVPETVDGRPWGAFDTEEMANDLRFFNFIPGERWHAFEGYAEHQYFVDPCK
FT                   LMLTTPGIDAKSGEYQSFGVPATILANFLRENGIVPEKCDLNSILFLLTPAEDMAKMQH
FT                   LVAQIARFERLLEQDAPLAEVLPSIYRANEARYRGYTLRQLCQEMHDLYVSHDVKQLQK
FT                   EMFRKAHFPRVVMNPQQANIEFVRGNVELVSLARAEGRIAAEGALPYPPGVLCVVPGEI
FT                   WGGSVQRYFLALEEGINRLPGFAPELQGVYIQQDEDGRKRAYGYVIKQ"
FT   gene            291339..292634
FT                   /gene="potE1"
FT                   /locus_tag="ETAE_0261"
FT   CDS_pept        291339..292634
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="potE1"
FT                   /locus_tag="ETAE_0261"
FT                   /product="putrescine transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83108"
FT                   /db_xref="GOA:D0ZAE9"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004754"
FT                   /db_xref="InterPro:IPR027566"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZAE9"
FT                   /protein_id="ACY83108.1"
FT                   /translation="MGVVQLTILTAVNMMGSGIIMLPTKLAEVGTISIVSWLVTAVGSM
FT                   ALAYAFAKCGMYSRKSGGMGGYAEYAFGKSGNFMANYTYGVSLLIANVAIAISAVGYGT
FT                   ELIGASLSPMGICLATIGVLWLCTAANFGGARITGRISSVTVWGVIIPVVGISVIGWFW
FT                   FSPTLYVDSWNPHHLPTFEAIGSSIAMTLWAFLGLESACANTDVVENPERNVPIAVLGG
FT                   TLGAAVIYIVSTNVIAGIVPNMDLANSTAPFGMAFAQMFDPTVGKIIMALMVMSCCGSL
FT                   LGWQFTIAQVFKSSADEGYFPAIFRRVTQSGAPVKGMLAIVAIQSVLSLMTISPSLNAQ
FT                   FNVLVNLAVVTNLIPYILSMAAVLIIQRVAGIDPAKARLPNILAFVGAMYSFYALYSSG
FT                   EQAMMWGAIATFLGWTLYGFVSPRFEMRDRQV"
FT   gene            292753..293199
FT                   /gene="nikR"
FT                   /locus_tag="ETAE_0262"
FT   CDS_pept        292753..293199
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nikR"
FT                   /locus_tag="ETAE_0262"
FT                   /product="nickel responsive regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83109"
FT                   /db_xref="GOA:D0ZAF0"
FT                   /db_xref="InterPro:IPR002145"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="InterPro:IPR013321"
FT                   /db_xref="InterPro:IPR014160"
FT                   /db_xref="InterPro:IPR014864"
FT                   /db_xref="InterPro:IPR022988"
FT                   /db_xref="InterPro:IPR027271"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZAF0"
FT                   /protein_id="ACY83109.1"
FT                   /translation="MMQRVTLSLDDDLMAEIDAIMKARNYQNRSEAIRDLARAGLQSMT
FT                   EAPSQSSHCVAALFYVYDHESRELSKRLTRTFHDHHDLSLASLHVHLDHGRCLEVSLLK
FT                   GAGGEVTRFAEQVIAERGVRHGKLVVVPGDDGEAHAHPHLHAHD"
FT   gene            complement(293215..294294)
FT                   /gene="mltC"
FT                   /locus_tag="ETAE_0263"
FT   CDS_pept        complement(293215..294294)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mltC"
FT                   /locus_tag="ETAE_0263"
FT                   /product="murein transglycosylase C"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83110"
FT                   /db_xref="GOA:D0ZAF1"
FT                   /db_xref="InterPro:IPR000189"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR023664"
FT                   /db_xref="InterPro:IPR024570"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZAF1"
FT                   /protein_id="ACY83110.1"
FT                   /translation="MKKVLALALIAPLLISCSGKKPDSNGEEYIKDTNGFDILMGQFAH
FT                   NIENIWGINEVLIAGPKDYVKYSDRYLTRSHINFETGQITIETIATLDPAESLRQAIVT
FT                   TLLMGDDPGAIDLYSDANDIKPSREPFLYGQVLDNTGQPIRWSGRANSFASYLLQNKLM
FT                   KRTSGLHVIYSVTIQLVPNHLDKRAHKYLGMVRRASERYGVDESLILAIMQTESSFNPY
FT                   AVSRSDALGLMQVMQHTAGKDVFVSKGKWGTPSRSYLFDPEKNIDTGTAYLAILQNTYL
FT                   GGIQNATSRRYAVITAYNGGAGSVLRVFSSDKGQAVSIINQMSPGDVYEALTQRHPSAE
FT                   SRRYLYKVNSTQKNYRRIR"
FT   gene            complement(294342..294614)
FT                   /locus_tag="ETAE_0264"
FT   CDS_pept        complement(294342..294614)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAE_0264"
FT                   /product="putative Fe(2+)-trafficking protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83111"
FT                   /db_xref="GOA:D0ZAF2"
FT                   /db_xref="InterPro:IPR007457"
FT                   /db_xref="InterPro:IPR036766"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZAF2"
FT                   /protein_id="ACY83111.1"
FT                   /translation="MSRTVFCTFLNREAEGLDFQSYPGDLGKRIYDHISKEAWGQWMAK
FT                   QTMLINEKKLNMMNPDDRSLLALEMEKFLFEGHDVHIEGYTPPSQ"
FT   gene            complement(294617..295705)
FT                   /gene="mutY"
FT                   /locus_tag="ETAE_0265"
FT   CDS_pept        complement(294617..295705)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mutY"
FT                   /locus_tag="ETAE_0265"
FT                   /product="A/G-specific adenine glycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83112"
FT                   /db_xref="GOA:D0ZAF3"
FT                   /db_xref="InterPro:IPR000445"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR003651"
FT                   /db_xref="InterPro:IPR004035"
FT                   /db_xref="InterPro:IPR004036"
FT                   /db_xref="InterPro:IPR005760"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR023170"
FT                   /db_xref="InterPro:IPR029119"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZAF3"
FT                   /protein_id="ACY83112.1"
FT                   /translation="MMQAQQFAHAVLAWYARFGRKTLPWQHPKTPYRVWLSEVMLQQTQ
FT                   VATVLPYFQRFTQRFPDVQALAAAPLDEVLHLWTGLGYYARARNLHKAAQLIVSQHHGE
FT                   FPQDFEQVAALPGIGRSTAGAILSLSLGQHHPILDGNVKRVLARCYAIPGWPGRKEVET
FT                   RLWQLSGEVTPADGVSQFNQAMMDLGALVCTRSRPKCELCPLNAGCLAYADGSWADFPG
FT                   KKPKQTLPERQAYLLLLQHGETVWLQQRPASGLWGGLFCFPQYDSEAALRAQLYRLGQD
FT                   PDAAQTLTAFRHTFSHFHLDIIPVWSAYTTASACMDEGDGLWYNLAQPPSVGLAAPTER
FT                   LLQQLRKQPPASATAGDATEKE"
FT   gene            295995..296711
FT                   /gene="trmB"
FT                   /locus_tag="ETAE_0266"
FT   CDS_pept        295995..296711
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trmB"
FT                   /locus_tag="ETAE_0266"
FT                   /product="tRNA (guanine-N(7))-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83113"
FT                   /db_xref="GOA:D0ZAF4"
FT                   /db_xref="InterPro:IPR003358"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZAF4"
FT                   /protein_id="ACY83113.1"
FT                   /translation="MNDVITAEFDENGRAIRRIRSFVRRQGRLTKGQQLALEQHWPLMG
FT                   VEFTPEALDLPALFGRQAPVVLEIGFGMGASLVAMAQQHPERDFLGIEVHSPGVGACLS
FT                   SAHEAGVNNLRVMCHDAVEVLERMIPDGSLDMVQLFFPDPWHKARHHKRRIVQPAFAER
FT                   IRGKLKIGGVFHMATDWENYAEHMLEVMNHAPGYRNLSDDNTYVPRPDSRPVTKFELRG
FT                   QRLGHGNWDLMFERVE"
FT   gene            296711..297037
FT                   /locus_tag="ETAE_0267"
FT   CDS_pept        296711..297037
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAE_0267"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83114"
FT                   /db_xref="InterPro:IPR007416"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZAF5"
FT                   /protein_id="ACY83114.1"
FT                   /translation="MAKNRSRRLRKKLHIDEFQEVGFSASWRFADGTPVETVDTLLDRL
FT                   IDEVIEPNGLAFDGSGYLRWEGLICLQQIGRCTDEQRQLVKGWLESQGMLDVVVSDLFD
FT                   VWWE"
FT   gene            297236..298162
FT                   /gene="yneH"
FT                   /locus_tag="ETAE_0268"
FT   CDS_pept        297236..298162
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yneH"
FT                   /locus_tag="ETAE_0268"
FT                   /product="glutaminase"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83115"
FT                   /db_xref="GOA:D0ZAF6"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR015868"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZAF6"
FT                   /protein_id="ACY83115.1"
FT                   /translation="MQTELSDQLLDEILDQVRPLLGQGRVANYIPALAEVAPDRLGIAV
FT                   CTVDGRMFSAGDAGERFSIQSISKVLSLTLAMHRYSEAEIWQRVGKEPSGQPFNSLVQL
FT                   ELEQGKPRNPFINAGALVVCDMLQSRLSAPRQRMLEVVRALSGSADICYDARVARSEFE
FT                   HSDRNAAIAYLMKSFGNFDNDVITVLHNYFHYCALRMNCMELARTFVYLANRGRALALD
FT                   EPVIGERQARQINALMVTSGLYDGAGEFAYRVGMPGKSGVGGGVVAVVPQEMIIAVWSP
FT                   QLDSCGNSLAGIAALELLAQRIGRSIF"
FT   gene            298170..298901
FT                   /locus_tag="ETAE_0269"
FT   CDS_pept        298170..298901
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAE_0269"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83116"
FT                   /db_xref="InterPro:IPR021307"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZAF7"
FT                   /protein_id="ACY83116.1"
FT                   /translation="MMGKWGCSLLLLLTAAQAQAAWQCQVKPQDDIIISAQQVQIVGAS
FT                   GNLQISRDGAVTRDGHPLALSADVRRQAETLQRDLRRDVPWIDQGVQTRLDRARGALDN
FT                   IIVEQLGSDSNVRHRLSTLDTQLKAQMNRVLEKRSDGYAFHHQAIAQVEKEGQTLVNQT
FT                   LGGVLQDSINEMGAKGLLKAGQSENPLQAVLGNLGGLQQSIRTEWDKQDNDLRAFGQQA
FT                   CERVQALDTQRKALLKALPAS"
FT   gene            298952..300643
FT                   /locus_tag="ETAE_0270"
FT   CDS_pept        298952..300643
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAE_0270"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83117"
FT                   /db_xref="GOA:D0ZAF8"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZAF8"
FT                   /protein_id="ACY83117.1"
FT                   /translation="MPLFALCMASFAVLMSSTLVMEGNDMKIKYNLFFGFGVFMFSLGA
FT                   PLAAEVPPGVSLAAAQTLTRNNGSEPASLDPHRSESDVEFNILRDFFEGLLTLDGEGHL
FT                   RPGLAARWQHSEAGRVWTFSLRPDLRWSNGEALTAQDLVFSWRRLIDPATASPYATFLV
FT                   NMGIKNAAAIQEGALPPSALGVAAPDARTLRVTLDQPLSTFLPMMVHPTLVPLNPRVLA
FT                   RYGDKWTQPGHFVGNGAYTLKQWVINERLVGERNPHYWDDAHTVIHQVVYLPIVSETAG
FT                   VNRYRAGELDMTPLPSALFASLKQSLGEQVQIFPKLGTYYYHFNTRRAPFDDVRVRQAL
FT                   NLGLDKEIIAQKVLGQGQRPAWLFGSDDIGGMALRAPDYARWPRETRLARAKALLAEAG
FT                   FGPGNPLRFTLLYNTSEGHQRIAIAAASMWKKNLGVEATLNNQEWKSMLDTMRSGHFDV
FT                   VRNAWVADYDDPAAMLNTFRSGDSNNTPQYSNPRFDAVLAQASASQDPAARQRLFQQAE
FT                   ALLAEDVPTIPLYHYVSVRLVKPYVGGYQPGNMDYLYSKDMYIRAH"
FT   gene            complement(300689..301819)
FT                   /gene="yggW"
FT                   /locus_tag="ETAE_0271"
FT   CDS_pept        complement(300689..301819)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yggW"
FT                   /locus_tag="ETAE_0271"
FT                   /product="coproporphyrinogen III oxidase and related Fe-S
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83118"
FT                   /db_xref="GOA:D0ZAF9"
FT                   /db_xref="InterPro:IPR004559"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010723"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR034505"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZAF9"
FT                   /protein_id="ACY83118.1"
FT                   /translation="MLKLPPLSLYIHIPWCVQKCPYCDFNSHAQKGEIPQQAYVDHLLA
FT                   DLDQELPRVAGRPLSTLFIGGGTPSLLSGEALQRLLDGVRARLPLAADAEITLEANPGT
FT                   VEAERFSAYQRAGVNRISIGVQSFSADKLQRLGRIHGPQEAIAAARLATALGLRSFNLD
FT                   LMHGLPQQSQEEALDDLRQAIALNPPHLSWYQLTIEPNTLFGSRPPRLPDDDALWEIFE
FT                   QGDRLLRASGYQQYETSAYALPGRQCQHNLNYWRFGDYLGIGCSAHGKLTFADGRIERR
FT                   AKTRHPRGYMQGNYLDQRQQVAMAERPFEFFMNRFRLLEPAPRADFSAYTGVDEATIRP
FT                   QLEAALAQGYISETPSHWQVTPHGKLFLNSLLELFL"
FT   gene            complement(301812..302405)
FT                   /gene="yggV"
FT                   /locus_tag="ETAE_0272"
FT   CDS_pept        complement(301812..302405)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yggV"
FT                   /locus_tag="ETAE_0272"
FT                   /product="putative deoxyribonucleotide triphosphate
FT                   pyrophosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83119"
FT                   /db_xref="GOA:D0ZAG0"
FT                   /db_xref="InterPro:IPR002637"
FT                   /db_xref="InterPro:IPR020922"
FT                   /db_xref="InterPro:IPR029001"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZAG0"
FT                   /protein_id="ACY83119.1"
FT                   /translation="MQHVVLATGNAGKVRELASLLTDFGLDIVAQSSLGIEGAEETGLT
FT                   FIENAILKARHAARLSGLPAIADDSGLAVDALGGAPGIYSARYAGEDASDRANLEKLLH
FT                   ALRDVPAGQRQARFHCVLVYLRHADDPTPLVCHGVWEGEIADAPSGDGGFGYDPIFFVP
FT                   ALGCTAAQLSREQKRAISHRGQALQQLLDRMRHA"
FT   gene            complement(302487..302777)
FT                   /locus_tag="ETAE_0273"
FT   CDS_pept        complement(302487..302777)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAE_0273"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83120"
FT                   /db_xref="InterPro:IPR003746"
FT                   /db_xref="InterPro:IPR005228"
FT                   /db_xref="InterPro:IPR036591"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZAG1"
FT                   /protein_id="ACY83120.1"
FT                   /translation="MSAVSREGDDWILRLYIQPKASRDLIIGLHGDELKVAITAPPVDG
FT                   QANAHLLKFIAKQFRVAKSRITLEKGELGRHKQLRISQPQQIPDAVAAALE"
FT   gene            complement(302774..303328)
FT                   /locus_tag="ETAE_0274"
FT   CDS_pept        complement(302774..303328)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAE_0274"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83121"
FT                   /db_xref="GOA:D0ZAG2"
FT                   /db_xref="InterPro:IPR003425"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZAG2"
FT                   /protein_id="ACY83121.1"
FT                   /translation="MLTLTFLVKTLLDLYVMVLLLRIWMQWARSDFYNPLSQFIVKLTQ
FT                   PVVAPLRRILPPLGPIDSASLLLAFILMTVKYPLLLLIQSGSLSLSPYNLLFGLISVVK
FT                   SAGYLVFWVIIIRSIMSWISQGRSPMDYVLYQLTEPMMAPIRRIIPAMGGLDFSAMVVI
FT                   LVLYLLNYLGIDLFGQLWFLL"
FT   gene            complement(303434..304144)
FT                   /locus_tag="ETAE_0275"
FT   CDS_pept        complement(303434..304144)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAE_0275"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83122"
FT                   /db_xref="GOA:D0ZAG3"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="InterPro:IPR011078"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZAG3"
FT                   /protein_id="ACY83122.1"
FT                   /translation="MNTTIKHNLDAVRQHLVRAAEQCGRDPRDITLLAVSKTKPIEDID
FT                   AAIAAGQRAFGENYVQEGVSKIQHYRQQPQGDALEWHFIGPLQSNKSRPVAEHFDWIHT
FT                   VDRVKIAQRLNEQRPAELEPLNVLIQVNISDEQSKSGITLEQIDALADAISQLPRLRLR
FT                   GLMAIPAPEDDPARQLAVCTRMAQALSALQRRYPQLDTLSLGMTHDMEAAITAGSTLVR
FT                   IGTAIFGARDYGTA"
FT   gene            complement(304315..304737)
FT                   /locus_tag="ETAE_0276"
FT   CDS_pept        complement(304315..304737)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAE_0276"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83123"
FT                   /db_xref="GOA:D0ZAG4"
FT                   /db_xref="InterPro:IPR005227"
FT                   /db_xref="InterPro:IPR006641"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR037027"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZAG4"
FT                   /protein_id="ACY83123.1"
FT                   /translation="MNPRTILAFDFGTRSIGCAIGQELTGSARPLQSFKANDGAPDWQQ
FT                   IEKVLREWQPDLVVVGLPLNMDGSEQPLTQMARKFANRLHGRFGVQIALQDERLSTVEA
FT                   RAHLFAGGGYRALEKGRVDAASAALILESWFEHQTY"
FT   gene            complement(304737..305300)
FT                   /locus_tag="ETAE_0277"
FT   CDS_pept        complement(304737..305300)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAE_0277"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83124"
FT                   /db_xref="InterPro:IPR003774"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZAG5"
FT                   /protein_id="ACY83124.1"
FT                   /translation="MKLAHHFLIAMPAMQDSRFKRTVIYVCEHNEDGAMGMIINKPLEQ
FT                   LTLSSLLEKLDITPSPRDAAIRLDKPVLAGGPLAEDRGFVLHSPTDTFGSSADIGPGCM
FT                   LTTSRDVLETLGTDRQPQEILVTLGYCSWSKGQLEQELLDNAWLTVEADSQILFHTPLA
FT                   DRWICAAKKLGVDIRNMPCNAGHA"
FT   gene            complement(305528..306478)
FT                   /gene="gshB"
FT                   /locus_tag="ETAE_0278"
FT   CDS_pept        complement(305528..306478)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gshB"
FT                   /locus_tag="ETAE_0278"
FT                   /product="glutathione synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83125"
FT                   /db_xref="GOA:D0ZAG6"
FT                   /db_xref="InterPro:IPR004215"
FT                   /db_xref="InterPro:IPR004218"
FT                   /db_xref="InterPro:IPR006284"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZAG6"
FT                   /protein_id="ACY83125.1"
FT                   /translation="MIKLGIVMDPIASINIKKDTSFAMLLEAQRRGYQLHYMEMDSLYL
FT                   QQGEARAQTRLLSVSDDKASWYRFDGEQDIALADLDVILMRKDPPFDTEFIYATYILER
FT                   AEARGTLIVNKPQSLRDCNEKLFTAWFADLTPDTLVTRSAAHLRDFHARHGDVILKPLD
FT                   GMGGASIFRIQQDDPNLSVIIETLTEHGKRFCMAQNYLPAIVDGDKRVLVIDGEPVPYC
FT                   LARIPKSGETRGNLAAGGRGEARPLSESDWAIARKVAPMLKEKGLIFVGLDIIGDRLTE
FT                   INVTSPTCAREIEAAFPVSITGMLMDAIEARLAAR"
FT   gene            complement(306511..307242)
FT                   /locus_tag="ETAE_0279"
FT   CDS_pept        complement(306511..307242)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAE_0279"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83126"
FT                   /db_xref="GOA:D0ZAG7"
FT                   /db_xref="InterPro:IPR006700"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZAG7"
FT                   /protein_id="ACY83126.1"
FT                   /translation="MRIPRIYHPQPLSIPGEVSLCDDAANHVGRVLRMGPGQALQLFDG
FT                   SNRVFDAEIISADKKSVRVRLNHVQEADRESPLHLHLGQVMSRGEKMEFTIQKSIELGV
FT                   SVITPLISERCGVRLDAERMAKKQQQWQKIAIAACEQCGRNRIPQIRPAMDLEAWCAEE
FT                   DDCLRLNLHPRASASINTLPQPLTRVRLLIGPEGGLSAAEIAMTADYRFTDILLGPRVL
FT                   RTETTALTAITALQVRFGDLG"
FT   gene            complement(307346..308059)
FT                   /gene="endA"
FT                   /locus_tag="ETAE_0280"
FT   CDS_pept        complement(307346..308059)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="endA"
FT                   /locus_tag="ETAE_0280"
FT                   /product="endonuclease I"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83127"
FT                   /db_xref="GOA:D0ZAG8"
FT                   /db_xref="InterPro:IPR007346"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZAG8"
FT                   /protein_id="ACY83127.1"
FT                   /translation="MSPKSFIALSTLLGSLLLTSGAQAETIHNFSQAKAAAVKINRDAP
FT                   GTFYCGCRIDWQGKKGTPDLASCGYQVRKNAHRAERIEWEHVMPAWQFGHQLQCWQEGG
FT                   RKNCAKNPNYVRIETDLHNLQPAIGEVNGDRNNFAFSQWRGGEGQYGQCTMKVDFKNKQ
FT                   AEPPERARGAIARTYFYMRDRYHIRLSPQQTRLFEVWDRQYPVSDWECQREARVAAVQG
FT                   NHNPYVQQACAARKP"
FT   gene            complement(308174..308701)
FT                   /locus_tag="ETAE_0281"
FT   CDS_pept        complement(308174..308701)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAE_0281"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83128"
FT                   /db_xref="GOA:D0ZAG9"
FT                   /db_xref="InterPro:IPR006640"
FT                   /db_xref="InterPro:IPR023483"
FT                   /db_xref="InterPro:IPR035240"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZAG9"
FT                   /protein_id="ACY83128.1"
FT                   /translation="MLAAMNTPRLPIALQQAVMHTLRRCLSLAEQRLNQPLPLPQIDYR
FT                   QRGTVAGTAWPQQWQIRLNPVLLQENGQAFIDSVIPHELAHLLVYRRFGRVAPHGREWR
FT                   WMMAEILGVEPQRTHRFSVDSVRGRTFTYRCACQQHQLTLRRHNRVQRGESSYRCRQCG
FT                   AALSFTPDATPA"
FT   gene            308846..308977
FT                   /locus_tag="ETAE_0282"
FT   CDS_pept        308846..308977
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAE_0282"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83129"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZAH0"
FT                   /protein_id="ACY83129.1"
FT                   /translation="MIILYIYFRLFCAGMCLCNVLNLKVKNDCKNIVYHGKRLLSFL"
FT   gene            309063..310382
FT                   /gene="cadB1"
FT                   /locus_tag="ETAE_0283"
FT   CDS_pept        309063..310382
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cadB1"
FT                   /locus_tag="ETAE_0283"
FT                   /product="lysine/cadaverine transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83130"
FT                   /db_xref="GOA:D0ZAH1"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004754"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZAH1"
FT                   /protein_id="ACY83130.1"
FT                   /translation="MASVKKIGLIACTGVVAGNMMGSGIALLPANLASLGSIAVWGWLI
FT                   ALVGAVSLAYVYARLATKNPQEGGPVAYAGEVGAAFGFQTGVLYYHANWIGNLAIGITA
FT                   VSYLSTFFPVLNSPVPAGIACIAIVWIFTFVNMLGGAWVSRLTTLGLVLVLIPVIGTGI
FT                   AGWFWFEPTTYMANWNTSGGTDYHAIIKSILLCLWAFIGVESASVSTGMVKDPQRNVPL
FT                   ATMMGTFLAGIVYIAATQAIAGMYPAHQMAASGAPFAISASTMVGSWAGPVVSAFTAFA
FT                   CLTSLGSWMMLVGQAGARAAHDGNFPKIYGELDKNGLPKKGLFLAALKMTVLMVLITVM
FT                   NASGGKASDLFGELTGIAVLLTMLPYFYSCIDLIRFDGANIKNVLSLLASILGCVFCFI
FT                   ALMGANSIELSGTFIVSLIILMFYSRKLGSAQDKGSAPRT"
FT   gene            310456..312606
FT                   /gene="cadA1"
FT                   /locus_tag="ETAE_0284"
FT   CDS_pept        310456..312606
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cadA1"
FT                   /locus_tag="ETAE_0284"
FT                   /product="lysine decarboxylase 1"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83131"
FT                   /db_xref="GOA:D0ZAH2"
FT                   /db_xref="InterPro:IPR000310"
FT                   /db_xref="InterPro:IPR005308"
FT                   /db_xref="InterPro:IPR008286"
FT                   /db_xref="InterPro:IPR011193"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036633"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZAH2"
FT                   /protein_id="ACY83131.1"
FT                   /translation="MNIIAIMNDMSAYFKEEPLRELQQELEKAGFRIAYPHDRNDLLKL
FT                   IENNARLCGVIFDWDKYNLALCEEISALNKMLPIYAFANTYSTLDVSMSDLRLNVRFFE
FT                   YTLGSAQDIALKIRQSTDQYIDAIMPPLTKALFKYVHEEKYTFCTPGHMGGTAFEKSPV
FT                   GTLFYDFYGENTLRSDISISVAELGSLLDHSGPHREAEEYIARTFNADRSYIVTNGTST
FT                   ANKIVGMYSSPAGASILIDRNCHKSLTHLMMMSSVVPLYLRPTRNAYGILGGIPRQEFT
FT                   REAIEEKVRNTPNATWPVHAVVTNSTYDGLFYNTDYIKQTLDVKSIHFDSAWVPYTNFH
FT                   PIYQGKAGMSGERVPGKVIYETQSTHKLLAAFSQASMIHVKGIINEETFNEAYMMHTST
FT                   SPHYGIVASAEMSAAMMKGNTGKRLIANSIERAIRFRKEIKRLRTESEGWFFDVWQPDN
FT                   IDEVACWPLNSRNDWHGFKNIDDDHMYLDPIKVTLLTPGMKADGTMDSWGIPASIVSKY
FT                   LDEHGIIVEKTGPYNLLFLFSIGIDKTKALSLLRALTDFKRVYDLNLRVKNVLPSLYQE
FT                   APEFYENMRIQELAQGIHTLTSESRLPDLMYSAFDVLPTLVLTPHDAFQEEVRGNIESC
FT                   PLQQMIGRVSANMILPYPPGVPLIMPGEMITEASKPVLDFLQLLCDIGAHYPGFETDIH
FT                   GVQCNGKGEYEVVVLKNHGAQG"
FT   gene            complement(312680..313840)
FT                   /locus_tag="ETAE_0285"
FT   CDS_pept        complement(312680..313840)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAE_0285"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83132"
FT                   /db_xref="InterPro:IPR005494"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZAH3"
FT                   /protein_id="ACY83132.1"
FT                   /translation="MKRIAISERPDWRAKASEFGFQFHTMYGEPYWCEDAYYQFSMAQV
FT                   EALEQTTAELHQMCLQVVEKVVDSEALLSRFQIPKHTWDFVRASWRSGQPSLYSRLDLA
FT                   YDGQGPAKLLENNADTPTSLYESAFFQWIWLEDQVRAGKLPAAADQFNSLQEQLIARFA
FT                   ELKANHGFQLLHMACCQDSDEDRGTVQYLQDCAAEAGLATEFLYMDEIGLGEKGQFTDP
FT                   QDQVISNLFKLYPWEFMLREIFSTKLEDAGVRWLEPAWKSILSNKALLPMLWEMFPNHP
FT                   NLLPAYFADGSQPPLDRYVVKPLFSREGANIRIVENGQEIERVDGPYGEEGMIVQQYHP
FT                   LPQFGDSYTLIGSWLVNDSPAGIGLREDRSRITQDLSRYYPHIILD"
FT   gene            complement(313844..314521)
FT                   /locus_tag="ETAE_0286"
FT   CDS_pept        complement(313844..314521)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAE_0286"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83133"
FT                   /db_xref="InterPro:IPR009576"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZAH4"
FT                   /protein_id="ACY83133.1"
FT                   /translation="MKRTKHINRSAFRKRWQMAPLALAVSAVFLLAGCEKSDETVSLYQ
FT                   NADDCSKANPSMSAQCKTSYDDALKEAAKTAPKYATREDCIAEFGEGQCTQTPAQAGMA
FT                   PTTGNTNAEAAQSGGSFWMPLMAGYMMGRLMGGGFNQQPLFTPRGAASPANGQFVDASG
FT                   KSYGPATAGGRTMNVPKTAMAPKPATTTTVTRGGFGETVAKQNSLQRSSASGTGTGSRS
FT                   MGG"
FT   gene            complement(314691..315428)
FT                   /gene="fucR"
FT                   /locus_tag="ETAE_0287"
FT   CDS_pept        complement(314691..315428)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fucR"
FT                   /locus_tag="ETAE_0287"
FT                   /product="L-fucose operon activator"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83134"
FT                   /db_xref="GOA:D0ZAH5"
FT                   /db_xref="InterPro:IPR001034"
FT                   /db_xref="InterPro:IPR014036"
FT                   /db_xref="InterPro:IPR018356"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZAH5"
FT                   /protein_id="ACY83134.1"
FT                   /translation="MKHDRHQAIVQLVAEHGTLSTEALAQRLDVSRETIRRDLNTLQKQ
FT                   GKIVRRHGRATGLGGETQDSGDPFNARLKSHLSGKAEIARQALEWIDSGMTLALDASST
FT                   CYYLAKQLPDVEITVFTNSLRICQALAKRQRIQLISSGGLLQRKYACYVNPAILSQLKA
FT                   LEIDLFIFSCEGIDGRGGLWESNAYNADFKALLLKRAAQSLLLIDKSKFNRAGEIQIGT
FT                   LDDVAQVISDMHDDDASLPDGGV"
FT   gene            complement(315483..315905)
FT                   /gene="fucU"
FT                   /locus_tag="ETAE_0288"
FT   CDS_pept        complement(315483..315905)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fucU"
FT                   /locus_tag="ETAE_0288"
FT                   /product="fucose dissimilation pathway protein FucU"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83135"
FT                   /db_xref="GOA:D0ZAH6"
FT                   /db_xref="InterPro:IPR007721"
FT                   /db_xref="InterPro:IPR023750"
FT                   /db_xref="InterPro:IPR023751"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZAH6"
FT                   /protein_id="ACY83135.1"
FT                   /translation="MLKNISPLISPQLLKTLAEMGHGDEIIFADAHFPAHAMGPQVIRA
FT                   DGLSVSDLLAAIIPLFELDSYAPPLVMMAAVEGDTLDPAVEARYLTALFADAPAQPVTR
FT                   IDRFAFYQRAQQAFAIVITGERAKYGNILLKKGVTP"
FT   gene            complement(315899..317362)
FT                   /gene="fucK"
FT                   /locus_tag="ETAE_0289"
FT   CDS_pept        complement(315899..317362)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fucK"
FT                   /locus_tag="ETAE_0289"
FT                   /product="L-fuculokinase"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83136"
FT                   /db_xref="GOA:D0ZAH7"
FT                   /db_xref="InterPro:IPR000577"
FT                   /db_xref="InterPro:IPR013450"
FT                   /db_xref="InterPro:IPR018483"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZAH7"
FT                   /protein_id="ACY83136.1"
FT                   /translation="MTHDVVLVLDCGATNVRAIAVDAHGNVVAQAAQANASQAGAEDAR
FT                   WHVWSLEAILQRFADCCRQIAPQLANARIHALTVTTFGVDGALVDRHGELLYPVISWKC
FT                   PRTTAEMEGIERYISAETLQTLSGIGQFSFNTLYKLLWFKHHHPELLEKAHAWLFISSL
FT                   INQRLTGEFTTDRTMAGTSQLLDVRNELFSDTILRSTGLRSDLFPRMVAAGEHIGHLLP
FT                   TMAQFLGLPTGIPVIAAGHDTQFALFGSGAGLEQPVLSSGTWEILMVRTPQVNTALLPQ
FT                   HRGSTCELDSCQGLFNPGLQWLASGVLEWIRQLYWPDAARQEAYRSMIAEAAAVAPGCD
FT                   GLRMNSQLLLSDGRAGWQGVTLNSGRGHFYRSALESLGWQLRHNLHTLQTLGGFQAQSL
FT                   LLVGGGSRNALWNQIKADILGIPVRVLANAETTVLGAALFAWSGAGYYASADRAREAVT
FT                   FTYHDYIPGEQRAQYQALQPTAPIRSHTC"
FT   gene            complement(317411..319192)
FT                   /gene="fucI"
FT                   /locus_tag="ETAE_0290"
FT   CDS_pept        complement(317411..319192)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fucI"
FT                   /locus_tag="ETAE_0290"
FT                   /product="L-fucose isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83137"
FT                   /db_xref="GOA:D0ZAH8"
FT                   /db_xref="InterPro:IPR004216"
FT                   /db_xref="InterPro:IPR005763"
FT                   /db_xref="InterPro:IPR009015"
FT                   /db_xref="InterPro:IPR012888"
FT                   /db_xref="InterPro:IPR012889"
FT                   /db_xref="InterPro:IPR015888"
FT                   /db_xref="InterPro:IPR038391"
FT                   /db_xref="InterPro:IPR038392"
FT                   /db_xref="InterPro:IPR038393"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZAH8"
FT                   /protein_id="ACY83137.1"
FT                   /translation="MNKQHSLPKVGIRPAIDGRRMGVRESLEAQTMEMAQATARLISEQ
FT                   LRHPCGAPVECVIADTCIAGMAEAAACEEKFSRSNVGLTITVTPCWCYGSETIDMDPLR
FT                   PKAIWGFNGTERPGAVYLAAALAAHSQKGIPAFSIYGHDVQDSGDDSIPADVQQKLLRF
FT                   TRAGLAVAGIKGKSYLSLGGVSMGIAGSIVDHDFFESWLGMKVQAVDMTELRRRIDNQI
FT                   YDQDELALALEWADAHFRYGPDLNAEQYRRSPEENRRVLRESLLMAICIRDMMQGNPKL
FT                   AERGWEEEALGYNAVAAGFQGQRHWTDQYPNGDTAEALLNSAFDWHGVRRPLVVATEND
FT                   SLNGVAMLFGHMLTGTAQIFADVRTYWSPQAVERVTGQRLEGLAEHGIIHLINSGSAAL
FT                   DGTCRQQDAEGHPTIKPHWQISQQEADACLAATEWCPAIHEYFRGGGFSSRFLTRGGVP
FT                   FTMSRVNLIKGVGPVLQIAEGWSVELPEEMHDILDNRTNATWPTTWFVPRLTGNGPFKD
FT                   VYSVMANWGANHGVLTIGHVGADLITLASMLRIPVCMHNVTDDAIYRPSAWAAHGMDSE
FT                   GQDYRACQNYGPLYKRA"
FT   gene            complement(319281..320585)
FT                   /gene="fucP"
FT                   /locus_tag="ETAE_0291"
FT   CDS_pept        complement(319281..320585)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fucP"
FT                   /locus_tag="ETAE_0291"
FT                   /product="L-fucose permease"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83138"
FT                   /db_xref="GOA:D0ZAH9"
FT                   /db_xref="InterPro:IPR005275"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZAH9"
FT                   /protein_id="ACY83138.1"
FT                   /translation="MSDITSKSTSAGNIASAAQRIAVVPKNILIPFVLLTSCFALWGLA
FT                   NNMTDVLIAQFRKVFTLTDMQSGLVQTAFYGAYFCLALPAALFIKRFSYKAGVLLGLGL
FT                   FCSGALLFYPASQIMAYGPFLLALFILAGGLSILETSANPYIIAMGPQETATRRLNLAQ
FT                   SFNPIGSITGVLIGKFYILAQLNPATDAERTVMDPDALASIQSAELSAVMGPYVVVALV
FT                   IIMVWLAIAFTRMPVAHDSSSAESTLKQSFSRLLSKGYFVRGVVGQFFYVGAQIGCWSY
FT                   TIRYVMAEMGGNEAEASTYLLLSIVLFSAFRFVCTALMKFVSPAILLGLLASLASASLL
FT                   LVMFVGGIAGVYGLVAVSACMSLMFPTIFGLSVHGLGKDTQFGGSCLIMAILGGAVLTA
FT                   LMGQISDMAGIRMAFLIPLLGFVYLIHFGFKGHRA"
FT   gene            320682..320996
FT                   /locus_tag="ETAE_0292"
FT   CDS_pept        320682..320996
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAE_0292"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83139"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZAI0"
FT                   /protein_id="ACY83139.1"
FT                   /translation="MIWPTGATFVKLGLPIFRLFDVSMSLSLTSISDGVVFAQNTFDKK
FT                   ENIFNKLIRDTLPCSLRRTSAAIAVPWSTRRRIMSRLISAMFGIVRGEFSPSPLTDVFA
FT                   "
FT   gene            321604..322251
FT                   /gene="fucA"
FT                   /locus_tag="ETAE_0293"
FT   CDS_pept        321604..322251
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fucA"
FT                   /locus_tag="ETAE_0293"
FT                   /product="L-fuculose phosphate aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83140"
FT                   /db_xref="GOA:D0ZAI1"
FT                   /db_xref="InterPro:IPR001303"
FT                   /db_xref="InterPro:IPR004782"
FT                   /db_xref="InterPro:IPR036409"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZAI1"
FT                   /protein_id="ACY83140.1"
FT                   /translation="MERETLARAIIDTCLEMTRLGLNQGTAGNVSVRYRDGMLITPTGI
FT                   PYEQLRCDQIVYVDGEGQHEEGKLPSSEWRFHLAAYQARPDANAVVHNHAIHCTAVSIL
FT                   NRPIPAIHYMIAAAGGNTIPCAPYATFGTRTLSDYVTEALKYRRATLLQHHGLIACGEN
FT                   LQKALWLAHEVEVLAQLYLATLAIVDPVPVLSDEEIAVVLEKFKTYGLRIEE"
FT   gene            322264..323412
FT                   /gene="fucO"
FT                   /locus_tag="ETAE_0294"
FT   CDS_pept        322264..323412
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fucO"
FT                   /locus_tag="ETAE_0294"
FT                   /product="L-1,2-propanediol oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83141"
FT                   /db_xref="GOA:D0ZAI2"
FT                   /db_xref="InterPro:IPR001670"
FT                   /db_xref="InterPro:IPR013460"
FT                   /db_xref="InterPro:IPR018211"
FT                   /db_xref="InterPro:IPR039697"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZAI2"
FT                   /protein_id="ACY83141.1"
FT                   /translation="MAHRMILNETAWFGRGAIAELPAEIQRRGYRKALIVTDATLVACG
FT                   AVARVTKHLDSAGLAYALFDGVVPNPTIRVVQQGLAVFRDSGADYLIAIGGGSPQDTCK
FT                   AIGIISNNPAFEDVRSLEGLSPTTRPSVPILAVPTTAGTAAEVTINYVITDEEQRRKFV
FT                   CVDPHDIPQAAFIDADMMDGMPPALKAATGVDALTHAIEGYITRGAWALTDALHLKAIE
FT                   MIGGALRASVNGDAEAGATMALGQYVAGMGFSNVGLGLVHGMAHPLGAFYNTPHGVANA
FT                   ILLPHVMRYNAGACGEKFRDIARALGVACDDLSLDQAAAAAIAAVEALNRDVGIPPSLR
FT                   EVGVCEEDIVRLAEAALADVCTGGNPRSATLRDIEQLYRQAY"
FT   gene            complement(323475..324044)
FT                   /locus_tag="ETAE_0295"
FT   CDS_pept        complement(323475..324044)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAE_0295"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83142"
FT                   /db_xref="GOA:D0ZAI3"
FT                   /db_xref="InterPro:IPR005325"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZAI3"
FT                   /protein_id="ACY83142.1"
FT                   /translation="MIYFDRNRLLQLDPRFLKQQRVSLLILSLLLLLGGLFCLFRPLAS
FT                   GNALSAVVGILLLLSGVGLIIGMIANRANNLWPMIGGILMGAAYLVMGFIFIRSPEVGL
FT                   FTVAVLVATLFALGGIARLMAGVKLKGAHGGWLQVIIGLLDLLIAWMLISAGPQGSILL
FT                   VTMIVGIEMLFSSFSLFQVAQLLKQR"
FT   gene            324542..325363
FT                   /locus_tag="ETAE_0296"
FT   CDS_pept        324542..325363
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAE_0296"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83143"
FT                   /db_xref="GOA:D0ZAI4"
FT                   /db_xref="InterPro:IPR021134"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZAI4"
FT                   /protein_id="ACY83143.1"
FT                   /translation="MVSCLAVMCYLWHEDFNVNLTLGPFSLLGVAIAIFLGFRNNASYA
FT                   RFIEARVLWGSLLITTRSLMRQAISLMPHPGGEHRRFAMLLTAFSYALKHHLRHEPMAM
FT                   ELTRLLPSQDKAAVLGSCSPCNRLLQLMGQWLGEQRRRGYLSDIDFQTIDTNLNQLSVI
FT                   LGGCERISNTPIPFAYSLIVHRTVYVFCALLPFALVSDLHYMTPLVSVFISYTFIALDA
FT                   LAEELEDPFGIEANDLPLNAMAHTIEANLRDMINDHTHLARICPDSHCRLD"
FT   gene            complement(325432..326115)
FT                   /gene="torD1"
FT                   /locus_tag="ETAE_0297"
FT   CDS_pept        complement(325432..326115)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="torD1"
FT                   /locus_tag="ETAE_0297"
FT                   /product="chaperone protein TorD"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83144"
FT                   /db_xref="GOA:D0ZAI5"
FT                   /db_xref="InterPro:IPR020945"
FT                   /db_xref="InterPro:IPR023069"
FT                   /db_xref="InterPro:IPR036386"
FT                   /db_xref="InterPro:IPR036411"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZAI5"
FT                   /protein_id="ACY83144.1"
FT                   /translation="MSTAGPLTAQHYACLYAWLAGLFAHEADEAQLARLRSPDTQAWLD
FT                   LLCQQAPLRPALQHLQAALAALETRPDARLELAADFAGLFLLSQKRAALPYASCYQGET
FT                   PRFRQAICVEMQSLLRQAGMQLNADFHEPEDHLSIFLELLSHLSFASAEQPEHQESERM
FT                   QLRRTTLNLLLGWLPAFSARCVRYDPFGFYGALSQLLLALVQQDADLNAVERVSPAATP
FT                   GPIAG"
FT   gene            complement(326112..328661)
FT                   /gene="torA"
FT                   /locus_tag="ETAE_0298"
FT   CDS_pept        complement(326112..328661)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="torA"
FT                   /locus_tag="ETAE_0298"
FT                   /product="trimethylamine-N-oxide reductase TorA"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83145"
FT                   /db_xref="GOA:D0ZAI6"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR006655"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR006658"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="InterPro:IPR011887"
FT                   /db_xref="InterPro:IPR041460"
FT                   /db_xref="InterPro:IPR041954"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZAI6"
FT                   /protein_id="ACY83145.1"
FT                   /translation="MNHNESVRISRRRFLSQLGGLTALGMFGPSLLVSRDAQAQAGTAA
FT                   AGGVQEGILTGSHWGAIRATVVDGRFVAAKPFEKDSYPSKMVAGLPDHVHNTARIRYPM
FT                   VRIDWMRKRHLSDTRQRGDNRFVRVSWDEALDLFYQELERIQTTYGPSALLSGSGWQST
FT                   GMFHNAAGMMGRALALHGNSVGTGGDYSTGAAQVILPRVVGSMEVYEQQTSWPLVLKNS
FT                   KTIILWGSDLLKNQQANWWCPDHDVYQYYAQLKEKVANGEIRVVSIDTVVSSTHDYLGR
FT                   DKVQHIAVNPQTDVPLQLALAHTLYSEKLYDAHFLDNYTVGFDQFLPYLLGTQDGQPKD
FT                   AEWAAKLTGIDAETIRALARQMAAGRTQIIAGWCVQRMQHGEQWSWMIVVLAAMLGQIG
FT                   LPGGGFGFGWHYNGAGTPSRKGIILSGFSGATTIPPLHNSSDYRGASSTIPIARFIDAM
FT                   LEPGKKIDWNGKQVTLPALKMCVFAGTNPFHRHQQINRMIAGWQTLETVVAIDNQWTST
FT                   CRFADIVLPATTQFERNDLDQYGNHSNRGILAMKQLVPPQFEARSDFDIFRELCRRFNR
FT                   EQAFTEGLDEMGWIKRIYQEGAQQGKGRGIHLPTFDAFWNGSGYIEFDDPQLFVRHQAF
FT                   RDDPDLEPLGTPSGLIEIYSKSIADMHYGDCQGHPMWFEKAERSHGGPGSARFPLHLQS
FT                   VHPDFRLHSQLCESPTLRAHYSVGGREPVFISPQDADARGIRNGDIVRVFNDRGQVLAG
FT                   AVVSDRYVPGVIRIHEGAWYDPDRGGVAGALCKYGNPNVLTLDIGSSRLAQATSAHTAI
FT                   VEVEKYRGPLDPVTAFNGPQEMVAQCQYVPLQTEETP"
FT   gene            complement(328676..329833)
FT                   /gene="torC"
FT                   /locus_tag="ETAE_0299"
FT   CDS_pept        complement(328676..329833)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="torC"
FT                   /locus_tag="ETAE_0299"
FT                   /product="nitrate/TMAO reductase, membrane-bound tetraheme
FT                   cytochrome c subunit"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83146"
FT                   /db_xref="GOA:D0ZAI7"
FT                   /db_xref="InterPro:IPR005126"
FT                   /db_xref="InterPro:IPR009154"
FT                   /db_xref="InterPro:IPR011031"
FT                   /db_xref="InterPro:IPR036280"
FT                   /db_xref="InterPro:IPR038266"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZAI7"
FT                   /protein_id="ACY83146.1"
FT                   /translation="MKNLWNRLNRPSARWSVLALLALGIVIGLALIVLPHVGIKLTSST
FT                   EFCVSCHSMQPVYQEYKQSVHFKNASGVRAECHDCHIPPDVPGMVKRKLEASNDIYQTF
FT                   IAHSIDTPEKFEAKRAELAEREWKRMKENNSATCRSCHNYDAMDHAKQHPEAAKQMAIA
FT                   AKDNQSCIDCHKGIAHQLPDMSSGFRKQFAELRQTASDDGNTLYTLDMKPIYAAKGDKE
FT                   PAGSLLPASEVTVLKRDGDWLQVQIEGWTETNGRQRVLSLLPGKRIFVSSIRDQVQQNA
FT                   KTLEKTTVAATGVEWSKLQTTAWVQKGDLVNNIKPIWAYADALYNGTCNQCHGAPEKAH
FT                   FDANGWIGTLNGMIGFTSLDKREERTLLKYLQMNASDTGGADQKH"
FT   gene            329965..330660
FT                   /gene="torR"
FT                   /locus_tag="ETAE_0300"
FT   CDS_pept        329965..330660
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="torR"
FT                   /locus_tag="ETAE_0300"
FT                   /product="DNA-binding response regulator in two-component
FT                   regulatory system"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83147"
FT                   /db_xref="GOA:D0ZAI8"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZAI8"
FT                   /protein_id="ACY83147.1"
FT                   /translation="MAMTHHIVIVEDEPVTQARLRDYFVQEGYQVSVTASGAGLRELML
FT                   LQPVDVILLDINLPDENGLMLTRALRERSTVGIILVTGRCDRIDRIVGLEMGADDYVTK
FT                   PLELRELVVRVKNLLWRIDLARQAQPAADNCYLFAGYCLNVSRHTLTLDDEPIRLTRAE
FT                   YEMLLAFVTNPGAILSRERLLRMLSSHRVDSPDVRTVDVLIRRLRAKLRPDLFVTQHGE
FT                   GYFLAAEVA"
FT   gene            complement(330668..331702)
FT                   /gene="torT"
FT                   /locus_tag="ETAE_0301"
FT   CDS_pept        complement(330668..331702)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="torT"
FT                   /locus_tag="ETAE_0301"
FT                   /product="periplasmic sensory protein associated with the
FT                   TorRS two-component regulatory system"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83148"
FT                   /db_xref="InterPro:IPR001761"
FT                   /db_xref="InterPro:IPR014301"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZAI9"
FT                   /protein_id="ACY83148.1"
FT                   /translation="MYRRHTLFLCLLWLSTATAHADAPLLRWPSDRQSVQLRQPPLHAV
FT                   KRWKLCALYPSLKDAYWLSINDGMIRAADRLGVTLKVFEAGGYRQQATQREQMALCRDW
FT                   GADAILIGSSTARFPALATLAAGIPLIEVVNALHDPAIRTRIGVPWFQMGYQPGRYLAQ
FT                   RLGQRPLKVLLMPGPRDAGGSREMSDGFKAALSGSRLQIVDVAYGDNDIEVQRNLLQDM
FT                   LERHPDIDVVAGTAIAAEVAMGEGRNRATPLTIVSFYLSHQVYRGLKRGRILAAASDQM
FT                   VWQGELAVEQALRTLQGERVPDNVSPPILVLTQRNVSSALVRRSLSPLGFRPVYLYQPA
FT                   PKAE"
FT   gene            331782..334574
FT                   /gene="torS"
FT                   /locus_tag="ETAE_0302"
FT   CDS_pept        331782..334574
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="torS"
FT                   /locus_tag="ETAE_0302"
FT                   /product="sensor histidine kinase/response regulator TorS"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83149"
FT                   /db_xref="GOA:D0ZAJ0"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR008207"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036641"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR037952"
FT                   /db_xref="InterPro:IPR038188"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZAJ0"
FT                   /protein_id="ACY83149.1"
FT                   /translation="MGTPSLTRRLWLAFALMAALTLGSVLVGWFSLHYVGRVEQANTQA
FT                   LLPTMNMARQLSEAGAYELFSAQSLSNADSEREWLAQGQMLTAQSLKISRLLDELRRQG
FT                   FDIDTIAQQETEITRSLGEQGALVGQRLQLRMRARALSAQVAAAAEQIAELAKGQASNA
FT                   ATAAGATQAGIYDLIEQRRAAAAEQALDRLIDIDLEYLNQMSELRLSALRVQQMIMALE
FT                   SDSGRLALSEQEERLAQALRILQRRQQRVEDPRIRAQIAQALGQVAQYRTLVDLYRQDN
FT                   DIYARLQALSQNNLDLFTRFSAEISRQVSDIELRNAAALEHLQQARRLGLTWLTLLGGA
FT                   GLLALCLILWRVVYRSLSQPLAHQTAALQRLLDGDFDSPFPDRAGVRELDTIGRLMEAF
FT                   RTSVRALRHQRQHLADLVQMRTAELQALVVEHRQARAEAENADRAKSAFLAAMSHEIRT
FT                   PLHGILGTAQLLAEQPISPQSRGYVQAINDSGESLLAVLNDVLDYSAIEAGSSSVVLND
FT                   EPFSPRQLLDSLLRLAEGRLRERPLRLAHDYADALPAWLQGDPRRIRQIVMNLLNNALR
FT                   FTERGVICVSCGCDETHWWIAVQDSGCGIDPAQQAAIFQPFVQLSARRGGTGLGLAICR
FT                   GLAQAMAGSLELSSTPGKGSRFCLRLPLRRAALPPPEAPAQAWSLVGRRLLLIEDNPLS
FT                   QRISAEMLQSAGVQVHIAGSAAEAQALLARDTAFDAALVDFDLPDSDGPTLARQMAEAY
FT                   PQLKRIGFSAHVLDEAQHRRIRPLFCGMIQKPVPRAELCRLIAHALADGEHSTVRPTRI
FT                   VRQIAAPLDDEQLAEDVATFGQPCLTEWLALFRQHSLPLLAEIAAARAAGDADQVKGLA
FT                   HRLKSSCASLGMRGVADACLALERAPLTAAALDEPIREGLAALEAWLAKVSESDDGKIT
FT                   "
FT   gene            334674..334814
FT                   /locus_tag="ETAE_0303"
FT   CDS_pept        334674..334814
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAE_0303"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83150"
FT                   /db_xref="GOA:D0ZAJ1"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZAJ1"
FT                   /protein_id="ACY83150.1"
FT                   /translation="MWQLKRQAPALHKKTRRINLGWAIALLLLGGSMALAAVIYLIISA
FT                   L"
FT   gene            complement(335162..335237)
FT                   /locus_tag="ETAE_t012"
FT   tRNA            complement(335162..335237)
FT                   /locus_tag="ETAE_t012"
FT                   /product="tRNA-Phe"
FT   gene            complement(335282..335398)
FT                   /locus_tag="ETAE_0304"
FT   CDS_pept        complement(335282..335398)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAE_0304"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83151"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZAJ2"
FT                   /protein_id="ACY83151.1"
FT                   /translation="MYDARSQAPDKALTTRRRGSRLAVGETLILSPDELPGR"
FT   gene            335400..335561
FT                   /locus_tag="ETAE_0305"
FT   CDS_pept        335400..335561
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAE_0305"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83152"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZAJ3"
FT                   /protein_id="ACY83152.1"
FT                   /translation="MLAAVLSAFVSGVSGIAVFQANGDINADVERGASAAGVAKRAILL
FT                   TLEINNMI"
FT   gene            335797..336438
FT                   /locus_tag="ETAE_0306"
FT   CDS_pept        335797..336438
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAE_0306"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83153"
FT                   /db_xref="InterPro:IPR021236"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZAJ4"
FT                   /protein_id="ACY83153.1"
FT                   /translation="MKRILTATALSLAMFSTFTWAADAAPTAPASAAAAAAGLSAQQVQ
FT                   DVAKVAQQGFTAMRDMQYARVALFRGYPDVATKLTDQSAGLLADDSTDWKSFIKSDKKA
FT                   PLAGDNYVIINASIALSEDFVATPEKQKAIAKANEKLSKGDRKGALEELRLAGVGITET
FT                   QYLMPLKQTRQAVAHAQSLLKAGKYYEANLALKGAEEGIITDSVTLVDGK"
FT   gene            complement(336546..337121)
FT                   /locus_tag="ETAE_0307"
FT   CDS_pept        complement(336546..337121)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAE_0307"
FT                   /product="putative TetR-family regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83154"
FT                   /db_xref="GOA:D0ZAJ5"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZAJ5"
FT                   /protein_id="ACY83154.1"
FT                   /translation="MQREHILTQALRRLEQHGLADATLPALIDSETLPLDQARRYWPDS
FT                   EALLYDCLRFHGQQIDTWRRQLLLNDTLSHDDKILARYPVLAEHVEQGRFPGCLFISAC
FT                   IQYPAADHPIHQLASRQKQASFDFTLHLLQESEIGDASLVAHQMELVQEGCLNRLLVSR
FT                   RREDVDIALHLAQDILHIAHCRRHDALS"
FT   gene            complement(337154..338872)
FT                   /gene="dsbD"
FT                   /locus_tag="ETAE_0308"
FT   CDS_pept        complement(337154..338872)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dsbD"
FT                   /locus_tag="ETAE_0308"
FT                   /product="thiol:disulfide interchange protein DsbD"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83155"
FT                   /db_xref="GOA:D0ZAJ6"
FT                   /db_xref="InterPro:IPR003834"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR022910"
FT                   /db_xref="InterPro:IPR028250"
FT                   /db_xref="InterPro:IPR035671"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036929"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZAJ6"
FT                   /protein_id="ACY83155.1"
FT                   /translation="MAQRIFALIALFITTLLPAQASLFGEQPRFVPVNQAFAFDFQQRG
FT                   EHLTLRWQIQPGYYLYRQQIRITPHQAQLGPWQLPPGIPHHDEFQGETAIFRDGLSLTL
FT                   PLLSAAAGGEISVTYQGCAAAGFCYPPETRRIPLEAITATAGALPSPGAATANTEHAPT
FT                   LPFPALWALLIGIGIAFTPCVLPMYPLISALILGQKQRHGWGHTALLALVYVQGMAITY
FT                   TVLGMVVAAAGLRFQAAFQHPYVLIGLSLLFILLALSMFGAFTLQLPASLQTRLTLWSN
FT                   RQRSGSLLGVFVMGALAGLICSPCTTAPLSAILLYIAQSGNLWVGGGTLYLYALGMGIP
FT                   LIAVTLFGNRLLPRSGPWMQHVKEGFGFVILALPVFLLERILGEAWGMRLWSLLGIAFF
FT                   LWGFSLSLHARRRGTRLWQILLLGAALICARPLQDWVFDGAPRASTGVNETLAFQPIDS
FT                   PQQLAQALAQAKARRQPVMLDFYADWCTACKEFEKYTFSNDAVRSQLAGTLLLQANVTA
FT                   NTEQHAQLLQQLNVLGLPSILFFTPDGQPLDNARVTGFMDAERFLAHLRQLPQAQ"
FT   gene            complement(338848..339216)
FT                   /gene="cutA"
FT                   /locus_tag="ETAE_0309"
FT   CDS_pept        complement(338848..339216)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cutA"
FT                   /locus_tag="ETAE_0309"
FT                   /product="divalent-cation tolerance protein CutA"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83156"
FT                   /db_xref="GOA:D0ZAJ7"
FT                   /db_xref="InterPro:IPR004323"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="InterPro:IPR023700"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZAJ7"
FT                   /protein_id="ACY83156.1"
FT                   /translation="MSQTVTPFTAAAAVPVDHSDAVVVLCTAPDEACAQELAAALLGEK
FT                   LAACVTLIPGATSLYYWEGKLEQEYEVQMIIKSERRHQQALLAYLKHQHPYQTPELLVI
FT                   PVQAGDQDYLSWLNASLR"
FT   gene            complement(339353..340654)
FT                   /gene="dcuA"
FT                   /locus_tag="ETAE_0310"
FT   CDS_pept        complement(339353..340654)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dcuA"
FT                   /locus_tag="ETAE_0310"
FT                   /product="anaerobic C4-dicarboxylate transporter DcuA"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83157"
FT                   /db_xref="GOA:D0ZAJ8"
FT                   /db_xref="InterPro:IPR004668"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZAJ8"
FT                   /protein_id="ACY83157.1"
FT                   /translation="MLVLELVIVLLAIFLGARLGGIGIGFAGGLGVLVLAAIGVAPGKI
FT                   PFDVISIIMAVIAAISAMQVAGGMDYLVHQTEKVLRKNPKYITILAPIVTYLLTIFAGT
FT                   GNISLSALPVIAEVAKEQGIKPCRPLSTAVVSAQIAITASPISAAVVYMSSVMEGHGIS
FT                   YLHLLMVVLPSTFLAVLVMSLIVSWCFDSKLSNDPVYRKRLEEGLITLRGDKQIEIKKG
FT                   AQTSVWLFLLGVVAVVAYAIINSPSLGLVAKPLMNTTNAILIIMLSVATLTTIICRVDT
FT                   DNVLNSSTFKAGMSACICILGVAWLGDTFVSANIDWIKETAGTVIQNHPWLLAVIFFFA
FT                   SALLYSQAATAKALMPMALALNVSPLTAVASFAAVSGLFILPTYPTLVAAVQMDDTGTT
FT                   RIGKLVFNHPFFIPGTLGVALSVCFGFLLGSVML"
FT   gene            complement(340770..342206)
FT                   /gene="aspA"
FT                   /locus_tag="ETAE_0311"
FT   CDS_pept        complement(340770..342206)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aspA"
FT                   /locus_tag="ETAE_0311"
FT                   /product="aspartate ammonia-lyase"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83158"
FT                   /db_xref="GOA:D0ZAJ9"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR004708"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR018951"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZAJ9"
FT                   /protein_id="ACY83158.1"
FT                   /translation="MSNNIRIEEDLLGTREVPADAYYGVHTLRAMENFYISNDKISDIP
FT                   EFVRGMVMVKKAAALANRELQTIPRKIADTIILACDEVLNNGKCMDQFPVDVFQGGAGT
FT                   SVNMNTNEVLANIGLELLGHKKGEYQYLNPNDHLNKCQSTNDAYPTGFRIAVYASIMKL
FT                   IDAIKNLREGVDRKADEFKNILKMGRTQLQDAVPMTLGQEFHAFSVLLNEEVKNLQRTA
FT                   ELLLEVNLGATAIGTGLNTPEGYQKLAVQKLAEVSGLPCVPAEDLIEATSDCGSYVMVH
FT                   GALKRTAVKLSKICNDLRLLSSGPRAGLNEINLPELQAGSSIMPAKVNPVVPEVVNQLC
FT                   FKVIGNDTCVTMAAEAGQLQLNVMEPVIGQAMFESISLLTNGCYNLREKCIDGITANKE
FT                   TCEKFVFNSIGIVTYLNPFIGHHNGDIVGKICAETGKSVREVVLERGLLTEAQLDDIFS
FT                   VENLMHPAYKAKRYTDESEK"
FT   gene            342571..343047
FT                   /gene="fxsA"
FT                   /locus_tag="ETAE_0312"
FT   CDS_pept        342571..343047
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fxsA"
FT                   /locus_tag="ETAE_0312"
FT                   /product="hypothetical cytoplasmic membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83159"
FT                   /db_xref="GOA:D0ZAK0"
FT                   /db_xref="InterPro:IPR007313"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZAK0"
FT                   /protein_id="ACY83159.1"
FT                   /translation="MRWLPFILIFFYVYIEISIFIKVAAVLGVALTLLLVILTSCLGAS
FT                   LVRNQGMKTLMQMQQKLAMGESPAAEMIKSVSLVMAGLLLLLPGFFTDFLGLLLMLPPV
FT                   QKRLALKLLPYFRIYRSGGPGDGGGPGGGPGGGGHTFDGEFERKDDDRQRLDNK"
FT   gene            343264..343557
FT                   /gene="groES"
FT                   /locus_tag="ETAE_0313"
FT   CDS_pept        343264..343557
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="groES"
FT                   /locus_tag="ETAE_0313"
FT                   /product="co-chaperonin GroES (HSP10)"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83160"
FT                   /db_xref="GOA:D0ZAK1"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR018369"
FT                   /db_xref="InterPro:IPR020818"
FT                   /db_xref="InterPro:IPR037124"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZAK1"
FT                   /protein_id="ACY83160.1"
FT                   /translation="MKIRPLHDRVIVKRKEVESKSAGGIVLTGSAAGKSTRGEVIAVGH
FT                   GRILENGDVKPLDVKVGDTVIFNDGYGVKAEKIDNEEVLIMSESDILAIVEA"
FT   gene            343617..345260
FT                   /gene="groEL"
FT                   /locus_tag="ETAE_0314"
FT   CDS_pept        343617..345260
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="groEL"
FT                   /locus_tag="ETAE_0314"
FT                   /product="chaperonin GroEL (HSP60 family)"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83161"
FT                   /db_xref="GOA:D0ZAK2"
FT                   /db_xref="InterPro:IPR001844"
FT                   /db_xref="InterPro:IPR002423"
FT                   /db_xref="InterPro:IPR018370"
FT                   /db_xref="InterPro:IPR027409"
FT                   /db_xref="InterPro:IPR027410"
FT                   /db_xref="InterPro:IPR027413"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZAK2"
FT                   /protein_id="ACY83161.1"
FT                   /translation="MAAKDVKFGNDARVKMLRGVNVLADAVKVTLGPKGRNVVLDKSFG
FT                   SPTITKDGVSVAREIELEDKFENMGAQMVKEVASKANDAAGDGTTTATVLAQAIVNEGL
FT                   KAVAAGMNPMDLKRGIDKAVTAAVEELKALSVPCSDSKAIAQVGTISANADDTVGQLIA
FT                   EAMEKVGKEGVITVEEGTGLQDELDVVEGMQFDRGYLSPYFINKPETGAVELESPFILL
FT                   ADKKISNIREMLPVLEAVAKAGKPLLIIAEDVEGEALATLVVNNMRGIVKVAAVKAPGF
FT                   GDRRKAMLQDIATLTAGTVISEEIGMELEKATLEDLGQAKRVVINKDTTIIIDGVGEES
FT                   AIQGRVTQIRQQIEEATSDYDREKLQERVAKLAGGVAVIKVGAATEVEMKEKKARVEDA
FT                   LHATRAAVEEGVVAGGGVALVRVAAKLVDLKGINEEQNVGIKVALRAMEAPLRQIVANA
FT                   GEEPSVVTNNVKAGEGNYGYNAATEEYGDMIDMGILDPTKVTRSALQYASSVAGLMITT
FT                   ECMVTDLPKEEKADLGAAGMGGMGGMGGMM"
FT   gene            complement(345557..353644)
FT                   /locus_tag="ETAE_0315"
FT   CDS_pept        complement(345557..353644)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAE_0315"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR022038"
FT                   /db_xref="InterPro:IPR041498"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZAK3"
FT                   /protein_id="ACY83162.1"
FT                   /translation="MTTDSKSATLNNNPTANNHIDNVKAFTVSGFDLVITFADGRVSTV
FT                   KDGLTDLVLGNIKLSDTTGSEITQSQVISSINTIQLGLDTVYLADKIEDKDKSTESETP
FT                   AQFSELPGVDEPAIEKIQQENLQKKISEYDELLKKQEDALREIVKEKDKVEQQKEIIDK
FT                   KVKSTLSTNLKPHEMDVQEAPPKPPIPPAPLSSSSSSASENASGKQNDVEAKPALSDLP
FT                   LFISGALDEKSDSGKIGDGLTNLTTPTFIGNATPGATATLTINGTPYPLTVDSEGKWAL
FT                   QIQPGLPDGAYDVTLNIVDGNGKTATTTIKITIDSQIDELTAMLDPDSDSGVANDAITN
FT                   NSKPILLGTAEPGAIIKVVIGSLTLTTITDAEGNWSVSPSSNLPDGSYDYIVTATDEAG
FT                   NSTTTQNTLTIDTTAPGIVFSLSAATDSGIAGDFTTNITQPVLTGSTEPGATIIVRLWG
FT                   NAYEIIADPQGNWELTINPALGDGNHEFTVQITDIAGNVSSQSGNLTIDTQAPTITASL
FT                   SSDSDSGSSQTDNITNNAHPVLTGYTKPLAVITITFAGEHYSVKADENGHWSWAIPENL
FT                   SLADGTHPYQLTVSDTAGNKLSTPYQGEFTLDTSPPEPPEPPTATLSDESNSGSLDDMI
FT                   TNVATPTLVGQSEPLAIIHVTIDGKTYQTQANETGEWHLLLDTLSDGTHTITVSAEDQA
FT                   GNISKPSGEMTLVIDTRTPEVTVTLAEGDDSGSSQSDGITAVNQPTFHGSATPNTTLLF
FT                   TINNHAYRIEVGADGQWRLPIDEPLADDSYHYTITVENAAGSTTTIDGTLVIDTTPPPA
FT                   DAGLDEASDSGRDPQDGITNVVKPTLTGHSEPGARVEITFNDTLYSQTSDADGMWSISL
FT                   KDSLSDGTYTYTVKTTDSAGNTSTAEHHFTIDTLSHVDARLDFTSAIPGDNDSTTDQIR
FT                   PKLSGKAEPGSLVTVEFNGHSYSASVDELGNWQLTLPSDAVPGTNSYTVTAEDLAGNIS
FT                   TVTGQFTYIPSGNQPPKVSAQLDPDSDSGIQGDSITNVKKPTIVGQATPGVTILLTIAG
FT                   NSYTTIAAADGSWSIDISQPLNEGHNGYTVVATDPNSGLSSTINNNIFIDSLAPGATVV
FT                   LTDASDSYIKGDMITSDRRPQFTGKTEPGATVSLIIDGVTFTTTADQNGNWLLGPSHTL
FT                   PNGTLGYTVIMTDIAGNQNTTQGNITIDSSTPRMNNAALNEIDDTGVQDRYWTNLLTPT
FT                   IKGWAEPGVKLTISINGNIYDITDISSDGTWRFQLPHGIALDNGLEQEIKYWVTATDSA
FT                   GNSAGTVDAIFIAKRKLTITDGLSEETDSDTKGDKLTSVTNPTLQGTISGGAASDNLHG
FT                   TITIGGKTYPLTITDGGTHWSFSLPADAALSFGVHEYTLTLVDKFGTETTHTATITRTM
FT                   LSGNLDFNDDSGIAGDNITNNTAPALSGKATIGSTLRIEFAGREYDIPVNANGIWTFPL
FT                   PGAPLAEGEYTYKLTESAGQNTTTFNGTFTVDLTPPEVSGGLSTQDQAPNDPSASTNPN
FT                   PTLQGHVEPHREVTVLIDGKRFTTTADANGFWSITLDSNLQPGQSYEYTITSTDSAGNT
FT                   GQYTGTISNGHVQPPLVSFGTHEDYLGGESDKVNEVFYNTSSPPLIGHGTPGDTITLSA
FT                   LTEHGQAYTATVNADGTWKIDLPPELFPSGIPALGATHWSLTVTDSYGIQNTYVINMIP
FT                   DVTPPSLTGELDPLSDSGIAGDGITNVDRPTLKGTTEPGLKVTITLAGQSYTVNADDSG
FT                   QWQFTVPRALADGTYDYQITTVDKAGNSATISGSVTIDSASLVLNGGLDSQADPNVVDG
FT                   WTNNHHQTLKGITEPGAVIAIVLNGISYTPVVSATGEWTLDLPDLPNGHYAYTITATNT
FT                   AGTTAAINGQFTIDDLPPTTTVRLSAASDSGVSGDAITNVDKPTFIGQTKPGATVTLHI
FT                   DGHDYTTVADHAGNWQITVTTPLGEGEHDYRVSVTDRSENSSTPVEGALTIKTEALIGQ
FT                   VTGGLDRDSDSGTLEDSITNNATPNFSGSAPAGVTVIVTIDGKTYRTVADQSGHWKLAV
FT                   TTPLSEGDHPYQIVIKDVAGNQSAPLTGSLTLDRACHLQVQGLASESDSGTVGDGITNT
FT                   TTPTLIGLSDAHATITLTIAGNLYTTTADASGQWRIPLTHPLGEGNHDYHVVATDSAGN
FT                   TSSSTAQVTIDTQAPSAPGGGLASESDSGTVGDGITNNTTPTLIGLSSAHATITLTIAG
FT                   NLYTTTADASGQWRIPLTRPLDEGSHDYHVVATDNAGNTSSSTAQVTIDTQAPSAPGGG
FT                   LSSTSDSGTVGDNITTVTTPMFNGTTEPNATIALTLNNQTYRFSAADDGTWRFTLPESA
FT                   ALSDGTYHYTLQASDKAGNVSAQTQGSITIDTQAPAAPDGGALVDPDGDNIIAVATPVF
FT                   NGTTEPNAMIMLTLNQKTYLIPSDNRGAWYFTLPESASLSDGTYHYTLQASDVAGNTSA
FT                   LTTHTLTIDTRPPEPLQGALVPDADGGALSEGITQQNTPTFSGSAEAHAEISLSIDHKE
FT                   YVTTADDAGKWQLTVDHPLTDATYDYTITAKDAAGNASQLHHQLTVDTFPPTQPNAHAE
FT                   ANTLDDSVTLKGTVDAQESVQITVTLNGHDYQASIDGENWQVALPSQEVKPGENPYTIT
FT                   ATDAAGNTATASGTFTQASTSDTPPHTDYQAQDMAALSAIVTDHINVEAEHYEL"
FT   gene            353780..354310
FT                   /locus_tag="ETAE_0316"
FT   CDS_pept        353780..354310
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAE_0316"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83163"
FT                   /db_xref="GOA:D0ZAK4"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZAK4"
FT                   /protein_id="ACY83163.1"
FT                   /translation="MLAKPIILTLFLFYCYFMSIDYFHCLDLVMEDSSVDDDLAPMVDG
FT                   LSGALCALILVCVVFIISATDVITASRSNNLSFRDSTVDFSKKTIFYSGALSLSDTDVL
FT                   DIRDDFLSQKYSVITFYGAISDKISSHSEKNTYNLLKLYAKLELPKDIEVKFKQGDVSL
FT                   CGNSLACIYWSAN"
FT   gene            354311..355411
FT                   /locus_tag="ETAE_0317"
FT   CDS_pept        354311..355411
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAE_0317"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83164"
FT                   /db_xref="GOA:D0ZAK5"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZAK5"
FT                   /protein_id="ACY83164.1"
FT                   /translation="MYWLGLLFYILSGLSYVAFPAVKNMVNQALLLAPQISYACAVLFI
FT                   YPLAIFLCHLIFRIKSKKYYLLLATQTKLAASIAVSLGLIGTFIGLTDMILAISSSLGG
FT                   DGNLATKMNAMISSISTALGAMSYAFLTSIVGVSISVLLLISLSFWAFYYKSEKEDDSK
FT                   PERERSLELQELLKRISVIESVNVNIANKLIAIPENTQLTEMLAKNSADMVMHLGKIEE
FT                   GLQTIGHSIKKVGEENIEKSSHMLEILSGIEGNGISTGNKLERCIERLSEFNIQMNVQR
FT                   IMFKEHFENVCDSGISNAKSINEMLAAQATQTNLFKEHFEFVQKMSHANHEQLKNIIDS
FT                   QANYINEQGRFKNKLKDVLKVIANEN"
FT   gene            355401..356624
FT                   /locus_tag="ETAE_0318"
FT   CDS_pept        355401..356624
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAE_0318"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83165"
FT                   /db_xref="GOA:D0ZAK6"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZAK6"
FT                   /protein_id="ACY83165.1"
FT                   /translation="MKIKSLAIILCAIIASPFAQAKQATENYVDFINSVYDQSDMIHIK
FT                   ILELESELLRSKQTNFYYSPKVSAESKYKTDNSRGEIFDSKVMVNSLIYSSSLPERFKE
FT                   KDSRIRSAELGLLKEKENLYKSTMENLVGIKYYSDLDLKAQKLEREAISLYNQIEGRYL
FT                   SGIAKASDVEQAKLLIQRIKTESEGINKEIELLKANIELSTGIQYPAQGVYLPDTILNK
FT                   INSYKADEKKIYNNLDYQLIGEQAESAKFNAQQQDNLMQLSLVAEERYNNRRRVDNDSY
FT                   AGIQVSVNVFDLDRKVAKQTGMKSYEVLKRRMDFKYKESMAKIRTLQLTSNSNQKEIKG
FT                   MEDQLNTTSIIIANQKQEYNISQSSYYEMLNTQYDYFSLERRITDMKISETINKISLLQ
FT                   VTGNLLSL"
FT   gene            356675..357862
FT                   /locus_tag="ETAE_0319"
FT   CDS_pept        356675..357862
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAE_0319"
FT                   /product="putative type I secretion membrane fusion
FT                   protein, HlyD family"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83166"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZAK7"
FT                   /protein_id="ACY83166.1"
FT                   /translation="MLVLVFYICIAKIDIVTPGTGVITGAADKLVIVSPDSGFINKFDL
FT                   KTGSLVKQGDILFSYTNLEVFHQEKTLNELVLFADTRIHNLEEDQRLLKMILDGNVSKE
FT                   KGFSSQNTSIPVQELSAFKLLNEYFSLKNEEDNLKLREQKMLEEKDDLNHRVLLLKRKG
FT                   GLLRSAKAPEIEIINNQSEVSQIISQITSGDISLLSLQNDMKAASNRFRSSVLEQLNNN
FT                   SDQLQVLRRERLENIGRLELLRSKIIANSVVSPINGVVLSIERNFDKGSYVENSQPVMT
FT                   IKKNNENKVIDAKILSKYRPFIYADASVKIVINSPGYKNNINGHIAKISADSFSDDEAR
FT                   GGERYYKVEIKPDDKAVVPPELEGVQVNVYALSKKITLLNYMTALVGDNITFNVW"
FT   gene            complement(357849..358007)
FT                   /locus_tag="ETAE_0320"
FT   CDS_pept        complement(357849..358007)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAE_0320"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83167"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZAK8"
FT                   /protein_id="ACY83167.1"
FT                   /translation="MSYIKFATLISFSFSKRMAIVLASNIDINNIIIATADDKAETNPN
FT                   IINITKH"
FT   gene            358135..358281
FT                   /locus_tag="ETAE_0321"
FT   CDS_pept        358135..358281
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAE_0321"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83168"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZAK9"
FT                   /protein_id="ACY83168.1"
FT                   /translation="MEMARKYLTYNYLVLKVALKDKTIIVEQPIYKPLSKNNCVVEELS
FT                   DEK"
FT   gene            358271..360238
FT                   /locus_tag="ETAE_0322"
FT   CDS_pept        358271..360238
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAE_0322"
FT                   /product="putative type I secretion protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83169"
FT                   /db_xref="GOA:D0ZAL0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010128"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZAL0"
FT                   /protein_id="ACY83169.1"
FT                   /translation="MKNNFFDIMRKYCFIEGERFNTKNKSTEMQDVIININEYIVNYFF
FT                   EFTVTSVSYQNNMSLPKTFVVEWGESNYIILQRESNRLINLTSSITIANDDLINKRVFF
FT                   LSKELKKIDDNDAFSAIKKMTPRASYFSLGLIFFALITPLYSNLFNTRLIYSDSYNSIF
FT                   FVTGVFILFVILELLLKSIVYAKTAQQVKTNNITCNAFYLYLLKLSNCRNAAVKIRTID
FT                   SSATALWESYPLIPVDFSLALLFLVCLFSMMSIYAFPLFIYYIILTFLCVYVRFSAYKK
FT                   TLQTNTSSYEKMSTLISLEEKRKELKFLRGNFCEKLLMDKTTKDEYTKMEMNIDNHHWA
FT                   ELIKSNSFVSMVVMFICSYFAVVNGALTTASIIAIMIINSRLSGALVGGINKMYLSKLH
FT                   AFHIKSSLGELLKDRDQCISHNGIAISHIENFSVSHLTIPFLDSALVNGLSLSAVPGDI
FT                   IGITGASGTGKSSLIKALSNSFNDYSGTIKLNNVDIKNVSADYINNCISYHSTNSRFIK
FT                   GTLRENFMVYGIVNDQDIIDILSLCCKKLTLSRENIDEKYVDELNLSNGERQKVLLCMA
FT                   LFKKPEVIFLDESTSFLSSADAITFLEEIKSCYAHAIVFFATHDIALKNMFTQIVTLPY
FT                   GEVMSHNDSVINIPMLKIKR"
FT   gene            complement(361450..368529)
FT                   /locus_tag="ETAE_0323"
FT   CDS_pept        complement(361450..368529)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAE_0323"
FT                   /product="putative invasin"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83170"
FT                   /db_xref="GOA:D0ZAL1"
FT                   /db_xref="InterPro:IPR003344"
FT                   /db_xref="InterPro:IPR003535"
FT                   /db_xref="InterPro:IPR008964"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR015217"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR024519"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="InterPro:IPR038177"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZAL1"
FT                   /protein_id="ACY83170.1"
FT                   /translation="MFKYTYDILNLISKKRLSSILPLINGRPRKSNSTSSNKPIARKMA
FT                   TPPQPIKIKVMAWCNIITQILFPIAISFSPSMSLAAAQRSSMQIHAQSTEPYILKKGET
FT                   VGSVAKKLGVTVSQLKKINQFRKFAHGIDKIGAGDEIDIPHSGSSLTKPGSPAAATPLS
FT                   PHADTSERESRVAGQLMGVGRVLASPQSSNAASEMARSWATAAANDEIVKWLSKYGTAQ
FT                   LQLNIDKNFSLDGSALDWLLPFYDTPTTTTFTQLGFRNRDHRNTLNIGIGTRTLSNNWL
FT                   FGVNAFYDHDLSGKNSRLGLGSEAWTDYLQLSLNGYLRLSDWHQSRDLADYNERPANGF
FT                   DVRANAWMPTLPQLGGKLMYEQYFGDAVGLFGKDNLQRNPYAFTVGVNYTPFPLLTLGV
FT                   DQRLGKNSEHDTQFNVQLNYRIGDDWRAQVDPSAVPHSRLISESRYNLVERNNNIVLEY
FT                   QKQNIMHLSLPSDTLSGQPGSEHMISAILQTKYGLQDIVWQDAEFISAGGKLQRQDKTH
FT                   FNLTLPSYRYSATARRSGSHATAQAEIAANTYHLSATAFDTKGNQSNTINLTVTVEPPT
FT                   VFQGKFEVQHDNAVANGSDAISVDYILTDESGGRVANKTILMTTNNGAKPSNAEINTDQ
FT                   HGVARLNVTNTAAGATLITATVNGVSQTQSVNFIADSAHPDANKSILLASPKSIVANGK
FT                   DATALTLQLKDAYGNPISGQSVTFISSESSGITVSSTTDSGNGNYSATLSGTRAGPLQI
FT                   TVAIDGKPLLGRSAPVTLTADSSQPDAAKSTLTATPDHIVANGTDAATLTLTLKDINDN
FT                   PIDGQKVAFISSERDGVAISHTTDHGNGSYSATLNGTRAGTTQVTVTVDGKPLAVSAAA
FT                   VTLSADGSRPDATRSLLEAKPSQIVANGTEAAALMLTLKDVNGNLISGQRIAFISSENT
FT                   GITVSSATDEGNGRYTATLRGTRAGITQVSVTIDGTPLAVHAARVTLTADSSNPNADKS
FT                   ILEANPSRIVANGVDAATLTLTLKDINDNLISGQSVAFISSEKNGVHISNTTDEGNGRY
FT                   RATLSGTRAGITQVTVAVDGNPLAVSAATVTLTADSSKPDAALSTLEAKPNQIVANGTE
FT                   AAALALMLKDVNGNPISGQRIAFISSENTGIVISGATDEGNGRYSATLKGTRAGATQIT
FT                   VTVDGKPLAVSAATVTLTADSSKPDATLSTLAVTPNQIVANGADSAALALILKDINGNP
FT                   ISGQSVAFISSEKNGVRISQTTDEDNGRYSATLSGTRAGMTQVTVTVDGKPLAVSAVTV
FT                   TLHADSSKPDASLSSFAVNPHEIVANGSDAATLTLLLKDINDNPLAAQNLAFISSETNG
FT                   VSITTTADEGNGRYSATLTGTRAVSTQITVKVNGVTLGVAAETVRLKADSSNPDAGQSA
FT                   LVVDPSRIVANGKDNATLTLTLKDVNGNLLAGQTVAFSGDLGIVVGRTVDHGDGTYSAV
FT                   LTAGITAGSARILTTVNGNELRLNAPSLTLTADSSQPDATKSTLAAKPDQIVANGTEAA
FT                   ALTLTLKDINGNPISGQNVKFVSSEKSGISVGNTSDEGNGRYRAALSGTRAGMTQVTVT
FT                   IDGNPLAVNAVTVTLTADSSKPDAALSTLTAKPEQIVANGIEASTLTLALKDIHDNPIS
FT                   GQRVAFISSENTGITVSSTTDDGSGNYSATLSGTHAVSTQITVTVNGVALAIDAKTVNL
FT                   TADSSNPDAAKSSLKATPKTIVANGSDASTLTLTLKDVNGNLISGQTVAFISSEHDGIT
FT                   VSGTTDNGNGDYSATLQGTRAIGTQITVTVNGQPLAVSAATVTLTADSSHPDSARSTLV
FT                   AAPTQIVTDSTQASTLTLMLMLKDINDNPISGQDVAFISSEKDGIHLTATAEKGNGSYS
FT                   ATLTGTRAGTTEITVTVGGKALAVHAATVTLIADSSKPDATLSTLEANPYNLEATTGAS
FT                   GRATLTLTLKDVHGNPIAGQEVVLSTDLGSISDGGRTTGHADGTYTATIYAGTAAGIAH
FT                   VTTQLNGSAFPLNLEVPINGDSSAPDPSKSSFEATPNLIVANGVETSALKLTLRDAHLN
FT                   PISSQDVKFISSKTNGITISSTTPLNDGTYHATLAGTEAFTTTITVTVNGNPMNASLHT
FT                   TVTLNGNKDHLDSAQSTLALDNATAEANSPIALTLTLKDTHGNPVSGQRVKFISSAPEY
FT                   STFGAVRDDGNGVYTATVSNIIPGSIDISVEVNGTALATLTEKATFTAMNVVISDTKTQ
FT                   NNQLSVNPGTEGSRPTATNLYLLRNSDNKVLAARYGVNSSEWGAFDIGNGLSDSDEYSV
FT                   LASNGAGAYRWAIYKYQLKRNYAEALVGWNTLLDNTARHYDVGTRLWNNTTSVDYPVPT
FT                   MASLDCSIVKTCL"
FT   gene            369165..369287
FT                   /locus_tag="ETAE_0324"
FT   CDS_pept        369165..369287
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAE_0324"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83171"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZAL2"
FT                   /protein_id="ACY83171.1"
FT                   /translation="MTIYSENAKEKTVSGTSLLFLAKNQTVIIALKADEKKTTV"
FT   gene            369320..369565
FT                   /locus_tag="ETAE_0325"
FT   CDS_pept        369320..369565
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAE_0325"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83172"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZAL3"
FT                   /protein_id="ACY83172.1"
FT                   /translation="MHTDIFFDVENELALRKRVMVNFLSTKMDREALIAFQLFKKKTQT
FT                   QSLSKEKKQPIFFFYSLTLLERQMRYLSLEGRPLTY"
FT   gene            369788..369913
FT                   /locus_tag="ETAE_0326"
FT   CDS_pept        369788..369913
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAE_0326"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83173"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZAL4"
FT                   /protein_id="ACY83173.1"
FT                   /translation="MKASLILPGYLNHSLTENHLNICCNLIFLYAFHHIHGQVSL"
FT   gene            370598..370945
FT                   /locus_tag="ETAE_0327"
FT   CDS_pept        370598..370945
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAE_0327"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83174"
FT                   /db_xref="InterPro:IPR025294"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZAL5"
FT                   /protein_id="ACY83174.1"
FT                   /translation="MRIKGLLGLAAVMLLAGCSTMTQLSSAGQQVKFTDTKPGTECQLL
FT                   GEAVGTQSNWLSGQGGETSSMRAAANDLRNKAAAMGGNVVYGAVSPSESFWSSFAPLDS
FT                   KMSGQVYKCPN"
FT   gene            complement(371029..371724)
FT                   /locus_tag="ETAE_0328"
FT   CDS_pept        complement(371029..371724)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAE_0328"
FT                   /product="putative transporter"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83175"
FT                   /db_xref="InterPro:IPR003741"
FT                   /db_xref="InterPro:IPR024185"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZAL6"
FT                   /protein_id="ACY83175.1"
FT                   /translation="MNNRDEFLATIARQLGREVRHTPQPRPQPINDYAQTRLTELSPQQ
FT                   RCDAFIDVASNVMLAHCERCSEAEAAQAALRLCQRYGQTPTLVSGDQRLAQLGITETLV
FT                   RECPATVWDPALGAENLRMAEQAKVGVVYAEYGLTESGGVVLFSSALRGRALSLLPESS
FT                   VFVLRKSTILPRVAQLASLLHQRAQRGERMPSCINLIGGPSSTADIELIKVVGVHGPVN
FT                   AAYLIVEDC"
FT   gene            complement(371724..373145)
FT                   /gene="ykgF"
FT                   /locus_tag="ETAE_0329"
FT   CDS_pept        complement(371724..373145)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ykgF"
FT                   /locus_tag="ETAE_0329"
FT                   /product="putative electron transport protein YkgF"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83176"
FT                   /db_xref="GOA:D0ZAL7"
FT                   /db_xref="InterPro:IPR003741"
FT                   /db_xref="InterPro:IPR004452"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR024185"
FT                   /db_xref="InterPro:IPR024569"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZAL7"
FT                   /protein_id="ACY83176.1"
FT                   /translation="MSLKTSDVKFKDRIRLQLDDAVMRKAVANAQERIGANRQKMVDEL
FT                   GHWDEWRERAEQIRDHVLDNLDAYLYQLAEKVTENGGKVYFAKTKEDATRYILQVAQAK
FT                   NAKKVVKAKSMVTEEIGMNHALQQAGIQVVETDLGEYILQLDQDPPSHVVVPAIHKDRT
FT                   QIRRVLHETLGYDGPETPEAMTLFIRQKIRQDFLSADIGVTGCNFAVAETGSVCLVTNE
FT                   GNARMCTTLPPTHIAVMGMERIAPTFEEVDVLITMLARSAVGARLTGYNTWLTGPREAD
FT                   NLDGPQEFHLVIVDNGRSSILGSPFRAVLRCIRCGACMNTCPAYRHIGGHGYGSIYPGP
FT                   IGAVISPLLGGYANFKDLPYACSLCTACDSVCPVNIPLSKLILRHRQAMVEAGLPPKAE
FT                   QRATRLFTYANSHPGLWKVGMIAGARAASWFIKGGKAPINAGALAEWTAARDLPQADGE
FT                   SFRSWFKQHKAQGNK"
FT   gene            complement(373156..373875)
FT                   /locus_tag="ETAE_0330"
FT   CDS_pept        complement(373156..373875)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAE_0330"
FT                   /product="conserved hypothetical protein with cysteine-rich
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83177"
FT                   /db_xref="InterPro:IPR004017"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZAL8"
FT                   /protein_id="ACY83177.1"
FT                   /translation="MNVNFFVTCLGDALKSRMARDSVLLLEQLGCTVHFPEKQGCCGQP
FT                   AINGGYVKDAIPGMKTLIRALEENDDPIISPAGSCTYAVKSYPSYLSDEPEWALRAERV
FT                   ANRMVDLTSFIVNTLGVQDVGARLPGRAVYHPSCSLLRKMKVREEPLTLLSHVRGLELL
FT                   PFPAAETCCGFGGTFSIKMAEISGEMVKEKVSHMMEVQPEYLIGADISCLINIGGRLQR
FT                   EGLPVKVMHIAEVLMSR"
FT   gene            complement(373925..375478)
FT                   /gene="lldP"
FT                   /locus_tag="ETAE_0331"
FT   CDS_pept        complement(373925..375478)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lldP"
FT                   /locus_tag="ETAE_0331"
FT                   /product="L-lactate permease"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83178"
FT                   /db_xref="GOA:D0ZAL9"
FT                   /db_xref="InterPro:IPR003804"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZAL9"
FT                   /protein_id="ACY83178.1"
FT                   /translation="MPAYLPFFLGILPLAVMIILILKLKTPIHLAVLITLALTLAVTGL
FT                   YWHTPLQTLGSALIYGALKGLWPIVIVILGAIYSYNLMLKTGSMDILRDVLAAVSDDKR
FT                   IQVLLIAWCFGGFLEAAAGYGTAVAIPIGILIALGFNPLKAAIASLVANTVPTAFGAVG
FT                   IPVSILAEQVNLPVTALSGTIISQLALFNILLPFVIVAIIGGGVKALRGVFTLTLLCGI
FT                   STLIPQYLVAIKLGAELPAFAGSLVSLIVVTLMAKARRGETAAEYRIDGAHLKGNVRYS
FT                   APQLLRACAIYLLIFIFILLCSPLFPAIRSTVAQVASVLPFPLANGQVLKLKIDWIATP
FT                   GVLIIIATLIGGVIQGAALRQMLQVFVATVKQLKNSIIAISAIVAMATVMDVSGLIATL
FT                   AQTLVNVTGGGYLFIAPIIGALGTFVTGSDTNSNVLFGKLQTMAAEKLHVDPLWLAAAN
FT                   TSGATGGKMISPQSIAIAVSATRMDGQGSAIMSGTLKYCCAYIVILGLKVGLVYYLFMS
FT                   "
FT   gene            complement(375717..376745)
FT                   /locus_tag="ETAE_0333"
FT   CDS_pept        complement(375717..376745)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAE_0333"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83180"
FT                   /db_xref="GOA:D0ZAM0"
FT                   /db_xref="InterPro:IPR003739"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022462"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZAM0"
FT                   /protein_id="ACY83180.1"
FT                   /translation="MAHIVTQKGQPREDWLQQLADVVTDPADLLAQLGLSDHPQWLAGC
FT                   EARRLFPLRVPRAFISRIRRGDPNDPLLRQVMSDAAEFIETPGFSTDPLEEQHSVVPGL
FT                   LHKYQNRALLLVKGGCAVNCRYCFRRHFPYQENQGTRANWQRAVAYLHEHPELDEIIFS
FT                   GGDPLMAKDHELDWLFTQLEQLPHLRRLRIHSRLPVVIPARVTDALCQRMADSRLQMVL
FT                   VTHINHANEIDEALSEAMGRLKQAGVTLLNQSVLLRGVNDSADTLAALSNALFDAGILP
FT                   YYLHVLDKVQGGAHFMVPDDEARRLMHGLLAQVSGYLVPRLTREIGGEPSKTQLDLHLR
FT                   QQ"
FT   gene            376788..377354
FT                   /gene="efp"
FT                   /locus_tag="ETAE_0332"
FT   CDS_pept        376788..377354
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="efp"
FT                   /locus_tag="ETAE_0332"
FT                   /product="translation elongation factor P"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83179"
FT                   /db_xref="GOA:D0ZAM1"
FT                   /db_xref="InterPro:IPR001059"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR011768"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013185"
FT                   /db_xref="InterPro:IPR013852"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR015365"
FT                   /db_xref="InterPro:IPR020599"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZAM1"
FT                   /protein_id="ACY83179.1"
FT                   /translation="MATYSSNDFRSGLKIMMDGEPYAVESSEFVKPGKGQAFARVKLRR
FT                   LLTGKLIEKTFKSTDSAEGADVMDVNLTYLYNDGEFWHFMNNETFEQLAADAKAVGDNA
FT                   KWLLDQAECVVTLWNGQPIAVTPPNFVELEIVETDPGLKGDTAGTGGKPATLTTGAVVK
FT                   VPLFVQIGEVIKVDTRSGEYVSRVK"
FT   gene            377563..377865
FT                   /gene="sugE"
FT                   /locus_tag="ETAE_0334"
FT   CDS_pept        377563..377865
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sugE"
FT                   /locus_tag="ETAE_0334"
FT                   /product="quaternary ammonium compound-resistance protein
FT                   SugE"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83181"
FT                   /db_xref="GOA:D0ZAM2"
FT                   /db_xref="InterPro:IPR000390"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZAM2"
FT                   /protein_id="ACY83181.1"
FT                   /translation="MLIAGLLEVVWAISLKYSHGFTRLWPSVVTLLAMAASVLLLAHAM
FT                   KTLPAGTAYAVWTGIGAVGAAIMGIILLGESASPLRLLSLGLILCGILGLKFSHT"
FT   gene            complement(377934..378293)
FT                   /gene="frdD"
FT                   /locus_tag="ETAE_0335"
FT   CDS_pept        complement(377934..378293)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="frdD"
FT                   /locus_tag="ETAE_0335"
FT                   /product="fumarate reductase subunit D"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83182"
FT                   /db_xref="GOA:D0ZAM3"
FT                   /db_xref="InterPro:IPR003418"
FT                   /db_xref="InterPro:IPR034804"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZAM3"
FT                   /protein_id="ACY83182.1"
FT                   /translation="MMNNKVYKRSDEPVFWGLFGAGGMWGAIFAPAVILIVGILLPLGM
FT                   FPDALTFERALSFSQSIIGRIFWLLMIILPLWCGLHRLHHMMHDLKIHVPAASWVFYGL
FT                   AAILSVVALIGIFTL"
FT   gene            complement(378307..378666)
FT                   /gene="frdC"
FT                   /locus_tag="ETAE_0336"
FT   CDS_pept        complement(378307..378666)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="frdC"
FT                   /locus_tag="ETAE_0336"
FT                   /product="fumarate reductase subunit C"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83183"
FT                   /db_xref="GOA:D0ZAM4"
FT                   /db_xref="InterPro:IPR003510"
FT                   /db_xref="InterPro:IPR034804"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZAM4"
FT                   /protein_id="ACY83183.1"
FT                   /translation="MSSNWWQKLGFYKFYMLRESSALENVWFSIVLIYGVFSLKDGAAG
FT                   WESFVAFLQNPLVLVLNIISLLLAVLHTKTWFELAPKAANIVVNDEKMGPAPIIKALWV
FT                   VTIVATVVVLGLALL"
FT   gene            complement(378722..379456)
FT                   /gene="frdB"
FT                   /locus_tag="ETAE_0337"
FT   CDS_pept        complement(378722..379456)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="frdB"
FT                   /locus_tag="ETAE_0337"
FT                   /product="fumarate reductase iron-sulfur subunit"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83184"
FT                   /db_xref="GOA:D0ZAM5"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR004489"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR025192"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZAM5"
FT                   /protein_id="ACY83184.1"
FT                   /translation="MAEMKNLKMEVMRYNPEQDAEPRFVTYEVPYDDTTSLLDALLYVK
FT                   DNLAPDLSFRWSCRMAICGSCGMMVDNVPKLACKTFLRDHPNGMRVEALANFPVERDLV
FT                   VDMTHFIESLEAIKPYVIGNDRKPEDGTNKQTPAEMEKYHQFSGCINCGLCYAACPQFG
FT                   LNPEFIGPAAITLAHRYNLDNRDHGKKERMPVLNTQNGVWSCTFVGYCSEVCPKHVDPA
FT                   AAIQQGKVESAKDFMIAMLKPQ"
FT   gene            complement(379449..381125)
FT                   /gene="frdA"
FT                   /locus_tag="ETAE_0338"
FT   CDS_pept        complement(379449..381125)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="frdA"
FT                   /locus_tag="ETAE_0338"
FT                   /product="fumarate reductase flavoprotein subunit"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83185"
FT                   /db_xref="GOA:D0ZAM6"
FT                   /db_xref="InterPro:IPR003952"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR005884"
FT                   /db_xref="InterPro:IPR014006"
FT                   /db_xref="InterPro:IPR015939"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR037099"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZAM6"
FT                   /protein_id="ACY83185.1"
FT                   /translation="MRSHTVAAEGGSAAVTQAHDSFDFHFHDTVAGGDWLCEQDVVDHF
FT                   VHNCPREMTQLELWGCPWSRKPDGSVNVRRFGGMKIERTWFAADKTGFHMLHTLFQTSL
FT                   KYPQIQRFDEHFVLDILVDDGQARGVVAINMMEGTMVQIRANAVILATGGAGRVYRYNT
FT                   NGGIVTGDGMGMAFKHGIPLRDMEFVQYHPTGLPGSGILMTEGCRGEGGILVNKDGYRY
FT                   LQDYGLGPETPLGEPKNKYMELGPRDKVSQAFWHEWRAGRTISTPRGDVVYLDLRHLGA
FT                   KKLHERLPFICELAKAYVGVDPVNEPIPVRPTAHYTMGGIETDQSCETRIKGLFAVGEC
FT                   SSVGLHGANRLGSNSLAELVVFGRVAGESALQHLQNVTPANGTALDAQVKDIEGNLKAL
FT                   VNQEGNENWATLRDEMGTSMEEGCGIYRTTDLMQKTVDKLAELKERFKRVKITDTSSVF
FT                   NTELLYAIELEHGLNVAECMAHSAINRRESRGAHQRLDEGCTERDDVNFLKHTLTYFNE
FT                   SGAPRIEYSDVKITKLPPAKRVYGAEAEAQEAKKKEEKANG"
FT   gene            381432..381551
FT                   /locus_tag="ETAE_0339"
FT   CDS_pept        381432..381551
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAE_0339"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83186"
FT                   /db_xref="GOA:D0ZAM7"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZAM7"
FT                   /protein_id="ACY83186.1"
FT                   /translation="MGVLSFLGRENIVKRDLNNVSVVIFYFLICFICFLEQCK"
FT   gene            381717..382694
FT                   /gene="yjeA"
FT                   /locus_tag="ETAE_0340"
FT   CDS_pept        381717..382694
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yjeA"
FT                   /locus_tag="ETAE_0340"
FT                   /product="lysyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83187"
FT                   /db_xref="GOA:D0ZAM8"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004525"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR018149"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZAM8"
FT                   /protein_id="ACY83187.1"
FT                   /translation="MSDTASWQPSAPVANLLKRASILSTIRRFFSDRGVLEVDTPSMSQ
FT                   ATVTDVHLVPFQTHFVGPGVAQGMTLYLMTSPEYHMKRLLAAGSGPIYQLCRSFRNEES
FT                   GRYHNPEFTMLEWYRPHYDMYRLMNEVDDLLQQVLECESAETLSYQQAFIRHLDVDPLS
FT                   ADKTQLREAAAKLDLSNVADNEEDRDTLLQLLFAFGVEPHIGKERPAFVYHFPASQASL
FT                   AQISTEDHRVAERFEVYYRGVELANGFHELTDAAEQRLRFEQDNRKRAAAGLPQQPIDE
FT                   HLLAALEHGMPDSSGVALGVDRLIMLALSAERLSEVIAFSVDRA"
FT   gene            complement(382750..386073)
FT                   /locus_tag="ETAE_0341"
FT   CDS_pept        complement(382750..386073)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAE_0341"
FT                   /product="putative membrane transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83188"
FT                   /db_xref="GOA:D0ZAM9"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR011014"
FT                   /db_xref="InterPro:IPR011066"
FT                   /db_xref="InterPro:IPR023408"
FT                   /db_xref="InterPro:IPR024393"
FT                   /db_xref="InterPro:IPR025692"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZAM9"
FT                   /protein_id="ACY83188.1"
FT                   /translation="MRQILQRILLSGLLLLLLPGLAQATLNERQLALDLKQAEAAKSAP
FT                   AQAETVDALQSALGWIDEAKASAQRTQQYRRAISDFPRLTRELRQQLSDESQPPAPAAL
FT                   PPASDAEQRMLQISSQLLEVARQLQQEQDRARDISDSLSQVAQKQAATRKALSEAERRL
FT                   QALTVTETALSQAQSAQLQAEVAARKAQVDELELEQLSANNRQELIRLQSEVLSRRHER
FT                   LDLQLQGLRNSLNSQRQRDAEEALERTRRLVEQSDNLPRSIVEQLTINQTLSRDLNHQA
FT                   QRLDDIAGRQRTIAGQTQQVRLALNTLREQAQWLSVSPALGETLRDRLARLPEMPKPQQ
FT                   LDSDMARLRVQRLRYEALLDKLAPASDYRQNDGEPLSGAQQRLLAPQLATQRELLNSLL
FT                   SGCDSQILELTKLKVANTQLIEALTEVREATHRYLFWAADIDPVGLGYLLTTLRALDRL
FT                   LSLDTLSQLSQATMMMLTDRTTLLPLCAALLLVGFSVYSRRYYSAFLARAAGRVGKVNQ
FT                   DHISLTLRTLLWSILVALPLPVLWAAVGYGLSNAWPYPVAVAIGEGVSAALPVLWAFMI
FT                   SAAFSRDSGLFIVHFGWGERQVRRAMRYYRMSIWLIVPLLMAVVTFNNLADRSFTATLG
FT                   RACFIMLCLALLLLTTSLRRAGIPLYLNRAGSGENLLNHLLWGGLLCAPAAAILAALLG
FT                   YLGAAQVLLARLETSVAIWFCLLMVYSVIRRWMLIQRRRIAFERAKQRRAERLEKRSRH
FT                   DEDGLHPAGVEGSQEVDESVVDLDAISERSLRLVRSILTMIALVSLIWLWSELHSAFAF
FT                   LENIRLWDVTASGVGGETLQPITLGAVLIAILVILVTIQLVKNLPALLELGLLQHLELS
FT                   PGTGYAITTITKYLLMIVGGLIGFSLLGIEWSKLQWLVAALTVGLGFGLGEIFGNFISG
FT                   LIILFEKPIRIGDTVTIRDLTGTITRINTRATTISDWDRKEIIVPNKAFIMEQFINWSL
FT                   SDPITRVVLTVPAEASANSQRVTELLLQAAGQCSLVLATPAPEVYLVDIQQGIQIFELR
FT                   IYASEMAHRMPLRHELHQLILAAYRQHDLVLPFPPIQIGSDSLRQVRGGQRRGFSAGGV
FT                   "
FT   gene            complement(386130..387047)
FT                   /gene="psd"
FT                   /locus_tag="ETAE_0342"
FT   CDS_pept        complement(386130..387047)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="psd"
FT                   /locus_tag="ETAE_0342"
FT                   /product="phosphatidylserine decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83189"
FT                   /db_xref="GOA:D0ZAN0"
FT                   /db_xref="InterPro:IPR003817"
FT                   /db_xref="InterPro:IPR033177"
FT                   /db_xref="InterPro:IPR033178"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZAN0"
FT                   /protein_id="ACY83189.1"
FT                   /translation="MDKEANVLDSIKIRLQYLLPKQGLTRLAGWAADKQAGWLTQSAIK
FT                   GFARYYGINMQEALYPDPAHYKTFNDFFVRPLRDGVRPLAEFDDGVVLPADGAISQLGP
FT                   IDADRILQAKGHDYTLEALLAGQYPLADTFRGGQFVTTYLSPRDYHRVHMPCDGQLREM
FT                   IYVPGDLFSVNPLTAANVPNLFARNERLICIFDTAFGPLAQILVGATIVGSIETVWGGC
FT                   VNSERAGIIRRWTYPAEGEHAVALKKGQEMGRFKLGSTVINLFAPGRIQFDRALSAGSI
FT                   TRMGRELGHAPAAAQESAADPESA"
FT   gene            complement(387154..388158)
FT                   /gene="yjeQ"
FT                   /locus_tag="ETAE_0343"
FT   CDS_pept        complement(387154..388158)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yjeQ"
FT                   /locus_tag="ETAE_0343"
FT                   /product="ribosome-associated GTPase"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83190"
FT                   /db_xref="GOA:D0ZAN1"
FT                   /db_xref="InterPro:IPR004881"
FT                   /db_xref="InterPro:IPR010914"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030378"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZAN1"
FT                   /protein_id="ACY83190.1"
FT                   /translation="MHANHQRRLQQTDNSAEMDDSLFGDAQDGIVVSRFGKHADVEAAD
FT                   GTQQRCNIRRTLPSLVTGDRVVWRAALQAGSKGIVEAVHPRSSVLTRPDYYDGVKPIAA
FT                   NIDQIVIVSAILPELSLNIIDRYLVACETLCVEPLIVLNKVDLLDDEGREFVEQAMAIY
FT                   RHIGYRVVLVSSHSGEGMAQLQALLTQRISIFAGQSGVGKSSLLNALLPALESQIEVGA
FT                   VSDNSGLGQHTTTAARLYHFPHGGDVIDSPGVREFGLWHLDAEQITQGFIEFRDYLGSC
FT                   KFRDCKHGNDPGCALREAVARDDIAETRFDNYHRILEGMAQVKLRKNFGNGDS"
FT   gene            388347..388892
FT                   /locus_tag="ETAE_0344"
FT   CDS_pept        388347..388892
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAE_0344"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83191"
FT                   /db_xref="GOA:D0ZAN2"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="InterPro:IPR022894"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZAN2"
FT                   /protein_id="ACY83191.1"
FT                   /translation="MSASETRLIWIDLEMTGLDPQRDRIIEIATLVTDADLNVLAEGPV
FT                   IALHQDDAQLALMDEWNVRTHTASGLVARVKASQYDDAAAEQATLDFLRQWVPAGVSPI
FT                   CGNSVGQDRRFLFRYMPELERYFHYRYLDVSTLKELARRWKPEILEGFKKKNTHQALDD
FT                   IRESVAELAYYRTHFIQL"
FT   gene            389074..389149
FT                   /locus_tag="ETAE_t013"
FT   tRNA            389074..389149
FT                   /locus_tag="ETAE_t013"
FT                   /product="tRNA-Gly"
FT   gene            389197..389272
FT                   /locus_tag="ETAE_t014"
FT   tRNA            389197..389272
FT                   /locus_tag="ETAE_t014"
FT                   /product="tRNA-Gly"
FT   gene            389324..389399
FT                   /locus_tag="ETAE_t015"
FT   tRNA            389324..389399
FT                   /locus_tag="ETAE_t015"
FT                   /product="tRNA-Gly"
FT   gene            complement(389556..389690)
FT                   /locus_tag="ETAE_0345"
FT   CDS_pept        complement(389556..389690)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAE_0345"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83192"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZAN3"
FT                   /protein_id="ACY83192.1"
FT                   /translation="MTKKRWAGWRSAVHKNRILLLFNPHCGRKRSTSLFSFQFIILYQ"
FT   gene            complement(389690..390829)
FT                   /locus_tag="ETAE_0346"
FT   CDS_pept        complement(389690..390829)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAE_0346"
FT                   /product="putative 4Fe-4S binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83193"
FT                   /db_xref="GOA:D0ZAN4"
FT                   /db_xref="InterPro:IPR004453"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR013542"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZAN4"
FT                   /protein_id="ACY83193.1"
FT                   /translation="MTHPLDLHQLAQHIKQWGLSLGFQQVGISDTDLRAEEAPLQAWLD
FT                   SGYHGEMEWMARHGMMRARPDELLPGTLRVISVRMNYLPPSAAFASTLKDPTLGYISRY
FT                   ALGRDYHKVLRARLKKLGEMIQAYCGELHFRPFVDSAPLLERPLAAKAGLGWTGKHSLL
FT                   LNPQAGSWFFLGELLIDLPLPVDTPQTAQCGRCVACITTCPTDAIVAPYKVDARRCISY
FT                   LTIELEGPIPEALRPLLGNRIYGCDDCQMICPWNRLAPLSEEADFLPRAALHAPALTTL
FT                   FAWDESTFLRMTEGSPIRRIGYQRWLRNLSVALGNAPYDAHIVTLLQQRLGISALLDEH
FT                   IHWALAQQRQKRAAQAVEVISSQQRRLIRAVDKGLPRDA"
FT   gene            390828..392324
FT                   /locus_tag="ETAE_0347"
FT   CDS_pept        390828..392324
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAE_0347"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83194"
FT                   /db_xref="GOA:D0ZAN5"
FT                   /db_xref="InterPro:IPR000631"
FT                   /db_xref="InterPro:IPR004443"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="InterPro:IPR030677"
FT                   /db_xref="InterPro:IPR036652"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZAN5"
FT                   /protein_id="ACY83194.1"
FT                   /translation="MMGHSCNRNADSLSHYVAPADWVRNAEARAAAAQGITLATLMQRA
FT                   GLAAFNRGRQCYPTSRRWLILCGHGNNGGDGYVIARLARASGLQVTLMAVAGHSPLPPE
FT                   AQQARAQWLQCGGSEIAASLPLPAAEVIVDALLGIGLSAAPRAPYDGLITAINAHPAPV
FT                   LSVDLPSGLNADTGAAAGAVVRADHTQSFICLKPGLLTGLARAVVGQLHCDPLGLTPWL
FT                   AQQDWPLQRLDGHCLPRWLAPRSPLAHKGDNGRLLLIGGDSGMGGAIRLAGQAALRSGA
FT                   GLVRVLTRAEHVAPLLAAAPELMVKALSPDTLKEALSWAEVVVVGPGLGQGEWGQRALA
FT                   ALASVRKPMLWDADALNLLSGAPSVCEWRVMTPHPGEAARLLGCGIADVENDRPAAVRA
FT                   LQRRYGGVALLKGAGTLIADDARCAIADIGNPGMASGGMGDILSGIIGGLLAQKLTLYD
FT                   AACAGAVLHGVAADAAARRDGERGMLASDLLPEIRRWANP"
FT   gene            392355..392819
FT                   /locus_tag="ETAE_0348"
FT   CDS_pept        392355..392819
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAE_0348"
FT                   /product="putative ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83195"
FT                   /db_xref="GOA:D0ZAN6"
FT                   /db_xref="InterPro:IPR003442"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZAN6"
FT                   /protein_id="ACY83195.1"
FT                   /translation="MTSIVLQLPDEAATIALGGALARACQRATVIYLYGDLGAGKTTFS
FT                   RGFLQAMGHQGTVKSPTYTLVEPYLLAPRPVYHFDLYRLADPEELEFMGIRDYFAQDAL
FT                   LLVEWPQQGMGFLPEPDITLHLTYTGGGRQAVIEAHSVHGQSVLAALNGQ"
FT   gene            392839..394491
FT                   /locus_tag="ETAE_0349"
FT   CDS_pept        392839..394491
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAE_0349"
FT                   /product="putative N-acetylmuramoyl-L-alanine amidase"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83196"
FT                   /db_xref="GOA:D0ZAN7"
FT                   /db_xref="InterPro:IPR002508"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZAN7"
FT                   /protein_id="ACY83196.1"
FT                   /translation="MLQRFLRITLPLALGWCLATMAGAAQLTNIQVSNGDRQAVVTLTF
FT                   NAPPELSHRIERNPDRVLVEIADSKRITGGLPMQFSGENMLSRIRDGGEQRAGKVLLVL
FT                   DTTQRPRVSVARSGNRAVLTLRAESRAAVAPASPPASTGKNPFHSRPRQAAAPALAPAA
FT                   APLPSVPVSAVKKSGRYDGSKIVVAIDAGHGGQDPGAIGQDGLREKEVTLAIARRLRGL
FT                   MDDDPMFQPVLTRSGDYFISVMGRSDVARRQKANLLISIHADAAPNRSANGASVWVLSN
FT                   RRANSEMAGWLEQHEKQSELLGGAGDVLANSNQDKYLSQTVLDLQFGHSQRVGYDVAVQ
FT                   VLRQMQSVVRLHKRHPEHASLGVLRSPDIPSLLVETGFISNSEGERQLGNGQHQERIAR
FT                   AIYLGVRSYFLAHPLQSGPKVENRPQPASAAGNVAAAAAVAPSASEIHVVKRGETLLGI
FT                   ANRYGSTLSGMMRLNNLKKEGVWVGQRLKVPSAGGSAQPAAASAPRIHLVKRGDTLTRI
FT                   AAHYGVSMDALRQANKMKSDEVQLGQRLRIPSR"
FT   gene            394509..396428
FT                   /gene="mutL"
FT                   /locus_tag="ETAE_0350"
FT   CDS_pept        394509..396428
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mutL"
FT                   /locus_tag="ETAE_0350"
FT                   /product="DNA mismatch repair enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83197"
FT                   /db_xref="GOA:D0ZAN8"
FT                   /db_xref="InterPro:IPR002099"
FT                   /db_xref="InterPro:IPR013507"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR014762"
FT                   /db_xref="InterPro:IPR014790"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020667"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR037198"
FT                   /db_xref="InterPro:IPR038973"
FT                   /db_xref="InterPro:IPR042120"
FT                   /db_xref="InterPro:IPR042121"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZAN8"
FT                   /protein_id="ACY83197.1"
FT                   /translation="MPIQILPPQLANQIAAGEVVERPASVVKELVENSLDAGATRIDID
FT                   IERGGAKLIRIRDNGSGIGKAELALALARHATSKISTLDDLEAIVSLGFRGEALASISS
FT                   VSRLTMTSRPEGQAEAWQAYAEGREMAVTVKPAAHPVGTTLEVLDLFYNTPARRKFLRT
FT                   EKTEFAHIDEVVRRIALARFDITLTLQHNGKTVRQYRAVREGDARERRLGAICGTAFVQ
FT                   HALALAWRHDDLAIHGWVAAPQAIRQIGELQYCYVNGRMMRDRLITHAIRQAYQDRLSD
FT                   ELPPAYVLYLEIDPRQVDVNVHPAKHEVRFHQARLVHDFIYQAVVDVLQQAQVASAQDD
FT                   PTLATPGAALDEGPRGVENRASAGENRFNRPASSPIASAPRPAHAAAPRMPAGDIFRRR
FT                   EGELYQRLLAASPTPAGETDSAFVAAPSAPLPAAEPPAVAVSTAAERAAPGDSLGRVLT
FT                   LCADGVALTECRRGVALVSLSYARRCLLRAQLQPSDEGLKAQPLLVPLRLTLEAAERQA
FT                   LQAQQPLLQQMGIRLQPERQHAQLHAVPLPLRQQNLPRLIPQMLRYLATAPACDAASLA
FT                   DWLAVHWHSADEAPWTVAQAVQLLADLERLCPQLVQSPPRALLQPLNLQPGVERLRQEE
FT                   QLNE"
FT   gene            396421..397374
FT                   /gene="miaA"
FT                   /locus_tag="ETAE_0351"
FT   CDS_pept        396421..397374
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="miaA"
FT                   /locus_tag="ETAE_0351"
FT                   /product="tRNA delta(2)-isopentenylpyrophosphate
FT                   transferase"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83198"
FT                   /db_xref="GOA:D0ZAN9"
FT                   /db_xref="InterPro:IPR018022"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR039657"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZAN9"
FT                   /protein_id="ACY83198.1"
FT                   /translation="MSNDKQMQKLPPAIFIMGPTASGKTALAMALRERFPVEIISVDSA
FT                   LIYRGMDIGTAKPSAEELARAPHRLIDIRSPTQSYSAADFRADALREMAQISAQGRIPL
FT                   LVGGTMLYYKALLEGLSPLPPADAAVRARIEQQAREQGWEALHRELARIDPVAAARIHP
FT                   NDPQRLSRALEVFFVSGNTLTELTRVSGEALPYAVSQFAIAPSSRELLHQRIALRFQQM
FT                   LEAGFEQEARRLFARGDLHPDLPSVRCVGYRQMWSYLAGEIDYDEMVYRGVCATRQLAK
FT                   RQMTWLRGWESVQWLDSDKPAEALDCVAQVVSASLD"
FT   gene            397615..397845
FT                   /gene="hfq"
FT                   /locus_tag="ETAE_0352"
FT   CDS_pept        397615..397845
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hfq"
FT                   /locus_tag="ETAE_0352"
FT                   /product="RNA-binding protein Hfq"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83199"
FT                   /db_xref="GOA:D0ZAP0"
FT                   /db_xref="InterPro:IPR005001"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZAP0"
FT                   /protein_id="ACY83199.1"
FT                   /translation="MNGIKLQGQIESFDQFVILLKNTVSQMVYKHAISTVVPSRPVSHH
FT                   SGNAGTGSAGSSYHHGGQAASQPTQGSDDAE"
FT   gene            397944..399224
FT                   /gene="hflX"
FT                   /locus_tag="ETAE_0353"
FT   CDS_pept        397944..399224
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hflX"
FT                   /locus_tag="ETAE_0353"
FT                   /product="GTP-binding protein HflX"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83200"
FT                   /db_xref="GOA:D0ZAP1"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR016496"
FT                   /db_xref="InterPro:IPR025121"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030394"
FT                   /db_xref="InterPro:IPR032305"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR042108"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZAP1"
FT                   /protein_id="ACY83200.1"
FT                   /translation="MFDRYEAGEQAVLVHIYFSQEKDSEDLSEFESLVSSAGVQALRVI
FT                   TGSRKAPHPKYFVGEGKAQEIAQAVAETQASVVLFDHPLSPAQERNLERLCQCRVIDRT
FT                   GLILDIFAQRARTHEGKLQVELAQLRHLATRLVRGWTHLERQKGGIGLRGPGETQLETD
FT                   RRLLRDRIHLIIGRLEKVEKQREQGRRARVRAEIPTVSLVGYTNAGKSTLFNTLTSATV
FT                   YAADQLFATLDPTLRRVEVNDVGPTVLADTVGFIRHLPHDLVAAFKATLLETRQASLLL
FT                   HVVDASDTRVDENIDAVNTVLADIGADEIPVLLVMNKIDMLQDFVPRIDRDEENRPLRV
FT                   WVSAQQASGMDLLFQALSERLGGEIASYTLRLPPAAGRLRSRFYQLQAIEKEWIEEDGS
FT                   IGLQVRMPVVDWRRLCKQQQELINFIV"
FT   gene            399283..400527
FT                   /gene="hflK"
FT                   /locus_tag="ETAE_0354"
FT   CDS_pept        399283..400527
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hflK"
FT                   /locus_tag="ETAE_0354"
FT                   /product="FtsH protease regulator HflK"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83201"
FT                   /db_xref="GOA:D0ZAP2"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR001972"
FT                   /db_xref="InterPro:IPR010201"
FT                   /db_xref="InterPro:IPR020980"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZAP2"
FT                   /protein_id="ACY83201.1"
FT                   /translation="MAWNQPGNNGQNRDPWGSSNNNGGNSGGNNNKGGRDQGPPDLDDL
FT                   FRKVSKKLGGLGGGKSGGSGSAGTPRSSIGGKKVVGLAVAAVVVIWAASGFYTIKEAER
FT                   GVVTRFGKFSHLVQPGLNWKPTFIDDVIPVNVESVRELAASGVMLTSDENVVRVEMNVQ
FT                   YRVTNPEEYLFNVTNADDSLRQATDSALRAVIGKYTMDTILTEGRTVIRNDTQKVLEEI
FT                   IRPYHMGITILDVNFQAARPPEEVKAAFDDAIAARENEQQYIREAEAYANEVQPRANGQ
FT                   AQRILEDAKAYKDRTVLEAQGEVGRFSRLLPEYKASPEITRERLYLETMERVLGHTRKV
FT                   LVDDKSNNLMVLPLDQIMRSGDKGASQAGDSKDTSLIRLNPPQASAGSSTDSSVMDQRR
FT                   VNAQRNDTTRLGRDY"
FT   gene            400527..401531
FT                   /gene="hflC"
FT                   /locus_tag="ETAE_0355"
FT   CDS_pept        400527..401531
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hflC"
FT                   /locus_tag="ETAE_0355"
FT                   /product="FtsH protease regulator HflC"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83202"
FT                   /db_xref="GOA:D0ZAP3"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR010200"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZAP3"
FT                   /protein_id="ACY83202.1"
FT                   /translation="MRKSLLVILIVVLVALYASLFVVQEGQRGIVLRFGKVLRDDENKP
FT                   LVYAPGLHLKIPFIESVKTLDARIQTMDNQADRFVTKEKKDLIVDSYIKWRISDFSRYY
FT                   LATGGGDVSQAEVLLKRKFSDRLRSEIGRLDIKDIVTDSRGKLMEDVRNALNTGTVDDA
FT                   AAPTEADDAIASAAARVARETNGKQPAVNPNSMAALGIQVVDVRIKQINLPTEVSDAIY
FT                   QRMRAEREAVARRHRSQGQEEAEKLRATADYEVTRTLAGAEREGRIIRGEGDAEAAKLF
FT                   ANAFSKDPDFFAFIRSLKAYENSFKGGQDVMVLRPDSDFFKYMRSPDGGKSAK"
FT   gene            complement(401935..403047)
FT                   /locus_tag="ETAE_0356"
FT   CDS_pept        complement(401935..403047)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAE_0356"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83203"
FT                   /db_xref="GOA:D0ZAP4"
FT                   /db_xref="InterPro:IPR002656"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZAP4"
FT                   /protein_id="ACY83203.1"
FT                   /translation="MKPGRNHFFDILRVVSVLFVITSHYSYMFDSSTVLTFPREYLTAG
FT                   IGRLGVSFFFMISGALAYLSLRKYAAPEYYLRRVYSVLIPYNIAYFGMALLLLALGVFF
FT                   TYPGNPLVEVGPNGTRSVLDMLPSVLGFDHYLHGVYEIKTVYFTGEWFIGCIILLYVIS
FT                   PLIYRAIVRYPMWTMLATVAITLMAYDTRVTNPYWSAQVRISDFTFGMLFIHLQAQFTR
FT                   YVRPLALIGALLIVAGVSWAHISHQPVREVLFPLAPVSLLFAVAFFFIVQGAYQLLHPW
FT                   LSRPRVSQILLSLASRAYIIMLLQHVIVIFLSVNMDMSVLNATQAIALYLIVLVTIERL
FT                   SVLFKPLAVKTERLLMNKTLRRSAGHMPAA"
FT   gene            403257..403439
FT                   /locus_tag="ETAE_0357"
FT   CDS_pept        403257..403439
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAE_0357"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83204"
FT                   /db_xref="GOA:D0ZAP5"
FT                   /db_xref="InterPro:IPR019201"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZAP5"
FT                   /protein_id="ACY83204.1"
FT                   /translation="MALALVLVVEGLGPMLFPQAWRRMIATMAQLPDGLLRRYGGGLVV
FT                   AGLVIYYMLRSRLGG"
FT   gene            403538..404836
FT                   /gene="purA"
FT                   /locus_tag="ETAE_0358"
FT   CDS_pept        403538..404836
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purA"
FT                   /locus_tag="ETAE_0358"
FT                   /product="adenylosuccinate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83205"
FT                   /db_xref="GOA:D0ZAP6"
FT                   /db_xref="InterPro:IPR001114"
FT                   /db_xref="InterPro:IPR018220"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033128"
FT                   /db_xref="InterPro:IPR042109"
FT                   /db_xref="InterPro:IPR042110"
FT                   /db_xref="InterPro:IPR042111"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZAP6"
FT                   /protein_id="ACY83205.1"
FT                   /translation="MGKNVVVLGTQWGDEGKGKVVDLLTERAKYVVRYQGGHNAGHTLV
FT                   INGEKTVLHLIPSGILRENVVSIIANGVVLAPDALLREMTELEARGVPVRERLLLSEAC
FT                   PLILPYHVALDNAREKARGAKAIGTTGRGIGPAYEDKVARRGLRVGDLFDKESFAVKLK
FT                   EIMEYHNFQLVNYYHVDAVDYQRVLDEVMAVADLLTSMVVDVADLLNKAYRNGEYVMFE
FT                   GAQGTLLDIDHGTYPYVTSSNTTAGGVATGSGVGPRCVDYVLGIVKAYSTRVGAGPFPT
FT                   ELFDSVGEFLCEKGNEFGATTGRRRRTGWLDAVAVRRAVELNSLSGFCLTKLDVLDGLD
FT                   EVKICVGYRLPDGREVDVTPLAAEGWEGIEPIYEVLPGWKESTFGVKQRDGLPQAALNY
FT                   IKRIEEVTGVPVDIISTGPDREETIVLRHPFDA"
FT   gene            405190..405564
FT                   /locus_tag="ETAE_0359"
FT   CDS_pept        405190..405564
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAE_0359"
FT                   /product="putative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83206"
FT                   /db_xref="InterPro:IPR000944"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZAP7"
FT                   /protein_id="ACY83206.1"
FT                   /translation="MAALPEGQMTSITQVTEVYGVSRNHMVKIINQLSRAGFVTAVRGK
FT                   HGGIRLGRPASEIRIGDVVRELEPLTLVNCSQAFCHITPACRLKQVLHRATDAFLAELD
FT                   QCTLADLIEHNPPLYKLLLV"
FT   gene            405604..408054
FT                   /gene="rnr"
FT                   /locus_tag="ETAE_0360"
FT   CDS_pept        405604..408054
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rnr"
FT                   /locus_tag="ETAE_0360"
FT                   /product="exoribonuclease R"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83207"
FT                   /db_xref="GOA:D0ZAP8"
FT                   /db_xref="InterPro:IPR001900"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR004476"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR011805"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013223"
FT                   /db_xref="InterPro:IPR013668"
FT                   /db_xref="InterPro:IPR022966"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR040476"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZAP8"
FT                   /protein_id="ACY83207.1"
FT                   /translation="MSQDPYLEREAEKYASPIPSREFILMHLAKRKTPASREELAQELA
FT                   LSSEEDLEALRRRLRAMERDGQLIFTRRQCYALPERLDLIKGTVIGHRDGFGFLRSEGQ
FT                   KDDLYLSPEQMKMCMHGDVILAQVTGTDRRGRKEVRVVRVVEPRTGLIVGRYFTDAGTG
FT                   FVVPDDGRLSFDILIPSDAIAGARMGYVVVVELTQRPTRRTKAVGKIVEVLGDNMGTGM
FT                   AVDIALRSHDIPHSWPEQVERQVADLSEDVPEAAKVGRIDLRDLPLVTIDGEDARDFDD
FT                   AVYCEKKRGGGWRLWVAIADVSYYVRPNTALDHEARSRGNSVYFPSQVVPMLPEVLSNG
FT                   LCSLNPQVDRLCMVCEMTIAASGRLSSYKFYEAVMSSHARLTYTKVAHILAGDPDLRAQ
FT                   YHALVKPLEELHALYKALDHAREERGGISFETEEAKFIFNAERRIERIEPTVRNDAHKL
FT                   IEECMILANISAARFMEKNHEPALFRIHDKPSEDHVMALRSVLAELGLSLGGGTQPEPK
FT                   DYALLMDKVADRPDHEMLQTMLLRSMKQAVYDPENRGHFGLALQAYAHFTSPIRRYPDL
FT                   SLHRGIKYLLAREHGHAERWTPSGGWHYHTEDMLQLGEHCSMTERRADEATRDVSDWLK
FT                   CDFMQDHVGQTYGGIITSVTGFGFFVRLDDLFIDGLVHVSTLDNDYYRFDQIGQRLIGE
FT                   SSGQVYRLGDKVEVKVDAVHLDERKIDFALISTARGVRGAGKTARNKARQANGGAENKP
FT                   SRSARRGGKMPANFAPDSVQRRGDEAAPAQKGKGKGKGKKPSAQTRKIAASTKAKRARK
FT                   KTTD"
FT   gene            408145..408888
FT                   /gene="yjfH"
FT                   /locus_tag="ETAE_0361"
FT   CDS_pept        408145..408888
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yjfH"
FT                   /locus_tag="ETAE_0361"
FT                   /product="23S rRNA (guanosine-2-O-)-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83208"
FT                   /db_xref="GOA:D0ZAP9"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR004441"
FT                   /db_xref="InterPro:IPR013123"
FT                   /db_xref="InterPro:IPR024915"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZAP9"
FT                   /protein_id="ACY83208.1"
FT                   /translation="MSEIIYGIHAVKALLEQDPQRFLDVFVMKGREDRRLLPLLQQLEE
FT                   CGIRVQVAQRQWLDEKVEGAVHQGIVARVKPGRQYQENDLPDLLAGLDHPPFLLILDGV
FT                   TDPHNLGACLRSADAAGVDAVIVPRDRSAQLNATAKKVACGAAENVPLIRVTNLARTMR
FT                   LLQQESIWIVGTAGEADHSLYQSRMTGAMALVMGAEGDGMRRLTREHCDELISIPMAGS
FT                   VSSLNVSVATGICLFEAVRQRSAKA"
FT   gene            complement(408916..409191)
FT                   /locus_tag="ETAE_0362"
FT   CDS_pept        complement(408916..409191)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAE_0362"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83209"
FT                   /db_xref="InterPro:IPR010854"
FT                   /db_xref="InterPro:IPR025543"
FT                   /db_xref="InterPro:IPR036275"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZAQ0"
FT                   /protein_id="ACY83209.1"
FT                   /translation="MSRSPLLTSLLFSIGLIGTSAQSAEYARADLVTDLSRMGMISLRG
FT                   IVGNPQDVERRIAHQADQRGARYYRILHMWESDGQQGWQATAALYR"
FT   gene            complement(409368..409679)
FT                   /locus_tag="ETAE_0363"
FT   CDS_pept        complement(409368..409679)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAE_0363"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83210"
FT                   /db_xref="InterPro:IPR010854"
FT                   /db_xref="InterPro:IPR025543"
FT                   /db_xref="InterPro:IPR036275"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZAQ1"
FT                   /protein_id="ACY83210.1"
FT                   /translation="MKTCKLTLTLLLTLLLGACSVMDGKPMPPPPPIAGHAQELRRNQT
FT                   EGLSKMWNISASVYGSPMNVQEVIQQRADAAGARYYYIVMLQETGVPGQWYSVATLYR"
FT   gene            409848..410597
FT                   /locus_tag="ETAE_0364"
FT   CDS_pept        409848..410597
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAE_0364"
FT                   /product="hydrolase of the alpha/beta superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83211"
FT                   /db_xref="GOA:D0ZAQ2"
FT                   /db_xref="InterPro:IPR001375"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZAQ2"
FT                   /protein_id="ACY83211.1"
FT                   /translation="MVEMFEQTVGGIPLLHAVPAGQRDSALPTIFFYHGFTSSKEMYSY
FT                   FGYAFAAAGFRVLLPEADMHGSRYDGDERRRLAHFWDILKSNIDELPSLYDHFLRAGLI
FT                   LDGRVGVAGASLGGMTALGAKARYPWLRATASFMGSGFYLSLSQRLFPRQHQPTEDERA
FT                   WVRQRVSALADYDVSGCLAQLADRPLLIWHGLADDLVPAAESQRLAQALASQHLMDNVS
FT                   VVTEPGIAHKITASALDCGTAFFSRCL"
FT   gene            complement(410636..410905)
FT                   /locus_tag="ETAE_0365"
FT   CDS_pept        complement(410636..410905)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAE_0365"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83212"
FT                   /db_xref="InterPro:IPR010854"
FT                   /db_xref="InterPro:IPR025543"
FT                   /db_xref="InterPro:IPR036275"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZAQ3"
FT                   /protein_id="ACY83212.1"
FT                   /translation="MKPAFAFITLCLLCGSAAAATEISASQGNAMPASEFAVISVNHDV
FT                   INVQDAMSDIRAQADADGAAYYQIIAIHEPLSHGQIHVSAVLYH"
FT   gene            411207..411602
FT                   /gene="rpsF"
FT                   /locus_tag="ETAE_0366"
FT   CDS_pept        411207..411602
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsF"
FT                   /locus_tag="ETAE_0366"
FT                   /product="30S ribosomal protein S6"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83213"
FT                   /db_xref="GOA:D0ZAQ4"
FT                   /db_xref="InterPro:IPR000529"
FT                   /db_xref="InterPro:IPR014717"
FT                   /db_xref="InterPro:IPR020814"
FT                   /db_xref="InterPro:IPR020815"
FT                   /db_xref="InterPro:IPR035980"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZAQ4"
FT                   /protein_id="ACY83213.1"
FT                   /translation="MRHYEIVFMVHPDQSEQVPGMIERYTGAITGAEGKIHRLEDWGRR
FT                   QLAYPINKLHKAHYVLMNVEASQEVIDELETNFRYNDAVIRSMVMRTKHAVTEASPMVK
FT                   AKDERRERREDFANETSEETEAGDSEE"
FT   gene            411933..412160
FT                   /gene="rpsR"
FT                   /locus_tag="ETAE_0367"
FT   CDS_pept        411933..412160
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsR"
FT                   /locus_tag="ETAE_0367"
FT                   /product="30S ribosomal protein S18"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83214"
FT                   /db_xref="GOA:D0ZAQ5"
FT                   /db_xref="InterPro:IPR001648"
FT                   /db_xref="InterPro:IPR018275"
FT                   /db_xref="InterPro:IPR036870"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZAQ5"
FT                   /protein_id="ACY83214.1"
FT                   /translation="MARYFRRRKFCRFTAEGVQEIDYKDIATLKNYITESGKIVPSRIT
FT                   GTRAKYQRQLARAIKRARYLSLLPYTDRHQ"
FT   gene            412203..412652
FT                   /gene="rplI"
FT                   /locus_tag="ETAE_0368"
FT   CDS_pept        412203..412652
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplI"
FT                   /locus_tag="ETAE_0368"
FT                   /product="50S ribosomal protein L9"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83215"
FT                   /db_xref="GOA:D0ZAQ6"
FT                   /db_xref="InterPro:IPR000244"
FT                   /db_xref="InterPro:IPR009027"
FT                   /db_xref="InterPro:IPR020069"
FT                   /db_xref="InterPro:IPR020070"
FT                   /db_xref="InterPro:IPR020594"
FT                   /db_xref="InterPro:IPR036791"
FT                   /db_xref="InterPro:IPR036935"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZAQ6"
FT                   /protein_id="ACY83215.1"
FT                   /translation="MQVILLDKVANLGSLGDQVNVKAGYARNFLVPTGKAVPATKKNVE
FT                   FFEARRADLEAKLAETLSVAEARAVKINELATVTIASKAGDEGKLFGSIGTRDIADAVT
FT                   AAGVAVAKSEVRLPNGVLRTLGDHEVHFQVHSDVFAQLNVVVVAE"
FT   gene            412868..413236
FT                   /locus_tag="ETAE_0369"
FT   CDS_pept        412868..413236
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAE_0369"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83216"
FT                   /db_xref="InterPro:IPR007438"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZAQ7"
FT                   /protein_id="ACY83216.1"
FT                   /translation="MASIALQRVYDVRAPFSPHTFLTDRLWPRGIAKARLDGVNWLKEV
FT                   APSTALRQAFHHAHLDWPTFVARYRDELAANPQAWQPLVQLLRQGESLTLLYGSRDSQC
FT                   NQAVALRDWLLAQLSAGE"
FT   gene            complement(413220..413864)
FT                   /locus_tag="ETAE_0370"
FT   CDS_pept        complement(413220..413864)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAE_0370"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83217"
FT                   /db_xref="InterPro:IPR007340"
FT                   /db_xref="InterPro:IPR013731"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZAQ8"
FT                   /protein_id="ACY83217.1"
FT                   /translation="MGRIAPKKHKVPAYSGVAIQDIWRRLRQGIALSAVRLRKADLRRI
FT                   PRRCRTALRTLWHWPDHIDWMAPLPALHRRWLTVACAVLLLALLWPSDDAAPPRPSPAL
FT                   QTTASPMQATLQPQREAPTPSDANDWQAYPILPGQTLAQLLREHNLDVTDAFAMARVEG
FT                   DDRPLSNLKAGQHVMIRRGPQGQMLALKLETTDDRQIAFRRESDGSFIRLR"
FT   gene            414113..414733
FT                   /gene="fklB"
FT                   /locus_tag="ETAE_0371"
FT   CDS_pept        414113..414733
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fklB"
FT                   /locus_tag="ETAE_0371"
FT                   /product="peptidyl-prolyl cis-trans isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83218"
FT                   /db_xref="GOA:D0ZAQ9"
FT                   /db_xref="InterPro:IPR000774"
FT                   /db_xref="InterPro:IPR001179"
FT                   /db_xref="InterPro:IPR036944"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZAQ9"
FT                   /protein_id="ACY83218.1"
FT                   /translation="MSTPAFDSIEAQASYGIGLQVGQQLNESGLQGLQPEALLAGLRDA
FT                   MEGNAPAVPVETVHRALREIHERADAVRREQQKALAEAGERFLAENAQQDDVTVTESGL
FT                   QFKVLKQGEGAIPSRQDKVRVHYTGRLVDGTVFDSSEQRGEPAEFPVGGVIAGWIEALS
FT                   MMPVGSRWQLYIPHQLAYGERGAGAAIAPYSALVFDVELLDIL"
FT   gene            complement(414788..415453)
FT                   /gene="ytfE"
FT                   /locus_tag="ETAE_0372"
FT   CDS_pept        complement(414788..415453)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ytfE"
FT                   /locus_tag="ETAE_0372"
FT                   /product="cell morphogenesis/cell wall metabolism
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83219"
FT                   /db_xref="GOA:D0ZAR0"
FT                   /db_xref="InterPro:IPR012312"
FT                   /db_xref="InterPro:IPR019903"
FT                   /db_xref="InterPro:IPR023742"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZAR0"
FT                   /protein_id="ACY83219.1"
FT                   /translation="MTYRDRPLGELAISIPRATRLFRHHALDFCCGGKQTLQRAAARQS
FT                   LDLAMLESQLAELDSAPQPHRDWQQAPLAELTAFIVTRYHQRHREQLPELVLMAQKVER
FT                   VHTDKVGCPRGLAKQLDSLRQELDGHMMKEERILFPLIEQGEGARCQGPISVMEHEHRD
FT                   AGERLEVIRFLTDNMTPPAGACTTWRALYAGISELINDLMEHISLENNLLFPRALNDT"
FT   gene            415696..416436
FT                   /gene="cysQ"
FT                   /locus_tag="ETAE_0373"
FT   CDS_pept        415696..416436
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysQ"
FT                   /locus_tag="ETAE_0373"
FT                   /product="3-phosphoadenosine 5-phosphosulfate (PAPS)
FT                   3-phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83220"
FT                   /db_xref="GOA:D0ZAR1"
FT                   /db_xref="InterPro:IPR000760"
FT                   /db_xref="InterPro:IPR006240"
FT                   /db_xref="InterPro:IPR020550"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZAR1"
FT                   /protein_id="ACY83220.1"
FT                   /translation="MLEQICQLARDAGAAIMTVYQGDQPLALAYKGDQSPVTAADLAAH
FT                   EIIKAGLLRITPAIPLLSEEAPPAWPQRRDWQRYWLVDPLDGTKEFLQRNGEFTVNIAL
FT                   IEQGVPTLGVVYVPTSGVLYCACDGKAWKEQDGVRMEIGVRNAIPPLVVISRSHGDAEL
FT                   TDYLQQLGEHQTMMVGSSLKFCLVAEGIAQLYPRFGPTHIWDTAAGHAIAFAAGAQVRD
FT                   WQGKTLSYIPAESLLNPGFRVSLY"
FT   gene            416750..416956
FT                   /locus_tag="ETAE_0374"
FT   CDS_pept        416750..416956
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAE_0374"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83221"
FT                   /db_xref="InterPro:IPR009491"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZAR2"
FT                   /protein_id="ACY83221.1"
FT                   /translation="MKIFQRYNPLLVAKYVKTLFRGRLYIQGVGAFEFDMGRILLPKVR
FT                   DKRHLSVMSEINRQVLRLQAEMA"
FT   gene            complement(417005..418351)
FT                   /locus_tag="ETAE_0375"
FT   CDS_pept        complement(417005..418351)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAE_0375"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83222"
FT                   /db_xref="GOA:D0ZAR3"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR002550"
FT                   /db_xref="InterPro:IPR005170"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZAR3"
FT                   /protein_id="ACY83222.1"
FT                   /translation="MLNSILLIILLIAISAFFSISEISLAASRKIKLKTMADEGDINAA
FT                   RVMALQDQPGYFFTVVQIGLNAVAILGGIVGDAAFSPAFRLLFDRFMPLEVSQQASFIC
FT                   SFVLVTGCFILFADLTPKRIGMIAPEAVAVRIVNPMRFCLLLFRPLVWFFNGLANLIFH
FT                   LFKIPMVRKDDITPDDIYAVVEAGALAGVLRKQEHEIIENVFELESRTVPSSMTPRESI
FT                   VYFDLGETEDSIKEKVSTHPHSKFLVCDGAIDHVVGYVDSKDLLNRVLGNQSLVLSSGV
FT                   QIRNVLIVPDTLTLSEALESFKNAGEDFAVILNEYALVVGVITLNDVMTTLMGDLVGQG
FT                   QEEQIIARDENSWLVEGVTPIDDVMRVLDIEEFPQSSNYETIGGFMMYMLRKIPKRTDA
FT                   VKYAGYKFEVVDIDSYKIDQLLVTRLAERLPPMSPDADGDAEASQQADK"
FT   gene            complement(418625..419191)
FT                   /gene="msrA"
FT                   /locus_tag="ETAE_0376"
FT   CDS_pept        complement(418625..419191)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msrA"
FT                   /locus_tag="ETAE_0376"
FT                   /product="methionine sulfoxide reductase A"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83223"
FT                   /db_xref="GOA:D0ZAR4"
FT                   /db_xref="InterPro:IPR002569"
FT                   /db_xref="InterPro:IPR036509"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZAR4"
FT                   /protein_id="ACY83223.1"
FT                   /translation="MSLSGIHALNGHDMYALPAGMEEALFAMGCFWGVERLFWQQPGIY
FT                   STAAGYSGGLTPNPTYREVCSGQTGHAETVRVVFDPALIRYDDLLRLFWQHHDPAQGMR
FT                   QGNDIGTQYRSALFPVTPQQMQAAQASQARFAQAMRQAGDLRPISTEICAAGPFYYAEE
FT                   EHQQYLHKHPHGYCGLGGIGVCLPD"
FT   gene            419544..421280
FT                   /locus_tag="ETAE_0377"
FT   CDS_pept        419544..421280
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAE_0377"
FT                   /product="putative outer membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83224"
FT                   /db_xref="GOA:D0ZAR5"
FT                   /db_xref="InterPro:IPR000184"
FT                   /db_xref="InterPro:IPR035243"
FT                   /db_xref="InterPro:IPR039910"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZAR5"
FT                   /protein_id="ACY83224.1"
FT                   /translation="MPRLRRIGLLCLLLAAPLAHAAQVRLVVEGLSGQLQQNVRATLST
FT                   IDEDEISNDGRFRVRAADAIRQGLRALGYFQPTIEFEYRPGSTFSRPQLIANVTPGEPV
FT                   RIAGLNVRIRGAAKDDPAYQALLAKSLPPIGSVLDQGDYDNLKNALNSLALQRGYFGAT
FT                   MPVHQLGVIEDQHKAFWDIEFDSGPRYRFGDVRFSGSQIQTAYLQNLRPFKSGEYYSAD
FT                   DLAKFSGNLSATNWFNSVVVSPDFKALGADQTLPLQAVVTPRSQNMVDLGGGYATDVGP
FT                   RMKVSWKRPWMNSYGHSLDTSLNLSMPEQTADFSYKIPLLKAPLEQYYLVQGGFQRTDL
FT                   NDTQSDSTTLNLARYWELSSGWQRGINMRWSLDHFTQGNLTETAMLLYPGVSVNRTRSR
FT                   GGLMPTWGDTQRYSVDVSNRYWGSSVDFAVFQAQNVWIRTLAERHRFVVRGNLGWIETN
FT                   DFNKVPPSLRFFAGGDRSIRGYKYKSISPKGSDGKLTGASRLVTGSLEYQYNLSGKWWG
FT                   GVFIDSGEAVNDFTKSDFHTGTGVGVIWVSPVGPIRLNLGVPVGREDKHDVQIYIGLGP
FT                   EL"
FT   gene            421277..425044
FT                   /locus_tag="ETAE_0378"
FT   CDS_pept        421277..425044
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAE_0378"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83225"
FT                   /db_xref="GOA:D0ZAR6"
FT                   /db_xref="InterPro:IPR007452"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZAR6"
FT                   /protein_id="ACY83225.1"
FT                   /translation="MRWYNIRRYALMLLLGLFLLLALLLGGMMTQSGLHLALNAAARWV
FT                   PGLEIGRVEGGWRDLTLRDVGYRMPGVDVAVGQFHLSLDISCLKRSELCLNVLSAQRVR
FT                   VNVDTQALPPSEPQATPSAPLGRLSTPYPLVLRLLRLNDVQVTVDGTAITLDALRSGAE
FT                   WRGSQLRLQPSDIQGLRVSLPPSPAASSSAESAVPTVPSTPLGETLTALFSRPLLPAAM
FT                   RLDLPLDLQVSRISARQVQIRAATDLDITSLELRAALDQQRLALHTLKVQAQQGSLSAR
FT                   GSATFSGRWPLDLQLNASVNQAPLKGEKLRLALKGAMYDTLALDANLSGPLRATLKGDT
FT                   RLADAGLPLSLSLDSPSLRWPLGGTPDYQVNNMALRLTGSAHDYRLQLRGAFSGQGLPD
FT                   AALDLAGKGNERQFTLSQLQLATLGGKADMQALVDWSKAISWRSSLTLTGIDTGRQWPA
FT                   WPSSLNGKIETRGSLYGGSWQLQVPQLKLTGRIKQNALDVGGQLRGNQAGQWQIPQLHI
FT                   ALGRNRIEVNGDLAQKQWSLDARIDAPRLDGTLPGLAGTARGTLKLRGDRQAPQLLADL
FT                   QARGLRWQALTIQRVALLGDIRSDQQIQGSLDLRVDSLKQGDIDISQLTLRAAGNERKH
FT                   RLQLVMQGTPLAGRLTLNGSLAQDRARWSGTLTDTDFTTPVGEWRLTRPIALDYGVDKQ
FT                   QMAIGPHCWENPNARLCVPQTIEVGESGNVSVVLERFDLAMLQPFLGPDTQLHGRFSGR
FT                   AQARWQAGEGLPQARITLSGDGVKLAQQVQGNTLPVALSTVTLEASLAQGQARLNWLIG
FT                   IEGNGQLRGDVRVANLQGARNLSGNVDIQRLSLALLNPALMKGEKAQGMLNASLRLGGT
FT                   TLHPQLYGRLALDGVDIDGQFMPFDVTDANLAINFDGMSSVLQGVIKTSQGQLNLSGNA
FT                   DWRNMNAWRARIAASGTRLRVTVPPMVRLDVSPNIVFDASPSQLALSGRVDIPWARITV
FT                   QDLPESAVGVSSDEVMLNNAHQPIRPVSASIPLHTDLTIAIGNNVRLSAFGLKAALKGE
FT                   LKVSQNQNGLGLNGQIMIPQGRFAAYGQDLLIRQGELVFAGPPGNPLLNIEAIRNPEST
FT                   ANDVTVGVRVTGLAEQPKLEVFSDPAMSQQEALSYLLRGQGLDSSGADSNAMTSMLIGL
FT                   GVAQSGKLVGKIGETFGVSNLTLDSQGVGDSSQVVVSGYVLPGLQVKYGVGIFDSLATL
FT                   TLRYRLMPNLYLEAVSGVNQALDLLYQFEF"
FT   gene            425047..425391
FT                   /locus_tag="ETAE_0379"
FT   CDS_pept        425047..425391
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAE_0379"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83226"
FT                   /db_xref="GOA:D0ZAR7"
FT                   /db_xref="InterPro:IPR009288"
FT                   /db_xref="InterPro:IPR013024"
FT                   /db_xref="InterPro:IPR036568"
FT                   /db_xref="InterPro:IPR039126"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZAR7"
FT                   /protein_id="ACY83226.1"
FT                   /translation="MRVIVYGSLRRKQGNSHWMTNATWLGDYVLEGYDLYDLGHYPAVV
FT                   PGEGRVYCEVYRITSSILAELDELKSNSKDYRRELIKTPYGCAWIYIYLNGVEGLPRIA
FT                   SGDWLKREED"
FT   gene            complement(425440..425970)
FT                   /gene="ppa"
FT                   /locus_tag="ETAE_0380"
FT   CDS_pept        complement(425440..425970)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ppa"
FT                   /locus_tag="ETAE_0380"
FT                   /product="Inorganic pyrophosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83227"
FT                   /db_xref="GOA:D0ZAR8"
FT                   /db_xref="InterPro:IPR008162"
FT                   /db_xref="InterPro:IPR036649"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZAR8"
FT                   /protein_id="ACY83227.1"
FT                   /translation="MSLINVPAGKDMPEDIYVVIEIPANADPIKYEIDKDTGALFVDRF
FT                   MSTAMFYPCNYGYINHTLSLDGDPVDVLVPTPYPLQPGSVIRCRPVGVLKMTDEAGEDA
FT                   KLVAVPHSKLTKEYDHIQDVNDLPELLRAQIAHFFEHYKDLEKGKWVKVEGWADAAAAK
FT                   AEIIASFERAKNK"
FT   gene            complement(426075..427079)
FT                   /gene="fbp"
FT                   /locus_tag="ETAE_0381"
FT   CDS_pept        complement(426075..427079)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fbp"
FT                   /locus_tag="ETAE_0381"
FT                   /product="fructose-1,6-bisphosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83228"
FT                   /db_xref="GOA:D0ZAR9"
FT                   /db_xref="InterPro:IPR000146"
FT                   /db_xref="InterPro:IPR020548"
FT                   /db_xref="InterPro:IPR028343"
FT                   /db_xref="InterPro:IPR033391"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZAR9"
FT                   /protein_id="ACY83228.1"
FT                   /translation="MKTLGEFIVEKQQDFPHATGELTALLSAIKLGAKIIHRDINKAGL
FT                   VDIIGASGAENIQGEVQMKLDLYANEKLKAALKARGEVAGIASEEEDDIVIFEGDRANN
FT                   AKYVVLMDPLDGSSNIDVNVSVGTIFSIYRRITPLGTPVTRKDFLQPGNRQVAAGYVVY
FT                   GSSTMLVYTTGNGVHAFTYDPSLGVFCLSHERLRFPHSGNMYSINEGNYIKFPLGVKKY
FT                   IKYCQEQDSATQRPYTSRYIGSLVADFHRNLLKGGIYIYPSTASHPQGKLRLLYECNPM
FT                   SFLAEQAGGKATDGFRRILDIVPDALHQRCPFFVGSCAMVEDAERFMHQFPDA"
FT   gene            427246..428622
FT                   /gene="yjfG"
FT                   /locus_tag="ETAE_0382"
FT   CDS_pept        427246..428622
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yjfG"
FT                   /locus_tag="ETAE_0382"
FT                   /product="UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-meso-diaminopimelate
FT                   ligase"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83229"
FT                   /db_xref="GOA:D0ZAS0"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005757"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZAS0"
FT                   /protein_id="ACY83229.1"
FT                   /translation="MRIHILGVCGTFMGGLALLARQLGHDVTGSDANVYPPMSTLLQQQ
FT                   GITLLEGYDPAHLEPQPDLVIIGNAMARGNPCVEAILERNIPYVSGPQWLHDEVLRHRW
FT                   VIAVAGTHGKTTTAGMVNWILESCGYEPGFVIGGVPGNFSVSARLGKSPFFVIEADEYD
FT                   CAFFDKRSKFVHYCPRTLILNNLEFDHADIFDDLRAIQRQFHHLVRLVPGQGRIILPAG
FT                   DANLKQVMAMGCWSEQELCGDEAAWSATRLSTDASRFSVSLDGECVGEVEWALVGEHNM
FT                   HNGLMAIAAARHVGVPPAEACRALGSFINARRRLELRGQAYGVSVYDDFAHHPTAILAT
FT                   LAALRGKVGGTARILAVLEPRSNTMKMGVCKNELAPALGRADEVFLYQPQHIPWQVAEV
FT                   AEACVQPAHWSADLGTLVEMIVKNAQPGDHILVMSNGGFGDIHDRLLQALAQKSAAHQA
FT                   "
FT   gene            complement(428734..429009)
FT                   /locus_tag="ETAE_0383"
FT   CDS_pept        complement(428734..429009)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAE_0383"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83230"
FT                   /db_xref="InterPro:IPR010854"
FT                   /db_xref="InterPro:IPR025543"
FT                   /db_xref="InterPro:IPR036275"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZAS1"
FT                   /protein_id="ACY83230.1"
FT                   /translation="MKIKATIATLATLCALSFGAAAAQPPAQEITTAQACDMQPMGVIT
FT                   VSGLDGSIADIDQQLATKAQSQGASAFRIIEERIDGNYHATALIYR"
FT   gene            complement(429354..429824)
FT                   /gene="argR"
FT                   /locus_tag="ETAE_0384"
FT   CDS_pept        complement(429354..429824)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argR"
FT                   /locus_tag="ETAE_0384"
FT                   /product="arginine repressor"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83231"
FT                   /db_xref="GOA:D0ZAS2"
FT                   /db_xref="InterPro:IPR001669"
FT                   /db_xref="InterPro:IPR020899"
FT                   /db_xref="InterPro:IPR020900"
FT                   /db_xref="InterPro:IPR036251"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZAS2"
FT                   /protein_id="ACY83231.1"
FT                   /translation="MRNTTKQEDLTKAFKALLKEEKFSSQGEIVQALQELGFDNINQSK
FT                   VSRMLTKFGAVRTRNAKMEMVYCLPAELGVPTTSSPLKNLVLDVDHNDAIVVIHTSPGA
FT                   AQLIARLLDSLGKSEGILGTIAGDDTIFTTPAKGFAVEQLYAAILALFEQEL"
FT   gene            complement(429886..430104)
FT                   /locus_tag="ETAE_0385"
FT   CDS_pept        complement(429886..430104)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAE_0385"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83232"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZAS3"
FT                   /protein_id="ACY83232.1"
FT                   /translation="MRKIRTCFTSDYACVTSTLCFTLQQHHINNISFTFSVRLLSFSRS
FT                   TRGDGFMIRPLYAVCAAHARMTRIFTD"
FT   gene            430288..431226
FT                   /gene="mdh"
FT                   /locus_tag="ETAE_0386"
FT   CDS_pept        430288..431226
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mdh"
FT                   /locus_tag="ETAE_0386"
FT                   /product="malate/lactate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83233"
FT                   /db_xref="GOA:D0ZB55"
FT                   /db_xref="InterPro:IPR001236"
FT                   /db_xref="InterPro:IPR001252"
FT                   /db_xref="InterPro:IPR001557"
FT                   /db_xref="InterPro:IPR010097"
FT                   /db_xref="InterPro:IPR015955"
FT                   /db_xref="InterPro:IPR022383"
FT                   /db_xref="InterPro:IPR023958"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZB55"
FT                   /protein_id="ACY83233.1"
FT                   /translation="MKVAVLGAAGGIGQALALLLKTQLPSGSELSLYDIAPVTPGVAVD
FT                   LSHIPTAVTVRGFGGEDASPALEGADIVLISAGVARKPGMDRSDLFNINAGIIRNLIGQ
FT                   VARTSPNACIGIITNPVNTMVPIAAEVLKKAGVYNPNKLFGVTTLDIIRSNTFVGELKH
FT                   LDPTTLDIPVIGGHSGVTILPLLSQIPGVSLSEQEVADLTKRIQNAGTEVVEAKAGGGS
FT                   ATLAMGQAAARFALSLVRAMQGDENVVECGYVESDGEYARFFAQPLLLGKEGLVQRLNI
FT                   GTLSAFEQHALESMLEVLRKDIALGEDFINK"
FT   gene            complement(431332..431616)
FT                   /locus_tag="ETAE_0387"
FT   CDS_pept        complement(431332..431616)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAE_0387"
FT                   /product="putative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83234"
FT                   /db_xref="GOA:D0ZB56"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR038722"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZB56"
FT                   /protein_id="ACY83234.1"
FT                   /translation="MKKTLPEDWHPAEIIAALHKRRLTLTQVSRNAGLSSSTLANALTR
FT                   PWPKGEWLIAEALSIHPSEIWPSRYYDPVTHELLDRKRLIRDAAAIKKI"
FT   gene            complement(431813..432784)
FT                   /gene="ispB"
FT                   /locus_tag="ETAE_0388"
FT   CDS_pept        complement(431813..432784)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ispB"
FT                   /locus_tag="ETAE_0388"
FT                   /product="octaprenyl diphosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83235"
FT                   /db_xref="GOA:D0ZB57"
FT                   /db_xref="InterPro:IPR000092"
FT                   /db_xref="InterPro:IPR008949"
FT                   /db_xref="InterPro:IPR033749"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZB57"
FT                   /protein_id="ACY83235.1"
FT                   /translation="MNLEQITELTAQDMADVNARILHQLNSDVALINQLGYYIISGGGK
FT                   RIRPMIAVLAARALGYQGDRHVTIAALIEFIHTATLLHDDVVDESDMRRGKATANAAFG
FT                   NAASVLVGDFIYTRAFQMMTSLESLRILALMSEATNVIAEGEVQQLMNVNDPDISEENY
FT                   MQVIYSKTARLFEAAAQCSAILAGADTAQEQALQDYGRYLGTAFQLIDDLLDYDADGKT
FT                   LGKNTGDDLNEGKPTLPLLHAMHHGSAERSAMIRQAIEQGNGRHLLEPVLETMQQAGSL
FT                   DYTRSRAEEEADKAIAALAPLPDSPHKQALIGLANLAVNRSF"
FT   gene            433044..433355
FT                   /gene="rplU"
FT                   /locus_tag="ETAE_0389"
FT   CDS_pept        433044..433355
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplU"
FT                   /locus_tag="ETAE_0389"
FT                   /product="50S ribosomal protein L21"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83236"
FT                   /db_xref="GOA:D0ZB58"
FT                   /db_xref="InterPro:IPR001787"
FT                   /db_xref="InterPro:IPR018258"
FT                   /db_xref="InterPro:IPR028909"
FT                   /db_xref="InterPro:IPR036164"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZB58"
FT                   /protein_id="ACY83236.1"
FT                   /translation="MYAVFQSGGKQHRVSEGQTVRLEKLDIATGETVEFDQILMVANGE
FT                   DIKIGVPFVAGGKVKAEVVAHGRGEKVKIVKFRRRKHHRKQQGHRQWFTDVKITGISA"
FT   gene            433374..433631
FT                   /gene="rpmA"
FT                   /locus_tag="ETAE_0390"
FT   CDS_pept        433374..433631
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmA"
FT                   /locus_tag="ETAE_0390"
FT                   /product="50S ribosomal protein L27"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83237"
FT                   /db_xref="GOA:D0ZB59"
FT                   /db_xref="InterPro:IPR001684"
FT                   /db_xref="InterPro:IPR018261"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZB59"
FT                   /protein_id="ACY83237.1"
FT                   /translation="MAHKKAGGSSRNGRDSESKRLGVKRFGGESVLAGSIIVRQRGTKF
FT                   HAGSNVGCGRDHTLFALADGKVKFEVKGPKNRKFISIVAE"
FT   gene            433719..434654
FT                   /locus_tag="ETAE_0391"
FT   CDS_pept        433719..434654
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAE_0391"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83238"
FT                   /db_xref="GOA:D0ZB60"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZB60"
FT                   /protein_id="ACY83238.1"
FT                   /translation="MESKQSAALGISLALTTAIFWGALPIAMKQVLPDMAPETIVWYRF
FT                   SMAALGLGSVLCLRGQLPPLRVFRQRRWLLLLSVATAGLLGNFILFSTSLQYLSPTTSQ
FT                   VIGQLSPVGLMFASVLVLKERMRPAQVIGAALLIGGLLLFFNTSLAEIFTRLTDYTLGV
FT                   LLGMAAAGVWVCYGIAQKVLLRRLASQQILCLLYALCAICLWPLAQPGQIYQLSGWQLL
FT                   CLLFCGVNTLVGYGALAEAMVRWQVAKVGAIVTLTPLFTLMFSDVLALAWPETFMTPSL
FT                   NTVGYIGAFVVVAGAMFSAIGHRWWPRQRA"
FT   gene            434703..435881
FT                   /locus_tag="ETAE_0392"
FT   CDS_pept        434703..435881
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAE_0392"
FT                   /product="putative GTP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83239"
FT                   /db_xref="GOA:D0ZB61"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR006074"
FT                   /db_xref="InterPro:IPR006169"
FT                   /db_xref="InterPro:IPR014100"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031167"
FT                   /db_xref="InterPro:IPR035101"
FT                   /db_xref="InterPro:IPR036726"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZB61"
FT                   /protein_id="ACY83239.1"
FT                   /translation="MKFVDEAVIHIEAGDGGNGCVSFRREKYIPKGGPDGGDGGDGGDV
FT                   YLLADENLNTLIDYRFEKSFRAERGQNGQSRDCTGKRGQDVTIKVPVGTRITDVDTGEV
FT                   LGDMTRHQQKLMVGKGGWHGLGNTRFKSSVNRTPRQKTNGTPGDKRDLSLELLLLADVG
FT                   MLGLPNAGKSTFIRAVSAAKPKVADYPFTTLVPSLGVVRMDSEKSFVVADIPGLIEGAS
FT                   EGAGLGIRFLRHLERCRVLLHLIDLAPIDESDPVENARVIIGELEKYSEKLAQKPRWLV
FT                   FNKTDLLAPEEAKARAQAIADALGWEGEHYLISAANREGVNALCWDVMNFLEAHPREAE
FT                   VEEEKEKAKKAEFMWDDYHREQLEQAEAEWEEEEDDDWDEDDDEGVEIIYQR"
FT   gene            complement(435927..437000)
FT                   /gene="basS"
FT                   /locus_tag="ETAE_0393"
FT   CDS_pept        complement(435927..437000)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="basS"
FT                   /locus_tag="ETAE_0393"
FT                   /product="sensor protein BasS/PmrB"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83240"
FT                   /db_xref="GOA:D0ZB62"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZB62"
FT                   /protein_id="ACY83240.1"
FT                   /translation="MISLRRTLLIMLALILLVTQLVSALWLWHESREQISFLVNETLSA
FT                   KVRTEQVDKEIREAIAALLIPSLVMMAVTLLLSWLAVSWIVRPLNQLQARLEKRSPSNL
FT                   TPIDIDSSMTEITSITRTLNHLFSRLQHTLRQERLFTADAAHELRTPLAGVRLHLELME
FT                   QSGVPEATTLVQRIDQLMHTVEQLLMLSRVGQNFASGHYLQLELISEVVLAQRSELCEM
FT                   LALRGQHLRLETPSQLAMHGDAMLLRLMLRNLVENAHRYSPEGSDILLRVTLSADEHGC
FT                   ILQVIDSGPGIDESRASELTEPFHRLDRRFGGSGLGLNIVVRILQLHKGQLTLRNNRPG
FT                   PGLNACCRLPLTPQDFG"
FT   gene            complement(436997..437659)
FT                   /gene="basR"
FT                   /locus_tag="ETAE_0394"
FT   CDS_pept        complement(436997..437659)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="basR"
FT                   /locus_tag="ETAE_0394"
FT                   /product="DNA-binding response regulator in two-component
FT                   regulatory system with BasS"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83241"
FT                   /db_xref="GOA:D0ZB63"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZB63"
FT                   /protein_id="ACY83241.1"
FT                   /translation="MKILIVEDDTLIQQGLAQAMARENYACDCAGNAASASALLQSGHY
FT                   SLIILDLGLPGMDGASALRQWRREGIDAPVLILTARDTVSDRVGGLDAGADDYLVKPFA
FT                   LAELLARVRALIRRMQGLCNNALQVDDIHLDLSSQQVSCGGLPLEITPKEFAILTRLMM
FT                   RAGQTISREVLQQDLYSWQDELSSNSLEVHIHNLRRKLGKNRIKTLRGVGYRLEKTP"
FT   gene            complement(437669..439036)
FT                   /gene="dacD1"
FT                   /locus_tag="ETAE_0395"
FT   CDS_pept        complement(437669..439036)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dacD1"
FT                   /locus_tag="ETAE_0395"
FT                   /product="D-alanyl-D-alanine
FT                   carboxypeptidase/endopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83242"
FT                   /db_xref="GOA:D0ZB64"
FT                   /db_xref="InterPro:IPR000667"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZB64"
FT                   /protein_id="ACY83242.1"
FT                   /translation="MQDYAQYLPEGTNLALMVQKVGSTTPTIDYHGQQMALPASTQKVI
FT                   TALAALLQLGPDFRFNTTFETRGQISAGALNGDLIVRFDGDPTLRRQNIRNMVAALKKQ
FT                   GVTRISGDILIDTSVFASHDKAPGWPWNDLTQCFSAPPAAAIVDRNCFSISLYSAPKAG
FT                   DRAFIRVASYYPVHMFSEVKTLARGSAEAPYCELDVVPGELNRYTLTGCLTQRADPLPL
FT                   AFAVQDGAAYAGAIVKDELQQANIDIAGHLRRETQVTPQGTILAQTQSAPLHDLLRVML
FT                   KKSDNMIADTVFRTIGHSYFNVPGTWRAGSDAVRQILRKKAGVNLGNSVVVDGSGLSRH
FT                   NLISPATMMEVLQYIAQNDSQLNFISMLPLAGYDGTLQYRGGLHEAGVDGKVSAKTGSL
FT                   QGVYNLAGFITTASGQRMAFVQYLSGYAVPPQDQRTRRQPLVRFESRLYRDIYRNN"
FT   gene            439351..439827
FT                   /gene="greA"
FT                   /locus_tag="ETAE_0396"
FT   CDS_pept        439351..439827
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="greA"
FT                   /locus_tag="ETAE_0396"
FT                   /product="transcription elongation factor"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83243"
FT                   /db_xref="GOA:D0ZB65"
FT                   /db_xref="InterPro:IPR001437"
FT                   /db_xref="InterPro:IPR006359"
FT                   /db_xref="InterPro:IPR018151"
FT                   /db_xref="InterPro:IPR022691"
FT                   /db_xref="InterPro:IPR023459"
FT                   /db_xref="InterPro:IPR028624"
FT                   /db_xref="InterPro:IPR036805"
FT                   /db_xref="InterPro:IPR036953"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZB65"
FT                   /protein_id="ACY83243.1"
FT                   /translation="MNQIPMTLRGAEKLREELDFLKGTRRPQIIAAIAEAREHGDLKEN
FT                   AEYHAAREQQGFCEGRIQEIEAKLSNAQVIDVTKMPNNGRVIFGSTVSVENLDTEDQQT
FT                   YRIVGDDEADFKHNLISVNSPIARGLIGKEEGDVVTIKTPGGEVEYEILKVEYL"
FT   gene            complement(439970..440263)
FT                   /gene="yhbY"
FT                   /locus_tag="ETAE_0397"
FT   CDS_pept        complement(439970..440263)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yhbY"
FT                   /locus_tag="ETAE_0397"
FT                   /product="RNA-binding protein YhbY"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83244"
FT                   /db_xref="GOA:D0ZB66"
FT                   /db_xref="InterPro:IPR001890"
FT                   /db_xref="InterPro:IPR017924"
FT                   /db_xref="InterPro:IPR035920"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZB66"
FT                   /protein_id="ACY83244.1"
FT                   /translation="MNLTNKQKQHLKSLAHSLKPVVQLGANGLTEGVLAEIEQALAHHE
FT                   LIKVKIAAEERETKTLIANAIVRETGACNVQLIGNILVIYRPSEERKISLPR"
FT   gene            440394..441020
FT                   /gene="rrmJ"
FT                   /locus_tag="ETAE_0398"
FT   CDS_pept        440394..441020
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rrmJ"
FT                   /locus_tag="ETAE_0398"
FT                   /product="23S rRNA methyltransferase J"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83245"
FT                   /db_xref="GOA:D0ZB67"
FT                   /db_xref="InterPro:IPR002877"
FT                   /db_xref="InterPro:IPR004512"
FT                   /db_xref="InterPro:IPR015507"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZB67"
FT                   /protein_id="ACY83245.1"
FT                   /translation="MGKKRSASSSRWLQEHFSDKYVQQAQKKGLRSRAWFKLDEIQGSD
FT                   KIFRPGMTVVDLGAAPGGWSQYVVTQIGDKGRIIACDLLPMDPIVGVDFLQGDFRDELV
FT                   LGALMERVGDAKVQVVMSDMAPNMSGTPSVDIPRSMYLVELALEMAKDVLAPGGSFVVK
FT                   VFQGEGFDEYLGQIRSLFTKVKIRKPDASRARSREVYIVATGRKL"
FT   gene            441077..443017
FT                   /gene="hflB"
FT                   /locus_tag="ETAE_0399"
FT   CDS_pept        441077..443017
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hflB"
FT                   /locus_tag="ETAE_0399"
FT                   /product="ATP-dependent metalloprotease"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83246"
FT                   /db_xref="GOA:D0ZB68"
FT                   /db_xref="InterPro:IPR000642"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR005936"
FT                   /db_xref="InterPro:IPR011546"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037219"
FT                   /db_xref="InterPro:IPR041569"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZB68"
FT                   /protein_id="ACY83246.1"
FT                   /translation="MAKNLILWLVIAVVLMSVFQSFGPSESNSRRVDYSTFLTEVNQDQ
FT                   VREVSIDGRAINVTKKDGNRYTTYIPINDPKLLDSLLTKNVKVIGEPPEEPSLLTSIFI
FT                   SWFPMLLLIGVWIFFMRQMQGGGGKGAMSFGKSKARMLTEDQIKTTFADVAGCDEAKEE
FT                   VGELVEYLRDPSRFQKLGGKIPKGILMVGPPGTGKTLLAKAIAGEAKVPFFTISGSDFV
FT                   EMFVGVGASRVRDMFEQAKKAAPCIIFIDEIDAVGRQRGAGLGGGHDEREQTLNQMLVE
FT                   MDGFEGNEGIIVIAATNRPDVLDPALLRPGRFDRQVVVGLPDVRGREQILKVHMRRVPL
FT                   ATDIDASVIARGTPGFSGADLANLVNEAALFAARNNKRVVSMVEFEKAKDKIMMGAERR
FT                   SMVMTEAQKESTAYHEAGHAIIGRLVPEHDPVHKVTIIPRGRALGVTFFLPQGDSISYS
FT                   RQKLESMISVAYGGRLAEELIYGTEHVSTGASQDIKQATTIARNMVTQWGFSEKLGPLL
FT                   YAEEEGEVFLGRSVAKTKHMSDETARIIDQEVKALIERNYQRARQLLADNMDIMHAMKD
FT                   ALMKYETIDAPQVDDLMARREVRPPAGWLDEQANRQAQAQQPAAQPAAAEQAADSDAAR
FT                   SDDDRHNDGEK"
FT   gene            443109..443942
FT                   /gene="folP"
FT                   /locus_tag="ETAE_0400"
FT   CDS_pept        443109..443942
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folP"
FT                   /locus_tag="ETAE_0400"
FT                   /product="dihydropteroate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83247"
FT                   /db_xref="GOA:D0ZB69"
FT                   /db_xref="InterPro:IPR000489"
FT                   /db_xref="InterPro:IPR006390"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZB69"
FT                   /protein_id="ACY83247.1"
FT                   /translation="MLLRSRELTLNLNYPQVMGILNVTPDSFSDGGRHNALDAALRHAE
FT                   SMIVAGATIIDVGGESTRPGAAEVSEAEELARVVPVVEALTQRFEVWVSVDTSKAAVIR
FT                   ACSAAGADMINDVRSLSEPGALAAAAESGLPVCLMHMQGEPKGMQHSPHYSDVVAEVDA
FT                   YLSAQIARCVAAGIARERLLLDPGFGFGKNLTHNYRLLANLAHFHHHGLPLLVGMSRKS
FT                   MVGQLLNVPPAQRVAGSVACAVIAAMQGAQIIRVHDVRETVDAMRVVEATLSAKE"
FT   gene            443950..445287
FT                   /gene="glmM"
FT                   /locus_tag="ETAE_0401"
FT   CDS_pept        443950..445287
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glmM"
FT                   /locus_tag="ETAE_0401"
FT                   /product="phosphoglucosamine mutase"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83248"
FT                   /db_xref="GOA:D0ZB70"
FT                   /db_xref="InterPro:IPR005841"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR006352"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR016066"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZB70"
FT                   /protein_id="ACY83248.1"
FT                   /translation="MSERKYFGTDGIRGKVGSSPITPDFVLKLGWAAGKVLARHGSRKI
FT                   IIGKDTRISGYMLESALEAGLAAAGLSAAFTGPMPTPAVAYLTRTFRAEAGIVISASHN
FT                   PYYDNGIKFFSIDGTKLPDEVEAAIEAELDKPLTCVESAELGKASRIVDAAGRYIEFCK
FT                   STFPNALSLSGLKIVADCANGATYHIAPNVLRELGAEVITIGTSPDGMNINKECGATDV
FT                   RALQARVVAENADLGMAFDGDGDRLIMVDHRGDKVDGDQILYIVAREALRQGKLHGGVV
FT                   GTLMSNMGLELALKQLGIPFARAKVGDRYVLETMQEKGWRMGAENSGHVIILDQTTTGD
FT                   GIVAGLQVLAAMARNHMSLADLCSGMTLLPQVLINVRFAGQCDPLQDAAVQQACAEVER
FT                   QLAGRGRVLLRKSGTEPLIRVMVEGEDLQQVTDLANVIADAVKAAS"
FT   gene            445474..445809
FT                   /gene="secG"
FT                   /locus_tag="ETAE_0402"
FT   CDS_pept        445474..445809
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secG"
FT                   /locus_tag="ETAE_0402"
FT                   /product="preprotein translocase subunit SecG"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83249"
FT                   /db_xref="GOA:D0ZB71"
FT                   /db_xref="InterPro:IPR004692"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZB71"
FT                   /protein_id="ACY83249.1"
FT                   /translation="MYEALLVIFLLVSVALIALIMLQQGKGADMGASFGAGASATLFGS
FT                   SGTGNFMTRTTGILATLFFVLSLVLGNLSGHQSKQGSEWDNLGQPVKTEQPATPAAPAT
FT                   PSSDIPN"
FT   gene            445863..445949
FT                   /locus_tag="ETAE_t016"
FT   tRNA            445863..445949
FT                   /locus_tag="ETAE_t016"
FT                   /product="tRNA-Leu"
FT   gene            446006..446082
FT                   /locus_tag="ETAE_t017"
FT   tRNA            446006..446082
FT                   /locus_tag="ETAE_t017"
FT                   /product="tRNA-Met"
FT   gene            446328..446750
FT                   /locus_tag="ETAE_0403"
FT   CDS_pept        446328..446750
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAE_0403"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83250"
FT                   /db_xref="GOA:D0ZB72"
FT                   /db_xref="InterPro:IPR003728"
FT                   /db_xref="InterPro:IPR028989"
FT                   /db_xref="InterPro:IPR028998"
FT                   /db_xref="InterPro:IPR035956"
FT                   /db_xref="InterPro:IPR036847"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZB72"
FT                   /protein_id="ACY83250.1"
FT                   /translation="MITAPVEALGFELVGIEFIRGRHSTLRIYIDSEEGITVDNCADVS
FT                   HQVSAVLDVEDPISVAYYLEVSSPGMDRPLFTAEHYTHFLNEEVTLVLRMAMQNRRKWQ
FT                   GIIKAVDGEMITVTVDGKDEVFALSNVQKANLVPHF"
FT   gene            446772..448259
FT                   /gene="nusA"
FT                   /locus_tag="ETAE_0404"
FT   CDS_pept        446772..448259
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nusA"
FT                   /locus_tag="ETAE_0404"
FT                   /product="transcription elongation factor"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83251"
FT                   /db_xref="GOA:D0ZB73"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR010213"
FT                   /db_xref="InterPro:IPR010214"
FT                   /db_xref="InterPro:IPR010995"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013735"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR025249"
FT                   /db_xref="InterPro:IPR030842"
FT                   /db_xref="InterPro:IPR036555"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZB73"
FT                   /protein_id="ACY83251.1"
FT                   /translation="MNKEILAVVEAVSNEKALPREKIFEALETALATATKKKYEQEIDV
FT                   RVAIDRKSGDFDTFRRWLIVDEVTQPTREITLDAARFEDPALDLGDYVEDQIESVTFDR
FT                   ITTQTAKQVIVQKVREAERAMVVDAFREHEGEIVTGVVKKVNRDSISLDLGNNAEAVIG
FT                   REDMLPRENFRPGDRIRGVLYAVRPEARGAQLFVTRSRPEMLIELFRIEVPEIGEEVIE
FT                   IKGAARDPGSRAKIAVKTNDKRIDPVGACVGMRGARVQAVSSELGGERIDIVLWDDNPA
FT                   QFVINAMAPADVASIVVDEDKHTMDIAVEASNLAQAIGRNGQNVRLASQLSGWELNVMT
FT                   AEDLQAKHQAEAHAAIDTFTKHLDIDEEFATLLVEEGFSTLEELAYVPERELLSIDGLD
FT                   EETVEALRTRAKNALTTLALAQEESLGDNKPADDLLNLPGMERSVAFKLAARGVCTLED
FT                   LAEQGVDDLTDIEGLNNEQAGELIMAARNICWFGDSE"
FT   gene            448284..450989
FT                   /gene="infB"
FT                   /locus_tag="ETAE_0405"
FT   CDS_pept        448284..450989
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="infB"
FT                   /locus_tag="ETAE_0405"
FT                   /product="translation initiation factor 2"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83252"
FT                   /db_xref="GOA:D0ZB74"
FT                   /db_xref="InterPro:IPR000178"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006847"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR013575"
FT                   /db_xref="InterPro:IPR015760"
FT                   /db_xref="InterPro:IPR023115"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036925"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZB74"
FT                   /protein_id="ACY83252.1"
FT                   /translation="MAEVTVKSLAAEIQTSVERLVQQLADAGINKSPDDSVSPQEREAL
FT                   LAHLNREHGGSSGKLTLQRKTRSTLSVPGTGGKSKSVQIEVRKKRTYVKSDAAAQQAEA
FT                   EALAKREAEEQAKREAEEQTQREMAEQAKREAAEQAKRQQEEQAKREAAEKAKREAAEK
FT                   EKVTNQHIDEKTKAAQAEKAKREAEAAELKRKAEEEARRKLEEDARKVAEEARRMAEAN
FT                   EGKWTENASEEDNSDYHVTTSHHAREAEDENDRQVEGDRRARGRGGKAAKQKKGSKLSE
FT                   SKADREEARAVNRGGKGGKRKPSSLQQGFTKPAQAVNRDVVIGETITVAELANKMAVKG
FT                   SQVIKSMMKMGAMATINQVIDQETAQMVAEEMGHKVILRRENELEEAVLNDRDTGAAAE
FT                   PRAPVVTIMGHVDHGKTSLLDYIRSTKVAAGEAGGITQHIGAYHVQTDNGMITFLDTPG
FT                   HAAFTAMRARGAQATDIVVLVVAADDGVMPQTIEAIQHAKAAGVPLVVAVNKIDKPEAD
FT                   PDRVKNELSQYGVMPEDWGGEAQFVHVSAKAGTGIDDLLDAILLQAEVLELKAVRNGMA
FT                   SGVVIESFLDKGRGPVATVLVREGTLHKGDIVLCGFEYGRVRAMRDELGREITEAGPSI
FT                   PVEILGMSGVPAAGDEATVVRDEKKAREVALYRQGKFREVKLARQQKAKLENMFSNMVE
FT                   GEVSELNIVLKADVQGSVEAIADSLRKLSTDEVKVKIVGSGVGGITETDATLAAASNAI
FT                   LLGFNVRADASARRVVEAENLDLRYYSVIYDLIDEVKQAMSGMLAPEYKQEIIGLAEVR
FT                   DVFKSPKFGAIAGCMVTEGVVKRHSPIRVLRENVVIYEGELESLRRFKDDVNEVRNGME
FT                   CGIGVKNYNDVRPGDVIEVFETIEVKRSID"
FT   gene            451086..451484
FT                   /gene="rbfA"
FT                   /locus_tag="ETAE_0406"
FT   CDS_pept        451086..451484
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rbfA"
FT                   /locus_tag="ETAE_0406"
FT                   /product="ribosome-binding factor A"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83253"
FT                   /db_xref="GOA:D0ZB75"
FT                   /db_xref="InterPro:IPR000238"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR020053"
FT                   /db_xref="InterPro:IPR023799"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZB75"
FT                   /protein_id="ACY83253.1"
FT                   /translation="MAREFSRTQRVAQEMQKEIAIILQREVKDPRVGMATVSGVEVSRD
FT                   LAYTKVFVTFLNDGEPETVKAGLKALQDASGFIRMLLGKAMRLRVVPELTFAYDASLVE
FT                   GMRMSNLVSNVVKDDEARRTAADRDEEA"
FT   gene            451484..452446
FT                   /gene="truB"
FT                   /locus_tag="ETAE_0407"
FT   CDS_pept        451484..452446
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="truB"
FT                   /locus_tag="ETAE_0407"
FT                   /product="tRNA pseudouridine synthase B"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83254"
FT                   /db_xref="GOA:D0ZB76"
FT                   /db_xref="InterPro:IPR002501"
FT                   /db_xref="InterPro:IPR014780"
FT                   /db_xref="InterPro:IPR015240"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR032819"
FT                   /db_xref="InterPro:IPR036974"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZB76"
FT                   /protein_id="ACY83254.1"
FT                   /translation="MSRPRRRGRDINGVLLLDKGQGMSSNDVLQKVKRIYNANKAGHTG
FT                   ALDPLATGMLPICLGEATKFSQFLLDADKRYRVIARLGQRTDTSDADGQVVCERPLSFS
FT                   EAELAQALEGFRGPGRQVPSMYSALKYQGRPLYEYARQGIDVPRESREITVFELRFIRW
FT                   EGDELELEIHCSKGTYIRTIIDDLGEVLGCGAHVIYLRRLQVSGYPSERMVTLEQLQAL
FT                   LAQAQQQERDPRLLLDPLLLPMDTAAAHLPEVNLSEIVAGYVQLGQPVQTPDLPQSGMV
FT                   RISVGAAHRFIGVGEVDDQGRLAPRRMVVESRLSEDDPT"
FT   gene            452595..452864
FT                   /gene="rpsO"
FT                   /locus_tag="ETAE_0408"
FT   CDS_pept        452595..452864
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsO"
FT                   /locus_tag="ETAE_0408"
FT                   /product="30S ribosomal protein S15"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83255"
FT                   /db_xref="GOA:D0ZB77"
FT                   /db_xref="InterPro:IPR000589"
FT                   /db_xref="InterPro:IPR005290"
FT                   /db_xref="InterPro:IPR009068"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZB77"
FT                   /protein_id="ACY83255.1"
FT                   /translation="MSLSVEAKAKIVAEFGRDANDSGSTEVQVALLTAQINHLQGHFAE
FT                   HKKDHHSRRGLLRMVSQRRKLLDYLKRKDVARYSSLIERLGLRR"
FT   gene            453120..455243
FT                   /gene="pnp"
FT                   /locus_tag="ETAE_0409"
FT   CDS_pept        453120..455243
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pnp"
FT                   /locus_tag="ETAE_0409"
FT                   /product="polyribonucleotide nucleotidyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83256"
FT                   /db_xref="GOA:D0ZB78"
FT                   /db_xref="InterPro:IPR001247"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR004088"
FT                   /db_xref="InterPro:IPR012162"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR015847"
FT                   /db_xref="InterPro:IPR015848"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR027408"
FT                   /db_xref="InterPro:IPR036345"
FT                   /db_xref="InterPro:IPR036456"
FT                   /db_xref="InterPro:IPR036612"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZB78"
FT                   /protein_id="ACY83256.1"
FT                   /translation="MLTPTVRKFQYGQHTVTLETGMMARQATAAVMVTMDDTAVFVTVV
FT                   GAKKAREGQDFFPLTVNYQERAYAAGRFPGGFFRREGRPGEGETLTARLIDRPIRPLFP
FT                   EGFLNEVQVVATVVSVNPQVSPDIVAMIGASAALSLSGIPFNGPIGAARVGYINDQYVL
FT                   NPTMDELKQSRLDLVVAGTDNAVLMVESEADLLSEDQMLGAVVFGHDQQQVVIENIKAL
FT                   AAEVGKPRWEWHAPEVNVALQHRVAEMAEARLGEAYHITEKQARYAKVDEIKESVIVDL
FT                   LAEDDALDAGEISDILGALEKAVVRGRVLRGEPRIDGREKDMIRALDVRTGVLPRTHGS
FT                   ALFTRGETQALVTATLGTERDAQNIDELTGERTDRFLLHYNFPPYSVGETGMMGSPKRR
FT                   EIGHGRLAKRGVLAVMPSQDAFPYTVRVVSEITESNGSSSMASVCGASLALMDAGVPIK
FT                   AAVAGIAMGLVKEQDNFVVLSDILGDEDHLGDMDFKVAGSRDGVTALQMDIKIEGITRE
FT                   IMQVALNQAKGARLHILGVMEQAINAPRGDISEFAPRIHTIKINPEKIKDVIGKGGSVI
FT                   RALTEETGTTIEIEDDGTVKIAATDGDKAKHAIRRIEEITAEIEVGRIYQGKVTRIVDF
FT                   GAFVAIGGGKEGLVHISQIADKRVEKVTDYLQMGQEVAVKVLEVDRQGRVRLSIKEANA
FT                   SAAAGQDAPADAE"
FT   gene            455363..456247
FT                   /gene="nlpI"
FT                   /locus_tag="ETAE_0410"
FT   CDS_pept        455363..456247
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nlpI"
FT                   /locus_tag="ETAE_0410"
FT                   /product="lipoprotein NlpI, contains TPR repeat"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83257"
FT                   /db_xref="GOA:D0ZB79"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR013105"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR023605"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZB79"
FT                   /protein_id="ACY83257.1"
FT                   /translation="MKPILRWCYVATAILLAGCSNADWRQNEVLAIPLQPSLQQEVMLA
FT                   RMEQILASRALTDDERAQLLYERGVLYDSLGLRALARNDFSQALAIRPDMPEVFNYLGI
FT                   YLTQAGNFDAAYEAFDSVLELDPTYSYARLNRGIALYYGGRYSLAQDDLQAFYQDDPND
FT                   PFRSLWLYLAERELNQEQALTALSQRYNKANRSQWGWNIVEFYLGKISEKTLMERLQAD
FT                   ATDNTSLAEHLSETDFYLGKHYLSLGEKSSASALFKLTVANNVHNFVENRYALLELARL
FT                   GQEQDDIPESDQQ"
FT   gene            456421..458325
FT                   /gene="deaD"
FT                   /locus_tag="ETAE_0411"
FT   CDS_pept        456421..458325
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="deaD"
FT                   /locus_tag="ETAE_0411"
FT                   /product="ATP-dependent RNA helicase DeaD"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83258"
FT                   /db_xref="GOA:D0ZB80"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR005580"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028618"
FT                   /db_xref="InterPro:IPR034415"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZB80"
FT                   /protein_id="ACY83258.1"
FT                   /translation="MAEFETTFADLGLAAPIIEALNDLGYEKPSPIQAACIPHLLNGRD
FT                   VLGMAQTGSGKTAAFSLPLLNNIDPSLKAPQVLVLAPTRELAVQVAEAMADFSKHMHGI
FT                   NVVALYGGQRYDVQLRALRQGPQIVVGTPGRLLDHLKRGTLSLTSLRGLVLDEADEMLR
FT                   MGFIEDVETIMAQIPAEHQTALFSATMPEAIRRITRRFMNEPQEVRIQSSVTTRPDISQ
FT                   SYWTVYGMRKNEALVRFLEAEDFDAAIIFVRTKNATLEVAEALERNGYSSAALNGDMNQ
FT                   ALREQTLERLKDGRLDILIATDVAARGLDVDRISLVVNYDIPMDAESYVHRIGRTGRAG
FT                   RAGRALLFVDNRERRLLRNIERTMKLTIPEVELPNAELLSTRRLAKFAARVQQQLESSD
FT                   LDQYRALLAKLQPEDEQDMETLAAALLKMAQGERPLILPPDPVVERRPRREFRERDERG
FT                   GDRFARRERDERGGDRPRRERREVGDMELYRIEVGRDDGVEVRHIVGAIANEGDISSRY
FT                   IGNIRLFGSHSTIELPKGMPGDLLTHFTRTRILNKPMNMQLIGDAPAREQRRERSGERG
FT                   GERRSFGGRDGGRDGDRRSFGGQRRFSDDRRGDRGFNRDSRSTRSDDNGHSRRRFNDA"
FT   gene            458458..458574
FT                   /locus_tag="ETAE_0412"
FT   CDS_pept        458458..458574
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAE_0412"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83259"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZB81"
FT                   /protein_id="ACY83259.1"
FT                   /translation="MRYIYKKLGSPAHFFFPMHFFSFTPSAFASIEKEARYQ"
FT   gene            458927..460243
FT                   /locus_tag="ETAE_0413"
FT   CDS_pept        458927..460243
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAE_0413"
FT                   /product="putative transmembrane transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83260"
FT                   /db_xref="GOA:D0ZB82"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZB82"
FT                   /protein_id="ACY83260.1"
FT                   /translation="MSSVALTDHPAVTRDGMSDSEWREATRFDSTDVGWVIMSIGMAIG
FT                   AGIVFLPVQVGLMGLWVFLLSSVVGYPAMYLFQRLFINTLAESPECRDYPSVISGYLGK
FT                   NWGILLGALYFVMLVIWMFVYSTAITNDSASYLHTFGVTEGLLSENPFYGLALICVLVA
FT                   ISSRGELLLFKLSSFMVLTKLLVVAALGIAMVGVWHLYNVGALPPLGLLVKNAVITLPF
FT                   TLTSILFIQTLSPMVISYRAHCKSREVARYKALRAMNIAFGVLFVTVFFYAVSFTLAMG
FT                   HDEAVKAYQQNISALAIAAQFIDGGAGNWVTVVSVILNIFAVMTAFFGVYLGFREATQG
FT                   IVMNLLRRMMPPERIKARWVQNGIMVFAVLLAWGAIILNAPVLSFTSICSPIFGMVGCL
FT                   IPAYLVYRVPALHKYKGVSLLVIIITGLLLCISPLLAFS"
FT   gene            460288..461604
FT                   /locus_tag="ETAE_0414"
FT   CDS_pept        460288..461604
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAE_0414"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83261"
FT                   /db_xref="InterPro:IPR005130"
FT                   /db_xref="InterPro:IPR021144"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZB83"
FT                   /protein_id="ACY83261.1"
FT                   /translation="MNTIQNACDTDALWAEFIRAVRQEVKPAVGCTEPVSLALAAAIAA
FT                   RQLAAPVDRIVCRVSPNLMKNGMGVTVPGTGMVGLPIAAALGALGGDADAGLEVIKNAS
FT                   AASVAAARALLAEGRVSVGMEQPCEQVLLSCARVYAGEAWAEVTIAGDHTRVVRIVHND
FT                   REIFRAADVANAATEAGYCLAQASLAQVYRFACDVPLERISFILDAAELNGALSREGLR
FT                   SRYGLHIGATLAQQRERGLLSHDLLSEIMIRTSAASDARMGGAVLPAMSNSGSGNQGIT
FT                   ATMPVVVVAEHMQASQEQLARALMLSHLTAIYIHSKLPTLSALCAATTAAMGAAAGIAW
FT                   LIDGRYEAVAMAIGSMIGDVSGMICDGASNSCAMKVSTSASAAFKAVLMALDDSAVSGN
FT                   EGIVAHDVDQSIANLCALASGAMRQTDTQIIEIMARKAS"
FT   gene            complement(461665..462543)
FT                   /locus_tag="ETAE_0415"
FT   CDS_pept        complement(461665..462543)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAE_0415"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83262"
FT                   /db_xref="GOA:D0ZB84"
FT                   /db_xref="InterPro:IPR001539"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZB84"
FT                   /protein_id="ACY83262.1"
FT                   /translation="MQFALGAVLYCWPQARLEAFYRAAAASEADIVYLGETVCSKRRVI
FT                   KSSDWLALARTLADSGKQVVLSTLALLQAPSELSELRRYIENGEFLIEANDLAAVNLAA
FT                   ERHLPFVAGPALNCYNAVTLRLLLRQGMVRWCMPVELSRDWLRNIRQQCDELGILGQFE
FT                   TEVFAYGHLPLAYSARCFTARAENLPKDECDTCCIRYPQGRRVLSQEQQQVFVLNGIQT
FT                   LSGYCYNLGNQLREMQGLVDIVRLSPQGEETLEMLSRFRANQQGEAPLTLARQAECNGY
FT                   WNQLAGLTLSS"
FT   gene            complement(462555..463550)
FT                   /gene="yhbU"
FT                   /locus_tag="ETAE_0416"
FT   CDS_pept        complement(462555..463550)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yhbU"
FT                   /locus_tag="ETAE_0416"
FT                   /product="putative collagenase"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83263"
FT                   /db_xref="GOA:D0ZB85"
FT                   /db_xref="InterPro:IPR001539"
FT                   /db_xref="InterPro:IPR036206"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZB85"
FT                   /protein_id="ACY83263.1"
FT                   /translation="MELLCPAGNLPALKAAVENGADAVYIGLKDDTNARHFAGLNFNEK
FT                   KLQEALEYVHQRGRKLHIAINTFAHPDGYSRWQRAVDMAAQLGADALILADLAMLEYAA
FT                   ERYPHIERHVSVQASVTNEEAIRFYQRHFAVARVVLPRVLSLHQVKQLARCSPVPLEVF
FT                   AFGSLCIMSEGRCYLSSYLTGESPNTVGACSPARFVRWQQTPQGMESRLNDVLIDRYAN
FT                   DENAGYPTLCKGRYLVDGVRYHTLEEPTSLNTLALLPALMEANIASVKIEGRQRSPAYV
FT                   SQVTRVWRQAIDRCRRDPEHFTPDAAWMEALDAVSEGAQTTLGAYHRRWQ"
FT   gene            463854..464375
FT                   /locus_tag="ETAE_0417"
FT   CDS_pept        463854..464375
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAE_0417"
FT                   /product="putative lipid carrier protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83264"
FT                   /db_xref="InterPro:IPR003033"
FT                   /db_xref="InterPro:IPR016830"
FT                   /db_xref="InterPro:IPR036527"
FT                   /db_xref="InterPro:IPR039543"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZB86"
FT                   /protein_id="ACY83264.1"
FT                   /translation="MLEQLRARIVRQGPAFLSLPLKVTPFVLQRHVLEQLLAWQFRQAL
FT                   AEGELAFLDGRWLQVDVRDLGLRWFVTVQQGTLRVGRQQQADVSFSADANDLILIAARK
FT                   EDPDTLFFQRRLRIEGDTELGLQVKNLMDAIDPELMPAPLRLALMQLADFVEAGLREGT
FT                   PIDARAVTSC"
FT   gene            464369..464872
FT                   /locus_tag="ETAE_0418"
FT   CDS_pept        464369..464872
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAE_0418"
FT                   /product="putative acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83265"
FT                   /db_xref="GOA:D0ZB87"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZB87"
FT                   /protein_id="ACY83265.1"
FT                   /translation="MLIRAEIPVDAPGIDRLLRRCFPGADEAELVSCLREDGLLTLGIV
FT                   ATDDEGGVVGYAAFSPVTVDGEECQWVGLAPLAVDEAYRRQGIAERLVYEGLDTLNEFG
FT                   YAGVAVLGDPRYYQRFGFVNAAQNDLHCRWPECDTLFQVYALAPQALEQARGRIEYAEP
FT                   FNRF"
FT   gene            465202..466686
FT                   /gene="putP"
FT                   /locus_tag="ETAE_0419"
FT   CDS_pept        465202..466686
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="putP"
FT                   /locus_tag="ETAE_0419"
FT                   /product="Na+/proline symporter"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83266"
FT                   /db_xref="GOA:D0ZB88"
FT                   /db_xref="InterPro:IPR001734"
FT                   /db_xref="InterPro:IPR011851"
FT                   /db_xref="InterPro:IPR018212"
FT                   /db_xref="InterPro:IPR038377"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZB88"
FT                   /protein_id="ACY83266.1"
FT                   /translation="MSVNTPTLITFLIYIFGMILIGLLAYRATNNFSDYILGGRRLGSV
FT                   VTALSAGASDMSGWLLMGLPGAIFVAGLSESWIAIGLVLGAYLNWRIVAGRLRVHTELN
FT                   NNALTLPDYFTQRFEDKQRILRLISALIILVFFTVYCASGVVAGARLFESTFGMSYESA
FT                   LWAGAAATIAYTFIGGFLAISWTDTVQATLMIFALILTPVMVVVSVGGFDDAMNAIAQR
FT                   SPAYLDLFRGLDWVAIVSLMGWGLGYFGQPHILARFMAADSHHTIRKARRISIVWMIFC
FT                   LGGAVAVGFFGIAFFSTHPELALEVHENKERVFISLSKLLFNPWIAGILLSAILAAVMS
FT                   TLSCQLLVSASAVTEDLYKAFLRKHANQRELVIVSRTMVMLIALIAIGLAANPHNYVLD
FT                   LVSYAWAGFGAAFGPVIIISLLWPGMTRNGALAGMLVGAATVVVWKQYAWFHLYEIIPG
FT                   FILASLAIVLVSLVGKGPSPQMRERFAQANTIYLTK"
FT   gene            467073..467528
FT                   /locus_tag="ETAE_0420"
FT   CDS_pept        467073..467528
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAE_0420"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83267"
FT                   /db_xref="GOA:D0ZB89"
FT                   /db_xref="InterPro:IPR011194"
FT                   /db_xref="InterPro:IPR011576"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZB89"
FT                   /protein_id="ACY83267.1"
FT                   /translation="MSNDDTLAAIRRFLARQHVVTLAVGQGEALWCADCFYALDAPTMT
FT                   LYLLTSPTSHHGRLMSVNPRVAGTVAHQTRSVAKIQGIQFHGRVACLEGEAAAAAYALY
FT                   YRRFPLARARPSPVWGLRLMRVKMTDNTCGFGHKRHWARQGEPVGVY"
FT   gene            467636..468310
FT                   /locus_tag="ETAE_0421"
FT   CDS_pept        467636..468310
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAE_0421"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83268"
FT                   /db_xref="GOA:D0ZB90"
FT                   /db_xref="InterPro:IPR000534"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZB90"
FT                   /protein_id="ACY83268.1"
FT                   /translation="MNVLLLGATGLIGRALLTRLTSEPRVTQIYAPTRTALPASAKLIN
FT                   PVGADICRAMLEWDTPCDVAFCCLGTTRKAAGSDSDFRYVDYSLVVECGAVALQHGCRH
FT                   YVVVSALGANAQSPFLYSRTKGEMEQALELQAWRRLSLLRPSLLQGERAKPRLLEQISE
FT                   PLFRLLPEKWKAIEADSVARAMLHCALYPAEYRLQILESEQVQRLGETATGGADTGADQ
FT                   RR"
FT   gene            complement(468298..468762)
FT                   /gene="nrdG"
FT                   /locus_tag="ETAE_0422"
FT   CDS_pept        complement(468298..468762)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nrdG"
FT                   /locus_tag="ETAE_0422"
FT                   /product="anaerobic ribonucleotide reductase activating
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83269"
FT                   /db_xref="GOA:D0ZB91"
FT                   /db_xref="InterPro:IPR001989"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR012837"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR034457"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZB91"
FT                   /protein_id="ACY83269.1"
FT                   /translation="MNYHQYYPVDVVNGPGTRCTLFVAGCVHQCPGCYNKATWRLDSGV
FT                   PFTTALEDRIIADLNDTRINHQGLSLSGGDPLHPHNVATILHLVQRVRTECRGKDIWLW
FT                   TGYRLEELTAEQQAVVALINVLVDGKFVQDLKDPMLIWRGSSNQIVHYLR"
FT   gene            complement(468846..470984)
FT                   /gene="nrdD"
FT                   /locus_tag="ETAE_0423"
FT   CDS_pept        complement(468846..470984)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nrdD"
FT                   /locus_tag="ETAE_0423"
FT                   /product="anaerobic ribonucleoside triphosphate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83270"
FT                   /db_xref="GOA:D0ZB92"
FT                   /db_xref="InterPro:IPR001150"
FT                   /db_xref="InterPro:IPR005144"
FT                   /db_xref="InterPro:IPR012833"
FT                   /db_xref="InterPro:IPR019777"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZB92"
FT                   /protein_id="ACY83270.1"
FT                   /translation="MKPIVIKRDGCQVPFNEQRIKEAVLRAALAADVDDADYCATVARV
FT                   VAMQMADRERVDINDIQHAVENQLMAGNYKQLARAYIEYRHDRDVAREQRGRLNQDIRG
FT                   LIEQSNAALLNENANKDSKVIPTQRDLLAGIVAKHYAKQHLLPRDVVQAHERGEIHYHD
FT                   LDYSPFFPMFNCMLIDLKGMLTNGFKMGNAEIERPKSISTATAVTAQIIAQVASHIYGG
FT                   TTINRIDEVLAPFVSASFAKHRQIAEQWNIPDVEGYAHARTEKECYDAFQSLEYEVNTL
FT                   HTANGQTPFVTFGFGLGTSWESRMIQQSILKNRIAGLGKNRKTAVFPKLVFAIRDGLNH
FT                   KFGDPNYDIKQLALECASKRMYPDILNYDQVVNVTGSFKTPMGCRSFLGVYEENGEMIH
FT                   DGRNNLGVISLNLPRIALEAQGDEAAFWKLLDRRLALARKALMTRIARLEGVKARVAPI
FT                   LYMEGACGVRLKADDAIADIFKNGRASVSLGYIGIHETINALFGTQTHVFDDAALRAKA
FT                   IAIVERLRQATDTWKQETGYAFSLYSTPSENLCDRFCRLDTAEFGLVEGVTDKGYYTNS
FT                   FHLDVEKQVNPYDKLDFEAPYPPLANGGFICYGEYPNLQHNLKALEDVWDYSYSRVPYY
FT                   GTNTPIDECYECGYTGEFECTSKGFTCPKCGNHDSTKVSVIRRVCGYLGSPDARPFNAG
FT                   KQEEVKRRIKHLNNGQIG"
FT   gene            471009..471152
FT                   /locus_tag="ETAE_0424"
FT   CDS_pept        471009..471152
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAE_0424"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83271"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZB93"
FT                   /protein_id="ACY83271.1"
FT                   /translation="MCIHLPVIHSTKPREIRLYARCVDALWITTIYRCSFTSETLYMGM
FT                   AI"
FT   gene            complement(471177..471317)
FT                   /locus_tag="ETAE_0425"
FT   CDS_pept        complement(471177..471317)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAE_0425"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83272"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZB94"
FT                   /protein_id="ACY83272.1"
FT                   /translation="MRGYIRAHSLPHVTISAFFIQKIIITLLKNGADHPLYNDSTDAKN
FT                   H"
FT   gene            complement(471394..471681)
FT                   /locus_tag="ETAE_0426"
FT   CDS_pept        complement(471394..471681)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAE_0426"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83273"
FT                   /db_xref="InterPro:IPR025612"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZB95"
FT                   /protein_id="ACY83273.1"
FT                   /translation="MNRQRQSLAAEKARLLQKIAQQRVDLHTESLRAEQLCINVDRTLT
FT                   TLWRLRRTLSLAAGLAAVYAARHPSRLLSGIKRAVGLWSTLRLARRTFYP"
FT   gene            complement(471678..472082)
FT                   /locus_tag="ETAE_0427"
FT   CDS_pept        complement(471678..472082)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAE_0427"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83274"
FT                   /db_xref="GOA:D0ZB96"
FT                   /db_xref="InterPro:IPR009937"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZB96"
FT                   /protein_id="ACY83274.1"
FT                   /translation="MAGDTSPTQDSAAGILGTARRIVTLLVGMTETRLRLAVVELEEEK
FT                   ANLIQLLLMAGVTLLFTAFGLMCLLVLLFWAVEPAYRLMALGIATALLLLLACVGAIWT
FT                   LTKARRSTFLLATRKQLEIDRQLLERREKP"
FT   gene            complement(472082..472387)
FT                   /locus_tag="ETAE_0428"
FT   CDS_pept        complement(472082..472387)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAE_0428"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83275"
FT                   /db_xref="GOA:D0ZB97"
FT                   /db_xref="InterPro:IPR010279"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZB97"
FT                   /protein_id="ACY83275.1"
FT                   /translation="MTNDSTAEHLRAELKSLADALEDVLNSSTDKPKAELEKLRARAHD
FT                   ALHNSRERLSQAGENVATQTREMAGRADDYVRDNPWTGVGIGAAVGVVLGVLLARR"
FT   gene            complement(472660..473073)
FT                   /locus_tag="ETAE_0429"
FT   CDS_pept        complement(472660..473073)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAE_0429"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83276"
FT                   /db_xref="GOA:D0ZB98"
FT                   /db_xref="InterPro:IPR026574"
FT                   /db_xref="InterPro:IPR027398"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZB98"
FT                   /protein_id="ACY83276.1"
FT                   /translation="MNQANSQPFTRRQGWKRMLGLLLFIVAALTAVILPQLGHKEVSLQ
FT                   IRATHSGLATPDGFFVYQKLDENGVSITSITPDREGLVVRLAHPEQQALALQVLQRELP
FT                   PGYSIADKILHRSLFHKSERPAAALSYSAGRNS"
FT   gene            complement(473075..473755)
FT                   /locus_tag="ETAE_0430"
FT   CDS_pept        complement(473075..473755)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAE_0430"
FT                   /product="putative membrane-associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83277"
FT                   /db_xref="GOA:D0ZB99"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="InterPro:IPR032818"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZB99"
FT                   /protein_id="ACY83277.1"
FT                   /translation="MDIIRELITALWHQDYETLANPSLVWTIYGILFVILFLENGLLPA
FT                   AFLPGDSLLILVGVLIARDTMDFPLTLLVLTSAASLGCWVGYLQGRWLGNTHLVQKWLS
FT                   HLPAHYHQRAHQLFHRHGLAALLIGRFLAFVRTLLPLIAGLSGLNGPRFQFFNWISGLL
FT                   WVLILSSLGYVLGKTPLFLRYEDQLMNLLMLLPLVLLVFGLCGSLLVLWRKKHAHATGK
FT                   SPRK"
FT   gene            complement(473856..474320)
FT                   /locus_tag="ETAE_0431"
FT   CDS_pept        complement(473856..474320)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAE_0431"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83278"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZBA0"
FT                   /protein_id="ACY83278.1"
FT                   /translation="MKRVTSASLLLLLCCWAATAIGKIGAWHSQAVTTLPLSQFPCNTA
FT                   VFSENYRDPAGSHCLSRIPHNRKITALIRLHICGGSEVVRNGLIPPDVPPPETRQPYRP
FT                   QAPGNDGHYARLSRILLRTLQLPPHQNRLGGWKESNILYRGQVTYHPALA"
FT   gene            complement(474511..474900)
FT                   /gene="crcB"
FT                   /locus_tag="ETAE_0432"
FT   CDS_pept        complement(474511..474900)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="crcB"
FT                   /locus_tag="ETAE_0432"
FT                   /product="camphor resistance protein CrcB"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83279"
FT                   /db_xref="GOA:D0ZBA1"
FT                   /db_xref="InterPro:IPR003691"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZBA1"
FT                   /protein_id="ACY83279.1"
FT                   /translation="MNYGLTLLVVACGGALGAISRFQITNWFSAWFGSGFPYATLTVNV
FT                   IGCFIMGALVSMLNSGTLIAPHWRPLIGVGFLGALTTFSTFSFDTFALFSEGFWMKAML
FT                   NVVLNLILCMAAVSAGYYLLLSRSA"
FT   gene            475006..475146
FT                   /locus_tag="ETAE_0433"
FT   CDS_pept        475006..475146
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAE_0433"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83280"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZBA2"
FT                   /protein_id="ACY83280.1"
FT                   /translation="MPGVISTGLGEVARYDGSATHIGSRCRLSPAVFNSFFELKVEHHH
FT                   R"
FT   gene            complement(475185..475952)
FT                   /gene="exuR"
FT                   /locus_tag="ETAE_0434"
FT   CDS_pept        complement(475185..475952)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="exuR"
FT                   /locus_tag="ETAE_0434"
FT                   /product="DNA-binding transcriptional repressor ExuR"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83281"
FT                   /db_xref="GOA:D0ZBA3"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZBA3"
FT                   /protein_id="ACY83281.1"
FT                   /translation="MECTRLYQQLAAELKQRVEGGVYPVGDKLPAERFIAEEMDVSRTV
FT                   VREAIIMLEVEGYVEVRKGSGIHVINNQPKSLIQPDNAIEFASAGPFELLQARQLIESN
FT                   IAEFAATQVTKQDIVALMEIQERARQEDRFRDSEWDLKFHVQVALATQNSAMATIVEKM
FT                   WSQRTHNPYWLKLHEHIDDKSIESWCEDHDKILKALIRKDPYGAKIAMWQHLENTKQML
FT                   FHATTDDFEFNVDRYLFAENPVVHLDAVANGGK"
FT   gene            complement(476125..477420)
FT                   /gene="exuT"
FT                   /locus_tag="ETAE_0435"
FT   CDS_pept        complement(476125..477420)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="exuT"
FT                   /locus_tag="ETAE_0435"
FT                   /product="galacturonate transporter"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83282"
FT                   /db_xref="GOA:D0ZBA4"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZBA4"
FT                   /protein_id="ACY83282.1"
FT                   /translation="MRKIKGLRWYMIGLVTIGTVLGYLTRNAIAVAAPALEDTLHITTQ
FT                   QYSYIIATYSACYTIMQPVAGYVLDLLGTKVGYAVFAVLWALFCMGTALANSWGGLAIA
FT                   RGAVGMAEAAMIPAGLKASSEWFPAKERSIAVGYFNVGSSIGGMIAPPLVVWAIMVHSW
FT                   EMAFIITGALSLLWAIGWLIFYKQPQDQKRLSDEERQYILSGQEAQHKGDNATRMSAWQ
FT                   ILRNRQFWGIALPRFLAEPAWGTFNAWIPLFMFKAYGFNLKEIAMFAWMPMLFADLGCV
FT                   IGGYLPPLFQKYFNVNLIVSRKLVVTLGAVLMIGPGMIGLFSSPYIAIALLCIGGFAHQ
FT                   ALSGSLITLSSDVFGRNEVATANGLTGMAAWTASTLFALVVGALADTLGFSPLFAALAV
FT                   FDLLGALIIWTVLQNRTANDPQPIPRPANANA"
FT   gene            477932..479341
FT                   /gene="uxaC"
FT                   /locus_tag="ETAE_0436"
FT   CDS_pept        477932..479341
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="uxaC"
FT                   /locus_tag="ETAE_0436"
FT                   /product="glucuronate isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83283"
FT                   /db_xref="GOA:D0ZBA5"
FT                   /db_xref="InterPro:IPR003766"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZBA5"
FT                   /protein_id="ACY83283.1"
FT                   /translation="MSPFLTEDFLLDTEFARRLYHDYAAEQPIFDYHCHLPPEQIAENY
FT                   RFKNLYDIWLKGDHYKWRAMRTNGVAERFCTGEASDREKFQAWAETVPHTIGNPLYHWT
FT                   HLELRRPFGITDTLLSAATAEDIWTRCNRMLAEDSFTARGIMGQMNVKMVGTTDDPIDD
FT                   LRHHRTIAADSSFTTKVLPSWRPDKAFNIDAALFSDYIAKLGAVADVDITRFADLCQAL
FT                   KVRMDYFAAHGCKVSDHALDVVVYGEADDATLDGILARRLSGGTPSETEVAQFKTAVLL
FT                   FLGREYQQRGWVQQYHIGALRNNNTPMFARLGADIGFDSINDAPVAQPLSRLLDAQSRN
FT                   GGLAKTILYCLNPRDNEVLGTMIGNFQGEGMPGKMQFGSGWWFNDQKDGMQRQMTQLAQ
FT                   LGLLSRFVGMLTDSRSFLSYTRHEYFRRILCQMIGRWVAQGEAPADIALLGSMVKNICF
FT                   DNAKSYFAIEL"
FT   gene            479448..480926
FT                   /gene="uxaB"
FT                   /locus_tag="ETAE_0437"
FT   CDS_pept        479448..480926
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="uxaB"
FT                   /locus_tag="ETAE_0437"
FT                   /product="altronate oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83284"
FT                   /db_xref="GOA:D0ZBA6"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013118"
FT                   /db_xref="InterPro:IPR013131"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZBA6"
FT                   /protein_id="ACY83284.1"
FT                   /translation="MQTLNRRDFPGRQHPDKVIQFGEGNFLRAFVDWQLDLLNEHTDLD
FT                   AGIVVVRPIDSDFPPSLNCQDGLYTTIVRGLNERGEAVSTSRVIRSVNRELNVYREFDA
FT                   FLALARDPNIRFVFSNTTEAGISYAPQDRLSDAPPSSFPAKLTRLLYERFCHFDGAADK
FT                   GWVLLPCELIDYNGEALRELVLRYAEQWDLPPAFTVWLTEHTTFCATLVDRIVTGYPRD
FT                   EATSLCDALGYQDSFLDTAEYFYLFVIQGPQWLAQALRLDAYAATQGPLNIRIVEDIRP
FT                   YKERKVAILNGAHTALVPVAYLAGLDTVGQSMDDAQVAAFVEQTIAQEIIPQLDLPIEE
FT                   LNAFSAAVIARFRNPYIQHQLLSIALNGMTKFRTRILPQLLSYRARQNAVPLRLSFALA
FT                   ALIAFYRGERDGLRYPLQDDAHWLAFYAAGWEAVRAGEQTLEQLVSAVLAQSAHWGEDL
FT                   NGVPGLTQQVSRALQAIEQQGMRAALGALLASSY"
FT   gene            480945..482435
FT                   /gene="uxaA"
FT                   /locus_tag="ETAE_0438"
FT   CDS_pept        480945..482435
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="uxaA"
FT                   /locus_tag="ETAE_0438"
FT                   /product="altronate hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83285"
FT                   /db_xref="GOA:D0ZBA7"
FT                   /db_xref="InterPro:IPR007392"
FT                   /db_xref="InterPro:IPR013974"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZBA7"
FT                   /protein_id="ACY83285.1"
FT                   /translation="MQSIIKIHPQDNVAVALRDLAAGETIALDDGALTLRDAVPRGHKV
FT                   ALCHLAPQAMVIKYGLPIGHALTPIAAGDHVHAQNLRTNLSDLDSYQYQPDFAAPTAQP
FT                   ADRAISLYRRASGEVAIRNELWILPTVGCVNGMARQMLQRFLRESDGASAIDGVHLFTH
FT                   PFGCSQLGDDHQNTRTLLQNMVHHPNAGGVLVVGLGCENNQIAAFRETLGDYDPARVRF
FT                   LVCQQQDDEVEAGTEALHELYGAMRGDRREPGRLSELKFGLECGGSDGFSGISANPLLG
FT                   RFSDYVIAHGGTSVLTEVPEMFGAERILMSRCRDGETFEKTVAMVNDFKRYFIDHQQPI
FT                   YENPSPGNKAGGITTLEEKSLGCTQKAGQSQVMDVLRYGERLHTPGLNLLSAPGNDAVA
FT                   TSALAAAGCHMVLFSTGRGTPYGGFVPTVKLATNTPLAAKKPHWIDFDAGQLLQGKPMA
FT                   LLLSEFIDLIVAIADGRQTCNEKNDFRELAIFKSGVTL"
FT   gene            482497..483018
FT                   /locus_tag="ETAE_0439"
FT   CDS_pept        482497..483018
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAE_0439"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83286"
FT                   /db_xref="GOA:D0ZBA8"
FT                   /db_xref="InterPro:IPR019629"
FT                   /db_xref="InterPro:IPR026267"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZBA8"
FT                   /protein_id="ACY83286.1"
FT                   /translation="MSGELLFAQGVGIVAFLVGITTFFNRDERRFRLQLALYSAIIGAH
FT                   FFLMGASAAGMSAELNAIRSVVATRTRNVWIMALFIALTLGLGGWELKHPVEVLPIVGT
FT                   IASTWALFRCRGLTTRCVMWCSTACWVIHNLWLGSLGGSLIEGSFLLINGYNIVRFYRM
FT                   QRRGIDPFRS"
FT   gene            complement(483128..484348)
FT                   /gene="sstT"
FT                   /locus_tag="ETAE_0440"
FT   CDS_pept        complement(483128..484348)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sstT"
FT                   /locus_tag="ETAE_0440"
FT                   /product="sodium/serine (threonine) transporter"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83287"
FT                   /db_xref="GOA:D0ZBA9"
FT                   /db_xref="InterPro:IPR001991"
FT                   /db_xref="InterPro:IPR023025"
FT                   /db_xref="InterPro:IPR036458"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZBA9"
FT                   /protein_id="ACY83287.1"
FT                   /translation="MRFITRGSLVGQILVGLVLGIALASFSQSGAIAAGLLGTLFVSAL
FT                   KAVAPVLVFILVAASIANHRQGQKTNMRPIVLLYLLGTFAAALVAVVVSFAFPSQLALV
FT                   SHTNDITPPGGIVEVLQSLLMNVVDNPFRALANGNFIGILAWAIGLGVALRHASDTTKR
FT                   VVGDLSYGVTFIVRVVIRFAPLGIFGLVSSTLAETGFDALWGYAHLLMVLIGAMLLVAL
FT                   VLNPLIVFWKIRRNPYPLVFTCLRESGLTAFFTRSSAANIPVNMELCKKLKLNEDTYAV
FT                   SIPLGATINMAGAAITITVLTLAAAHTLGISVDLPTALLLSLVAAVCACGASGVAGGSL
FT                   LLIPLACSLFGISSDIAMQVVAVGFIIGVLQDSCETALNSSTDVLFTAAACVAAEESTG
FT                   DSAAELG"
FT   gene            complement(484721..485689)
FT                   /locus_tag="ETAE_0441"
FT   CDS_pept        complement(484721..485689)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAE_0441"
FT                   /product="putative transporter protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83288"
FT                   /db_xref="GOA:D0ZBB0"
FT                   /db_xref="InterPro:IPR005496"
FT                   /db_xref="InterPro:IPR022369"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZBB0"
FT                   /protein_id="ACY83288.1"
FT                   /translation="MLNSVGTPWLWGSFALIILIMLAIDLLLQGRRGAQAMTMRQAAVW
FT                   SLVWVSLALLFNAGLWLYLSETLGRAAADQQALAFLTGYLIEKALAVDNVFVWLMLFSY
FT                   FSVPANMQRRVLVYGVLGAIILRTIMIFAGSWLVTQFQWILYLFGAFLLFTGIKMAMAH
FT                   DDDGDLGDRPLVRWLRRHLRMTDCIESEHFFTRRSGTLFATPLLLVLILVELSDVIFAV
FT                   DSIPAIFAVTTDPFLVLTSNLFAILGLRAMYFLLAGVAERFTLLKYGLAAILTFIGIKM
FT                   LIVDFYHIPIAFSLGIVAGILALTLLINAGVNHRRASRAPR"
FT   gene            486074..486982
FT                   /locus_tag="ETAE_0442"
FT   CDS_pept        486074..486982
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAE_0442"
FT                   /product="hypothetical transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83289"
FT                   /db_xref="GOA:D0ZBB1"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZBB1"
FT                   /protein_id="ACY83289.1"
FT                   /translation="MAVARKTNPLAIAGLIALTLIWSYSWIAMKQVTQYIGAFDFTALR
FT                   CVCGALLLLVVLHLRGRGMRPTPFGYTLAIALLQTCGMVGLAQWALMSGGAGKVAILSY
FT                   TMPFWVVIMAALFLGERMRRLQYVAIAAAALGLLLVLQPWKLDLSSLQSALLAVLSGIS
FT                   WGASAIVAKRMYARYPGIDLLGLTTWQMLYAAVVMSVVAWLVPQRSVDWQPYVFWALAY
FT                   SAILATALAWSLWLFVLKNLPAGIASLSTLAVPVCGVLFSWWLLGENPGPVEGCGIVLI
FT                   ALALAVISIKRQGPQAQSTRR"
FT   gene            complement(487017..487997)
FT                   /locus_tag="ETAE_0443"
FT   CDS_pept        complement(487017..487997)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAE_0443"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83290"
FT                   /db_xref="GOA:D0ZBB2"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZBB2"
FT                   /protein_id="ACY83290.1"
FT                   /translation="MIRLAIIGTNWITRRFVDAALACGQYRLSAVYSRRLEQAADFAAP
FT                   YGAVHCFDSLDALACSPEVDAVYIASPNALHCAQTLLMLRHGKHVICEKPLASTHAEAQ
FT                   RAFDCARANGVVLFEAFKTAYLPNFDVIRSALPRLGRLRKAFLNYCQYSSRYPRYLNGE
FT                   NPNTFNPAFSNGSIMDIGFYCLASGVALFGEPQRVSAEAVLLDSGVDAHGHVAMRYPGL
FT                   EVLLFHSKVSDSALPSEIQGEEGSLVIEHLSQCQRVTLIPRGGVAQEIGVVQRENTMEY
FT                   EAQAFARLIREGRVAHAGVARALSTARLLDEIRRQTGVVFPADRA"
FT   gene            complement(488053..488556)
FT                   /locus_tag="ETAE_0444"
FT   CDS_pept        complement(488053..488556)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAE_0444"
FT                   /product="putative metal-dependent hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83291"
FT                   /db_xref="GOA:D0ZBB3"
FT                   /db_xref="InterPro:IPR002725"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZBB3"
FT                   /protein_id="ACY83291.1"
FT                   /translation="MTHLSYLAGYPEPLLAQVRTLLAQRRLGDTLRRRYPERHTITTDR
FT                   ALYDYAHSLKNLYMRNTPPLSRVQYDSRIQVIQQALGLHSVVSRVQGNRLKAKAEIRIA
FT                   SLFRQGPEALLRMIVVHELAHLREKNHDKAFYSLCCHMEPDYHQLEFDARLYLTCLDVE
FT                   GSVY"
FT   gene            488634..489779
FT                   /gene="rsmC1"
FT                   /locus_tag="ETAE_0445"
FT   CDS_pept        488634..489779
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rsmC1"
FT                   /locus_tag="ETAE_0445"
FT                   /product="16S RNA G1207 methylase RsmC"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83292"
FT                   /db_xref="GOA:D0ZBB4"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR007848"
FT                   /db_xref="InterPro:IPR017237"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZBB4"
FT                   /protein_id="ACY83292.1"
FT                   /translation="MSQLESSAGCPAITGLTLARFPRQSDDPSLQAWEAADEYLLQQID
FT                   LTQAQGRPTIIFNDAFGALACALHELRPYSVSDSYVSQLATRHNLQLNDLDEDAVTLLD
FT                   SLSPLPEAPALVVIKLPKMLALLEQQLHALRAVVAPDTRIIAAAKARDIHTSTLQLFES
FT                   ILGETHTSLAWKKARLIYCQVGERAVTPAPATTVWPLEGTPYTMHNHAGVFSRGSLDIG
FT                   ARFFLQHLPEGIQGEVADLGCGNGVLGLAALSSSPQARVLFADESYMAVASARLNVQHN
FT                   RPQDLARCEFWVGNGLAGREGGTLDAVLCNPPFHQQHSITDQVAWDMFVAARRCLKRNG
FT                   ALYIVGNRHLDYYPKLRRLFGNCATLGMNRKFVVLKAVKTA"
FT   gene            489962..491119
FT                   /locus_tag="ETAE_0446"
FT   CDS_pept        489962..491119
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAE_0446"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83293"
FT                   /db_xref="GOA:D0ZBB5"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZBB5"
FT                   /protein_id="ACY83293.1"
FT                   /translation="MDRRTLLKSSVALLGALSLSGPGSLARAQFVAQRPAAPDADHPLA
FT                   LNFNENALGMSAQAHQAIAAALPGAFRYPDAAREALIAALASEMALTPAHLSLGNGSSE
FT                   CIRAILQAQAIAAQRQGKAVQLVVPDPTFNYAELYLQPLGVEVVKVPLDAQLGFPLAEM
FT                   QRRTRAFNGLSLVYLCNPNNPTATLTPTDALAAWITQAPPDTFFVIDEAYAEFVNDPAF
FT                   RSAVALVQAGHENLLVTRTFSKLYALAGLRVGYGVAAPSVAAQSEALMSLDNTNSAGAA
FT                   AALASLQDRAFVEHSRKTTDLSRQIVCAALDELQLAYLPSQANFIFHQVNGDAARYQAR
FT                   MKQHHILVGRPFPPLNNWNRLTLGTPQEMQLFVAQLHAFRRQGWV"
FT   gene            complement(491147..492511)
FT                   /gene="qseC"
FT                   /locus_tag="ETAE_0447"
FT   CDS_pept        complement(491147..492511)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="qseC"
FT                   /locus_tag="ETAE_0447"
FT                   /product="sensor protein QseC"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83294"
FT                   /db_xref="GOA:D0ZBB6"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013727"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZBB6"
FT                   /protein_id="ACY83294.1"
FT                   /translation="MRHLSRQLTHSLRARLTGGFLILVLLVWSSASALTWYQTRDALNE
FT                   LFDTQQMLFAKRLLAFDLSQLKHPLQLPQSHDLLRKHRGDQDKDALAFAIFNADGRMLL
FT                   NDGDNGDNLVYRYQGDGFTDGYLDNDDDSWRLLWLTTPDGRYRILVGQEWDYRNDMALS
FT                   IVGAQMVPWLVALPVMVILLLLVVSRGLAPLHRLAAALRRRRPDDATPLPREAIPSEVW
FT                   PVVASLNTLFARTNAQMVRERRFTSDAAHELRTPLAALRVQAEVVQLAQDDLALRQRAL
FT                   GQLEQGIDRATRLVDQLLTLSRLDSLSQLDDVQPRALAELLQTAVIDMDAKAHAAGVAL
FT                   ALSVDDPKVCRRIQPLLFSLLIRNLLDNAIRYSPTGSQVTLRLTSHRLQITDNGAGVSD
FT                   AVLQRLGERFYRPPGQEKTGSGLGLSIVRQIASLHGMQVQFDHAPGGGFQATLRW"
FT   gene            complement(492511..493170)
FT                   /gene="ygiX"
FT                   /locus_tag="ETAE_0448"
FT   CDS_pept        complement(492511..493170)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ygiX"
FT                   /locus_tag="ETAE_0448"
FT                   /product="DNA-binding response regulator in two-component
FT                   regulatory system with QseC"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83295"
FT                   /db_xref="GOA:D0ZBB7"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZBB7"
FT                   /protein_id="ACY83295.1"
FT                   /translation="MRVLLIEDDRLIGDGIKAGLSKMGFTLDWFTDGQLGMTALESAPY
FT                   DAVILDLSLPGIDGLEILRRWREAGHAEPVLILTARDALEQRVTGLQQGADDYLCKPFA
FT                   LIEVAARLQALIRRNHGQAQTLLSHGAVSLDPLSLTATLDGASLPLKPKEFALLELLLR
FT                   NAGRVLPRSLIEEKLYSWDDDVSSNAVEVHIHHLRRKLGSHFIRTVHGVGYTLGDS"
FT   gene            493381..493785
FT                   /locus_tag="ETAE_0449"
FT   CDS_pept        493381..493785
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAE_0449"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83296"
FT                   /db_xref="InterPro:IPR005220"
FT                   /db_xref="InterPro:IPR016052"
FT                   /db_xref="InterPro:IPR036700"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZBB8"
FT                   /protein_id="ACY83296.1"
FT                   /translation="MMKKSAAIFAILALCSAPVLAQTGGFSGPGATQQVQNTQQSGGFV
FT                   GGQQAVTTVAKAKDLNDNSWVVLQGNIEQRVRGDHYTFRDATGTIEVEIDHKYWNGQTI
FT                   TPKDKVEIQGEVDKDWNTTKIDVKRLHKMN"
FT   gene            complement(493844..496276)
FT                   /locus_tag="ETAE_0450"
FT   CDS_pept        complement(493844..496276)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAE_0450"
FT                   /product="putative formate acetyltransferase 3"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83297"
FT                   /db_xref="GOA:D0ZBB9"
FT                   /db_xref="InterPro:IPR001150"
FT                   /db_xref="InterPro:IPR004184"
FT                   /db_xref="InterPro:IPR005949"
FT                   /db_xref="InterPro:IPR010098"
FT                   /db_xref="InterPro:IPR019777"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZBB9"
FT                   /protein_id="ACY83297.1"
FT                   /translation="MTILQLNTLSERIRAHKEALIHIVTPPICTERAVHYTEAYQRHLD
FT                   KPVPVRRALALAEHLARRTIWINHDELIVGNQASRVRAAPIFPEYTVSWIEKEIDDLAD
FT                   RPGAGFSVTEEDKAVLHRVCPWWRGQTVQDRCYGMFTDEQKALLASGIIKAEGNMTSGD
FT                   AHLAVNYPLLLDLGLDGLRERVAARRRRIDLTQLDDLHGEQFLKAVDITLEAVSQHCLR
FT                   FAALARRMVVDEPRAERRSELLTIADGCEHIAHRPPQTFWQALQLCYFIQLLLQIESNG
FT                   HSVSFGRMDQYLYPWYRRDVELEQRLSREQAIELLQSCWLKLLEVNKIRSGTHSKASAG
FT                   SPLYQNVTIGGQNLVDGTPQDAVNPLSYAILESCGRLRSTQPNLSVRYHAGISDDFLEA
FT                   CTQVIRCGFGMPAFNNDEIVIPAFIDLGVAPQDAYQYAAIGCIETAVAGKWGYRCTGMS
FT                   FINVARVMLAALEGGRDATSGDVFLPQPQALSLGNFADFEQVMAAWERQIRYYTRKSIE
FT                   IEYVVDTALEENAHDILCSALVDDCIERAKSIKQGGAKYDWVSGLQVGIANLGNSLAAV
FT                   KKLVFEQGSISQQDLADALAQDFNGPQYELLRQRLLNGAPKYGNDDDSVDALLVRAYDS
FT                   YIDELSHYRNPRHGRGPVGGGYYAGTSSISANVPFGAATLATPDGRKAHTPLAEGASPA
FT                   SGTDRIGPTAVMGSVGKLPTRAILGGVLLNQKLNPATLENERDRQKLMLLLRTFFEVHK
FT                   GWHIQYNIVSRDTLLDAKAHPERYRDLVVRVAGYSAFFTALSPDTQDDIIARTEHVL"
FT   gene            complement(496281..497180)
FT                   /locus_tag="ETAE_0451"
FT   CDS_pept        complement(496281..497180)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAE_0451"
FT                   /product="putative pyruvate-formate lyase-activating
FT                   enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83298"
FT                   /db_xref="GOA:D0ZBC0"
FT                   /db_xref="InterPro:IPR001989"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR012839"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR034457"
FT                   /db_xref="InterPro:IPR040074"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZBC0"
FT                   /protein_id="ACY83298.1"
FT                   /translation="MIFNIQRYSTHDGPGIRTVIFLKGCSLACRWCQNPESLTRTPQLL
FT                   YDERSCLTGCSLCQQAAPAVAIRTGQGLTLLRQRADADTLERLRDCCPSQALTVCGEAL
FT                   AVEEILRQAERDRPFYQRSGGGITLSGGEPFMQPTLAETLLRRCHQSGIHTAVETCLHV
FT                   PWRYIAPALPYTDLFLADLKHVDEARFREWTGGSARRVMDNLTRLAAAGATLILRVPLI
FT                   PGFNANLDDIRRIVDFAAVALTVREIHFLPYHTLGRNKYRLLGQPYLAPAQPLNDPALL
FT                   DAARDYACQRGLSVILGG"
FT   gene            497324..497986
FT                   /gene="mipB"
FT                   /locus_tag="ETAE_0452"
FT   CDS_pept        497324..497986
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mipB"
FT                   /locus_tag="ETAE_0452"
FT                   /product="fructose-6-phosphate aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83299"
FT                   /db_xref="GOA:D0ZBC1"
FT                   /db_xref="InterPro:IPR001585"
FT                   /db_xref="InterPro:IPR004731"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018225"
FT                   /db_xref="InterPro:IPR033919"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZBC1"
FT                   /protein_id="ACY83299.1"
FT                   /translation="MELYLDTADCAAVQRLARILPLAGVTTNPSILARSGLSPAQALPR
FT                   LYDALGGHGRLFAQVMANDAQGMVSEARALRAIVDNLVVKVPVTSEGLAAIKLLKQEGI
FT                   PTLGTAVYGAGQGLLAALAGADYIAPYVNRLDAQGGDGIKTVEALQRLLTLHAPQASVL
FT                   AASFKNARQALDCLLAGCGAITLPIEVAEQFISAPAVTAAVAQFEQDWQDAFGRRTL"
FT   gene            complement(498216..498291)
FT                   /locus_tag="ETAE_t018"
FT   tRNA            complement(498216..498291)
FT                   /locus_tag="ETAE_t018"
FT                   /product="tRNA-Met"
FT   gene            498427..498939
FT                   /gene="mug"
FT                   /locus_tag="ETAE_0453"
FT   CDS_pept        498427..498939
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mug"
FT                   /locus_tag="ETAE_0453"
FT                   /product="G:T/U mismatch-specific DNA glycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83300"
FT                   /db_xref="GOA:D0ZBC2"
FT                   /db_xref="InterPro:IPR005122"
FT                   /db_xref="InterPro:IPR015637"
FT                   /db_xref="InterPro:IPR023502"
FT                   /db_xref="InterPro:IPR036895"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZBC2"
FT                   /protein_id="ACY83300.1"
FT                   /translation="MSVDILAPGLRVVFCGINPGLSSAHTGYHFANPRNRFWSVIHLAG
FT                   FTDRQLAPQEERHLLDTGCGITALVQRPTVTAAELTAAELRAGGDALQAKIARYQPRAL
FT                   AVLGKQAFTQAFGIRRPAWGRQALRIGDTMLWVLPNPSGLNRATLAALVESYRALYLAL
FT                   TPQERGA"
FT   gene            complement(499042..500877)
FT                   /gene="rpoD"
FT                   /locus_tag="ETAE_0454"
FT   CDS_pept        complement(499042..500877)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoD"
FT                   /locus_tag="ETAE_0454"
FT                   /product="DNA-directed RNA polymerase, sigma subunit
FT                   (sigma70/sigma32)"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83301"
FT                   /db_xref="GOA:D0ZBC3"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007127"
FT                   /db_xref="InterPro:IPR007624"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR007631"
FT                   /db_xref="InterPro:IPR009042"
FT                   /db_xref="InterPro:IPR012760"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR028630"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR042189"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZBC3"
FT                   /protein_id="ACY83301.1"
FT                   /translation="MEQNPQSQLKLLVTKGKEQGYLTYAEVNDHLPEDIVDSDQIEDII
FT                   QMINDMGIQVMEEAPDADDLMLAENIADEDAAEAAVQVLSSVESEIGRTTDPVRMYMRE
FT                   MGTVELLTREGEIDIAKRIEDGINQVQCSVAEYPEAITYLLEQYDRVEASEARLSDLIT
FT                   GFVDPNAEEDMAPTATHVGSELPEEELDDDEDEDEDEDDDSDDDNSIDPELARQKFVEL
FT                   REQYEKTRLAIKAEGRSSGKAQEEIQNLSEIFKQFRLVPKQFDYLVSNMREMMDRVRGQ
FT                   ERLIMKLCVEQSKMPKKNFITLFTGNETSITWFDAALAMGKPWGEKLKDMREDVERSLQ
FT                   KLHQIEEETGLTIEQVKDINRRMSIGEAKARRAKKEMVEANLRLVISIAKKYTNRGLQF
FT                   LDLIQEGNIGLMKAVDKFEYRRGYKFSTYATWWIRQAITRSIADQARTIRIPVHMIETI
FT                   NKLNRISRQMLQEMGREPTPEELAERMMMPEDKIRKVLKIAKEPISMETPIGDDEDSHL
FT                   GDFIEDTTLELPLDSATSESLRSATRDVLAGLTAREAKVLRMRFGIDMNTDHTLEEVGK
FT                   QFDVTRERIRQIEAKALRKLRHPSRSEVLRSFLDD"
FT   gene            complement(501113..502861)
FT                   /gene="dnaG"
FT                   /locus_tag="ETAE_0455"
FT   CDS_pept        complement(501113..502861)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaG"
FT                   /locus_tag="ETAE_0455"
FT                   /product="DNA primase"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83302"
FT                   /db_xref="GOA:D0ZBC4"
FT                   /db_xref="InterPro:IPR002694"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR006295"
FT                   /db_xref="InterPro:IPR013173"
FT                   /db_xref="InterPro:IPR013264"
FT                   /db_xref="InterPro:IPR016136"
FT                   /db_xref="InterPro:IPR019475"
FT                   /db_xref="InterPro:IPR030846"
FT                   /db_xref="InterPro:IPR034151"
FT                   /db_xref="InterPro:IPR036977"
FT                   /db_xref="InterPro:IPR037068"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZBC4"
FT                   /protein_id="ACY83302.1"
FT                   /translation="MAGRIPRVFINDLLARTDIVELVDARVKLKKQGKNYHACCPFHSE
FT                   KTPSFTVNADKQFYHCFGCGAHGNAIDFLMNYDRLEFVESIEELATMAGLEVPYESGSG
FT                   PSQMERHQRQNLYQLMDSLCGYYQQSLRQPGATQAQQYLTGRGMSQAIMDRFAIGYAPQ
FT                   GWDNALKRFGRDAGGRTALNDAGMLVNNENGRSYDRFRDRIMIPIRDKRGRVIAFGGRV
FT                   LGNGTPKYLNSPETEIFHKGRQLFGLYEALQHAAQPERLLVVEGYMDVIALAQYGVNYA
FT                   VASLGTSTTAEHIQLLFRHTDSVVCCYDGDNAGREAAWRALETALPYLSDGRQLKFMFL
FT                   PEGEDPDTLIRQEGAEAFERRMNDAHPLSAFLFDSLLPQVDLSTPDGRAKLSALALPLI
FT                   GQVPGETLRLYLRQSLGQKLGILDDSQLEKLLPRRSEAVKNYQPPRLKPTTMRILIALL
FT                   VQNPALAAEVPTLDGLRQHPLPGLPLFIELVETCLAQPGLTTGQLLELYRDNKYASQLE
FT                   TLATWNHMIIEPMVLETFVDTLGSLYDAVLEQRLEQLIARARTDGLTPAEREEVRSLNE
FT                   ALAKKN"
FT   gene            complement(503049..503264)
FT                   /gene="rpsU"
FT                   /locus_tag="ETAE_0456"
FT   CDS_pept        complement(503049..503264)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsU"
FT                   /locus_tag="ETAE_0456"
FT                   /product="30S ribosomal protein S21"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83303"
FT                   /db_xref="GOA:D0ZBC5"
FT                   /db_xref="InterPro:IPR001911"
FT                   /db_xref="InterPro:IPR018278"
FT                   /db_xref="InterPro:IPR038380"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZBC5"
FT                   /protein_id="ACY83303.1"
FT                   /translation="MPVIKVRENEPFDVALRRFKRSCEKAGILAEVRRREFYEKPTTER
FT                   KRAKASAVKRHAKKLARENARRTRLY"
FT   gene            503478..504503
FT                   /gene="gcp"
FT                   /locus_tag="ETAE_0457"
FT   CDS_pept        503478..504503
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gcp"
FT                   /locus_tag="ETAE_0457"
FT                   /product="O-sialoglycoprotein endopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83304"
FT                   /db_xref="GOA:D0ZBC6"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR017860"
FT                   /db_xref="InterPro:IPR017861"
FT                   /db_xref="InterPro:IPR022450"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZBC6"
FT                   /protein_id="ACY83304.1"
FT                   /translation="MRILGIETSCDETGIAIYDDEKGILANQLYSQIKLHADYGGVVPE
FT                   LASRDHVRKTVPLIQAALREADLTPADLDGVAYTAGPGLVGALLVGATVGRSLAFAWGV
FT                   PAVPVHHMEGHLLAPMLEENPPAFPFVALLVSGGHTQLISVTGIGEYRLLGESIDDAAG
FT                   EAFDKTAKLLGLDYPGGPVLSKMAQQGVAGRFVFPRPMTDRPGLDLSFSGLKTFAANTI
FT                   HANGDDAQTRADIARAFEDAVVDTLAIKCRRALDQTGFTRLVMAGGVSANRALRARLAQ
FT                   MMQQRGGAVFYARPEFCTDNGAMIAYAGMVRLKSGVDADLSISVRPRWPLAELPPVAAD
FT                   R"
FT   gene            complement(504525..505187)
FT                   /locus_tag="ETAE_0458"
FT   CDS_pept        complement(504525..505187)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAE_0458"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83305"
FT                   /db_xref="GOA:D0ZBC7"
FT                   /db_xref="InterPro:IPR003811"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZBC7"
FT                   /protein_id="ACY83305.1"
FT                   /translation="MSATALGMIIFAYLCGSISSAILVCKAAGLPDPRENGSGNPGATN
FT                   VLRIGGRLAAAAVLIFDVLKGMIPVWLAYKLEVSPFYLGLTAIAACLGHIYPVFFRFRG
FT                   GKGVATAFGAIAPIGWDLTGLMVGTWLLTVLLSGYSSLGAIVSALIAPFYVWWFKPQFT
FT                   FPVAMLSCLILVRHHDNIQRLWRGKEGKIWKKKGAKGAQDSERQATPPRDDEPPTPR"
FT   gene            505366..505731
FT                   /gene="folB"
FT                   /locus_tag="ETAE_0459"
FT   CDS_pept        505366..505731
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folB"
FT                   /locus_tag="ETAE_0459"
FT                   /product="bifunctional dihydroneopterin
FT                   aldolase/dihydroneopterin triphosphate 2-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83306"
FT                   /db_xref="GOA:D0ZBC8"
FT                   /db_xref="InterPro:IPR006156"
FT                   /db_xref="InterPro:IPR006157"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZBC8"
FT                   /protein_id="ACY83306.1"
FT                   /translation="MDIVFIEGLTVVTTIGVFEWEQTIRQRLVFDVELGWDNRRAAQSD
FT                   DVAHCLSYAEVSEAILQHVEPNRFALVERVAEEVAALLMARFNTPWVRLRVSKPGAVAQ
FT                   AHSVGVVIERGCRTADV"
FT   gene            505780..506598
FT                   /gene="uppP"
FT                   /locus_tag="ETAE_0460"
FT   CDS_pept        505780..506598
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="uppP"
FT                   /locus_tag="ETAE_0460"
FT                   /product="undecaprenyl pyrophosphate phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83307"
FT                   /db_xref="GOA:D0ZBC9"
FT                   /db_xref="InterPro:IPR003824"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZBC9"
FT                   /protein_id="ACY83307.1"
FT                   /translation="MDLHTLLNAFILGVVEGLTEFLPVSSTGHMIIVGHWLGFEGDKAK
FT                   TFEVIIQLGSILAVVVMFWRRLFGLIGIHFGRPVAREGCGQGQLKLGHIVLAMIPAVVL
FT                   GLLFHDFIKSLFTPLTVAYALVVGGLLLLAAEWLKPTQARAVGLDDITYRQAFMIGCFQ
FT                   CLALWPGFSRSGATISGGMLMGVSRYAASEFSFLLAVPMMMGASALELYKSLPYLSLGD
FT                   LPMFSVGFVTAFVVALIAIKTFLNVIKRISFVPFAIYRFIVAAAVYLVFC"
FT   gene            complement(506633..507877)
FT                   /gene="cca"
FT                   /locus_tag="ETAE_0461"
FT   CDS_pept        complement(506633..507877)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cca"
FT                   /locus_tag="ETAE_0461"
FT                   /product="tRNA nucleotidyltransferase/poly(A) polymerase"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83308"
FT                   /db_xref="GOA:D0ZBD0"
FT                   /db_xref="InterPro:IPR002646"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR012006"
FT                   /db_xref="InterPro:IPR032828"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZBD0"
FT                   /protein_id="ACY83308.1"
FT                   /translation="MKTYLVGGAVRDKYLQLPTQDRDWVVVGATPQALLAQGYQQVGKD
FT                   FPVFLHPRSKEEYALARTERKAGQGYTGFSTYFAPDVTLEQDLLRRDLTINAMAEDDEG
FT                   QLIDPYGGLQDLRQRQLRHVSEAFVEDPLRVLRVARFAARFAPLGFQVAAPTLALMQRM
FT                   SQRGELAHLTPERVWLETEKALSGPAPQVYFQVLRDCGALAVLFPEIDRLFGVPAPAQW
FT                   HPEIDTGIHTLLTLAMASHLSDDVAVRFAALTHDVGKGLTNPNFWPHHHGHGPAGVRLV
FT                   REMCQRLRTPNPVRDLALLVAEYHDLIHTVERLRPATLLKLLDTIDVWRRPQRLQHMIL
FT                   CSEADARGRTGLEEQPYPQADYLRAAYHQVAQVAVREVIADGFQGAAIREELQTRRLQV
FT                   LKRWKAAQEAALNAE"
FT   gene            complement(507999..508616)
FT                   /locus_tag="ETAE_0462"
FT   CDS_pept        complement(507999..508616)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAE_0462"
FT                   /product="putative signal transduction protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83309"
FT                   /db_xref="GOA:D0ZBD1"
FT                   /db_xref="InterPro:IPR003646"
FT                   /db_xref="InterPro:IPR016476"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZBD1"
FT                   /protein_id="ACY83309.1"
FT                   /translation="MHLFRRLLLPLLSLCLAFQSHAEEQRFISDALSTYVHSGPGNQYR
FT                   IVGTINAGDPVTLLGINQQSQFAQIRDAKGRSVWLPLDQLSNQPSLRTRVPALEAQLSA
FT                   LTAKLSHIDGEWQQKTAEMQSKVAGSDDAIARLQAENQQLRQQLSSAQKSLGALNSQLD
FT                   DKKRAIILQWFLYGGGVAGAGLLLGLLLPRLLPRRQKARWMN"
FT   gene            complement(508826..510091)
FT                   /locus_tag="ETAE_0463"
FT   CDS_pept        complement(508826..510091)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAE_0463"
FT                   /product="putative phosphate/sulphate permease"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83310"
FT                   /db_xref="GOA:D0ZBD2"
FT                   /db_xref="InterPro:IPR001204"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZBD2"
FT                   /protein_id="ACY83310.1"
FT                   /translation="MEIIANHGSLLIIVAAFFGLLMAIGIGANDVANAMGTSVGARAVT
FT                   IRQAIVIAMIFEFAGAYLAGGEVTQTIRSGIIDTSAFAGHPQTLVFGMMASLLAAGIWL
FT                   IVASLMGWPVSTTHSIIGAIIGFACVSVGPEAVEWGGVKGIVGSWIITPLISGVVAYGI
FT                   FLSAQRLIFNTENPFANARRFGPVYMFLTALVISLVTIKKGLKHVGLHLTDGETWLVSL
FT                   LVSLLVMLGGYLYLSRKSFTDDADEQDHFRGVERVFSLLMVITACAMAFAHGSNDVANA
FT                   IGPLSAIVAIVRDPSVLAGTSPIVWWILPLGGIGIVVGLALMGRRVMETVGTGITDLTP
FT                   SRGFAAQFATASTVVIASGTGLPISTTQTLVGAVLGVGFARGIAALNLNVVRNIVASWI
FT                   VTLPAGAALSIALFYLLQAVFG"
FT   gene            complement(510114..510794)
FT                   /locus_tag="ETAE_0464"
FT   CDS_pept        complement(510114..510794)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAE_0464"
FT                   /product="putative phosphate transport regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83311"
FT                   /db_xref="InterPro:IPR002727"
FT                   /db_xref="InterPro:IPR018445"
FT                   /db_xref="InterPro:IPR038078"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZBD3"
FT                   /protein_id="ACY83311.1"
FT                   /translation="MPVNTILGLFAKSPLKPLQEHASRVHECCSLLVPFFAATAQQQWD
FT                   QAQEIREQISNLEKQADTLKREIRLKLPRGLFLPVDRGDMLELVTQQDRLANRAKDIAG
FT                   RVIGRRLQIPAVMQADFVSYLQRCLDATALSSKVIHEMDELLETGFRGREADLVEQMVM
FT                   ELDHIEDDTDHQQILLRQTLLSLEHQLNPVDIMFLYQIIEWVGGLADKALRVGSRLELM
FT                   LARS"
FT   gene            complement(510837..511097)
FT                   /locus_tag="ETAE_0465"
FT   CDS_pept        complement(510837..511097)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAE_0465"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83312"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZBD4"
FT                   /protein_id="ACY83312.1"
FT                   /translation="MATQSLARRLIIDIAQCLGGRMLKRPTGQARGQCVYSGREGDEFQ
FT                   FNFHGHFFCHIKVLPRCSALLGKKCKNGVQCRAHQLPCAPF"
FT   gene            511086..512249
FT                   /locus_tag="ETAE_0466"
FT   CDS_pept        511086..512249
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAE_0466"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83313"
FT                   /db_xref="GOA:D0ZBD5"
FT                   /db_xref="InterPro:IPR007899"
FT                   /db_xref="InterPro:IPR023577"
FT                   /db_xref="InterPro:IPR033469"
FT                   /db_xref="InterPro:IPR039013"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZBD5"
FT                   /protein_id="ACY83313.1"
FT                   /translation="MRRHDMGLRIRGCDGAYEMTLKTAGSDVGGLHQRPEYNVALDAPQ
FT                   LDLRRFPAQAWPEGCDVDALQTALQPLFSTDFQRERWEVTYRESQIEVALDRGDIRAAG
FT                   ESEGLHEIELELLRGERDDLFAFAEQLLTLEGIRMGAMSKAARGYRLAAGNAALRRRAF
FT                   PLLRPAARASVEQGMSAALAQILAHWQYHEEAWLRGDAASRGGIQEALTALRQSLTLFG
FT                   GIVPRKASATLRAGLSALEEQIQQPTCVAQTLCYGRESLTTQWALTRWLAESGWRAYLD
FT                   AAGSAKLSGSFKRFADIMLGRCGAELKALFAQVRHPQEYQDKLPRLQHQILAIRLLGGA
FT                   YGEAAVEDYLAPWQTLAQAIVHPAAVTAEAACAQALHQPAFWRNGAH"
FT   gene            512329..515166
FT                   /gene="glnE"
FT                   /locus_tag="ETAE_0467"
FT   CDS_pept        512329..515166
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glnE"
FT                   /locus_tag="ETAE_0467"
FT                   /product="glutamine synthetase adenylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83314"
FT                   /db_xref="GOA:D0ZBD6"
FT                   /db_xref="InterPro:IPR005190"
FT                   /db_xref="InterPro:IPR013546"
FT                   /db_xref="InterPro:IPR023057"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZBD6"
FT                   /protein_id="ACY83314.1"
FT                   /translation="MSETRALPALLHSQGARQAARLRDATSAALPALALSDFVADSLAA
FT                   YPAWWQQLQQLPPQVQEWQQYAGWLAERLAQVQDESTLMQALRLFRRHMLTRIAWMQAR
FT                   AQADCQQTLLQLSALAETLVIGARDWLYHRACQEWGVPCNAAGEAQPLLILGMGKLGGG
FT                   ELNFSSDIDLIFVYPQSGATRGGRRELDNAQFFTRLGQRLIKALDQPTEDGFVYRVDMR
FT                   LRPFGDSGPLVLSFSALEDYYQEQGRDWERYAMVKARLLGEGQDRYGQELYRLLRPFVF
FT                   RRYIDFSVIQSLRNMKGMIAREVRRRGLKENIKLGAGGIREIEFITQVFQLIRGGRERS
FT                   LQQRALLPALAAIGELGLLTAAQVAALRDAYLFLRRLENLLQAIDDQQTQTLPSDDLNR
FT                   ARLAYGMGLADWAALSRALQEHMAAVRAIFNALIGDDDQDEEERGDDAALRFAPLWQER
FT                   LDESELAALMPQLDPAQRLRLQQTLEAFHRDVDKRTIGPRGREVLATLMPTLLAQVCVR
FT                   DDALVLQQRLMPLLLNIVTRTTYLELLMEFPAALHQLIRLCAASPMLAEQLARYPLLLD
FT                   ELLDPVTLYRPVDQGAYRDELRQYLLRIPDDEEQRLEALRQFKHAQQLRIAASDIAGAL
FT                   PVMKVSDHLTYLAEAVIEAVVQQAWEQMVARYGQPTHLVDHGQRGFAVIGYGKLGGWEL
FT                   GYGSDLDLVFLLDCPAEVMTDGPRCIDGRQFYLRLAQRIMHLFSARTASGILYEVDARL
FT                   RPSGAAGMLVSTLTAFGDYQRSEAWTWEHQALVRARPVYGDVQMHRQFDAIRREILCRE
FT                   RDAATLRCEVAEMREKMRTHQGSRDAAQFDIKADRGGIVDIEFIAQYLVLRYGAEQPDL
FT                   TRWSDNVRIFELMAQYAVMPQAEADALTHAYVTLRNTLHHLALQAQPGVVESTRFADAR
FT                   ARVCESWQRWLGTAR"
FT   gene            complement(515177..516106)
FT                   /gene="htrB"
FT                   /locus_tag="ETAE_0468"
FT   CDS_pept        complement(515177..516106)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="htrB"
FT                   /locus_tag="ETAE_0468"
FT                   /product="lipid A biosynthesis lauroyl acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83315"
FT                   /db_xref="GOA:D0ZBD7"
FT                   /db_xref="InterPro:IPR004960"
FT                   /db_xref="InterPro:IPR011920"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZBD7"
FT                   /protein_id="ACY83315.1"
FT                   /translation="MSDNHVYPQFQRSMLHPRYWLTWLGIGIFYLVMLLPYPWLYRLGK
FT                   MLGKTAMRFMKKRVEVTRRNLALCFPQMPAAQREAWVRQNFESVGMALVETGMAWFWPD
FT                   WRIRRWCRVEGEENLRQAKQTGKGILLIGMHFLTLELGARIFGMHNPGVGVYRPNDNPV
FT                   LDWLQTWGRLRSNKYMLDRRDVKGMIRALKEGEIVWYAPDHDYGPRSSVFVPLFAVAQA
FT                   ATTTGTYILARMGQPTLLPFIPLRNADGSGYTLRIQPMLQDVPLDDQTTTAAYMNRVVE
FT                   REIMLAPTQYMWLHRRFKTCPPGVASRY"
FT   gene            516213..517646
FT                   /gene="hldE"
FT                   /locus_tag="ETAE_0469"
FT   CDS_pept        516213..517646
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hldE"
FT                   /locus_tag="ETAE_0469"
FT                   /product="fused heptose 7-phosphate kinase/heptose
FT                   1-phosphate adenyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83316"
FT                   /db_xref="GOA:D0ZBD8"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR011913"
FT                   /db_xref="InterPro:IPR011914"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR023030"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZBD8"
FT                   /protein_id="ACY83316.1"
FT                   /translation="MKVTLPDFRRAQVLVVGDVMLDRYWYGPTSRISPEAPVPVVKVET
FT                   IEERPGGAANVAMNIASLGANARLVGLTGVDDAARALSARLDEVHVECDFVAIPTQPTI
FT                   TKLRVLSRNQQLIRLDFEEGFGGVDPEPILARIRQALPQLGAMILSDYAKGALASVQAM
FT                   IRLARDAGVPVLIDPKGTDFERYRGATLLTPNLSEFEAVVGRCHSEQEIVDRGLALMDR
FT                   FDLTALLVTRSEQGMTLLQRGIAPLHMPTQAQEVYDVTGAGDTVIGMLATSIAAGTSLE
FT                   EACFLANAAAGVVVGKLGTSTVSPIELENAIRGRADTGFGVMTQEELKTAVLQARQRGE
FT                   KVVMTNGVFDILHAGHVSYLANARRLGDRLIVAVNSDASTRRLKGPERPVNPLTQRMLV
FT                   LAALESVDWVIPFEEDTPQRIIAEILPDLLVKGGDYRPEEIAGGKEVIAAGGDVRVLNF
FT                   EDGCSTTNIINTIRQGQND"
FT   gene            517708..518925
FT                   /locus_tag="ETAE_0470"
FT   CDS_pept        517708..518925
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAE_0470"
FT                   /product="putative amino acid transporter"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83317"
FT                   /db_xref="GOA:D0ZBD9"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZBD9"
FT                   /protein_id="ACY83317.1"
FT                   /translation="MQGVGMLSTSLLGTGVFAVPALAAQVAGDDSLWAWPLLIVLVFPI
FT                   AIGFAALGRHFPSAGGAAHFVGKAFGPHMARVTGWLFLSVIPVGLPASLQIAAGFWQAL
FT                   FGWQGAPLLAVELITLLAVWLLGTRGAGSSANLQTLIALLVVLLIAAVWWRGGISPTQI
FT                   PWPVPSQLSLSPLTGALAVMFWCFVGLEAFAHLASEFRHPQRDFPRALLLGLLLAGAVY
FT                   WACSVAVLHFHAFGDGRAAAASLPGIVVQLFGRHALWIACVIGYLACFASLNVYIQSFA
FT                   RLVWSQAQRRPQSRLAQLSARQAPVNALTSVMLCCLLCSLLIYLSGLSLDALIVYANGV
FT                   FIMIYLLCMLAGCRLLRGHARLMALTGSVLCLLLLAMVGVKSLYALGMLLVLYLLLPRR
FT                   AASHGG"
FT   gene            complement(518946..519212)
FT                   /locus_tag="ETAE_0471"
FT   CDS_pept        complement(518946..519212)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAE_0471"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83318"
FT                   /db_xref="InterPro:IPR007475"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZBE0"
FT                   /protein_id="ACY83318.1"
FT                   /translation="MIDPKKIEQIARQVHQSMPKGLREFGDDMEKRVRQILQQQLSRLD
FT                   LVNREDFEIQTQVLLRTREKLALLEQRVAALEARLNDAEDGQA"
FT   gene            519569..520357
FT                   /gene="ribB"
FT                   /locus_tag="ETAE_0472"
FT   CDS_pept        519569..520357
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ribB"
FT                   /locus_tag="ETAE_0472"
FT                   /product="3,4-dihydroxy-2-butanone 4-phosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83319"
FT                   /db_xref="GOA:D0ZBE1"
FT                   /db_xref="InterPro:IPR000422"
FT                   /db_xref="InterPro:IPR017945"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZBE1"
FT                   /protein_id="ACY83319.1"
FT                   /translation="MGESNDICRDSPARVILAAPLRVPLLKFALVLVIHTIIDEVFTMN
FT                   QILLSDFGTPMERVERALSALRDGRGVMVLDDENRENEGDMIFAAEKMTVEQMALTIRH
FT                   GSGIVCLCITEARRQQLDLPMMVSNNTSHYGTAFTVTIEAAEGVTTGVSAQDRLTTVRA
FT                   AIADGAKPSDLHRPGHVFPLRARPGGVLARRGHTEATIDLVSLAGFRPAGVLCELTNDD
FT                   GTMARAPQVMAFARQHGMPVVTIEDLVAYRQAHEPQEQAC"
FT   gene            complement(520424..521191)
FT                   /locus_tag="ETAE_0473"
FT   CDS_pept        complement(520424..521191)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAE_0473"
FT                   /product="putative divalent heavy-metal cations
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83320"
FT                   /db_xref="GOA:D0ZBE2"
FT                   /db_xref="InterPro:IPR003689"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZBE2"
FT                   /protein_id="ACY83320.1"
FT                   /translation="MSIPLLLTLLAGGATAVGALLAIIGQRPSNRVLAFSLGFAAGIML
FT                   LISLMEMLPAALNTPKMPPLLGYAMFILGLVGYFLLDRLLPHQHAHDMVPLGNRTPRSL
FT                   KRTALLLTLGISLHNFPEGIATYVTASADLELGMGIALAVAIHNIPEGLAVAGPVYAAS
FT                   GSRLRALWWASLSGVAEILGGLLAFTLLGPTVSPVGMAAIMALVAGIMVALSVDELMPL
FT                   AREIDPHSNPSRGVLCGMTVMGLSLALLQATPL"
FT   gene            521409..522194
FT                   /locus_tag="ETAE_0474"
FT   CDS_pept        521409..522194
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAE_0474"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83321"
FT                   /db_xref="GOA:D0ZBE3"
FT                   /db_xref="InterPro:IPR004183"
FT                   /db_xref="InterPro:IPR014436"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZBE3"
FT                   /protein_id="ACY83321.1"
FT                   /translation="MSEATMPALFLAHGSPMNAIEDNPFSALWQRLGRELPRPKAIVVI
FT                   SAHWCTQGLWATAMAQPRTLHDFGGFPPALSALRYPAPGSPALARELQSLLAPQYTLSL
FT                   DEGGWGLDHGAWSLLVHLYPQADIPVIQLSLDPRQPAAYHYQLGQALAPLRQRGVLMLG
FT                   SGNVVHNLRTLRWEAEAEPYPWARRFEDVVRQGLRERGEDAALLRFADNPDATLANPTP
FT                   EHFLPLLPVLGCWDGAEPLRVFEQGIVMGSLSMLSLQVG"
FT   gene            complement(522372..522458)
FT                   /locus_tag="ETAE_t019"
FT   tRNA            complement(522372..522458)
FT                   /locus_tag="ETAE_t019"
FT                   /product="tRNA-Leu"
FT   gene            complement(522492..522578)
FT                   /locus_tag="ETAE_t020"
FT   tRNA            complement(522492..522578)
FT                   /locus_tag="ETAE_t020"
FT                   /product="tRNA-Leu"
FT   gene            complement(522614..522700)
FT                   /locus_tag="ETAE_t021"
FT   tRNA            complement(522614..522700)
FT                   /locus_tag="ETAE_t021"
FT                   /product="tRNA-Leu"
FT   gene            complement(522877..524013)
FT                   /gene="rsmC2"
FT                   /locus_tag="ETAE_0475"
FT   CDS_pept        complement(522877..524013)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rsmC2"
FT                   /locus_tag="ETAE_0475"
FT                   /product="16S RNA G1207 methylase RsmC"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83322"
FT                   /db_xref="GOA:D0ZBE4"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR007848"
FT                   /db_xref="InterPro:IPR013675"
FT                   /db_xref="InterPro:IPR023543"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZBE4"
FT                   /protein_id="ACY83322.1"
FT                   /translation="MQRIATAAMNGAFQNAGESSIITGQPIEEFCAMSAFTPASEVVLR
FT                   HGEEFEPRRVLFAGDLQDTLPAQFNAVEVRAHTTQYHHWQALHPAMGERCLFSLTITAE
FT                   FAAGIDTLIYFWPKSKPEALFQLTQLLSQLPVGCDVFIVGENRAGVRSAEELASDMLTL
FT                   NKIDSARRCGLYHGQLAQPPRFDLNDWWMSYDTGSLRIATLPGVFSRDGLDIGSHLLLS
FT                   SLPHGLKGNVLDVGCGAGVLSAAIARMSPETRLTLSDVNAAALTASRQTLAQNAIDGEV
FT                   LASNVFSDISGRFDLIISNPPFHDGVQTSLLAAQTLIRGAVSHLQLGGELRIVANAFLP
FT                   YPQVLDAVFGRHEVVAQTGKFKVYSAILDRAALEHSRR"
FT   gene            524113..524523
FT                   /gene="holD"
FT                   /locus_tag="ETAE_0476"
FT   CDS_pept        524113..524523
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="holD"
FT                   /locus_tag="ETAE_0476"
FT                   /product="DNA polymerase III, psi subunit"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83323"
FT                   /db_xref="GOA:D0ZBE5"
FT                   /db_xref="InterPro:IPR004615"
FT                   /db_xref="InterPro:IPR036654"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZBE5"
FT                   /protein_id="ACY83323.1"
FT                   /translation="MTSRRDQLLQQLGITQWVLRRPALLRGEVAITLSAQTRLLIVSEA
FT                   PLSPDDLLLCDILRALSLTAEQAVILTPEQYEMLSDRQRYLCWWLGESASSEACLRSPA
FT                   LGALYHNPGAKRALWQQICHEQHHFFPDPGGH"
FT   gene            524483..524929
FT                   /gene="rimI"
FT                   /locus_tag="ETAE_0477"
FT   CDS_pept        524483..524929
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rimI"
FT                   /locus_tag="ETAE_0477"
FT                   /product="acetylation of N-terminal alanine"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83324"
FT                   /db_xref="GOA:D0ZBE6"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR006464"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZBE6"
FT                   /protein_id="ACY83324.1"
FT                   /translation="MSNIISSLTPADTDAAYAVECASHAFPWTHSTFLSNQGERYYNLK
FT                   LESQGQLAAFAITQVVLDEATLFNVAVAPAYQRQGLGRTLLLRLIDDLTERGVVTLWLE
FT                   VRDSNRAAIALYHALGFNEVSLRRNYYPTADGREDARIMALPLG"
FT   gene            complement(525004..525126)
FT                   /locus_tag="ETAE_0478"
FT   CDS_pept        complement(525004..525126)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAE_0478"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83325"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZBE7"
FT                   /protein_id="ACY83325.1"
FT                   /translation="MIFYSVLSCPARERAQTAAIGGQHRRKWVISALFSLIYSG"
FT   gene            525125..526714
FT                   /gene="prfC"
FT                   /locus_tag="ETAE_0479"
FT   CDS_pept        525125..526714
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prfC"
FT                   /locus_tag="ETAE_0479"
FT                   /product="peptide chain release factor RF-3"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83326"
FT                   /db_xref="GOA:D0ZBE8"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004548"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR032090"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR038467"
FT                   /db_xref="InterPro:IPR041732"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZBE8"
FT                   /protein_id="ACY83326.1"
FT                   /translation="MSPSEYAREVAKRRTFAIISHPDAGKTTITEKVLLFGQAIQVAGT
FT                   VKGRGSSQHAKSDWMEMEKQRGISITTSVMQFPYHDSLVNLLDTPGHEDFSEDTYRTLT
FT                   AVDCCLMVIDAAKGVEDRTRKLMEVTRLRDTPILTFMNKLDRDIRDPMELLDEVESELR
FT                   IACAPITWPIGCGKLFKGVYHLYKDETYLYQSGKGHTIQEVRVIKGLDNPQLDAAVGED
FT                   LAVQLREELELVQGASTEFEEEAFLNGQLTPVFFGTALGNFGVDHMLDGLVAWAPAPMP
FT                   RMTDVRKVSADEEKFSGFVFKIQANMDPKHRDRVAFMRVVSGRYDKGMKLRQVRTGKDV
FT                   VIADALTFMAGDRAHVEEAYPGDIIGLHNHGTIQIGDTFTQGEEMKFTGIPNFAPELFR
FT                   RIRLRDPLKQKQLLKGLVQLSEEGAVQVFRPVANNDLIVGAVGVLQFDVVVARLKSEYN
FT                   VEAIYESVNVSTARWVECDDAKKFDEFQRKNELHLALDGGDNLAYIAPTMVNLNLTQER
FT                   YPEVRFRKTREH"
FT   gene            526939..527940
FT                   /locus_tag="ETAE_0480"
FT   CDS_pept        526939..527940
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAE_0480"
FT                   /product="putative esterase of the alpha-beta hydrolase
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83327"
FT                   /db_xref="GOA:D0ZBE9"
FT                   /db_xref="InterPro:IPR002641"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="InterPro:IPR037483"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZBE9"
FT                   /protein_id="ACY83327.1"
FT                   /translation="MGYRIPITLGNIEPLAYKPYHPGRIALVCEGGGQRGIFTAGVLDE
FT                   FLRARFNPFDLYLGTSAGAQNLSSFVCGQAGYARRVITRYTTRSEFFNPLRFVRGGHLI
FT                   DLDWLVDCTHREMPLAFDRAERMLGQQRQFYMVASRSDDFSAAYFPAQRDSWLQVIKAS
FT                   SAIPGFYRSGVELDGVVYQDGGIADAVPVREAYRLGADTIVVIRTVPSQMFYTPRWVKR
FT                   MESLLSESSLQQMVRMMQRHEKSYRRTQRFIEQPPGRLRIFEIYPPKPLASHALGSTVA
FT                   SLNTDYHLGRRCARYFLAAVGHWLLPRDLPAHAHGPARLTHQAARQPAGETL"
FT   gene            527937..528728
FT                   /locus_tag="ETAE_0481"
FT   CDS_pept        527937..528728
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAE_0481"
FT                   /product="putative deoxyribonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83328"
FT                   /db_xref="GOA:D0ZBF0"
FT                   /db_xref="InterPro:IPR001130"
FT                   /db_xref="InterPro:IPR018228"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZBF0"
FT                   /protein_id="ACY83328.1"
FT                   /translation="MIAAALIDTHCHFDFAPFCGDEAASLHRARAAGIGDIIVPSIEAS
FT                   RFASVLALAHRYPMLHAALGLHPLYIEHHRDTDIAALDTLLAQADPAVVALGEIGLDHY
FT                   GDVRQPARQLSLLQDQLALAQRYDLPVILHSRRSHDLLAKILRQRRLMRTGVVHGFSGS
FT                   LAQAQAFVRLGYAIGVGGTITYARANKTRAAVAALPLEALLLETDAPDMPLFGYQGAPN
FT                   RPEQLTRVFAALCALRSETPAQIAQALYDNTHRLFHFPPRS"
FT   gene            528999..530249
FT                   /locus_tag="ETAE_0482"
FT   CDS_pept        528999..530249
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAE_0482"
FT                   /product="putative nucleoside transporter"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83329"
FT                   /db_xref="GOA:D0ZBF1"
FT                   /db_xref="InterPro:IPR002668"
FT                   /db_xref="InterPro:IPR008276"
FT                   /db_xref="InterPro:IPR011642"
FT                   /db_xref="InterPro:IPR011657"
FT                   /db_xref="InterPro:IPR018270"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZBF1"
FT                   /protein_id="ACY83329.1"
FT                   /translation="MVTLILLGVLLSNNRRAIRVRTVAGAFAVQVCLGAFVLYVPAGRD
FT                   MLGAMSTGVANVIAYGNQGISFMFGGLVSDKMFELFGGGGFVFALRVLPVIVFFSSLIA
FT                   VLYYLGIMQLVIRVLGGALHKLLGTSRTESLSATANIFVGQTEAPLVVRPYIATMTQSE
FT                   LFAVMCGGLASVAGSVLAGYAQMGVPLEYLIAASFMAAPGGLLFAKLIVPETEQTHDRE
FT                   DATALVAAEDRPANVIDAAASGAASGLQLALNVGAMLLAFIALIALLNGMLGGIGGWFN
FT                   YPQLSMELILGWVFSPLAFLIGVPWNEAQIAGSFIGQKLIVNEFVAYMNFGEYLKADAE
FT                   VAAAGLQVLSGHTKAIISFALCGFANLSSVAILLGGLGSMAPKRRHEIARFGLRAVAAG
FT                   TLSNLMSATIAGFFLAL"
FT   gene            complement(530310..531173)
FT                   /locus_tag="ETAE_0483"
FT   CDS_pept        complement(530310..531173)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAE_0483"
FT                   /product="putative pyruvate-formate lyase-activating
FT                   enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83330"
FT                   /db_xref="GOA:D0ZBF2"
FT                   /db_xref="InterPro:IPR001989"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR012839"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR023912"
FT                   /db_xref="InterPro:IPR034457"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZBF2"
FT                   /protein_id="ACY83330.1"
FT                   /translation="MNNRRALVSKLLPFSCVDGPGSRLVLFLQGCNLRCRSCHNPYTIG
FT                   RCDECAQCVATCPHQALSLQAGKVLWDALACQQCDTCLQGCPRQASPMALSLSVDDVLM
FT                   QLRRQAAFIKGITVSGGEATLQLPFLLALFQAIRRDPGLQALDCLVDSNGELSEPGWTR
FT                   LIPWCDGVMVDLKAWDDERHRWLTGRGNRRILHSIRWLAQRRRLAELRLLVIPQHSDYL
FT                   THIDALAEFILSLGDVPVRLNAFHHHGVYGPASAWQPAAKDDVERLAQALETRGVGAVI
FT                   RPALYL"
FT   gene            complement(531145..532695)
FT                   /locus_tag="ETAE_0484"
FT   CDS_pept        complement(531145..532695)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAE_0484"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83331"
FT                   /db_xref="InterPro:IPR016905"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZBF3"
FT                   /protein_id="ACY83331.1"
FT                   /translation="MPETSANALHSRCMAIACDPHLSALQKRHFLALEAENDLPYPALP
FT                   EAARQALDEGVICDMFEGHAPYKPRYVLPDYARFLANGSEWLELEPAQDFDDALSMLTI
FT                   LYHHVPSVTSMPVFLGHLDQLLLPYVGILTENELYIRIKRFWRYLDRTFPDAFMHANLG
FT                   PSDNILTRLFLRADAELAQVVPNLTFLYHPEITPAERLQQAIENICACSKPHIANAPLH
FT                   DNIFTAGGYGIVSCYNALPLGGGGSTLVRMNLKEVALRSRGEEDFFTRTLPDYCQRQTE
FT                   ILRARSDFLFTRSHFFSQSFLVHEGLIDAQRFVPMFGIFALAEAVDILCQQSGVAARYG
FT                   QDEAANALGYRISAWLDAFVRATPLPHAWQQRALLHAQSGISSDRGTTPGARLPYGSEP
FT                   DPIGHLMAVAPHHAYYPAGISDILTLDPTVKSNPQALMQLCLGAFSAGMREFTANVSGN
FT                   DLVRVTGYMVRLSDLARYEQEGSRLNTTWLAEEAARNTGMLERQARVISHEQQTRFSQ"
FT   gene            532745..532939
FT                   /locus_tag="ETAE_0485"
FT   CDS_pept        532745..532939
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAE_0485"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83332"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZBF4"
FT                   /protein_id="ACY83332.1"
FT                   /translation="MSCNGMKSRRRACGVHRRTAERGQCKAVGCARSHVSIGFDDSYDL
FT                   YVILIIYRDPMLHSDFHLM"
FT   gene            533073..533948
FT                   /gene="deoC"
FT                   /locus_tag="ETAE_0486"
FT   CDS_pept        533073..533948
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="deoC"
FT                   /locus_tag="ETAE_0486"
FT                   /product="deoxyribose-phosphate aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83333"
FT                   /db_xref="GOA:D0ZBF5"
FT                   /db_xref="InterPro:IPR002915"
FT                   /db_xref="InterPro:IPR011343"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR023649"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZBF5"
FT                   /protein_id="ACY83333.1"
FT                   /translation="MWDRFTAQAVKTFVPFFLIEPAWAAFSQLESIMTELQTAAQRALR
FT                   LMDLTTLNDNDTDEKVIALCHQAKSPAGNTAAVCIYPRFIPIARKTLREQGTPDVRIAT
FT                   VTNFPHGNDDIEIALVETRAAIAYGADEVDVVFPYRALMAGNEQVGFDLVKACKETCAA
FT                   ANVLLKVIIETGELKDAALIRKASEISIKAGADFIKTSTGKVPVNATLESAEIMMSVIR
FT                   DMGVAKSVGFKPAGGVRTAEDAAQYLALADRLLGEGWADSRHFRFGASSLLASLLQTLG
FT                   YDAKGTGSSY"
FT   gene            534057..535379
FT                   /gene="deoA"
FT                   /locus_tag="ETAE_0487"
FT   CDS_pept        534057..535379
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="deoA"
FT                   /locus_tag="ETAE_0487"
FT                   /product="thymidine phosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83334"
FT                   /db_xref="GOA:D0ZBF6"
FT                   /db_xref="InterPro:IPR000053"
FT                   /db_xref="InterPro:IPR000312"
FT                   /db_xref="InterPro:IPR013102"
FT                   /db_xref="InterPro:IPR013465"
FT                   /db_xref="InterPro:IPR017459"
FT                   /db_xref="InterPro:IPR017872"
FT                   /db_xref="InterPro:IPR018090"
FT                   /db_xref="InterPro:IPR035902"
FT                   /db_xref="InterPro:IPR036320"
FT                   /db_xref="InterPro:IPR036566"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZBF6"
FT                   /protein_id="ACY83334.1"
FT                   /translation="MFLAQEIIRKKRDGHALSEEEIRFFINGIRDNTISEGQIAALAMT
FT                   IFFHDMAMPERVALTMAMRDSGTVLDWKSLNLNGPIVDKHSTGGVGDVTSLMLGPMVAA
FT                   CGGYVPMISGRGLGHTGGTLDKLESIPGFDIFPDDSRFRSIIADVGVAIIGQTSSLAPA
FT                   DKRFYATRDITATVDSIPLITASILAKKLAEGLDALVMDVKVGSGAFMPTFALSEALAQ
FT                   AIVGVANGAGCRTTALLTDMNQVLASSAGNALEVREAVQFLTGEARNPRLFEVTMALCV
FT                   EMLISGKLAADQTEARNKLQAVLDNGKAAEIFGRMVAAQSGPCDFVERYDHYLPQAVLC
FT                   KPVFAEQAGIITAMDTRALGMSVVGLGGGRRQASDSIDYSVGLTEMVRLGDSVDGQRPL
FT                   AVVHARDEASWQQAAEAVRAAVTLGERAPEPTPVVYRRITQ"
FT   gene            535480..536703
FT                   /gene="deoB"
FT                   /locus_tag="ETAE_0488"
FT   CDS_pept        535480..536703
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="deoB"
FT                   /locus_tag="ETAE_0488"
FT                   /product="phosphopentomutase"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83335"
FT                   /db_xref="GOA:D0ZBF7"
FT                   /db_xref="InterPro:IPR006124"
FT                   /db_xref="InterPro:IPR010045"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR024052"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZBF7"
FT                   /protein_id="ACY83335.1"
FT                   /translation="MKRAFIMVLDSFGIGEAKDAKSFGDEGADTLGHIARACARGEADI
FT                   GRQGPLHLPNLCRLGLGKAALASTGRFPEGLDENAEIIGAYGYANELSSGKDTPSGHWE
FT                   IAGVPVLFDWGYFHEHQNSFPQALLDTLVERANLPGYLGNCHSSGTVILDQLGEEHMKS
FT                   GKPIFYTSADSVFQIACHEETFGLERLYELCEIARDELNKGGYNIGRVIARPFVGDKAG
FT                   HFQRTGNRHDLAVEPPAPTMLKKLVDEKQGEVVSIGKIADIYANVGITKKVKATGIDAL
FT                   FDATLQEMRQAGNDTIVFTNFVDFDSSYGHRRDVAGYAAALELFDRRLPEMLALVKEDD
FT                   ILILTADHGCDPTWHGSDHTREHIPVLVYGPKVKPGSLGERDTFADIGQTVAHYFGLSP
FT                   MAYGKPMF"
FT   gene            536770..537495
FT                   /gene="deoD"
FT                   /locus_tag="ETAE_0489"
FT   CDS_pept        536770..537495
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="deoD"
FT                   /locus_tag="ETAE_0489"
FT                   /product="purine-nucleoside phosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83336"
FT                   /db_xref="GOA:D0ZBF8"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR004402"
FT                   /db_xref="InterPro:IPR018016"
FT                   /db_xref="InterPro:IPR035994"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZBF8"
FT                   /protein_id="ACY83336.1"
FT                   /translation="MATPHINAEMGDFADVVLMPGDPLRAKHIAETFLQDVRQVNNVRG
FT                   MLGFTGTYKGRKISVMGHGMGIPSCSIYAKELITDFGVKKIIRVGSCGAVRMDVKLRDV
FT                   VIGMGACTDSKVNRLRFKDNDFAAIADFDMVRNAADAAKAKGIDVRVGNLFSADLFYSP
FT                   DPTMFDVMEKYGILGVEMEAAGIYGVAAEFGAKALTICTVSDHIRTHEQTTAAERQTTF
FT                   NDMIEIALESVLLGDQEQA"
FT   gene            537668..538054
FT                   /locus_tag="ETAE_0490"
FT   CDS_pept        537668..538054
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAE_0490"
FT                   /product="putative cytochrome"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83337"
FT                   /db_xref="GOA:D0ZBF9"
FT                   /db_xref="InterPro:IPR009155"
FT                   /db_xref="InterPro:IPR010980"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZBF9"
FT                   /protein_id="ACY83337.1"
FT                   /translation="MRKSVLALAGLAMMAGSALAQAASVSEDMDVINQSYRQAQQATTA
FT                   QDFKQALTAMRAAATAAKSEAPSKLQGQASDSADMKDYRHGLDLLIGQIDKAEKLADAG
FT                   QLDQAKTEAQQMLQTRNVYHKKYR"
FT   gene            538079..538570
FT                   /locus_tag="ETAE_0491"
FT   CDS_pept        538079..538570
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAE_0491"
FT                   /product="putative nickel-dependent hydrogenase cytochrome
FT                   b-type subunit"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83338"
FT                   /db_xref="GOA:D0ZBG0"
FT                   /db_xref="InterPro:IPR011577"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZBG0"
FT                   /protein_id="ACY83338.1"
FT                   /translation="MRLTHWSVALGFLCNRLYLTVPGSTPHQLIGLTVAGLVLLRLLWG
FT                   VTGARGAARLSAFIPTPSALIHHLHELRTRTVPQAPHHNPLGAIGIWATWLLLLLIALT
FT                   GWGQGNDLAFRWPLDVWHVWLVDALTLVVCVHIAAVFAMSFWLRRNLIGAMLPGRRGGE
FT                   "
FT   gene            complement(538606..539016)
FT                   /gene="rnk"
FT                   /locus_tag="ETAE_0492"
FT   CDS_pept        complement(538606..539016)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rnk"
FT                   /locus_tag="ETAE_0492"
FT                   /product="nucleoside diphosphate kinase regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83339"
FT                   /db_xref="GOA:D0ZBG1"
FT                   /db_xref="InterPro:IPR001437"
FT                   /db_xref="InterPro:IPR023459"
FT                   /db_xref="InterPro:IPR028625"
FT                   /db_xref="InterPro:IPR029462"
FT                   /db_xref="InterPro:IPR036953"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZBG1"
FT                   /protein_id="ACY83339.1"
FT                   /translation="MSRPAIIINELDAERLDRLLERPAFAAQPVAQALNEELDRAQLLA
FT                   PAAMPADVVTMNSRVRFRDLNTNEEHVRTLVYPHLQDSAEDGLSVMAPIGAALLGLRVG
FT                   DAIRWTLPNGNQTHIEVLALLYQPEAAGELLR"
FT   gene            complement(539186..539458)
FT                   /locus_tag="ETAE_0493"
FT   CDS_pept        complement(539186..539458)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAE_0493"
FT                   /product="putative phosphocarrier protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83340"
FT                   /db_xref="GOA:D0ZBG2"
FT                   /db_xref="InterPro:IPR000032"
FT                   /db_xref="InterPro:IPR001020"
FT                   /db_xref="InterPro:IPR002114"
FT                   /db_xref="InterPro:IPR035895"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZBG2"
FT                   /protein_id="ACY83340.1"
FT                   /translation="MSVTQTVEIKNRLGMHARPAMKLFELVQTFDADVILRNENGIEAE
FT                   ANSVIALLMLDSAQGGQIEIQATGPDERQALDAVVSLFNAGFDEE"
FT   gene            complement(539466..540317)
FT                   /locus_tag="ETAE_0494"
FT   CDS_pept        complement(539466..540317)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAE_0494"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83341"
FT                   /db_xref="GOA:D0ZBG3"
FT                   /db_xref="InterPro:IPR005337"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZBG3"
FT                   /protein_id="ACY83341.1"
FT                   /translation="MVLMIVSGRSGSGKSVALRALEDMGFYCVDNLPVELLPELARTLA
FT                   TRDTSAAVSIDVRNMPESPEVLETAMDHLPESFTPQLLFLDADRNTLIRRYSDTRRLHP
FT                   LSSKNLSLENAIDQENELLEPLRSRADLIIDTSEMSVHELAEMLRARLLGKRERELTMV
FT                   FESFGFKHGIPIDADYVFDVRFLPNPHWDPKLRPMTGLDKPVAAFLDRHTEVHNFIYQT
FT                   RSYLEQWLPALENNNRSYLTVAIGCTGGKHRSVYVAEQLADYFRSRGKNVQSRHRTLEK
FT                   RR"
FT   gene            complement(540426..540872)
FT                   /gene="ptsN"
FT                   /locus_tag="ETAE_0495"
FT   CDS_pept        complement(540426..540872)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ptsN"
FT                   /locus_tag="ETAE_0495"
FT                   /product="sugar-specific enzyme IIA component of PTS"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83342"
FT                   /db_xref="GOA:D0ZBG4"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR006320"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZBG4"
FT                   /protein_id="ACY83342.1"
FT                   /translation="MPLSVVLTPECTRNAVHCASKKRVLEIISELAAAQLNLPTQVVFD
FT                   AILTRERMGSTGIGNGIAIPHGKLEEDTLRAIAVFIHLDQPINFDAIDNQPVDLLFALL
FT                   VPADQCKTHLQTLSLMAQKLSDKGVCRRLRAAQSDEDLYQIITE"
FT   gene            complement(541010..541297)
FT                   /locus_tag="ETAE_0496"
FT   CDS_pept        complement(541010..541297)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAE_0496"
FT                   /product="putative sigma(54) modulation protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83343"
FT                   /db_xref="GOA:D0ZBG5"
FT                   /db_xref="InterPro:IPR003489"
FT                   /db_xref="InterPro:IPR036567"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZBG5"
FT                   /protein_id="ACY83343.1"
FT                   /translation="MQLNITGHHLEITDAIRQFVSEKFAKLEQYFDRINQVNVTLSIEK
FT                   VDHIAEATVFINGGELHASAQQEDMYAAIDILIDKLARQLNKHKDKLKQH"
FT   gene            complement(541319..542776)
FT                   /gene="rpoN"
FT                   /locus_tag="ETAE_0497"
FT   CDS_pept        complement(541319..542776)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoN"
FT                   /locus_tag="ETAE_0497"
FT                   /product="RNA polymerase factor sigma-54"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83344"
FT                   /db_xref="GOA:D0ZBG6"
FT                   /db_xref="InterPro:IPR000394"
FT                   /db_xref="InterPro:IPR007046"
FT                   /db_xref="InterPro:IPR007634"
FT                   /db_xref="InterPro:IPR038709"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZBG6"
FT                   /protein_id="ACY83344.1"
FT                   /translation="MQLRLSQQLAMTPQLQQAIRLLQLSTLELQQEIQQALESNPLLEQ
FT                   LEPNDEADGDSADDERVQDDADARDDDDPLDTRDALEQREMPDELPLDASWDEIYTAGT
FT                   PSGTGTDYHDDELPVFQGETTQTLQDYLMWQVELTPFSETDLAIATAIVDAVDDTGYLT
FT                   ASLEEILESLGDEHALPEEVEAVLKRIQRFDPVGVAARDLRDCLLVQLSQFAPDTPYLN
FT                   EARSIVDRHLDLLGNHDFRNLMRSTKLKEEVLKEAMQLIQSLDPRPGLSINTGESDYVI
FT                   PDVLVHKHQGRWVVELNQDSVPRLHINQRYAALGAQARSDSDSQFIRSNLQEAKWLIKS
FT                   LESRNDTLLKVSRCIVEQQQAFFEHGAESMKPMVLADIAQQVEMHESTISRVTTQKFLH
FT                   SPRGIFELKYFFSSHVNTEDGGEASSTAIRALVKKLIAAENPAKPLSDSKLTTLLADQG
FT                   IMVARRTVAKYRESLSIPPSNQRKQLV"
FT   gene            complement(542913..543638)
FT                   /locus_tag="ETAE_0498"
FT   CDS_pept        complement(542913..543638)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAE_0498"
FT                   /product="putative ABC transporter-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83345"
FT                   /db_xref="GOA:D0ZBG7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030921"
FT                   /db_xref="InterPro:IPR032823"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZBG7"
FT                   /protein_id="ACY83345.1"
FT                   /translation="MARLIAENLAKSYKGRRVVENVSLTVNSGEIVGLLGPNGAGKTTT
FT                   FYMVVGIVPRDAGRIIIDDDDISLLPLHARARRGIGYLPQEASIFRRLSVYDNLMAVLE
FT                   IRDDLNAEQRADRADELLEEFHIAHLRDNLGQSLSGGERRRVEIARALAANPKFILLDE
FT                   PFAGVDPISVIDIKKIIEHLRDRGLGVLITDHNVRETLDVCERAYIVSQGNLIAYGSPD
FT                   EILADEQVKRVYLGEEFRL"
FT   gene            complement(543645..544202)
FT                   /locus_tag="ETAE_0499"
FT   CDS_pept        complement(543645..544202)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAE_0499"
FT                   /product="putative lipopolysaccharide ABC transporter,
FT                   periplasmic lipopolysaccharide-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83346"
FT                   /db_xref="GOA:D0ZBG8"
FT                   /db_xref="InterPro:IPR005653"
FT                   /db_xref="InterPro:IPR014340"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZBG8"
FT                   /protein_id="ACY83346.1"
FT                   /translation="MKFKASTLKLRDLILAGALLSASASALAVTGDTDQPIHINSMQQS
FT                   LDMQGNVATFTGDVIVTQGTIKITADKVVVTRPNGQQGSEIVEAYGNPVTFYQMQDNGK
FT                   PVEGHSQQLRYELAKDYVILTGKAFLKQLDSNIEGDRITYLVKQQQMEAFSDKGKRVTT
FT                   VLLPSQLQDKGNAKPAPQKKSN"
FT   gene            complement(544177..544728)
FT                   /locus_tag="ETAE_0500"
FT   CDS_pept        complement(544177..544728)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAE_0500"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83347"
FT                   /db_xref="GOA:D0ZBG9"
FT                   /db_xref="InterPro:IPR010664"
FT                   /db_xref="InterPro:IPR026265"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZBG9"
FT                   /protein_id="ACY83347.1"
FT                   /translation="MIILLTLIALALIGWNLADNSPDGAPTTLDPNTPNYQSQHTLTVV
FT                   YDPSGKLSYKLVAQDVQHYSEQGVTWFTRPVLTTFDPQAAATWSVRADKAKLTNDNMLY
FT                   LYGNVEVNSLTPTSQLERITTDNAQVNLVTQDISSDDEVTLYGSNFTSHGLKMRGNMRD
FT                   KTARLIDKVNTYYEIQSKHP"
FT   gene            complement(544746..545312)
FT                   /gene="yrbI"
FT                   /locus_tag="ETAE_0501"
FT   CDS_pept        complement(544746..545312)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yrbI"
FT                   /locus_tag="ETAE_0501"
FT                   /product="3-deoxy-D-manno-octulosonate 8-phosphate
FT                   phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83348"
FT                   /db_xref="GOA:D0ZBH0"
FT                   /db_xref="InterPro:IPR010023"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZBH0"
FT                   /protein_id="ACY83348.1"
FT                   /translation="MQQNTSPIATCYGPVSADVMARAAQIRLLICDVDGVLSDGLIYMG
FT                   NQGEELKAFNVRDGYGIRCLVTQGIDVAIITGRSSQLVADRAATLGIRHLYQGQSDKLI
FT                   AFERILADLQLAPHQAAYIGDDLIDWPVMARVGLSVAVADAHPLLLPNAHYTTRIAGGR
FT                   GAVRELCDIILQAQGNLDQAKGLSI"
FT   gene            complement(545328..546314)
FT                   /gene="yrbH"
FT                   /locus_tag="ETAE_0502"
FT   CDS_pept        complement(545328..546314)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yrbH"
FT                   /locus_tag="ETAE_0502"
FT                   /product="D-arabinose 5-phosphate isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83349"
FT                   /db_xref="GOA:D0ZBU8"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR004800"
FT                   /db_xref="InterPro:IPR035474"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZBU8"
FT                   /protein_id="ACY83349.1"
FT                   /translation="MSHMEFQPDFDFQQAGKDVLRIEREGLAQLDHFINQDFSRACEAM
FT                   LRCSGKVVVMGMGKSGHIGRKIAATLASTGTSAFFVHPGEASHGDLGMVEPRDVVLAIS
FT                   NSGESQEIQALIPVLKRQSVTLICMTNNPDSAMGRAADIHLCIRVPQEACPLGLAPTTS
FT                   TTATLVMGDALAVALLQARGFTAEDFALSHPGGALGRKLLLRVSDIMHSGDEVPTVSPT
FT                   ASLRDALLEITRKNLGLTVICGPDAHIDGIFTDGDLRRIFDMGIDLNNAKIADVMTRGG
FT                   IRIRPTALAVDALNLMQDRHITSLLVAENDRLIGVVHMHDMLRAGVV"
FT   gene            complement(546369..547358)
FT                   /gene="yrbG"
FT                   /locus_tag="ETAE_0503"
FT   CDS_pept        complement(546369..547358)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yrbG"
FT                   /locus_tag="ETAE_0503"
FT                   /product="putative calcium/sodium:proton antiporter"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83350"
FT                   /db_xref="GOA:D0ZBU9"
FT                   /db_xref="InterPro:IPR004481"
FT                   /db_xref="InterPro:IPR004837"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZBU9"
FT                   /protein_id="ACY83350.1"
FT                   /translation="MLLATLLMLIGLLLLVYGADRVVYGAAAVAHALGVAPLVIGMTIV
FT                   SMGTSLPELTVSLTATLHNQIDTAVGNVLGSNITNILLILGCAALIRPLSVRSDILRRE
FT                   LPLTLGATILCGFLLYDNQLNRIDGAILMTFFGAFLWLMLKMAHRVMPGGQDSYAREQI
FT                   AELPRDTGLPVALLWMALGFIILPLASRMVIDNATVLARYLGVSELIIGLTVIAVGTSL
FT                   PELATACAGAIKGEHDIVLGNIIGSNTFNILVVLGIPALIGPRNPLIDGAAFARDYWVM
FT                   LAFTLVLTLLCLRRRHSIGRLAGALLLCAFIAYIGLLYTQPSLMLYWD"
FT   gene            547639..548469
FT                   /gene="yrbF"
FT                   /locus_tag="ETAE_0504"
FT   CDS_pept        547639..548469
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yrbF"
FT                   /locus_tag="ETAE_0504"
FT                   /product="putative ABC transporter ATP-binding protein
FT                   YrbF"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83351"
FT                   /db_xref="GOA:D0ZBV0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030296"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZBV0"
FT                   /protein_id="ACY83351.1"
FT                   /translation="MNHQENNLVDIRGMSFSRGNRQIFTDINLTVPRGKVTAIMGPSGI
FT                   GKTTLLRLIGGQLRPDRGEIWFDGENIPALSRGRLFEARKKMSMLFQSGALFTDLSVFD
FT                   NVAFPLREHTRLPESLLRTTVLMKLEAVGLRGAADLMPSELSGGMARRAALARAIALDP
FT                   QMILFDEPFVGQDPITMGVLVKLIDELNHALGITCVVVSHDVPEVLSIADHAYIVAEQR
FT                   VIAHGDRQALRANQDPRVRQFLDGIADGPVPFRYPAGDYRHALLASGEGSSHVA"
FT   gene            548459..549241
FT                   /gene="yrbE"
FT                   /locus_tag="ETAE_0505"
FT   CDS_pept        548459..549241
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yrbE"
FT                   /locus_tag="ETAE_0505"
FT                   /product="putative transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83352"
FT                   /db_xref="GOA:D0ZBV1"
FT                   /db_xref="InterPro:IPR003453"
FT                   /db_xref="InterPro:IPR030802"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZBV1"
FT                   /protein_id="ACY83352.1"
FT                   /translation="MLLNGLAAFGRRGIRVCAAFGRAGLMLFSALVGRPEPGKQWPLLR
FT                   RQLYSVGVQSLLIIIVSGLFIGMVLGLQGYLVLTTYSAEASLGMMVALSLLRELGPVVT
FT                   ALLFAGRAGSALTAEIGLMKATEQLSSLEMMAVDPLRRVVAPRFWAGVISMPLLTVIFV
FT                   AVGIWGGSVVGVDWKGIDAGFFWSAMQGAVDYRTDLLNCLIKSLVFAITVMWIALFNGY
FT                   DAVPTSAGISRATTRTVVHASLAVLGLDFVLTALMFGN"
FT   gene            549246..549779
FT                   /locus_tag="ETAE_0506"
FT   CDS_pept        549246..549779
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAE_0506"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83353"
FT                   /db_xref="GOA:D0ZBV2"
FT                   /db_xref="InterPro:IPR003399"
FT                   /db_xref="InterPro:IPR030970"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZBV2"
FT                   /protein_id="ACY83353.1"
FT                   /translation="MQTKKAEVWVGLFMLIALCAAVFLCLQVANVKSLGSEPTYRLYAT
FT                   FDNVGGLKARSPVKIGGVVIGRVAEISLDPQTYLPRVAMDIDQRYNHIPDTSSLAIRTS
FT                   GLLGEQYLALNVGFEDPEMGTAILKDGGTIQDTKSAIVLEDLIGQFLYKSGGENGNASA
FT                   STAPAGNTPAPVAH"
FT   gene            549800..550450
FT                   /locus_tag="ETAE_0507"
FT   CDS_pept        549800..550450
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAE_0507"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83354"
FT                   /db_xref="InterPro:IPR008869"
FT                   /db_xref="InterPro:IPR042245"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZBV3"
FT                   /protein_id="ACY83354.1"
FT                   /translation="MLKRIVMAALLCVAPWFSAQASAAPTLDQSNPYTLMNQAAAATFS
FT                   RLKSEQPRIKQDPDYLRTIVREELMPYVQVKYAGALVLGQYYRGATPAQRDAYFKAFQS
FT                   YLEQVYGQALALYHGQRYEVAAERPLGDATIVTIRVTIFDNQGRPPVRLDFQWRKNTQT
FT                   GHWQAFDMIAEGVSMITTKQNEWAAILREKGVDGLTQQLIVAAKQPITLDTKQ"
FT   gene            550447..550761
FT                   /locus_tag="ETAE_0508"
FT   CDS_pept        550447..550761
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAE_0508"
FT                   /product="putative anti-sigma B factor antagonist"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83355"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZBV4"
FT                   /protein_id="ACY83355.1"
FT                   /translation="MTARGELRWRRVDATLYLQGALECDSLDALWQQRQTLLTDITCVD
FT                   ISELSRVDSAGLALLLHVQNLRPETPIPLRGVSERLRTLITLYNLQDIVVCAAPSANLA
FT                   "
FT   gene            550902..551156
FT                   /locus_tag="ETAE_0509"
FT   CDS_pept        550902..551156
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAE_0509"
FT                   /product="conserved hypothetical protein, BolA superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83356"
FT                   /db_xref="InterPro:IPR002634"
FT                   /db_xref="InterPro:IPR036065"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZBV5"
FT                   /protein_id="ACY83356.1"
FT                   /translation="MNNDQIKDVLMKALALQEVHVTGDGSHFQVIVVGELFAGMSRVKQ
FT                   QQAVYAPLMEYIADNRIHALTIKAYTPDEWQRDRKLSGL"
FT   gene            551220..552476
FT                   /gene="murA"
FT                   /locus_tag="ETAE_0510"
FT   CDS_pept        551220..552476
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murA"
FT                   /locus_tag="ETAE_0510"
FT                   /product="UDP-N-acetylglucosamine enolpyruvyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83357"
FT                   /db_xref="GOA:D0ZBV6"
FT                   /db_xref="InterPro:IPR001986"
FT                   /db_xref="InterPro:IPR005750"
FT                   /db_xref="InterPro:IPR013792"
FT                   /db_xref="InterPro:IPR036968"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZBV6"
FT                   /protein_id="ACY83357.1"
FT                   /translation="MDKFRLQGPTRLDGEVTISGAKNAALPILFAALLAEEPVEIQNVP
FT                   KLRDIDTTMKLLSQLGAKVERNGSVHVDASGVNELCAPYELVKTMRASIWALGPLVARF
FT                   GRGQVSLPGGCAIGARPVDLHISGLEQLGAEIRLEEGYVKASVQGRLQGAHIVMDKVSV
FT                   GATVTIMSAATLAQGTTVIENAAREPEIVDTAGFLNTLGAKISGAGTDRITIEGVERLG
FT                   GGVYRVLPDRIETGTFLVAAAVSRGRVVCRHTRPDTLDAVLAKLREAGADIEVGEDWIS
FT                   LDMHGQRPKAVTVRTAPHPGFPTDMQAQFSLLNLVAEGTGVITETIFENRFMHIPELIR
FT                   MGAHAEIEGNTAICHGVETLSGAQVMATDLRASASLVIAGCIAQGTTLVDRIYHIDRGY
FT                   ERIEDKLSAMGARIERVGE"
FT   gene            complement(552839..553900)
FT                   /gene="degS"
FT                   /locus_tag="ETAE_0511"
FT   CDS_pept        complement(552839..553900)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="degS"
FT                   /locus_tag="ETAE_0511"
FT                   /product="serine endoprotease"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83358"
FT                   /db_xref="GOA:D0ZBV7"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR001940"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR011783"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZBV7"
FT                   /protein_id="ACY83358.1"
FT                   /translation="MLVKLLRSTLLGLAVAIVLMIALPSLRPHGLMPLFSEASFEEQPV
FT                   SYNAAVRRAAPAVVNVYNGSMSGSNSGLAIKTLGSGVIMDEKGYILTNKHVVSAADQIV
FT                   VALQDGRWFEAMLVGSDTLTDLAVLKIQASNLPVITINPKRVPHIGDVVLAIGNPYNIG
FT                   QTTTQGIISATGRVGLSTYGHQNFLQTDASINHGNSGGALVNSLGELVGINTLSLDKSN
FT                   DGETPEGIGFAIPTALATKIMNKLIRDGRVIRGFIGIGGREIVPVRNQPASAERIQGII
FT                   VNSVAANGPAALAGIHPGDIVLNVNGKPAISATETMDQVAEIRPGSEVPVIIMRNGERL
FT                   KLNVTIAEFPNVD"
FT   gene            complement(553992..555287)
FT                   /gene="degQ"
FT                   /locus_tag="ETAE_0512"
FT   CDS_pept        complement(553992..555287)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="degQ"
FT                   /locus_tag="ETAE_0512"
FT                   /product="trypsin-like serine protease"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83359"
FT                   /db_xref="GOA:D0ZBV8"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR001940"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR011782"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZBV8"
FT                   /protein_id="ACY83359.1"
FT                   /translation="MTRRSLPLLLALSLSLGALPTAQASLPATLNGQALPSLAPMLAKV
FT                   LPAVVSVYVEGKQTPRHRRMEGLGSGVIINADKGYVLTNNHVIRDAQSIRVQLEDGREY
FT                   SARLIGRDAASDIALLQLIDARHLTAIPLADSDKLRVGDFAVAVGNPFGLGQTATAGIV
FT                   SALGRSGLNLEGPENFIQTDAAINSGNSGGALVNLKGELIGINTAILAPAGGNIGIGFA
FT                   IPSNMARSLSDQLIKYGEVKRGVLGIRGRDMTADLANAFKLDSPRGTFVNEVLPKSAAA
FT                   RAGIRAGDVLISLNGTPITSFAELRAKVGSVAPGTALQIGLLRNGKPMNVTVTLENHAL
FT                   ASVQGETLTPALAGASLSPGEAQGAPGIRIDTVEKGSPAAQIGLHKADLIIGVNRLRTR
FT                   DITALRRALAGDPPVIALHLIRGGEGMYLLLR"
FT   gene            complement(555443..555835)
FT                   /gene="yhcB"
FT                   /locus_tag="ETAE_0513"
FT   CDS_pept        complement(555443..555835)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yhcB"
FT                   /locus_tag="ETAE_0513"
FT                   /product="cytochrome d ubiquinol oxidase subunit III"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83360"
FT                   /db_xref="GOA:D0ZBV9"
FT                   /db_xref="InterPro:IPR009386"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZBV9"
FT                   /protein_id="ACY83360.1"
FT                   /translation="MTWEYALIGLVVGIIIGALAMRFGNRKLRQQKTLQDELEKSKTDL
FT                   DQYRQELVNHFARSAELLDNMAKDYRQLYQHMATSSNNLLPDMPAHDNPFRYRLTEADN
FT                   DQAPVEIPPRDYSEGASGLLRADRHD"
FT   gene            556033..557166
FT                   /locus_tag="ETAE_0514"
FT   CDS_pept        556033..557166
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAE_0514"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83361"
FT                   /db_xref="GOA:D0ZBW0"
FT                   /db_xref="InterPro:IPR005654"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030870"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZBW0"
FT                   /protein_id="ACY83361.1"
FT                   /translation="MSSPYALTPDTPLARYRAALAAGDYQPDAAQQRAVEALDEIHRQW
FT                   AVRWHTAGPAAWRTRLPHWLGGRRTAEPIVGLYLWGGVGRGKTWLMDLFFDTLPGQRKQ
FT                   RLHFHRFMLWVHESLADKQGQADPLSALADALKAQADVLCFDEFFVTDIGDAMLLGTLL
FT                   PALFTRGVTLVATSNIPPAQLYPNGLQRSRFLPAIAQIQTHCQVLNVDGGTDYRLRTLT
FT                   QAHLYLTPLGARTEQAMEALFLRLAGQTGQIGGTLAINHRQMPVLRRAEAVVALHFSAL
FT                   CEAPCSSRDYIALAQRYHTVLLHGVSAMGADREACARRFLALVDEFYERRVTLIISATC
FT                   DMFGLYRGERLAFEYQRCLSRLQEMQSEAYLSLPHRP"
FT   gene            557423..557851
FT                   /gene="rplM"
FT                   /locus_tag="ETAE_0515"
FT   CDS_pept        557423..557851
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplM"
FT                   /locus_tag="ETAE_0515"
FT                   /product="50S ribosomal protein L13"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83362"
FT                   /db_xref="GOA:D0ZBW1"
FT                   /db_xref="InterPro:IPR005822"
FT                   /db_xref="InterPro:IPR005823"
FT                   /db_xref="InterPro:IPR023563"
FT                   /db_xref="InterPro:IPR036899"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZBW1"
FT                   /protein_id="ACY83362.1"
FT                   /translation="MKTFTAKPETVKRDWYVVDATGKTLGRLATELARRLRGKHKAEYT
FT                   PHVDTGDYIIVLNAEKVAVTGNKRLDKKYFHHTGHIGGIKEATFEEMIARRPERVIEIA
FT                   VKGMLPKGPLGRAMFRKLKVYAGNEHNHAAQQPQVLDI"
FT   gene            557866..558258
FT                   /gene="rpsI"
FT                   /locus_tag="ETAE_0516"
FT   CDS_pept        557866..558258
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsI"
FT                   /locus_tag="ETAE_0516"
FT                   /product="30S ribosomal protein S9"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83363"
FT                   /db_xref="GOA:D0ZBW2"
FT                   /db_xref="InterPro:IPR000754"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020574"
FT                   /db_xref="InterPro:IPR023035"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZBW2"
FT                   /protein_id="ACY83363.1"
FT                   /translation="MAENQYYGTGRRKSSAARVFIKPGSGKIVINQRSLEQYFGRETAR
FT                   MVVRQPLELVDMVEKLDLYITVKGGGISGQAGAIRHGITRALMEYDETLRSELRKAGFV
FT                   TRDARQVERKKVGLRKARRRPQFSKR"
FT   gene            558594..559235
FT                   /gene="sspA"
FT                   /locus_tag="ETAE_0517"
FT   CDS_pept        558594..559235
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sspA"
FT                   /locus_tag="ETAE_0517"
FT                   /product="stringent starvation protein A"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83364"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR004046"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR034341"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="InterPro:IPR040079"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZBW3"
FT                   /protein_id="ACY83364.1"
FT                   /translation="MAVAANKRSVMTLFSGPTDIFSHQVRIVLAEKGVSVEIEQVDMDN
FT                   LPQDLIDLNPYRTVPTLVDRELTLYESRIIMEYLDERFPHPPLMPVYPVARGESRLFMH
FT                   QIERDWYSLLYKIEKGSAQEADAARKQLREELLAIAPVFAQKPYFMSDEFSLVDCYLAP
FT                   LLWRLPVLGIELSGAGAKELKGYMTRVFERDAFLASLTEAEREMRLHTRG"
FT   gene            559238..559729
FT                   /gene="sspB"
FT                   /locus_tag="ETAE_0518"
FT   CDS_pept        559238..559729
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sspB"
FT                   /locus_tag="ETAE_0518"
FT                   /product="ClpXP protease specificity-enhancing factor"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83365"
FT                   /db_xref="GOA:D0ZBW4"
FT                   /db_xref="InterPro:IPR007481"
FT                   /db_xref="InterPro:IPR036760"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZBW4"
FT                   /protein_id="ACY83365.1"
FT                   /translation="MELSQMSPRRPFLLRAFYDWLLDNQLTPHLVVDVHCADVMVPMEY
FT                   ARDGQIVLNIAPRAVGGLELADDAVRFNARFGGVPRQVYVPMAAVMAIYARENGAGTMF
FT                   EPEAAYEQDGDETRAETESDEPAMTLIDGDRSPDNEAPADDDGGDEPPPRGRPALRVVK
FT                   "
FT   gene            complement(559948..560424)
FT                   /locus_tag="ETAE_0519"
FT   CDS_pept        complement(559948..560424)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAE_0519"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83366"
FT                   /db_xref="InterPro:IPR004375"
FT                   /db_xref="InterPro:IPR037012"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZBW5"
FT                   /protein_id="ACY83366.1"
FT                   /translation="MILGHIDDLAQRGDLPTPIRRALQRALEAGAAQLENGTHPIDGER
FT                   LYMNVMTLTPQRAEEKQGEIHRDYLDIQLVLEGEERIDFTLAGQARECQPYQQEGDYQL
FT                   CAAMAQPQRLIMTPGMFAVFLPGEPHKPGCISRTSDPIRKVVVKLHRDCLKEEK"
FT   gene            complement(560421..561296)
FT                   /locus_tag="ETAE_0520"
FT   CDS_pept        complement(560421..561296)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAE_0520"
FT                   /product="putative N-acetylmannosamine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83367"
FT                   /db_xref="GOA:D0ZBW6"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="InterPro:IPR023945"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZBW6"
FT                   /protein_id="ACY83367.1"
FT                   /translation="MNTLAIDLGGTKLAAALVDVDGQLSQRVEAATPASGDPEALTQAL
FT                   AQLITRYRGMADRVAVASTGIIHQGILSALNPDNLGGLNRFPLQECIERLSALPCHLLN
FT                   DAQAAAWAEYLALTPSGQDMAFITVSTGVGGGLVLNGRLQIGRGAFAGHIGHTLADPAG
FT                   PRCGCGRSGCVESIASGRAIAAAAQDDLVGLDARAIFQRAAAGDAQAQRLIARSAQAIA
FT                   QLIADLRATLDIQCAVIGGSVGLAPGYLDQVQHFLRQMPHAYHATLYSARHQRDAGLIG
FT                   AALWSRRETA"
FT   gene            complement(561277..561984)
FT                   /gene="yhcJ"
FT                   /locus_tag="ETAE_0521"
FT   CDS_pept        complement(561277..561984)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yhcJ"
FT                   /locus_tag="ETAE_0521"
FT                   /product="N-acetylmannosamine-6-phosphate 2-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83368"
FT                   /db_xref="GOA:D0ZBW7"
FT                   /db_xref="InterPro:IPR007260"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZBW7"
FT                   /protein_id="ACY83368.1"
FT                   /translation="MSVFTTLQQHIQRNGALIVSCQPVPDSPMDSPEIVAAMAAAAAQA
FT                   GAAALRIEGVANLQAVRPRVTLPIIGIIKRDLDDSPVRITPFLRDVDDLVQAGADIIAF
FT                   DGTLRPRPEQREALLARIQHHGRLAMADCSSLEDGLYCQHLGCDFIGTTLSGYTNGETP
FT                   CEPDLALVHALSSAGCRVIAEGRYNTPAQAAQALSQGAWAVTVGSAITRIEHICQWYCQ
FT                   ALQAEAHHEYAGH"
FT   gene            complement(562150..562851)
FT                   /gene="dsbB1"
FT                   /locus_tag="ETAE_0522"
FT   CDS_pept        complement(562150..562851)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dsbB1"
FT                   /locus_tag="ETAE_0522"
FT                   /product="disulfide bond formation protein DsbB"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83369"
FT                   /db_xref="GOA:D0ZBW8"
FT                   /db_xref="InterPro:IPR003752"
FT                   /db_xref="InterPro:IPR023380"
FT                   /db_xref="InterPro:IPR023792"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZBW8"
FT                   /protein_id="ACY83369.1"
FT                   /translation="MFAKMWSDLRQNPVETLVRWQEQRFLWLLMALAMGGLIVLAHAFF
FT                   QIYLYMAPCEQCVYIRFAMFVMVIGGLVAAINPRNLALKLFGCIAAFYGAIIGMGYSIK
FT                   LNGIHHAVHSPDALFGVQGCSTDPSFPFGLPLAEWAPSWFKPTGDCGYDAPMVPQGVAL
FT                   DSVQQWFIDMYVQAEGWYLIPSMQFMNMAQACFLAFALCFAILVIMSVAWAIHLLRRRA
FT                   MPADPTASTPR"
FT   gene            complement(562868..563539)
FT                   /gene="dsbA1"
FT                   /locus_tag="ETAE_0523"
FT   CDS_pept        complement(562868..563539)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dsbA1"
FT                   /locus_tag="ETAE_0523"
FT                   /product="disulfide isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83370"
FT                   /db_xref="GOA:D0ZBW9"
FT                   /db_xref="InterPro:IPR001853"
FT                   /db_xref="InterPro:IPR023205"
FT                   /db_xref="InterPro:IPR028588"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZBW9"
FT                   /protein_id="ACY83370.1"
FT                   /translation="MHLTLGKTHLKALLGATLLTCAFGAAAFSEGTDYVVLEKPIPNAQ
FT                   KTLIKVFSYDCPFCYKYDKAVTGPVSDKVKDIVRFEPYHLDTKGVYGPQGSEILAVLLN
FT                   KDRAAGVSIFDDASQFKKAKFAYYAAYHDKKERWKDGKDPAAFTQTGLDAAGLSQADLE
FT                   GGLKDPAVQKTLGEWKASAYDVAKIQGVPAYVVNGKYLIMTKSIKSVDSMADLVKELAA
FT                   K"
FT   gene            complement(563603..565438)
FT                   /gene="assT"
FT                   /locus_tag="ETAE_0524"
FT   CDS_pept        complement(563603..565438)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="assT"
FT                   /locus_tag="ETAE_0524"
FT                   /product="arylsulfate sulfotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0524"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83371"
FT                   /db_xref="GOA:D0ZBX0"
FT                   /db_xref="InterPro:IPR010262"
FT                   /db_xref="InterPro:IPR028610"
FT                   /db_xref="InterPro:IPR035391"
FT                   /db_xref="InterPro:IPR038477"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZBX0"
FT                   /protein_id="ACY83371.1"
FT                   /translation="MIKMDLLQSQENTMLSTTRKTLVAGAIAFAIGAVSPAVHAAGMPA
FT                   APAVGNLGAVVVDPYGNSPLTALINLNGHAISDVNVTVQGKGKNGVAVSYPVGKQSLLT
FT                   YDGIPIFGLYQKHDNQVTVEYKEGGKLKKDAYTIRTSAIVNKYMDNRSLTDLQPVKPVK
FT                   VAKGFEDRLYLVNTHTFTPQGSDLHWSGEKDKNAGLLDASPATGSLPFDIAPFTFIVDT
FT                   QGEYRWWLNQDTLYNGHDVDINQRGYLMGIRETPRGTFTAVQGQHWYEFDMMGQVLNNH
FT                   RLPRGYLDATHESIEIPNGNVMLRVGKRNYLRDDGQRVHTIRDHILEVDKAGRVVDVWD
FT                   LNLILDPLRDSLLGALDAGAVCVNVDLDHAGKQAKLEPDTPFGDALGVGPGRNWAHVNS
FT                   IAYDPKDDSIILSSRHQGVIKIGRDKQVKWILAPAEGWNEKLSAKLLKPVDAQNKPLNC
FT                   SAKGVCENSDFDFSYTQHTAWLSPKGTLTVFDNGDGRHLEQPALPTMKYSRIVEYKIDE
FT                   KNMTVQQLWEYGKDRGYEWYNPITSIVEYQPDRDTMFSFGGSTNLFEPGQPTTGRLNEI
FT                   DYKTKEVKVELDVLSDKANQTHYRAALIRPQGLFL"
FT   gene            565795..566796
FT                   /locus_tag="ETAE_0525"
FT   CDS_pept        565795..566796
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAE_0525"
FT                   /product="putative transcriptional regulator LysR-like
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83372"
FT                   /db_xref="GOA:D0ZBX1"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037402"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZBX1"
FT                   /protein_id="ACY83372.1"
FT                   /translation="MRKVDNVAVDSELLALFRALAETGSLTQAAGRVGLSQAAASRALS
FT                   KLRAVFQDQLFVKGGYGMQATPRARELMPRVTAVLQALDHLTMPYEFDPQALRRTLYLG
FT                   AVDNGVWMIFSRVVKSLFQQAPNARIEILPIGDDLFSSLKFGRMDLAIYPLIDIPPDFH
FT                   EANLFKTTFSCLVRQGHPLARQMLRGETPTLAQINAYRRLQVSLHDGQPGATVGNAVHR
FT                   QGKDYDVAMSVPYFLAAPMLLSQTDFVLTLPTQTARHFSQMANLAILPYPDGETTFYTR
FT                   LIWHHRVHHDPVIQWLRTLFLRFASEEAALESARDNADAAGCRVGAERYTQR"
FT   gene            complement(566781..568199)
FT                   /gene="gltD"
FT                   /locus_tag="ETAE_0526"
FT   CDS_pept        complement(566781..568199)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gltD"
FT                   /locus_tag="ETAE_0526"
FT                   /product="glutamate synthase subunit beta"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83373"
FT                   /db_xref="GOA:D0ZBX2"
FT                   /db_xref="InterPro:IPR006006"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR028261"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZBX2"
FT                   /protein_id="ACY83373.1"
FT                   /translation="MSQNVYQFIDLQRIDPPKKPLKQRQGEFIEIYEPFSDGQAQAQAD
FT                   RCLSCGNPYCEWRCPLHNYIPNWLKLANEGRIWDAATLSHQTNSLPEVCGRVCPQDRLC
FT                   EGACTLHDEFGAVTIGSVERYITDKALAEGWMPDLSGVQPTGKRVAIVGAGPAGLACAD
FT                   VLARSGVQAELFDRHPEIGGLLTFGIPAFKLEKQVMVRRREIFSAMGIRFHLNTEIGRD
FT                   ITLESLLSQFDAVFLGVGTYQALPGGLEQEEASGVHSALPYLIATARHLMGYAEDPQTP
FT                   YVSMHGKRVVVLGGGDTAMDCVRSALRQGATQVTCAYRRDEGNMPGSRREVKNAREEGA
FT                   AFRFNLQPLAIETNAAGRVCGVRMAQTTLTDPDAAGRRAVRLVPDAEVTLAADAVILAF
FT                   GFRPHAMTWLAEHGVDLDAQGRIVAADHGDYPHQTSNPQIFAGGDAVRGSDLVVTAIAE
FT                   GRRAAQGILNYLCV"
FT   gene            complement(568215..572672)
FT                   /gene="gltB"
FT                   /locus_tag="ETAE_0527"
FT   CDS_pept        complement(568215..572672)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gltB"
FT                   /locus_tag="ETAE_0527"
FT                   /product="glutamate synthase subunit alpha"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83374"
FT                   /db_xref="GOA:D0ZBX3"
FT                   /db_xref="InterPro:IPR002489"
FT                   /db_xref="InterPro:IPR002932"
FT                   /db_xref="InterPro:IPR006982"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR036485"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZBX3"
FT                   /protein_id="ACY83374.1"
FT                   /translation="MLYDASHERDNCGFGLIAHIEGEPSHKVVRTAIHALARMQHRGAI
FT                   LADGKTGDGCGLLLQKPDRFLRMVAEERGWRLAKNYAVGMLFLSRDEERASAARRIVEE
FT                   ELQNETLSIVGWRDVPVNQEVLGEIALSSMPHIAQIFINAPAGWRPRDLERRLFIARRR
FT                   IEKRIDDPDFYVCSLSNLVTIYKGLCMPADLPRFYHDLADLRMESAICLFHQRFSTNTV
FT                   PRWPLAQPFRYLAHNGEINTITGNRQWARARTYKFKTPLIPDLQDAAPFVNETGSDSSS
FT                   LDNMLELLLSGGMDIVRAMRLLVPPAWQNNPDMDPDLRAFFDFNSMHMEPWDGPAGIVM
FT                   SDGRFAACNLDRNGLRPARYVITKDRLITCASEVGIWDYQPDEVVEKGRVGPGELMVID
FT                   TRAGQILHSRETDDDLKSRHPYREWMEKNVRRLIPFEDLPDERVGSRTLDDAALLTYQK
FT                   QFAYSQEEIDQILRVLGENGQEATGSMGDDTPFAVLSSRPRLIYDYFRQQFAQVTNPPI
FT                   DPLREAHVMSLSTSIGREMNVFCEAEGQAHRLNFKSPVLLYSDFAQLIGQEKEHYRAET
FT                   LDITFDPEQQDLQQALAALCDEAEAQVRRGAVLLVLSDRAISARRLPIPAPMAVGAVQR
FT                   RLVEQSLRCDANIIVETAGARDPHHFAVLLGFGATAIYPYLAYETLAKLVDSGAIARSY
FT                   RQVMLNYRNGINKGLYKIMSKMGISTVASYRCSKLFEAVGLHPAICDLCFPGVISRIGG
FT                   ATFSDFQQDLHNLSRRAWLARQPLEQGGLLKYVHDGEYHAYNPDVVQALQQAVQSGDYR
FT                   DYQRYASLVNQRPITTLRDLLALRPVAQPLALEQVEAESALFQRFDTAAMSIGALSPEA
FT                   HEALAQAMNGLGGFSNSGEGGEDPARYNTDKASRIKQVASGRFGVTPAYLVNADVIQIK
FT                   VAQGAKPGEGGQLPGDKVTPYIARLRYSVPGVTLISPPPHHDIYSIEDLAQLIFDLKQV
FT                   NPRALISVKLVSEPGVGTIATGVAKAYADLITIAGYDGGTGASPLSSVKHAGCPWELGL
FT                   VETQQALVANGLRHKIRLQVDGGLKSGADIIKAAILGAESFGFGTGPMVALGCKYLRIC
FT                   HLNNCATGVATQDEKLRRDHFHGLPLRVTHYFHFIARETRELMAQLGVSRLVDLIGRTD
FT                   LLTVLEGVTAKQSRLDLAPLLHTATPHPGKGLYCSEGNPPFDPGQLNQSLLSQLQDNIA
FT                   TRQGRALFCDIHNTDRSVGAALSGAIAERYGEQGMAASPLKIQFSGTAGQSFGVWNAAG
FT                   LELTLTGDANDYVGKGMAGGRIVIRPPVGSAFRSHEASIIGNTCLYGATGGKLFAAGRA
FT                   GERFAVRNSGALTVVEGIGDNGCEYMTGGIVCVLGRTGINFGAGMTGGFAYVLDEDGEF
FT                   RQRVNAELVEVLEMAALPIHEEHLRGLITEHVRLTGSGRAEAILADWPQWAARFVLIKP
FT                   KSSDVKALLGHRSRSAAELRVQAQ"
FT   gene            573308..574258
FT                   /locus_tag="ETAE_0528"
FT   CDS_pept        573308..574258
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAE_0528"
FT                   /product="putative Fe-S oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83375"
FT                   /db_xref="GOA:D0ZBX4"
FT                   /db_xref="InterPro:IPR005911"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR032432"
FT                   /db_xref="InterPro:IPR039661"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZBX4"
FT                   /protein_id="ACY83375.1"
FT                   /translation="MAKLASGLYKASFTIMQLQQLVNMFGADLQRRYGEKIHKLTLHGG
FT                   FSCPNRDGTLGRGGCTFCNVASFADEQMQRRSIAEQLEAQARKVNRARRYLAYFQAYTS
FT                   TYAEVCILRDMYREALQQADMVGLCVGTRPDCVPESVLDLLAEYREQGYEVWLELGLQS
FT                   ANDKTLRRINRGHDFACYQRTTRAARARGLKVCSHLIVGLPGESHADCLDTLQRVVETG
FT                   VEGIKLHPLHIVTGSVLAKAWQAGRLQDLTLERYVHTAGEMIRHTPPEVIYHRISASAR
FT                   RPTLLAPQWCENRWTGMVAINNYLLECGGQASALS"
FT   gene            574447..576783
FT                   /gene="arcB"
FT                   /locus_tag="ETAE_0529"
FT   CDS_pept        574447..576783
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="arcB"
FT                   /locus_tag="ETAE_0529"
FT                   /product="aerobic respiration control sensor protein ArcB"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83376"
FT                   /db_xref="GOA:D0ZBX5"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR008207"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR014409"
FT                   /db_xref="InterPro:IPR027460"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036641"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR040642"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZBX5"
FT                   /protein_id="ACY83376.1"
FT                   /translation="MKQIRVLAQYYVDLMVKLGLVRFSILLASALVLLAMVVQMAVTML
FT                   LRGQVDSIDVVRSVFFGLLITPWAVYFLSVVVEQLEESRQRLSKLVNKLEEMRHRDLKL
FT                   NQQLKDNISQLNQEIADRVKAEEARLQVLDTLQHEIDQRELAQVELEQQSALLRSFLDS
FT                   SPDLVYYRNEDGEFSGCNRAMELLTGKSEKQLIGLTPRDVYDPDIAQKVIETDEKVFRH
FT                   NVSLTYEQWLVYPDGRKACFELRKVPFYDRVGKRHGLMGFGRDITERKRYQDALENASR
FT                   EKTTFISTISHELRTPLNGIVGLSRILLDTELNEEQLKYLKTIHVSAIALGNIFNDIIE
FT                   MDKLERRKVQLDNQAIDFTGFLTDLENLSGLLVQPKGLSFTLTPDPALPHKVMADGTRL
FT                   RQILWNLIGNAVKFTQRGGVSVRVWREQQDKLLFEVRDTGIGIPPEEQDKIFAMYYQVK
FT                   DMHGGKPATGTGIGLAVSKRLAQTMGGDIVVSSVAGEGACFTLSIRAPVVEEALSEPPA
FT                   EEEMPLPALHVLLVEDIELNVIVARSVLEKMGNSVDVAMSGAEALAMFVPQEYDLVLLD
FT                   IQLPDMTGLDIARTLCQRYGKPALPPLVALTANVLKDKKEYLDAGMDDVLSKPLAVPAL
FT                   TAVIRRFWDSAPATTLEAGEPHAHDLCELLDTEMLQQYLDLVGPQLIDQSLAVFEKMMP
FT                   GYLSVLESNMTARDQKGITEEGHKIKGAAGSVGLRHLQQLAQQIQTPTLPAWWDNVQEW
FT                   IDELKQEWRHDVQVLRDWVAQANKK"
FT   gene            576800..576961
FT                   /locus_tag="ETAE_0530"
FT   CDS_pept        576800..576961
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAE_0530"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83377"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZBX6"
FT                   /protein_id="ACY83377.1"
FT                   /translation="MRNDCANTRENEHLRIVDERNYQEKVCVNGANRFDAQRHQHTNKL
FT                   VMDVSSFI"
FT   gene            577159..577812
FT                   /gene="elbB"
FT                   /locus_tag="ETAE_0531"
FT   CDS_pept        577159..577812
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="elbB"
FT                   /locus_tag="ETAE_0531"
FT                   /product="isoprenoid biosynthesis protein with
FT                   amidotransferase-like domain"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83378"
FT                   /db_xref="GOA:D0ZBX7"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR026041"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZBX7"
FT                   /protein_id="ACY83378.1"
FT                   /translation="MKRVGVVLSGCGVFDGSEIHEAVLTLLALSRAGAQAVCLAPDREQ
FT                   AQVIDHLRGEPTAERRNVLVEAARIARGDVTSLAQADASQLDALIVPGGFGAAKNLSSF
FT                   ATDGAACSIDPALQHLVTRLHRDGKPLGFICIAPALLPKLLGVPVRVTIGNDAATADAI
FT                   AAMGGEHVACAVNDIVVDEAQRVVTTPAYMLANTIAEAAEGIDKLVAQVLDMTR"
FT   gene            577809..578543
FT                   /gene="mtgA"
FT                   /locus_tag="ETAE_0532"
FT   CDS_pept        577809..578543
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mtgA"
FT                   /locus_tag="ETAE_0532"
FT                   /product="monofunctional biosynthetic peptidoglycan
FT                   transglycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83379"
FT                   /db_xref="GOA:D0ZBX8"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR011812"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZBX8"
FT                   /protein_id="ACY83379.1"
FT                   /translation="MSQTAASRRVLQRIRRWGSRLVIALLGAWIAALLIFAVLPVPYST
FT                   VMVQRQVGAWLHGDFSYVAHQTWRPMSQIAPPMALAVIAAEDQKFPQHWGFDLTAIGQA
FT                   LDSADEGGRPLRGASTLSQQTMKNLLLWDGRSWLRKGLEAPLTLAEELVWSKRRILTVY
FT                   LNIAEFGPGVFGVEEAAQRYFHKPASRLTAGEAALLAAVLPNPHRFSVRAPSRYVLQRQ
FT                   RWILRQMRQLGGEAFLQRYDLR"
FT   gene            complement(578605..579195)
FT                   /locus_tag="ETAE_0533"
FT   CDS_pept        complement(578605..579195)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAE_0533"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83380"
FT                   /db_xref="InterPro:IPR007055"
FT                   /db_xref="InterPro:IPR014004"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZBX9"
FT                   /protein_id="ACY83380.1"
FT                   /translation="MTMRFPLTRCFPALVVLSALLLQGCVAAVIGSATMATQAASDPRS
FT                   VGTQVDDGTLEARISNALSKDAQLKKEARVVVTAYQGQVLLTGQAPSQALISRAKQIAM
FT                   GVEGTKAVYNEIRLGQPVSLGTASADAWITTKVRSQLLASDQVKSTNVKVTTENGEVFL
FT                   LGLVTPKEGQAAAQTASKVSGVKHVTTAFSLLK"
FT   gene            complement(579206..579796)
FT                   /locus_tag="ETAE_0534"
FT   CDS_pept        complement(579206..579796)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAE_0534"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83381"
FT                   /db_xref="GOA:D0ZBY0"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR023070"
FT                   /db_xref="InterPro:IPR035461"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZBY0"
FT                   /protein_id="ACY83381.1"
FT                   /translation="MLERIKGCFTESIQTQIAAAEALPDAISRAAMTLVQSLLNGNKIL
FT                   SCGNGASGANAQHFAATLINRFETERPSLPAIALNADSVVLTAIGNDRLHDEIYAKQVR
FT                   ALGHAGDVLLAISTRGNSRDIVKAVEAAVTRDMTIVALTGYDGGELAGLLGQQDVEIRI
FT                   PSHRSTRIQEMHMLTVNCLCDLIDNTLFPHQAD"
FT   gene            complement(579843..580229)
FT                   /locus_tag="ETAE_0535"
FT   CDS_pept        complement(579843..580229)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAE_0535"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83382"
FT                   /db_xref="GOA:D0ZBY1"
FT                   /db_xref="InterPro:IPR003509"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR011856"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZBY1"
FT                   /protein_id="ACY83382.1"
FT                   /translation="MAAVPERQHRPGAITAHQIGAHYEQRARRYLERAGLRFHAANVRL
FT                   RGGEIDLIMRDGATWVFVEVRYRKTACYGGAAASIDSRKRQRLQRCAAYWLAAQNQSIE
FT                   TADCRFDVLAITGSQLQWLPNAFV"
FT   gene            complement(580187..582265)
FT                   /locus_tag="ETAE_0536"
FT   CDS_pept        complement(580187..582265)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAE_0536"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83383"
FT                   /db_xref="GOA:D0ZBY2"
FT                   /db_xref="InterPro:IPR007443"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/Swiss-Prot:D0ZBY2"
FT                   /protein_id="ACY83383.1"
FT                   /translation="MLSSITVRTKSGRLIPLVLAATLLAACSGRVSTTPPAPVQSEATA
FT                   SADYYLQQMQQSSDDSKADWQLLAIRALLREGKLPQAADLLGQLPSQLSEAQQLEQRLV
FT                   SAELEIARHAPQQAQAILTKLDVAQLSQAQQLRYYQAVIAAAQGKTTLAQIRAYIALQP
FT                   LLTQEKQRKANIDATWAALSTLTPADLNGMVINANEDILRGWLDLLRLYQDNRQDPALL
FT                   KAAIKDWQTRYPNNPAATLLPSALDNILHLQSASTASIALLLPLNGQAKVFSDAIEAGF
FT                   NAAKNGAFSQNSAPTAAAATDNGAPASSGTLAAATTPSAPADVNAAGAVSPSAQGTDAA
FT                   APAAPNDSAALPPLDAAGDPIAPSVSPGNPDAHIQVYDTSSQPLPALLSQAQQAGASLV
FT                   VGPLLKNNVDQLNTLSTPLNILALNQPEQVQNHPNICYFALSPEDEARDAARHIWAQGK
FT                   RTPLLLIPRSPLGDRVAKAFATEWQSLGGGSVLQQTFGSSAELRSTINGGTGIRLTGQP
FT                   VSIAPAQPASVTIAGLTIPAPVQPPVASGGGVDAVYIIATPAEITLIKPMIDLANGTHN
FT                   GIGLYASSRSYQAGAGPDFRLEMEGVQFSDIPLLAGSDPAILQQAPAQYRNDYSLMRLY
FT                   AMGADAWTLANHFAQLRQIPGFQVQGATGTLSANDNCVIQRKLPWLQYQKGSIVPVQ"
FT   gene            582326..583195
FT                   /locus_tag="ETAE_0537"
FT   CDS_pept        582326..583195
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAE_0537"
FT                   /product="putative tetrapyrrole methylase"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83384"
FT                   /db_xref="GOA:D0ZBY3"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR008189"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR018063"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZBY3"
FT                   /protein_id="ACY83384.1"
FT                   /translation="MNQNDHAAISAATLYVVPTPIGNLGDITQRALETLKAVDLIAAED
FT                   TRHTGMLLQHFAINARFFALHDHNEQQKADQLLAKLREGQSIALVSDAGTPLINDPGYH
FT                   LVRRCREAGIRVVPLPGACAAITALCAAGVASDRFCYEGFLPAKGKARRDRLRDLQQEA
FT                   RTLIFYESTHRLLESLADMVSELGAERYVVLARELTKTWENIHGAPVAELLAWVQQDEN
FT                   RRKGEMVLIVEGYQADDEALSPEALRTLALLQAELPLKKAAALAAEIHGVKKNTLYKYA
FT                   LAQQSGDK"
FT   gene            complement(583634..584314)
FT                   /locus_tag="ETAE_0538"
FT   CDS_pept        complement(583634..584314)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAE_0538"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83385"
FT                   /db_xref="GOA:D0ZBY4"
FT                   /db_xref="InterPro:IPR019305"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZBY4"
FT                   /protein_id="ACY83385.1"
FT                   /translation="MVKATLRFRLHRTAIVLICLALLVILMQGASYFSLSHQRARLDQV
FT                   SELAQTLAQQVAARLSPLINDDTPDTKKIAPILEALTRHSRILDASVYALDGSLIAQAG
FT                   ERVEVRDRLALDGQRAGSYFNHQIVQPIDGRDGPLGFLRLTLDTHVLATESQQVDNTTN
FT                   LLRLMMLLALAIGIILARTLLQARRSRWQQSSYLLTANVPLEEESERDAPTQENAASTT
FT                   PPTS"
FT   gene            584421..585398
FT                   /gene="serB"
FT                   /locus_tag="ETAE_0539"
FT   CDS_pept        584421..585398
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="serB"
FT                   /locus_tag="ETAE_0539"
FT                   /product="phosphoserine phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83386"
FT                   /db_xref="GOA:D0ZBY5"
FT                   /db_xref="InterPro:IPR023190"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041449"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZBY5"
FT                   /protein_id="ACY83386.1"
FT                   /translation="MPNSLTFCDLPAEIYRWPGLPLSLSGDEVMPLDYRAGHTGWLLYG
FT                   RHLDKAALQAFQRRLAAPLVVVAAWCIEDYQVVRLAGGMPARAAKLANEQGIDTAVLGR
FT                   LPHLRSPGLLVMDMDSTAITIECIDEIARLAGVGGEVAAVTERAMRGELDFAASLRQRV
FT                   AALEGADAAILQQVRDDLPLMPGLTSLVRKLQAFDWHVAIASGGFTYFADHLRTRLNLS
FT                   AAVANALEVHNGRLTGRVTGRIVDAQCKEDTLCELAQRLNIPLTQTVAIGDGANDLKMI
FT                   QRAGLGIAFHAKPCVYDRAPLAIRHADLIGVLCVLSATLKHEER"
FT   gene            585453..586841
FT                   /gene="radA"
FT                   /locus_tag="ETAE_0540"
FT   CDS_pept        585453..586841
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="radA"
FT                   /locus_tag="ETAE_0540"
FT                   /product="DNA repair protein RadA"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83387"
FT                   /db_xref="GOA:D0ZBY6"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004504"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020588"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041166"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZBY6"
FT                   /protein_id="ACY83387.1"
FT                   /translation="MAKAVKRAFVCNECGADYPRWQGQCSACQAWNSISEVRLAAAPAA
FT                   GRSARLSGYAGDAGSLSKVQKLSEISLEALPRFSTGFTEFDRVLGGGVVPGSAILIGGN
FT                   PGAGKSTLLLQTLCRLSQQMKTLYVTGEESLQQVAMRAHRLGLPTEGLNMLSETSIEQI
FT                   CLIAEQEQPKLMVIDSIQVMHMADIQSSPGSVAQVRETAAYLTRFAKTRGVAIVMVGHV
FT                   TKDGSLAGPKVLEHCIDCSVLLDGDADSRFRTLRSHKNRFGAVNELGVFAMTEQGLREV
FT                   SNPSAIFLSRGEEITAGSSVMVVWEGTRPLLVEIQALVDTSMMSNPRRVAVGLEQNRLA
FT                   ILLAVLHRHGGLQMADQDVFVNVVGGVKVSETSADLALLMSLVSSLRDRPLPQDLVIFG
FT                   EVGLAGEVRPVASGQERIIEAAKHGFRRAIVPHANVPKKAIPNMTVYGVKKLSDALDIL
FT                   QDLA"
FT   gene            complement(586904..588571)
FT                   /gene="yjjK"
FT                   /locus_tag="ETAE_0541"
FT   CDS_pept        complement(586904..588571)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yjjK"
FT                   /locus_tag="ETAE_0541"
FT                   /product="putative ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83388"
FT                   /db_xref="GOA:D0ZBY7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR022374"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032781"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZBY7"
FT                   /protein_id="ACY83388.1"
FT                   /translation="MAQYVYTMNRVGKIVPPKRHILKDISLSFFPGAKIGVLGLNGAGK
FT                   STLLRIMAGVDTDIEGEARPQPGIKIGYLPQEPKLNLEQTVREAVEEAVGDVKQALTRL
FT                   DEVYALYADPDADFDKLAKEQGELEAIIQSHDGHNLDNQLERAADALRLPAWDAKIANL
FT                   SGGERRRVAICRLLLEKPDMLLLDEPTNHLDAESVAWLERFLHDYEGTVVAITHDRYFL
FT                   DNVAGWILELDRGEGIPWEGNYSSWLEQKDQRLAQEASAEAARRKSIEKELEWVRQGAK
FT                   GRQSKGKARLARFEELNNTDYQKRNETSELFIPPGPRLGDKVLEVSNLSKSYGDRLLID
FT                   ALSFSIPKGAIVGIIGPNGAGKSTLFRMISGQEQADSGSITLGDTVTLASVDQFRDAMD
FT                   DKKSVWEEISGGQDIMRIGNFEIASRAYVGRFNFKGTDQGKRVGELSGGERGRLHLAKL
FT                   LQVGGNMLLLDEPTNDLDVETLRALENALLEFPGCAMVISHDRWFLDRIATHILDYQDE
FT                   GRVEFFEGNFSEYEEYKKRTQGAEALQPHRIKYKKIAK"
FT   gene            588958..590886
FT                   /gene="slt"
FT                   /locus_tag="ETAE_0542"
FT   CDS_pept        588958..590886
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="slt"
FT                   /locus_tag="ETAE_0542"
FT                   /product="lytic murein transglycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83389"
FT                   /db_xref="GOA:D0ZBY8"
FT                   /db_xref="InterPro:IPR000189"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR008939"
FT                   /db_xref="InterPro:IPR012289"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR023800"
FT                   /db_xref="InterPro:IPR037061"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZBY8"
FT                   /protein_id="ACY83389.1"
FT                   /translation="MVMVGKWRYWSVGLCLALSAAAASADSLDAQRARYQQIKQAWDGN
FT                   RMDSVNQLMPTLRDYPLYPYLAYRALTQDMSQVNAQQIKAFLQQYPTLPPARSLTSRYV
FT                   NELARREDWIGLLAFSPQPPQPVAARCNYYYAQYATGHAEAAWRGAQTVWMSGQSLPSS
FT                   CDKLFDAWKGAGGLRDQAILARLRLALEKGNAGLVKYLQQQLPANYQTLNTALTALQAN
FT                   PRSVEAFARSVAPSDFTRDIVGVAFASLARQDADAARAMLPTLVRLQHIPSSQRQAMEE
FT                   TIAWRLMGSDASADDRRWRDGVIRRSHNAALLERRLRMALGEGNPAQVREWLGRLPQSV
FT                   RDKDEWRYWQAVALIDEGKRSEGQAILRALIKQRGFYPMVAAQRLGIPYPLQVMRAVRP
FT                   DAALAQEPAIARVRELMYWNMDNTARSEWSALVASKPRPQQEALARYALDQGWADLSVQ
FT                   ATIVAKLWDHLQERFPLAWPQEFRSATEDKGITQSYAMAIARQESAWNPEARSSVGASG
FT                   LMQLMPKTAEHTAKMFSLSHYQNSSQLFDPKINIDIGTRYLEYVYQSLGRNRILASAAY
FT                   NAGPSRVNTWLGNSDGRVDAVAFIESIPFSETRGYVKNVLAYDAYYRYFMHRPDQILTD
FT                   AEWARRY"
FT   gene            590978..591310
FT                   /gene="trpR"
FT                   /locus_tag="ETAE_0543"
FT   CDS_pept        590978..591310
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trpR"
FT                   /locus_tag="ETAE_0543"
FT                   /product="Trp operon repressor"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83390"
FT                   /db_xref="GOA:D0ZBY9"
FT                   /db_xref="InterPro:IPR000831"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013335"
FT                   /db_xref="InterPro:IPR038116"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZBY9"
FT                   /protein_id="ACY83390.1"
FT                   /translation="MQKTTPAPDQAPAEPDDWQRFIQLLQQAYQEGCQEPMLQLFLTPD
FT                   ERDALATRVRIIEELLKGEMSQRELKSQLGAGIATITRGSNSLKMASPDFKRWLVRQLL
FT                   PSTPQA"
FT   gene            complement(591301..591837)
FT                   /locus_tag="ETAE_0544"
FT   CDS_pept        complement(591301..591837)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAE_0544"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83391"
FT                   /db_xref="GOA:D0ZBZ0"
FT                   /db_xref="InterPro:IPR002786"
FT                   /db_xref="InterPro:IPR026533"
FT                   /db_xref="InterPro:IPR029001"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZBZ0"
FT                   /protein_id="ACY83391.1"
FT                   /translation="MYHVVAATTNPAKIQAITLAFDAAFGAGQYRIEGIDVDSGVPEQP
FT                   LGSTQTRSGARHRVICARQLRPEADFWVGIEAGIEDNMTFAWMSVENHCHRGESRSASL
FT                   TLPDSVMDGIRQGQTLGHEMRRLSGIDDINRREGAIGIFTQGRLSRTSVYYQALLLALA
FT                   ALEPGYHREPPPHYA"
FT   gene            592001..592648
FT                   /gene="gpmB"
FT                   /locus_tag="ETAE_0545"
FT   CDS_pept        592001..592648
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gpmB"
FT                   /locus_tag="ETAE_0545"
FT                   /product="phosphoglycerate mutase"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83392"
FT                   /db_xref="GOA:D0ZBZ1"
FT                   /db_xref="InterPro:IPR001345"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZBZ1"
FT                   /protein_id="ACY83392.1"
FT                   /translation="MRQVYLIRHGETEWNVQRRIQGQSNSPLTVMGEQQARQVGARLGQ
FT                   MGITHVIASDLGRTQQTGEIIAAACRCPLTLDARLRELSMGVLESRLLASLSPQEEQWR
FT                   LSMLDGSPQGCIPQGETMAQLAERMQQALNDCLALPQGSRPVLVSHGIALGCLLSTVLG
FT                   LPPYAERRLRLRNCSLSRVDYQQSAWLASGWVVETAGDVQHLAQPSMDEVLR"
FT   gene            complement(592645..593535)
FT                   /locus_tag="ETAE_0546"
FT   CDS_pept        complement(592645..593535)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAE_0546"
FT                   /product="AraC-type DNA-binding domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83393"
FT                   /db_xref="GOA:D0ZBZ2"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR010499"
FT                   /db_xref="InterPro:IPR011256"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="InterPro:IPR029442"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZBZ2"
FT                   /protein_id="ACY83393.1"
FT                   /translation="MDQADIIHDLLNWLEGHLDHPLTLDNVAAKAGYSKWHLQRMFKDV
FT                   TGQAIGAYIRARRLSNAAAALRLTSRPILDIALQYRFDSQQTFTRAFKKQFNKTPALYR
FT                   REEEWHAYGMRPPIRLGDYAIPTPEFITLPSLSLVGVTQSYTCTLEQICRVRTELRTQF
FT                   WRDFLHAVQDIRDIPPVLYGLHHSHPNPDKDDEQSIMYTTALEPHLLPKQVTREVQSIE
FT                   LAGGEYAKFSYQGPTEHFQAFIMSLYNSALPTLNLTRRRGYDVERFYPLVDSTQRPPKN
FT                   LRCEYLIPIRHTPSS"
FT   gene            593730..594218
FT                   /locus_tag="ETAE_0547"
FT   CDS_pept        593730..594218
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAE_0547"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83394"
FT                   /db_xref="InterPro:IPR010292"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZBZ3"
FT                   /protein_id="ACY83394.1"
FT                   /translation="MNKYFVGLCVALTTLWGASVHAEEIGSVDTVFKLFGPDHKIVVEA
FT                   FDDPDVENVTCYVSRAKTGGIKGGLGLAEDTSDAAISCQQVGPIALSEKIRNKKADGEV
FT                   VFRKRTSLVFKKLQVVRFYDSKRNVLIYLSYSDRVVEGSPKNAISAVPVMPWSAAPQG"
FT   gene            complement(594289..596007)
FT                   /gene="proS"
FT                   /locus_tag="ETAE_0548"
FT   CDS_pept        complement(594289..596007)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="proS"
FT                   /locus_tag="ETAE_0548"
FT                   /product="prolyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0548"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83395"
FT                   /db_xref="GOA:D0ZBZ4"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002316"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR004500"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR007214"
FT                   /db_xref="InterPro:IPR023717"
FT                   /db_xref="InterPro:IPR033730"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="InterPro:IPR036754"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZBZ4"
FT                   /protein_id="ACY83395.1"
FT                   /translation="MRTSQYLLSTLKETPADAEVVSHQLMLRAGMIRKLASGLYTWLPT
FT                   GLRVLNKVENIVREEMNYAGAIEVSMPVVQPADLWQESGRWEQYGPELLRFVDRGDRPF
FT                   VLGPTHEEVITDLVRNEISSYKQLPLNFYQIQTKFRDEVRPRFGVMRSREFLMKDAYSF
FT                   HTTQASLQETYDAMYAAYGRIFSRMGLDFRAVQADTGSIGGNASHEFQVLAQSGEDDIV
FT                   FSTASDYAANIELAEALAPTAERAAATQPMQLVDTPNAKTIAELVEQHGLPIEKTVKTL
FT                   LVHASEESGHTLVALLVRGDHELNEVKAEKLALVASPLTFANEAEIRALVNAGPGSLGP
FT                   VNLPLPVVADRAVAAMSDFGAGANIDGKHYFGINWERDVALPQIADIRNVVEGDPSPDG
FT                   KGTLLIKRGIEVGHIFQLGTKYTEALNATVQGEDGRNQLMTMGCYGIGVTRVVAAAIEQ
FT                   NHDERGIIWPDAIAPFQVAILPMNMHKSFRVKEVAERLYDELRAKGIEVLLDDRKERPG
FT                   VMFADMELIGIPHTVVIGDRNLDNNEIEYKYRRSGEKLMISVDEIAAFLQAQIAR"
FT   gene            complement(596126..596830)
FT                   /locus_tag="ETAE_0549"
FT   CDS_pept        complement(596126..596830)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAE_0549"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83396"
FT                   /db_xref="InterPro:IPR023368"
FT                   /db_xref="InterPro:IPR023370"
FT                   /db_xref="InterPro:IPR036413"
FT                   /db_xref="InterPro:IPR036414"
FT                   /db_xref="InterPro:IPR040372"
FT                   /db_xref="InterPro:IPR041369"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZBZ5"
FT                   /protein_id="ACY83396.1"
FT                   /translation="MSQFQFAPIGVIRSPYKEKFAIPRQPGLICDGGGALELLPPYNQP
FT                   DAVRGLEGFSHLWVIFVFHQTMDGGWRPTVRPPRLGGNARVGVFATRSTFRPNPIGMSL
FT                   VELHGIETRNGVRLQLGSLDLVDGTPVLDIKPYLPFAESQPQARAGFAQQAPPADMPVV
FT                   FSPDAQAQIAQRQRDYPHLARFIRQVLTQDPRPAYRHAEEDDRVYAVHLLDFNLRWQVK
FT                   NGVCDVLGLDPR"
FT   gene            complement(596827..597249)
FT                   /gene="rcsF"
FT                   /locus_tag="ETAE_0550"
FT   CDS_pept        complement(596827..597249)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rcsF"
FT                   /locus_tag="ETAE_0550"
FT                   /product="outer membrane lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83397"
FT                   /db_xref="GOA:D0ZBZ6"
FT                   /db_xref="InterPro:IPR030852"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZBZ6"
FT                   /protein_id="ACY83397.1"
FT                   /translation="MRALPLCLLTASLALSGCSLLSRPAAPIKPLAADRTPETVAKPRA
FT                   VTPRQTPITLYESAEDLIGKPFRDLGEVSGSVCQTRPHHSAPSLTTARKRMLYKAAQLK
FT                   ANAVLLHSCQILSQSHGCYRQATCTGSALSIATPAQ"
FT   gene            complement(597360..598175)
FT                   /gene="metQ"
FT                   /locus_tag="ETAE_0551"
FT   CDS_pept        complement(597360..598175)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metQ"
FT                   /locus_tag="ETAE_0551"
FT                   /product="DL-methionine transporter substrate-binding
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83398"
FT                   /db_xref="InterPro:IPR004872"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZBZ7"
FT                   /protein_id="ACY83398.1"
FT                   /translation="MSTKFTSLALVGTLLGTLALAGCGQEEKDPNHIKVGVIVGAEQQV
FT                   AEVAQKVAKDKYGLNVELVTFNDYVLPNEALNKGDIDANAFQHKPYLDQQIKDRGYKLV
FT                   AVGNTFVYPIAGYSKKIKSLNELQDGAQIAIPNDPTNLGRSLLLLQSVGLIKLKDGIGL
FT                   LPTVLDITENPKHLKLVELEAPQLPRSLDDNQIALAVINTTYASQIGLTPAKDGIFVEG
FT                   KDSPYVNLIVAREDNKDAENVKKFVQAYQSDEVYNAANKIFNGGAVKGW"
FT   gene            complement(598238..598867)
FT                   /gene="yaeE"
FT                   /locus_tag="ETAE_0552"
FT   CDS_pept        complement(598238..598867)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaeE"
FT                   /locus_tag="ETAE_0552"
FT                   /product="DL-methionine transporter permease subunit"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83399"
FT                   /db_xref="GOA:D0ZBZ8"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZBZ8"
FT                   /protein_id="ACY83399.1"
FT                   /translation="MVRGIWETVVMTLVSGFFGFVIGLPVGVLLYTSRPGQILENARLY
FT                   NLLSALVNIFRSIPFIILLVWMIPFTRLIVGTSIGLQAALVPLTIGAAPFIARMVENSL
FT                   LEIPSGLIEAARAMGATPMQIVNKILLPEALPGLINAATITLITLVGYSAMGGAVGAGG
FT                   LGQIGYQYGYIGYNATVMNTVLVLLVVLVYLIQFSGDRIVKAISRK"
FT   gene            complement(598884..599915)
FT                   /gene="metN"
FT                   /locus_tag="ETAE_0553"
FT   CDS_pept        complement(598884..599915)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metN"
FT                   /locus_tag="ETAE_0553"
FT                   /product="DL-methionine transporter ATP-binding subunit"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83400"
FT                   /db_xref="GOA:D0ZBZ9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR012692"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR017908"
FT                   /db_xref="InterPro:IPR018449"
FT                   /db_xref="InterPro:IPR026253"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041701"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZBZ9"
FT                   /protein_id="ACY83400.1"
FT                   /translation="MIKLTHITKVFQQGQRRISALDDVSLHVPAGQIYGVIGSSGAGKS
FT                   TLIRCVNLLERPTQGQVFVDGQDLTAMSTGQLTRTRRQIGMIFQHFNLLSSRTVYGNIA
FT                   LPLELDRVPRDEITRRVTELLALVGLADKRDAYPANLSGGQKQRVAIARALASNPKVLL
FT                   CDEATSALDPATTRAILELLKDINRRLGLTILLITHEMDVVKRICDQVAVISQGKLIEQ
FT                   GSVGEVFSHPKTPLAQQFIHATLHLDIPDDFAERMTPTRSADSQPLLRLEFTGQSVDAP
FT                   LISQAVRRFNVDISILSSQMDYAGGVKFGVMLAEVHGDDADAQAAIAFFEQHHVKVEVL
FT                   GYV"
FT   gene            600107..600670
FT                   /locus_tag="ETAE_0554"
FT   CDS_pept        600107..600670
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAE_0554"
FT                   /product="D,D-heptose 1,7-bisphosphate phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83401"
FT                   /db_xref="GOA:D0ZC00"
FT                   /db_xref="InterPro:IPR004446"
FT                   /db_xref="InterPro:IPR006543"
FT                   /db_xref="InterPro:IPR006549"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZC00"
FT                   /protein_id="ACY83401.1"
FT                   /translation="MAQQIPAIFLDRDGTMNVDHGYVHDSDDFQFIDGVIDAMRELKAM
FT                   GFALVMVTNQSGIARGMFTEDQFMHLTEWMDWSLADRGVDLDGIYYCPHHPQGSVPEYT
FT                   QACDCRKPQPGMLLEAQRFLNIDMAASYMVGDKREDLQAAQAAGVGTKVLVRSGKPLSA
FT                   EGEALADIVLDSLAQLPQAIKARG"
FT   gene            601064..602600
FT                   /locus_tag="ETAE_r007"
FT   rRNA            601064..602600
FT                   /locus_tag="ETAE_r007"
FT                   /product="16S ribosomal RNA"
FT   gene            602680..602755
FT                   /locus_tag="ETAE_t022"
FT   tRNA            602680..602755
FT                   /locus_tag="ETAE_t022"
FT                   /product="tRNA-Glu"
FT   gene            602955..605864
FT                   /locus_tag="ETAE_r008"
FT   rRNA            602955..605864
FT                   /locus_tag="ETAE_r008"
FT                   /product="23S ribosomal RNA"
FT   gene            605941..606062
FT                   /locus_tag="ETAE_r009"
FT   rRNA            605941..606062
FT                   /locus_tag="ETAE_r009"
FT                   /product="5S ribosomal RNA"
FT   gene            complement(606195..607841)
FT                   /locus_tag="ETAE_0555"
FT   CDS_pept        complement(606195..607841)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAE_0555"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0555"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83402"
FT                   /db_xref="GOA:D0ZC01"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR011066"
FT                   /db_xref="InterPro:IPR023408"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZC01"
FT                   /protein_id="ACY83402.1"
FT                   /translation="MVRLLRVILPLLSLLWSAALSAAEPRLAPDEAEQARTVTILQQPI
FT                   VMLQAHFGLATPEERVKQAAQDLQNIAPGDLQSPVQITPTQRYGQPVRLFSINGKPLLL
FT                   LAQQDLDVGDDLSLDQAAERIQQRLENLRGALIEQHSTHYLALAALRFAGGTALLFALL
FT                   WLARRVQKRIRSHFDILIMQHRGWVPYRLRSYVGGLERRISAVLLLLGCAIAGYIWLVW
FT                   ALKLFPATRYWGYSLHRYSLAAATQLLQDLIAALPDLLSLAAIAAVALLIQRLLRLLFR
FT                   QVESGRLKLPGLYPDTIKATRRLLSVIIWMFALSMAYPFFPGADTLAFKGVSVFFGLMI
FT                   TLGSAGLVSHAMSGLVLIYSRALHQGDYVRIGEYDGFVDDIGILATKLKTREGFDVTIP
FT                   NAVVASGKIVNLSTHAAHGGIIISTGVTIGYDVPWRQVHAMLLLALQQTEGIQHDLEPT
FT                   IRQNELQDWYVSYELRAEIVAGAAPAQVKSALHGHILDVFNRFGVQIMSPHFVMQPKEA
FT                   IWVSQEKWFSPPAQPPAPSAAEENRGDKAGP"
FT   gene            complement(607951..609306)
FT                   /gene="pssA"
FT                   /locus_tag="ETAE_0556"
FT   CDS_pept        complement(607951..609306)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pssA"
FT                   /locus_tag="ETAE_0556"
FT                   /product="phosphatidylserine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0556"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83403"
FT                   /db_xref="GOA:D0ZC02"
FT                   /db_xref="InterPro:IPR001736"
FT                   /db_xref="InterPro:IPR016270"
FT                   /db_xref="InterPro:IPR025202"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZC02"
FT                   /protein_id="ACY83403.1"
FT                   /translation="MLSKFKRAKHQQHLAQLPKLPQQVGEVETLFSPAAFRQALLEAIG
FT                   QATQRIYLVALYLENDDGGRDVLNALYQAKRQRPQLEIFVLVDWHRAQRGRIGAEASNT
FT                   NADWYCRMASEYPDVIVPIYGVPVNTREALGVLHLKGFIIDDRVIYSGASLNDVYLHRH
FT                   DKYRYDRYHFIQNPRLAGVMCQFVQSTLLSNPAVQRLDRCDRPKNPEIRNETRQFRHAL
FT                   RDSGYQVPAEAGNEELAVTPLAGLGKQNILNKTIHHLICSTERTLTLCTPYFNLPAPLV
FT                   RDIIFLLRQGKQVEIIVGDKKANDFFIPEEEPFKIIGALPYLYEINLRRFISRLQPYLD
FT                   NGQLTVRLWRDDDNTYHLKGMWVDDRWQLITGNNLNPRAWRLDLENAILIHDPRGEIQH
FT                   QRQHELECIRRHTQVVRSYEDLETLQQYPLKVRKLIRRLRRIRVDRLISRIL"
FT   gene            complement(609441..612113)
FT                   /locus_tag="ETAE_0557"
FT   CDS_pept        complement(609441..612113)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAE_0557"
FT                   /product="CoA binding domain/acetyltransferase domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0557"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83404"
FT                   /db_xref="GOA:D0ZC03"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR003781"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016102"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR032875"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZC03"
FT                   /protein_id="ACY83404.1"
FT                   /translation="MSQRSLESLLRPKSIAVIGASNQPSRSGHLVMLNLLNGGFPGPIM
FT                   PVTPRYQAVCGVLAYPTIADLPCVPDLAILCTNAQRTPALIAELGAKGCRAAIVIAAPA
FT                   SQADALRSLALRHGVRLLGPNSLGLLAPWQKLNASFSPVPILPGRLAFISQSAAVSNTI
FT                   LDWARQREIGFSLFVALGDSLDTDVDDLLDYLARDAKTSAILLYLEHLHDARRFLSAAR
FT                   SAARNKPILVIKSGRSPQARRVLGEAAGLDIAYDAAIQRAGLLRVQNTHELFSAVETLS
FT                   HMHPLRGERLLIVGNGAAPLAMALDELQRRGGHPAPCDDALHSALCTALPAETYLQGPI
FT                   DLRDDATPARYQATLQHLLDSRCYDALLIQHAPSATAPATETARALIETLSAHPRARHV
FT                   TLMTNWSGENTSQEARRLFSEAGIPTYRTPEGAVTAFMHMVEYRRNQRQLMETPALPAS
FT                   LPANAALAHRLLAQAQADGVTRLDTHEVRDILACYGLDTLPSWIANDSTEAVHIAERIG
FT                   YPVALKLRSPDIAHNSDVQGVMLYLRNAREVEQAANAIFDRARQAYPQARILGLLVQST
FT                   ANRIGAQELRICVENDAVFGPLILLGEGGAEWDAQRDAAAALPPLNMNLARYLIVQAQK
FT                   RGHIRRRAPLADLDIAGLSQVLVQVSHLIVDCPTIQRLEIHPLLACGSTFTLLDVSLQL
FT                   LDRHAAPTRLAICPYPHQLKESIRLKNGGDALLRPILPEDEPLLQQFIQRVSKEDLYYR
FT                   YFSEINEFTHEDLAKMTQIDYEREMAFVAVQSTPQGEEILGVTRALIDPDNTDAEFAVL
FT                   VRSDRHGLGLGSILLDKLIRYARQRQLRRLLGITMPTNRGMIALARKIGFQVEILLEDG
FT                   IVNLSLSLSDSTLPDSEKC"
FT   gene            complement(612187..612915)
FT                   /locus_tag="ETAE_0558"
FT   CDS_pept        complement(612187..612915)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAE_0558"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0558"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83405"
FT                   /db_xref="InterPro:IPR005636"
FT                   /db_xref="InterPro:IPR039262"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZC04"
FT                   /protein_id="ACY83405.1"
FT                   /translation="MFKIAVLLTPENTMSANAVLRLRAARLSQSTRPFHARGCRVQRCQ
FT                   RCLLPQIHCLCDTLASYPAHSRFCLMMYDTEPLKPSNTGRLIADVLPDTLAYGWSRTQP
FT                   DPQLLQLLDDPAYQPYVVFPGSYAEPERVVTEVRCDDRRPLFIMLDGTWPEARKMFRKS
FT                   PYLDRFPVFSINMAQAPGYLLREAHRPEQYCTAEVAAALLALADDRQASQGLLQHFHHF
FT                   RQQYLLGKSHPQVPVAAAVE"
FT   gene            complement(612975..613406)
FT                   /gene="trxC"
FT                   /locus_tag="ETAE_0559"
FT   CDS_pept        complement(612975..613406)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trxC"
FT                   /locus_tag="ETAE_0559"
FT                   /product="thioredoxin 2"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0559"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83406"
FT                   /db_xref="GOA:D0ZC05"
FT                   /db_xref="InterPro:IPR005746"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZC05"
FT                   /protein_id="ACY83406.1"
FT                   /translation="MNTVCPACHTTNRIPDDRRSEQATCGRCSHALFDGAIVNASEETL
FT                   DKLLQDDLPVLIDFWAPWCGPCQGFAPVFAAVAAARAGEVRCIKVNTEDQPALSSRFRI
FT                   RSIPTIMLYRNGQRVDMLNGAMPQAPFEAWLDEQLAKQA"
FT   gene            613613..614794
FT                   /locus_tag="ETAE_0560"
FT   CDS_pept        613613..614794
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAE_0560"
FT                   /product="putative tRNA/rRNA methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0560"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83407"
FT                   /db_xref="GOA:D0ZC06"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR013123"
FT                   /db_xref="InterPro:IPR016479"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZC06"
FT                   /protein_id="ACY83407.1"
FT                   /translation="MSDSLNGKNGKVKVMYVRDSDAADERQSRAPAKGRPGARGDRSRS
FT                   DRNDRGDRSRSDRNDRGDRSRSDRNDRGDRSRSDRNDRGDRSRSDRSDRGDRAARPARS
FT                   EQGVGERSPWRTVSLGDNGGVGGESDHGGISGKSFIDPEQLRRQRAEETRVYGENACQA
FT                   LFASRPEAIVRAWFLQAVTPRFREALRWMAANRKAYHVVDDAELTKASGTDHHGGVCFL
FT                   IKKRRSLDAQQYLANQAEDAVDCVLALENVANPHNLGGIMRTCAHFGIRGIIAPESAAL
FT                   ESGAAVRTAEGGAEHVQAIDAEDFSAALDTFRRAGYTIVTTSSHKGTTQLHRATLPAKI
FT                   VLVVGHEGDGLSDGTLQQGDLSVSIGGTGSVESLNVSVATGIMLAEWWRQNAR"
FT   gene            complement(614868..615584)
FT                   /gene="arcA"
FT                   /locus_tag="ETAE_0561"
FT   CDS_pept        complement(614868..615584)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="arcA"
FT                   /locus_tag="ETAE_0561"
FT                   /product="DNA-binding response regulator in two-component
FT                   regulatory system with ArcB or CpxA"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0561"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83408"
FT                   /db_xref="GOA:D0ZC07"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZC07"
FT                   /protein_id="ACY83408.1"
FT                   /translation="MQTPHILIVEDELVTRNTLKSIFEAEGYIVHEANDGAEMHQILSE
FT                   FDINLVIMDINLPGKNGLLLARELREQANVALMFLTGRDNEVDKILGLEIGADDYITKP
FT                   FNPRELTIRARNLLSRTMNLGSGTEERKSVEHYRFNGWELDINSRSLVSPDGEQYKLPR
FT                   SEFRAMLHFCENPGKIQSRAELLKKMTGRELKPHDRTVDVTIRRIRKHFESTPDTPEII
FT                   ATIHGEGYRFCGDLEE"
FT   gene            complement(616011..616127)
FT                   /locus_tag="ETAE_0562"
FT   CDS_pept        complement(616011..616127)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAE_0562"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83409"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZC08"
FT                   /protein_id="ACY83409.1"
FT                   /translation="MLNNVLLKNFQQLMAKRKFRRKRRSIIIIFIQLIYNKN"
FT   gene            616233..616940
FT                   /locus_tag="ETAE_0563"
FT   CDS_pept        616233..616940
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAE_0563"
FT                   /product="hypothetical tRNA/rRNA methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0563"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83410"
FT                   /db_xref="GOA:D0ZC09"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR004384"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZC09"
FT                   /protein_id="ACY83410.1"
FT                   /translation="MQIHIVLVAPARAENVGAAARAMKTMGFTSLRIVDSKADGEPAAR
FT                   WVAHGAGDILDGARHFDTLAQALADVDFSVASTARSRARFHYYCTPQELCAVLQEKQRW
FT                   MASCALVFGREDSGLTNDELALVDLLTGVPMAADYPSLNLGQAVMVFCYQLSSLMQVQA
FT                   AQAPAAQGEQLAALRARTDRLLTTLGVDGDTKLSDWLDQRIGLLAQRDTAMLHRLLHDI
FT                   ESALETSASGKKM"
FT   gene            complement(616979..617101)
FT                   /locus_tag="ETAE_0564"
FT   CDS_pept        complement(616979..617101)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAE_0564"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0564"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83411"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZC10"
FT                   /protein_id="ACY83411.1"
FT                   /translation="MESTVFYFVTPISANFIQHEYLDNRNLKNKTMGNWQSIAI"
FT   gene            617310..619772
FT                   /gene="thrA"
FT                   /locus_tag="ETAE_0565"
FT   CDS_pept        617310..619772
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thrA"
FT                   /locus_tag="ETAE_0565"
FT                   /product="bifunctional aspartokinase I/homeserine
FT                   dehydrogenase I"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0565"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83412"
FT                   /db_xref="GOA:D0ZC11"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001341"
FT                   /db_xref="InterPro:IPR001342"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR005106"
FT                   /db_xref="InterPro:IPR011147"
FT                   /db_xref="InterPro:IPR018042"
FT                   /db_xref="InterPro:IPR019811"
FT                   /db_xref="InterPro:IPR027795"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR041743"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZC11"
FT                   /protein_id="ACY83412.1"
FT                   /translation="MRVLKFGGTSVANAERVFSVADILESNAAQGQVAAVLSAPARITN
FT                   HLVALIERTIAGQDIQPILGDAEKIFTDLIDGLAQAQPGFDAAPLRLRVSQEFGQIRQV
FT                   LHGIALLGQCPDSVNAALICRGEALSIAIMAALLRARGRQVTVIDPVSSLLARGGYLES
FT                   SVDIAESARRIAAQAIPADSLILMAGFTAGNERGELVVLGRNGSDYSAAVLAACLRAAC
FT                   CEIWTDVDGVYTCDPRLVPDARLLESMSYQEAMELSYFGAKVLHPRTISPIAQFQIPCL
FT                   IKNTANPQAPGTLIGAQRRGDDALPVKGITHLNHMAMLNVSGPGMKGMVGMAARVFAVM
FT                   SRSGISVVLITQSSSEYSISFCVPQGELARACQALQDEFFLELKDGLLEPLDVIEHLAI
FT                   ISVVGDGMRTQRGISAKFFSALARANINIVAIAQGSSERSISVVVNNDAATTAVRVTHQ
FT                   MLFNTDQVIEVFVIGVGGVGGALLAQIERQQAWLKSKHIDLRVCGIANSRALLTHVHGI
FT                   DMANWRGALEQASQPFNLGRLMRLVNEYHLLNPVIVDCTSSQALADQYADFLGNGFHVV
FT                   TPNKKANTASLDYYRLLRQKAAGSQRKFLYDTNVGAGLPVIENLQNLLSAGDELQRFCG
FT                   ILSGSLSFIFGRLEEGATFSQATREARQLGYTEPDPRDDLSGMDVARKLLILAREAGYA
FT                   LELDDICVEPVLPAAFDARGDVDTFLANLAQADDAFSARVAAAQARGCVLRYVGEIDQG
FT                   RCSVRIAEVDSDDALYKVKNGENALTFYSRYYQPLPMVLRGYGAGNDVTAAGVFADLLR
FT                   TLSWKLGV"
FT   gene            619777..620703
FT                   /gene="thrB"
FT                   /locus_tag="ETAE_0566"
FT   CDS_pept        619777..620703
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thrB"
FT                   /locus_tag="ETAE_0566"
FT                   /product="homoserine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0566"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83413"
FT                   /db_xref="GOA:D0ZC12"
FT                   /db_xref="InterPro:IPR000870"
FT                   /db_xref="InterPro:IPR006203"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZC12"
FT                   /protein_id="ACY83413.1"
FT                   /translation="MKIYAPASIGNVSVGFDVLGAAVTPLDGTLLGDCVSVEASDRFAL
FT                   HCRGRFVDSLPAAAQENIVYQCWQRFCEVTGRELAVEMVLEKNMPIGSGLGSSACSVVA
FT                   ALAALNRFAGDPLDAQRLLTLMGELEGRISGSVHYDNVAPCYLGGLQLMLEAQGIISQP
FT                   VPCFDDWLWVMAYPGIKVSTAEARAILPLHYSRGDCVRHGRHLAGFIHACHTRQPSLAA
FT                   ALMQDVIAEPYRCGLLPGFADARRAAGELGTLACGISGSGPTLFAVCDDPAAAQAVAQW
FT                   LTQHYLQNEQGFVHICRLDTAGARQLG"
FT   gene            620707..621993
FT                   /gene="thrC"
FT                   /locus_tag="ETAE_0567"
FT   CDS_pept        620707..621993
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thrC"
FT                   /locus_tag="ETAE_0567"
FT                   /product="threonine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0567"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83414"
FT                   /db_xref="GOA:D0ZC13"
FT                   /db_xref="InterPro:IPR000634"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR004450"
FT                   /db_xref="InterPro:IPR029144"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="InterPro:IPR037158"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZC13"
FT                   /protein_id="ACY83414.1"
FT                   /translation="MKLYNLKDHNEQVNFAQALVQGLGRQQGLFFPHALPALARAQIDA
FT                   LLEQDFVTRSAHILAAYLGDEFPFETLRDRVQAAFDFPAPVVPVSDDIAALELFHGPTL
FT                   AFKDFGGRFMAQMLQQVAGERPVTILTATSGDTGAAVAHAFYGLKNVQVVILYPRGKVS
FT                   PLQEKLFCTLGGNIRTLAIEGDFDACQALVKQAFDDPTLCRELGLNSANSINISRLLAQ
FT                   ICYYFEAVAQLPQAARNQLVISVPSGNFGDLTAGLLAQSLGLPVKRFIAATNANDTVPR
FT                   FLSSGVWQPHETVATLSNAMDVSRPNNWPRVEELFRRREWSLGALGSGALSDAQTAAAM
FT                   RELAALGYVSEPHAAIAYRALRDDLQPGEYGLFLGTAHPAKFQESVEAILQRSIPLPQA
FT                   LAARAALPLLSQTLPADFSRLRAALLDRP"
FT   gene            complement(622051..622848)
FT                   /locus_tag="ETAE_0568"
FT   CDS_pept        complement(622051..622848)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAE_0568"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0568"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83415"
FT                   /db_xref="InterPro:IPR005583"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZC14"
FT                   /protein_id="ACY83415.1"
FT                   /translation="MLTIISPAKTLDYTSPLATQRYTQPQMLAQAETLMQTVRTLTPAQ
FT                   LGSLMKISDKLAGLNAARFTEWQPRFTPENARQAILAFKGDVYTGLQAETFSEQDFDFA
FT                   QRHLCMLSGLYGVLRPLDLMMPYRLEMGTRLHTPYGNDLYAFWGDSITRQLNQQLQQQG
FT                   DRVVVNLASDEYFKAVRPAALEGELIKPIFMDEKNGSMKVISFYAKKARGLMSRFIIQA
FT                   RLRDPEQLKAFDLEGYAFAGETQGRQGRELLFTRRHSAISPAR"
FT   gene            complement(622960..624393)
FT                   /locus_tag="ETAE_0569"
FT   CDS_pept        complement(622960..624393)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAE_0569"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0569"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83416"
FT                   /db_xref="GOA:D0ZC15"
FT                   /db_xref="InterPro:IPR001463"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZC15"
FT                   /protein_id="ACY83416.1"
FT                   /translation="MTDLISFINNILWGSVLIYLLIGAGLYFTFRTGFIQFRHFGHMFS
FT                   VLKNSNKADSGGISSFQALCTSLAARVGTGNLTGVAIALTAGGPGAIFWMWIIALIGMA
FT                   TSFIESTLAQLYKTRDDQGNFRGGPAYYMEKGLGMRWMGILFSLFLLVAFGLVFNAVQA
FT                   NSIAQATAVAFHIPPLYVGIALMLMCGVVIFGGLRSIARTAELVVPVMAIAYLLLAFWV
FT                   MGHNLARMPEVLLLVIKSAFGLQEAAAGAIGYGISQAMTQGIQRGLFSNEAGMGSAPNA
FT                   AASATPYPPHPASQGYVQMLGVFMDTLVICSATAAIILSSGVLDAAPGTISGIELTQRA
FT                   LSSAVGDWGGIFIAVAIFFFAFTSIIANYAYAESNLIFLEHNHPHGLVFLRLCTLGMVM
FT                   FGALAELPLVWKMADLSMALMAITNLIAILLLSGVAFKLARDYNHQRRLGLLPTLDLSK
FT                   YPEIQQQVEPGIWEKPPRQ"
FT   gene            624824..625777
FT                   /gene="talB"
FT                   /locus_tag="ETAE_0570"
FT   CDS_pept        624824..625777
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="talB"
FT                   /locus_tag="ETAE_0570"
FT                   /product="transaldolase B"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0570"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83417"
FT                   /db_xref="GOA:D0ZC16"
FT                   /db_xref="InterPro:IPR001585"
FT                   /db_xref="InterPro:IPR004730"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018225"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZC16"
FT                   /protein_id="ACY83417.1"
FT                   /translation="MTDKLTSLRQLTTVVADTGDIAAMKQYQPQDATTNPSLILNAAQI
FT                   PEYRKLIDDAITWARAQSGDRAQQIVDASDKLAVNIGLEILKLIPGRISTEVDARLSYD
FT                   TEASVAKAKRLIKLYNDAGISNDRILIKLASTWQGIRAAERLEKEGINCNLTLLFSFAQ
FT                   ARACAEAGVFLISPFVGRILDWHKANGDKSEFAPAEDPGVISVTEIYNYYKQHGYETVV
FT                   MGASFRNVGEILELAGCDRLTISPSLLKTLSESTGSVERKLAYQGEVKARPARMSEAEF
FT                   YWQHNQDPMAVEKLADGIRKFAVDQGKLESMIGALL"
FT   gene            625907..627358
FT                   /gene="gabD"
FT                   /locus_tag="ETAE_0571"
FT   CDS_pept        625907..627358
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gabD"
FT                   /locus_tag="ETAE_0571"
FT                   /product="succinate-semialdehyde dehydrogenase I"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0571"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83418"
FT                   /db_xref="GOA:D0ZC17"
FT                   /db_xref="InterPro:IPR010102"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZC17"
FT                   /protein_id="ACY83418.1"
FT                   /translation="MMQLHDMGLFRQQALIDGVWCDADSGDVMTVINPASGDTLGSVPK
FT                   MGAAETRRAIEAAAHALPGWRARTGKARAQILRRWFDLILAHQEDLARLMTLEQGKPLA
FT                   ESRGEIAYAASFIEWFAEEAKRVYGDTIPAPQGDKRLLVIKQPIGVTAAITPWNFPAAM
FT                   ITRKAGPALAAGCTMVLKPASQTPYSALALAELALRAGVPQGVFSVVTGSAGAVGNELT
FT                   ANPLVRKLSFTGSTEIGRQLMAQCAHDIKKVSLELGGNAPFIVFDDADLDQAVAGAMAS
FT                   KFRNAGQTCVCANRLYVQEGIYERFAEKLCSAVQALKVGNGLDDGVTVGPLIDSRARAK
FT                   VEAHIADAVARGARIACGGQADARGENFFCPTVLLDVPADAQVAREETFGPLAPLFRFR
FT                   DEDEVIARANATEFGLASYFYTRDVGRVFRVAEALEYGIVGINSGLISNEMAPFGGVKS
FT                   SGLGREGAKYGIEDYLEIKYLCLGL"
FT   gene            627529..628185
FT                   /locus_tag="ETAE_0572"
FT   CDS_pept        627529..628185
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAE_0572"
FT                   /product="putative hydrolase, haloacid dehalogenase-like
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0572"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83419"
FT                   /db_xref="GOA:D0ZC18"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZC18"
FT                   /protein_id="ACY83419.1"
FT                   /translation="MWRKHFAAIFLDMDGALLDSDDHAEQVWEQWAHQRQIDHALLRPR
FT                   IYSQRVQETLRQLAPRYSDDAECQRLEQALLAAVRQRRSRLRQDAAAWLAMLGETPWGV
FT                   VTQAGQPRAAEQIAHSGMCPPPLVIGAEQVSCGRPDPEPYLLAASHYGLDPRDCLVIES
FT                   DEAGIRAAQAAGMTVIALSYRRPRHSLQRADVVIGGWRSIILHPQPEGIVVEVIA"
FT   gene            628182..628769
FT                   /gene="mogA"
FT                   /locus_tag="ETAE_0573"
FT   CDS_pept        628182..628769
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mogA"
FT                   /locus_tag="ETAE_0573"
FT                   /product="molybdenum cofactor biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0573"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83420"
FT                   /db_xref="GOA:D0ZC19"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="InterPro:IPR008284"
FT                   /db_xref="InterPro:IPR036425"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZC19"
FT                   /protein_id="ACY83420.1"
FT                   /translation="MNTLRIGLVSISDRASSGVYQDLGIPALEAWLASALATPYTLETR
FT                   LIPDEQPLIEQTLCELVDERGCHLVLTTGGTGPARRDVTPDATLAVADREMPGFGEQMR
FT                   QISLRFVPTAILSRQVGVIRKQALIINLPGQPKSIRETLEGLKDASGAPLVHGIFASVP
FT                   YCIQLLEGPYVETHSAVIAAFRPKSAQRETIN"
FT   gene            628891..630201
FT                   /locus_tag="ETAE_0574"
FT   CDS_pept        628891..630201
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAE_0574"
FT                   /product="putative proline/betaine transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0574"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83421"
FT                   /db_xref="GOA:D0ZC20"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZC20"
FT                   /protein_id="ACY83421.1"
FT                   /translation="MELHNHRRLNHQDYKTLALAALGGALEFYDFIIFVFFAAVVGALF
FT                   FPPDMPEWLRLVQTFGIFAAGYLARPLGGIIMAHFGDRVGRKRMFSLSILLMALPTLVM
FT                   GMLPTYQSIGIAAPLLLLLMRVLQGAAIGGEVPGAWVFVAEHVPPQRIGFACGILTSGL
FT                   TSGILLGSLVATWLNSWLTPQEVLAGGWRIPFFLGGLFGLMAMYLRRWLHETPVFLAMQ
FT                   ARRALAAELPLKQVVRDHRRAVAVSMLLTWLLSACIVVVILMTPSLLQTQYGLPAALTL
FT                   QANSVAIVTMSLGCVLAGGLVDRVGAGRLFIGGGLLLALCTWQFFSSLSPQIEPAQLFW
FT                   RYGLAGFSIGTIGAVPFVMVCAFPAEVRFSGISFSYNLAYAVFGGLTPIAVTLLLTLTP
FT                   LAAGGYVLALSLLGVALGFYFQRAPLRAAQGEARLSR"
FT   gene            complement(630286..630789)
FT                   /locus_tag="ETAE_0575"
FT   CDS_pept        complement(630286..630789)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAE_0575"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0575"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83422"
FT                   /db_xref="GOA:D0ZC21"
FT                   /db_xref="InterPro:IPR000791"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZC21"
FT                   /protein_id="ACY83422.1"
FT                   /translation="MLNLHNAGLFPLTSVILAMGIFFGGIAQILAGLLEYKKGNTFGLT
FT                   AFTAYGSFWLTLVALLTLPKMGLAEATDALSLGAYLALWGIFTLFMFFGTLRSNRVLQF
FT                   VFASLTVLFFLLAYGNITANAAVLHIAGIEGIICGASAIYLAMAEVINEQYGRDVLPIG
FT                   AKHA"
FT   gene            631172..633079
FT                   /gene="dnaK"
FT                   /locus_tag="ETAE_0576"
FT   CDS_pept        631172..633079
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaK"
FT                   /locus_tag="ETAE_0576"
FT                   /product="molecular chaperone"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0576"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83423"
FT                   /db_xref="GOA:D0ZC22"
FT                   /db_xref="InterPro:IPR012725"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR018181"
FT                   /db_xref="InterPro:IPR029047"
FT                   /db_xref="InterPro:IPR029048"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZC22"
FT                   /protein_id="ACY83423.1"
FT                   /translation="MGKIIGIDLGTTNSCVAVMDGGKARVLENAEGDRTTPSIIAYTQD
FT                   GEVLVGQPAKRQAVTNPQNTLFAIKRLIGRRFEDAEAQRDKDIMPYQIVAADNGDAWVE
FT                   VKGQKIAPPQISAEVLKKMKKTAEDFLGEPVTEAVITVPAYFNDAQRQATKDAGRIAGL
FT                   DVKRIINEPTAAALAYGMDKGVGNRTIAVYDLGGGTFDISIIEIDDVDGEKTFEVLATN
FT                   GDTHLGGEDFDSRLINYLVDEFKKEQGIDLRNDPLAMQRLKEAAEKAKIELSSAQQTDV
FT                   NLPYITADATGPKHMNIKVTRAKLESLVEDLVARSMEPLKVALKDAGLSVSDIDDVILV
FT                   GGQTRMPMVQKQVADFFGKEPRKDVNPDEAVAIGAAVQGGVLAGDVKDVLLLDVTPLSL
FT                   GIETMGGVMTALISKNTTIPTKHSQVFSTAEDNQSAVTIHVLQGERKRAADNKSLGQFN
FT                   LDGIQPAPRGMPQIEVTFDIDADGILHVSAKDKNSGREQNITIKASSGLSEDEIKQMVR
FT                   DAEANAEADRKFEELVQVRNQADQLVHGTRKLVEEAGDKLPATDKSAIEDAVKALEAAS
FT                   KGEDKADIEAKIQALVQSSAKLQELAQQQAQAGEAQADTSAKKDDDVVDAEFEEVKDKK
FT                   "
FT   gene            633190..634326
FT                   /gene="dnaJ"
FT                   /locus_tag="ETAE_0577"
FT   CDS_pept        633190..634326
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaJ"
FT                   /locus_tag="ETAE_0577"
FT                   /product="DnaJ-class molecular chaperone with C-terminal Zn
FT                   finger domain"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0577"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83424"
FT                   /db_xref="GOA:D0ZC23"
FT                   /db_xref="InterPro:IPR001305"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR002939"
FT                   /db_xref="InterPro:IPR008971"
FT                   /db_xref="InterPro:IPR012724"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="InterPro:IPR036410"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZC23"
FT                   /protein_id="ACY83424.1"
FT                   /translation="MAKKDYYEILGVSREADEREIKKAYKRLAMKYHPDRNQGDKEAED
FT                   KFKEIKEAYEILTDAQKRAAYDQYGHAAFEQGGMGGGGAGGFGGGADFSDIFGDVFGDI
FT                   FGGGRRQRAARGADLRYNMDLTLEEAVRGVTKEIRIPTLVECDVCHGSGAKKGSEPITC
FT                   PTCHGAGQVQMRQGFFTVQQPCPHCHGRGTIIKDPCNKCHGHGRIEKSKTLSVKIPAGV
FT                   DTGDRIRLAGEGEAGENGAPAGDLYVQVQVKAHPIFEREDNNLFCEVPINFAMAALGGE
FT                   IEVPTLDGRVKLKIPAETQTGKMFRMRGRGVKSVRGGAQGDLLCRVVVETPVNLNDKQK
FT                   QLLRELEESFGGPASDKNSPRSKRFFDGVKKFFDDLTR"
FT   gene            634574..635752
FT                   /gene="nhaA"
FT                   /locus_tag="ETAE_0578"
FT   CDS_pept        634574..635752
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nhaA"
FT                   /locus_tag="ETAE_0578"
FT                   /product="Na+/H+ antiporter"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0578"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83425"
FT                   /db_xref="GOA:D0ZC24"
FT                   /db_xref="InterPro:IPR004670"
FT                   /db_xref="InterPro:IPR023171"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZC24"
FT                   /protein_id="ACY83425.1"
FT                   /translation="MIKSLQRFVGSDAFGGVILIIAAALAMILANTDWTSHIYQAFLNT
FT                   PVEVRVGSLHINKNMLLWVNDALMAIFFLMIGLEVKRELVCGSLASARQAAFPVIAALG
FT                   GMVVPALIYLLFNGQDAVASTGWAIPAATDIAFALGVLALLGNRVPLALKVFLLALAII
FT                   DDLGAIIIIALFYTSDLSILSLAVAGAAIVALALLNLFNVRRVGLYILVGVVLWTAVLK
FT                   SGVHATLAGVVIGFFVPLKEQDGKSPARSLEHALHPWVAYMILPLFAFANAGVSLDGVT
FT                   LSGLFSLLPLGVIAGLFIGKPLGISLFCWLAVKLKLATLPQGTTFKEIIAIGVLCGIGF
FT                   TMSIFIASLAFGDADPALAVFSRLGILLGSSLAAIVGYLLLRRVLPAQKAAA"
FT   gene            635968..636870
FT                   /gene="nhaR"
FT                   /locus_tag="ETAE_0579"
FT   CDS_pept        635968..636870
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nhaR"
FT                   /locus_tag="ETAE_0579"
FT                   /product="transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0579"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83426"
FT                   /db_xref="GOA:D0ZC25"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZC25"
FT                   /protein_id="ACY83426.1"
FT                   /translation="MRLSHINFNHLYYFWQVCKEGSVVGAAEALFLTPQTITGQIKALE
FT                   ERLGGKLFKRQGRGLVPSELGQLVFRYADRMFMLSQEMLDIVNYRKESSMLFDVGVADA
FT                   LSKRLVSQVLETAVADHEQIHLRCFESTHELLLEQLSQHKLDMILSDCPVDSSQQEGLF
FT                   SVKLGECGVSFFCRQPLPEMPFPTCLEQRKLLIPGRRSMLGRKLLNWFNSQGLQVQILG
FT                   EFDDAALMKAFGLYHDAIFVAPSIYAQDMYANVQDNIREVGRIDNVQEEYYVIFAERMI
FT                   QHPAVQRVCNKDFSALFSR"
FT   gene            637000..637188
FT                   /locus_tag="ETAE_0580"
FT   CDS_pept        637000..637188
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAE_0580"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0580"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83427"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZC26"
FT                   /protein_id="ACY83427.1"
FT                   /translation="MDQAFVCLTVNDRLHVVVRCLSSCFVASSDSCVYFLDESTHHGTT
FT                   ASIVLATLFRLNGAFLS"
FT   gene            637615..638577
FT                   /gene="ribF"
FT                   /locus_tag="ETAE_0581"
FT   CDS_pept        637615..638577
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ribF"
FT                   /locus_tag="ETAE_0581"
FT                   /product="bifunctional riboflavin kinase/FMN
FT                   adenylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0581"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83428"
FT                   /db_xref="GOA:D0ZC27"
FT                   /db_xref="InterPro:IPR002606"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015864"
FT                   /db_xref="InterPro:IPR015865"
FT                   /db_xref="InterPro:IPR023465"
FT                   /db_xref="InterPro:IPR023468"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZC27"
FT                   /protein_id="ACY83428.1"
FT                   /translation="MELIRGIHNLRARHRGCVLTIGNFDGVHRGHRALLARLRQEGERL
FT                   GLPVMVMIFEPQPLEMFAPQNAPARLTRLRDKCRYLADAGVDAVLCVRFDRQFASHSAQ
FT                   DFVKHLLVERLGVKFLMIGDDFRFGAEREGDYHMLQAAGKAYGFTVTNSLSFCVGDRRV
FT                   SSTAVRHALRHDDLALAESLLGHPYRIAGRVVHGDALGRTIGFPTANLPLKRLVAPVKG
FT                   VYAVDVYGLGLTPLPGVANIGTRPTVAGIRQQLEVHLLDVTMDLYGRHIDVVLRAKLRN
FT                   EQRFDSLDALKRQIAQDVVAAREFFGLTTPVQSLMAQSQ"
FT   gene            638602..641448
FT                   /gene="ileS"
FT                   /locus_tag="ETAE_0582"
FT   CDS_pept        638602..641448
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ileS"
FT                   /locus_tag="ETAE_0582"
FT                   /product="isoleucyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0582"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83429"
FT                   /db_xref="GOA:D0ZC28"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002301"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR010663"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR023585"
FT                   /db_xref="InterPro:IPR033708"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZC28"
FT                   /protein_id="ACY83429.1"
FT                   /translation="MSDYKNTLNLPETGFPMRGDLAKREPGMLQHWYEQDLYGIIRNAK
FT                   KGKKSFILHDGPPYANGSIHIGHSVNKILKDIIIKSKGLSGYDSPYIPGWDCHGLPIEL
FT                   KVEQLIGKPGEKYSAAEFREQCRAYAAEQVAGQKADFIRLGVLGDWEHPYLTMDYGTEA
FT                   NIIRALARIVDNGHLMKGAKPVHWCPDCGSSLAEAEVEYYDKVSPSIDVRFAAVDKAQV
FT                   LAKFGVSEAKGDVNVVIWTTTPWTLPANRAVALHPELEYQLVQVEGECLILAAELVESV
FT                   MKRAGIDHWQVLGSCKGEDLELLRFRHPFMSFDVPIIMGDHVTLDAGTGAVHTAPGHGP
FT                   DDYVVGQKYGLEIANPVGSNGCYLPGTHPALDGLFVFKANDVVIDLLKSSGALLHVEKL
FT                   THSYPCCWRHKTPIIFRATPQWFISMDRQGLRSQSLAEIERIERQGLDEQNLSGWIPAW
FT                   GKARIESMVANRPDWCISRQRTWGVPMAMLVHKETQALHPRTTELMETVAKRVEQAGIQ
FT                   AWWDLDIRDLLGDEADQYEKVPDTLDVWFDSGSTSYSVVDARPEFGGHSPDMYLEGSDQ
FT                   HRGWFMSSLMISVAMKGKAPYRQVLTHGFTVDGQGRKMSKSVGNVVSPQQVMNKLGGDI
FT                   LRLWVASTDYTGEMAVSDEILKRSADAYRRIRNTARFLLANLNGFDPRKDMVKPEDMVV
FT                   LDRWAVGCAKQAQDEIIAAYENYDFHEVVQRLMQFCSVEMGSFYLDIIKDRQYTAKADS
FT                   VARRSCQTALYHIAEALVRWMAPILSFTADEIWGYLPGERAQFVFTEEWYQGLFGLDTA
FT                   ESMNDAFWAELLKVRGEVNKVIEQARNDKKVGGSLEAAITLYADEALATQLDSLQDELR
FT                   FVLITSAARVQPLAQASADAVASELAGLKVGLSKAAGSKCPRCWHYSTAIGQDAAHPQL
FT                   CPRCVTNVAGQGEERKFA"
FT   gene            641445..641945
FT                   /gene="lspA"
FT                   /locus_tag="ETAE_0583"
FT   CDS_pept        641445..641945
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lspA"
FT                   /locus_tag="ETAE_0583"
FT                   /product="lipoprotein signal peptidase"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0583"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83430"
FT                   /db_xref="GOA:D0ZC29"
FT                   /db_xref="InterPro:IPR001872"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZC29"
FT                   /protein_id="ACY83430.1"
FT                   /translation="MMRRPLLSTGLRWLWIVVAVLIVDLGSKQLILQHFMLGETLPLFP
FT                   SLNLHYARNYGAAFSFLADSGGWQRWFFAGIAIAICVALLVMMYRSAASQRLNNIAYAL
FT                   IIGGALGNLFDRLWHGFVVDMIDFYVGSWHFATFNLADTAICIGAALVVLEGFLPQRDK
FT                   EKM"
FT   gene            641945..642412
FT                   /locus_tag="ETAE_0584"
FT   CDS_pept        641945..642412
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAE_0584"
FT                   /product="putative FKBP-type peptidyl-prolyl cis-trans
FT                   isomerases 2"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0584"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83431"
FT                   /db_xref="GOA:D0ZC30"
FT                   /db_xref="InterPro:IPR001179"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZC30"
FT                   /protein_id="ACY83431.1"
FT                   /translation="MPQAQATSAVLVHFTLTLEDGSLAESSRERGQPALFRLGDGSLSP
FT                   ALEAQLLGCRRGDRRAFTLAPADAFGERSDDLVQFFPLGQFRDSGEPQAGAVILFTAAD
FT                   GAQMPGLVREIVGESVTVDFNHPLAGMPVTFDLEVLAIDPPQGDEHAHSAG"
FT   gene            642393..643346
FT                   /gene="ispH"
FT                   /locus_tag="ETAE_0585"
FT   CDS_pept        642393..643346
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ispH"
FT                   /locus_tag="ETAE_0585"
FT                   /product="4-hydroxy-3-methylbut-2-enyl diphosphate
FT                   reductase"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0585"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83432"
FT                   /db_xref="GOA:D0ZC31"
FT                   /db_xref="InterPro:IPR003451"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZC31"
FT                   /protein_id="ACY83432.1"
FT                   /translation="MRILLANPRGFCAGVDRAISIVDRALAIYGAPIYVRHEVVHNRFV
FT                   VNDLRERGAVFIEEIGEVPDGAILIFSAHGVSQAVRAEAKARHLTMLFDATCPLVTKVH
FT                   MEVARASRRGTEAILIGHAGHPEVEGTMGQYSNPLGGMYLVESPQDVWQLQVKDERNLC
FT                   FMTQTTLSVDDTSEVIDALRARFPAIVGPRKDDICYATTNRQEAVRSLAAQADVVLVVG
FT                   SKNSSNSNRLAELARRAGKPAYLIDSASDINDAWLSGVGCVGVTAGASAPDVLVREVID
FT                   RLQALGGSAAQEMQGREENIVFEVPRELRIEVQQAD"
FT   gene            complement(643442..643996)
FT                   /locus_tag="ETAE_0586"
FT   CDS_pept        complement(643442..643996)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAE_0586"
FT                   /product="putative outer membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0586"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83433"
FT                   /db_xref="InterPro:IPR005247"
FT                   /db_xref="InterPro:IPR008914"
FT                   /db_xref="InterPro:IPR036610"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZC32"
FT                   /protein_id="ACY83433.1"
FT                   /translation="MFTKKALACLLVAGGLSLSAQAMTLSSPTVDNGKSLQNVQIFNGW
FT                   GCTGQNKSPALAWSDVPAGTKSFAVTMYDPDAPTGSGWWHWMMIDIPASVHSLAQNVGE
FT                   KESRDLPKGAIQLRNDFGYNGFGGACPPPGAKPHNYQITVYALNVAKLDIPAHASPAYA
FT                   GYFILQHKIGEARLTAPTNMR"
FT   gene            complement(644189..644674)
FT                   /gene="xdhC"
FT                   /locus_tag="ETAE_0587"
FT   CDS_pept        complement(644189..644674)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="xdhC"
FT                   /locus_tag="ETAE_0587"
FT                   /product="xanthine dehydrogenase, Fe-S binding subunit"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0587"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83434"
FT                   /db_xref="GOA:D0ZC33"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR002888"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR036884"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZC33"
FT                   /protein_id="ACY83434.1"
FT                   /translation="MNVKEWGEISCQINGKNYQFCVSPAMSLLEMLREHGLTSVKQGCC
FT                   VGECGACSVLIDGVATDSCLYLALWADGKQIVTAEGLGRTDSLSPIQQAYVDAGAVQCG
FT                   FCTPGLVVATHALLAKPRSRPLTHEEIRRGLSGNLCRCTGYQAIVRAVDLCQREEEQ"
FT   gene            complement(644671..645549)
FT                   /gene="xdhB"
FT                   /locus_tag="ETAE_0588"
FT   CDS_pept        complement(644671..645549)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="xdhB"
FT                   /locus_tag="ETAE_0588"
FT                   /product="xanthine dehydrogenase, FAD-binding subunit"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0588"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83435"
FT                   /db_xref="GOA:D0ZC34"
FT                   /db_xref="InterPro:IPR002346"
FT                   /db_xref="InterPro:IPR005107"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="InterPro:IPR036683"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZC34"
FT                   /protein_id="ACY83435.1"
FT                   /translation="MYDIKRYLRATSARHASELMLAHPDSRLLAGGTDVLIQLHHHNAQ
FT                   YAHIVDIHGLPELCGITTLDDGTLRIGSGTTFTQIIEHPLIQTHLPMLAEAAATIAGPQ
FT                   IRNVATYGGNICNGATSADSAAPSVALKAQLEILTPDGVTIRPIDGFHTGPGKVALSPG
FT                   EILLAFRFHPDDHRRAGSAYIKYAMRGAMDIATIGCAALCRIESGRFSELRLAYGVAAP
FT                   TPIRCPQAEACANGQPLSRQTLAAVAAAVAGDVSPRSSWRAEKEFRLHLIRTLAQRAIT
FT                   LAVQRAGGEIL"
FT   gene            complement(645556..647847)
FT                   /gene="xdhA"
FT                   /locus_tag="ETAE_0589"
FT   CDS_pept        complement(645556..647847)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="xdhA"
FT                   /locus_tag="ETAE_0589"
FT                   /product="xanthine dehydrogenase subunit XdhA"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0589"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83436"
FT                   /db_xref="GOA:D0ZC35"
FT                   /db_xref="InterPro:IPR000674"
FT                   /db_xref="InterPro:IPR008274"
FT                   /db_xref="InterPro:IPR036856"
FT                   /db_xref="InterPro:IPR037165"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZC35"
FT                   /protein_id="ACY83436.1"
FT                   /translation="MSLGSPLRRVDAEAKVTGQARYTDDMMMPGMLHACYVRSRIAHGN
FT                   VTAIDTREAESMPGVEAVFTFHDVPSAPFPTAGHAWSLEPGKRDIADRHLLTGHVRHFG
FT                   DGVAIVVARDLLSAERAAERVQVSYEALPVITRPLAALADNAPAIHPGGNLLRHSEIDA
FT                   GEPDARMAAADLQLEGHYETPVVQHCHMEGVTCYAYMEQPDHIVIVSSTQIPQIVRRTV
FT                   AQALGLPWSHVRVIKPYVGGGFGNKQDVLEEPMAAFLTQRLGGKPVKVSLSREECFVAT
FT                   RTRHAFSIDARLGMRRDGQLEGYRLTVLSNTGAYASHGHSIAAAGANKISYLYPRSAFG
FT                   YCADTVYTNLPAAGAMRGYGAPQVDFALECLMDDAAARLDLDPLEVRLRNVARQGDRNP
FT                   VNGKTIYSAGLTECLEKGRRLFEWDQRRAECLAQPADAPVRRGVGVACFSYGSNTYPVG
FT                   VEIAGARLLLNQDGTVNLQIGATEIGQGSDTVFAQMASETLGIPFKQIRVISTQDTDIT
FT                   AFDPGAFASRQSYVAAPAIRRAAEIMRQKILAHAALISHQPEWGLTLCDGNVVMAMQPD
FT                   QVLMSVADVAMQAYYHQEIGAQILAEVSHKTTTNPPAFGCTFVDLSIDIALCQVTINRI
FT                   LNLHDSGRILNPQLAEGQVHGGMGMGIGWALFEEMIIDEKSGVVRNPNLLDYKFPTCVD
FT                   LPDLECAFVETVEPQSAYGHKALGEPPIISPGPAIRNAIRMATGVAINALPITPKTLYR
FT                   EFVQAGLIRE"
FT   gene            complement(648100..648216)
FT                   /locus_tag="ETAE_0590"
FT   CDS_pept        complement(648100..648216)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAE_0590"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0590"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83437"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZC36"
FT                   /protein_id="ACY83437.1"
FT                   /translation="MVAFQVNGCLSPEPEKIGNNAKIHRRWPSAAAAAPLTA"
FT   gene            648295..649113
FT                   /locus_tag="ETAE_0591"
FT   CDS_pept        648295..649113
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAE_0591"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0591"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83438"
FT                   /db_xref="GOA:D0ZC37"
FT                   /db_xref="InterPro:IPR000846"
FT                   /db_xref="InterPro:IPR022663"
FT                   /db_xref="InterPro:IPR022664"
FT                   /db_xref="InterPro:IPR023940"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZC37"
FT                   /protein_id="ACY83438.1"
FT                   /translation="MAEQIRVAIAGAGGRMGRQLIAATAAIPGVTLGAALEREGSSLLG
FT                   CDAGELAGCGITGVTVESSLERVAGQFDVLIDFTRPEGTMAHLAFCQAHGKAMVIGTTG
FT                   FSEQEKATIEAASQHIAIVLAANFSVGVNVMLRLLEKAAQVMGSYCDIEILEAHHRHKV
FT                   DAPSGTALAMGEAIAGALGRRLESCAVYTRQGHTGERVPGSIGFATLRAGDIVGEHTAL
FT                   FADVGERLEITHKASSRMTFASGAMRAALWLGAQQPGMYDMCDVLALDTL"
FT   gene            649257..649463
FT                   /gene="dapB"
FT                   /locus_tag="ETAE_0592"
FT   CDS_pept        649257..649463
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dapB"
FT                   /locus_tag="ETAE_0592"
FT                   /product="dihydrodipicolinate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0592"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83439"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZC38"
FT                   /protein_id="ACY83439.1"
FT                   /translation="MPPPLRPRLDFFREKTHYSVIAFDICARQPFSPFLKLVFLVVWHQ
FT                   KHAKICKKHKKLPFHLDNERMHH"
FT   gene            649657..650736
FT                   /gene="carA"
FT                   /locus_tag="ETAE_0593"
FT   CDS_pept        649657..650736
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="carA"
FT                   /locus_tag="ETAE_0593"
FT                   /product="carbamoylphosphate synthase small subunit"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0593"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83440"
FT                   /db_xref="GOA:D0ZC39"
FT                   /db_xref="InterPro:IPR002474"
FT                   /db_xref="InterPro:IPR006274"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR035686"
FT                   /db_xref="InterPro:IPR036480"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZC39"
FT                   /protein_id="ACY83440.1"
FT                   /translation="MGEVVFNTSMTGYQEILTDPSYSRQIVTLTYPHIGNVGTNAADEE
FT                   SSAVHAQGLIVRDLPPIASNFRCQETLPDYLRRHRVVAIADIDTRKLTRLLREKGAMNG
FT                   CIITAESGCEPDAALALEKARAFPGLKGMDLAKEVTTQEPYEWRQGSWTLKDGLPAPSE
FT                   DAALPYHVVAYDFGVKRNILRMLVDRGCRLTVVPAQTSAQDVLALNPDGIFLSNGPGDP
FT                   APCDYAIEAIATFLRGEIPLFGICLGHQLLALASGAQTVKMKFGHHGGNHPVKDLDHDR
FT                   VMITAQNHGFAVDEATLPATLRATHKSLFDGSLQGIHRTDRPAFSFQGHPEASPGPHDA
FT                   APLFDHFMTLIENYRRTAK"
FT   gene            650756..653977
FT                   /gene="carB"
FT                   /locus_tag="ETAE_0594"
FT   CDS_pept        650756..653977
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="carB"
FT                   /locus_tag="ETAE_0594"
FT                   /product="carbamoylphosphate synthase large subunit"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0594"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83441"
FT                   /db_xref="GOA:D0ZC40"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005480"
FT                   /db_xref="InterPro:IPR005483"
FT                   /db_xref="InterPro:IPR006275"
FT                   /db_xref="InterPro:IPR011607"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR033937"
FT                   /db_xref="InterPro:IPR036897"
FT                   /db_xref="InterPro:IPR036914"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZC40"
FT                   /protein_id="ACY83441.1"
FT                   /translation="MPKRTDIKSILILGAGPIVIGQACEFDYSGAQACKALREEGYRVI
FT                   LVNSNPATIMTDPEMADATYIEPIHWEVVRKIIEKERPDAVLPTMGGQTALNCALELER
FT                   QGVLAEFGVTMIGATADAIDKAEDRRRFDQAMKKIGLDTARSGIAHSLEESLAVAEQVG
FT                   FPCIIRPSFTMGGTGGGIAYNREEFEEICARGLDLSPTNELLIDESLIGWKEYEMEVVR
FT                   DKNDNCIIVCAIENIDPMGIHTGDSITVAPAQTLTDKEYQIMRNASMAVLREIGVETGG
FT                   SNVQFAVNPKNGRLIVIEMNPRVSRSSALASKATGFPIAKVAAKLAVGYTLDELMNDIT
FT                   GGRTPASFEPSIDYVVTKIPRFNFEKFAGANDRLTTQMKSVGEVMAIGRTQQESLQKAL
FT                   RGLEVGASGFDPKVNLDDPQALTKIRRELKDAGAERIWYVADAFRAGLSVDGVFNLTNI
FT                   DRWFLVQIEELVRLEERVADVGINGLTPDFLRQLKRKGFADARLARLAGVAESEIRKLR
FT                   HKQGLHPVYKRVDTCAAEFATDTAYLYSTYEEECEANPTHDRPKIMVLGGGPNRIGQGI
FT                   EFDYCCVHASLALREDGYETIMVNCNPETVSTDYDTSDRLYFEPVTLEDVLEIVAVERP
FT                   QGVIVQYGGQTPLKLARALEAAGVPVIGTSPDAIDRAEDRERFQQAVNRLGLKQPANAT
FT                   VTAIEQAVEKGAQIGYPLVVRPSYVLGGRAMEIVYDESDLRRYFQTAVSVSNDAPVLLD
FT                   HFLDDAVEVDVDAICDGERVLIGGIMEHIEQAGVHSGDSACSLPAYTLSAEIQDELRRQ
FT                   AEKLAMELCVRGLMNVQFAVKDNQVYLIEVNPRAARTVPFVSKATGVPLAKVAARVMVG
FT                   QTLAQQGMTEEVIPPYYSVKEVVLPFAKFPGVDPILGPEMRSTGEVMGVGRTFAEAFAK
FT                   AMLGSQSQVKTPGRALLSVREGDKHRVVDLAAKLLKQGFELDATHGTAVVLGEAGINPR
FT                   LVNKVHEGRPHIQDRIKNGEYTYIVNTTAGRQAIEDSKLIRRSALRYKVHYDTTLNGGF
FT                   ATAMALNADPTEQVISVQEMHARLK"
FT   gene            654200..654970
FT                   /locus_tag="ETAE_0595"
FT   CDS_pept        654200..654970
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAE_0595"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0595"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83442"
FT                   /db_xref="GOA:D0ZC41"
FT                   /db_xref="InterPro:IPR010619"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZC41"
FT                   /protein_id="ACY83442.1"
FT                   /translation="MESDRQREITRLCIHCALFLLQHGAESMLVEQLSTRLGLALGVDS
FT                   VESSISANAVVLTTIKGGRCLTSTRKNVDRGINMHVVTEVQHIVIMAEHRLLDMSDVRR
FT                   RLEHIRPLRYPRALVVLMVGLSCACFCKLNGGGWDGALVAFFASAVAMYARQLMTHRQL
FT                   NPLINFCITAFIATSVSGALLQLSAFAETSLIAMAASILLLVPGFPLINAVADMFKGHV
FT                   NTGLARWAMATLLTLATCLGVVMALSLWGLQGWA"
FT   gene            654967..655434
FT                   /locus_tag="ETAE_0596"
FT   CDS_pept        654967..655434
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAE_0596"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0596"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83443"
FT                   /db_xref="GOA:D0ZC42"
FT                   /db_xref="InterPro:IPR020914"
FT                   /db_xref="InterPro:IPR024528"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZC42"
FT                   /protein_id="ACY83443.1"
FT                   /translation="MMTLLLQLLQDMLLAAIPALGFAMVFNVPNRALRYCALLGAIGHG
FT                   SRLLLITLGLNIEWASLMAAILIGIIGIQWSRWLLAHPKVFTVAAVIPMFPGIYAYRAM
FT                   IAVVEISRSGYSEPLFASMVTNFLKASFIVGALSIGLSLPGIWLYRKRPGV"
FT   gene            655563..656045
FT                   /gene="folA"
FT                   /locus_tag="ETAE_0597"
FT   CDS_pept        655563..656045
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folA"
FT                   /locus_tag="ETAE_0597"
FT                   /product="dihydrofolate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0597"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83444"
FT                   /db_xref="GOA:D0ZC43"
FT                   /db_xref="InterPro:IPR001796"
FT                   /db_xref="InterPro:IPR012259"
FT                   /db_xref="InterPro:IPR017925"
FT                   /db_xref="InterPro:IPR024072"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZC43"
FT                   /protein_id="ACY83444.1"
FT                   /translation="MIISLIAALSADRVIGLDNAMPWHLPADLAWFKRNTLAKPVIMGR
FT                   KTYESIGRPLPGRHNIVISRRAGCDDRVTWVTTPQAALEAAAEAQEVMIIGGGSIYSQF
FT                   LPQASRLYLTHVDADVAGDTYFPDYAPDEWQTCFSEFHDADSDNSHAYCFEILDRR"
FT   gene            complement(656294..657133)
FT                   /gene="apaH"
FT                   /locus_tag="ETAE_0598"
FT   CDS_pept        complement(656294..657133)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="apaH"
FT                   /locus_tag="ETAE_0598"
FT                   /product="diadenosinetetraphosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0598"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83445"
FT                   /db_xref="GOA:D0ZC44"
FT                   /db_xref="InterPro:IPR004617"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZC44"
FT                   /protein_id="ACY83445.1"
FT                   /translation="MSTLLIGDVHGCYHELRDLLSLAGFDPARDTLWLTGDLVARGPDS
FT                   LAVLRYVKSLGDSVRLVLGNHDLHLLAVYAGISRNKPKDKLTPLLEAPDADSLINWLRR
FT                   QPVLQVDSDLHLVMAHAGISPQWDLATAQRCAREVEAMLASDSYPFFLNAMYGDMPNNW
FT                   SESLSGLARLRFTTNALTRMRYCFPGGELDMICKDAPDDAPAPLRPWFDLDSPVRGSGY
FT                   SIAFGHWASLEGRGTPPQVYALDTGCCWGGTLTALRWEDRRSFSVPSRRASRHAKAE"
FT   gene            complement(657138..657515)
FT                   /gene="apaG"
FT                   /locus_tag="ETAE_0599"
FT   CDS_pept        complement(657138..657515)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="apaG"
FT                   /locus_tag="ETAE_0599"
FT                   /product="ApaG (protein affecting Mg2+/Co2+ transport)"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0599"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83446"
FT                   /db_xref="InterPro:IPR007474"
FT                   /db_xref="InterPro:IPR023065"
FT                   /db_xref="InterPro:IPR036767"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZC45"
FT                   /protein_id="ACY83446.1"
FT                   /translation="MLDAPRIIVQVQSVYAESQSLPEEARFVFAYTVTLRNLGRFNVQL
FT                   LRRYWLITNGNGRQTEVQGEGVIGEQPLILPSGEFQYTSGAIIETPCGTMEGHYEMVDH
FT                   QGHTFRIAIPVFRLAIPSLIN"
FT   gene            complement(657540..658343)
FT                   /gene="ksgA"
FT                   /locus_tag="ETAE_0600"
FT   CDS_pept        complement(657540..658343)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ksgA"
FT                   /locus_tag="ETAE_0600"
FT                   /product="dimethyladenosine transferase (rRNA methylation)"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0600"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83447"
FT                   /db_xref="GOA:D0ZC46"
FT                   /db_xref="InterPro:IPR001737"
FT                   /db_xref="InterPro:IPR011530"
FT                   /db_xref="InterPro:IPR020596"
FT                   /db_xref="InterPro:IPR020598"
FT                   /db_xref="InterPro:IPR023165"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZC46"
FT                   /protein_id="ACY83447.1"
FT                   /translation="MHQGHLARKRFGQNFLTDQFVIDSIVSAINPLPGQAVVEIGPGLG
FT                   ALTEPVADRMDKMTVIELDRDLAERLSTHPFISRKLTIRQQDAMTVDFSEMAREAGQPL
FT                   RVFGNLPYNISTPLMFHLFSYASAIGDMHFMLQKEVVNRLVAGPDSKTYGRLSVMAQYY
FT                   CQVIPVLEVPPSAFRPAPKVDSAVVRLIPHRELPYPVSDVRVLSRITTEAFNQRRKTVR
FT                   NSLGHLFSADQLSALGIDPARRAETLSVADYCRLANWLCEHPQAQ"
FT   gene            complement(658348..659340)
FT                   /gene="pdxA"
FT                   /locus_tag="ETAE_0601"
FT   CDS_pept        complement(658348..659340)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pdxA"
FT                   /locus_tag="ETAE_0601"
FT                   /product="4-hydroxythreonine-4-phosphate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0601"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83448"
FT                   /db_xref="GOA:D0ZC47"
FT                   /db_xref="InterPro:IPR005255"
FT                   /db_xref="InterPro:IPR037510"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZC47"
FT                   /protein_id="ACY83448.1"
FT                   /translation="MAPIRRIVITPGEPAGVGPELIVQLAQRPWPAELVVCADPSLLEV
FT                   RARALGLPLTLRRYDPALPAQAQQAATLTVLPIPLEADVIPGELNVANGNYVVATLARA
FT                   CDGCLSGEFAALVTGPVHKGIINDAGVPFTGHTEFFADRSGCPRVVMMLASEHLRVALA
FT                   TTHLPLQEVPAAITPQTLREVITILDADLRRRFGLHQPHIYVCGLNPHAGEGGHMGREE
FT                   LDIIIPTLDALRASGIRLTGPLPADTLFQPKYLDDADAVLAMYHDQGLPVLKYQGFGHA
FT                   VNITLGLPFIRTSVDHGTALDLAASGQAQPGSFITALNLAIEMTNHSNE"
FT   gene            complement(659345..660652)
FT                   /gene="surA"
FT                   /locus_tag="ETAE_0602"
FT   CDS_pept        complement(659345..660652)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="surA"
FT                   /locus_tag="ETAE_0602"
FT                   /product="peptidyl-prolyl cis-trans isomerase SurA"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0602"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83449"
FT                   /db_xref="GOA:D0ZC48"
FT                   /db_xref="InterPro:IPR000297"
FT                   /db_xref="InterPro:IPR015391"
FT                   /db_xref="InterPro:IPR023034"
FT                   /db_xref="InterPro:IPR023058"
FT                   /db_xref="InterPro:IPR027304"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZC48"
FT                   /protein_id="ACY83449.1"
FT                   /translation="MKNWRTLILGVALCANTAFAAPQVVDKVVAIVDNGVVLESDVDGM
FT                   MKSVKLNAQQADQQLPDNATLRHQILERLIMDNVQLQMAKRMGLEISDSELDNAINGIA
FT                   QQNHISMQQLRSRLAADGLDYKTYRAQIRKEMLISEVRNNEVRRRVTILPQEVDALAKQ
FT                   IGSQNSGETAVNLSHILIPLPENPTQQQVSEAQQQAESLIQQLHQGASFAKLAAAYSAD
FT                   PQALKGGEMGWGRLQELPTLFAEALQSAKKGDIVGPIRSGVGFHILRVNDLRGDQANVS
FT                   VTEVHARHILLRTSPVMSDAQARAKLEALSAQITSGKITFEQAAKEYSQDPGSAQKGGD
FT                   LGWAVPSMYDPAFRDALMKLNKGEISQPVHSNFGWHLIQLLGTRQVDRTDEAQKERAYR
FT                   MLFNRKFAEEAQTWLQEQRAAAYVKILGNNSANGAQ"
FT   gene            complement(660773..663160)
FT                   /gene="imp"
FT                   /locus_tag="ETAE_0603"
FT   CDS_pept        complement(660773..663160)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="imp"
FT                   /locus_tag="ETAE_0603"
FT                   /product="organic solvent tolerance protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0603"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83450"
FT                   /db_xref="GOA:D0ZC49"
FT                   /db_xref="InterPro:IPR005653"
FT                   /db_xref="InterPro:IPR007543"
FT                   /db_xref="InterPro:IPR020889"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZC49"
FT                   /protein_id="ACY83450.1"
FT                   /translation="MTESLTPRMKKSIPTLIATLVWSALYSQHALASLAEQCLIGVPVY
FT                   DKPLVSGDINSLPVHITADKSEANYPNNALFHGNVDIQQGNSTLTADKVQLDQKAIQGH
FT                   PDPLRTVTAIGNVHYADSQIRLQGPSAWSNLNNKDTNVWRGDYQFVGRQGRGDADLMKT
FT                   RDANRYTILDNGTFTSCLPGDNSWSIAGSEIIQDRQEQVAEIWNARFKIGPVPVFYSPY
FT                   LQFPTGSTRRSGFLIPTINYSNGDGIEFTLPWYWNIAPQADATFTPHYMEKRGLQLQNE
FT                   FRYLSEFGMGLVEFDWLGNDRQFQQDRQNQGITGQALDDLKNRDRWLFYWRHFGVLDHW
FT                   RFGVDYTKVSDPYYFTDLNSAYGSSTSGYATQKFTLGYAETNWNATLSTTQFQVFANAG
FT                   DVNAYRTAPQLDLNYYKNDLGPFDFTLYGQAVKFTNDNVYLPEADRYHVEPVLSLPLSN
FT                   RWGSINTEAKLMATHYQQDVPTQGNLTQLKDNVNRVMPEFKIDGKMVFERDATLLNGYT
FT                   QTLEPRAQYLYIPYRNQSDIYSYDSTLLQTDYTGLFRDRSYSGLDRIASANQVTTGLTT
FT                   RLYDDEQNERFNASIGQIYYFSPSRTGDETTNIDRHDNTGSLVWAGDSYLKLTDNWGLR
FT                   GGLQYDTRLNSVALGNAVMEYRKDAESVLQLSYRYASPEYITSMLPSYANNAIYNQGIS
FT                   QAGIIGSLPLADRWAMVAGYYYDTKAKQSADAIAGLQYNTCCWSVGVTYERKINSWDSA
FT                   TQNSKYDNKFSFKFALRGMNQNYSLGTAEMLRSGILPYQRAF"
FT   gene            663318..664154
FT                   /gene="djlA"
FT                   /locus_tag="ETAE_0604"
FT   CDS_pept        663318..664154
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="djlA"
FT                   /locus_tag="ETAE_0604"
FT                   /product="DnaJ-domain-containing proteins 1"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0604"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83451"
FT                   /db_xref="GOA:D0ZC50"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR007791"
FT                   /db_xref="InterPro:IPR023749"
FT                   /db_xref="InterPro:IPR029024"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZC50"
FT                   /protein_id="ACY83451.1"
FT                   /translation="MRYWGKLVGVLLGLMAGIGFWGVVLGFLIGHMFDKSRAIKRQGYF
FT                   ANQQQRQGLFFRTTFQVMGHLTKSKGRVTEADIQVASMFMDRLNLHGDARLMAQQAFRE
FT                   GKEPGYPLRERLRELRSVCFGRIDLIRIFLEIQLQAAFADGQLHPNERAVLYVIAEELG
FT                   FSRAQFDQFLGMMEGGRQFGGGYHQAGGQQGGYQQGGFYTPPQGPTLEDACKVLGVAPS
FT                   ADATTIKRAYRKLMSEHHPDKLVAKGLPPEMMELAKQKAQEIQAAYDLIKKEKGFK"
FT   gene            complement(664231..664938)
FT                   /gene="rluA"
FT                   /locus_tag="ETAE_0605"
FT   CDS_pept        complement(664231..664938)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rluA"
FT                   /locus_tag="ETAE_0605"
FT                   /product="ribosomal large subunit pseudouridine synthase A"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0605"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83452"
FT                   /db_xref="GOA:D0ZC51"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR006224"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZC51"
FT                   /protein_id="ACY83452.1"
FT                   /translation="MGRRTPAGGALPPSATPALEHYDPPREPWLHVLYQDAHIIVVNKP
FT                   SGLLSVPGRLPEHQDSILTRIQAQFPGAESVHRLDMATSGVLVVALTKDAERELKRQFR
FT                   EREPKKNYVARVWGHPQQDEGVIDLPLICDWPNRPKQKVCFEQGKPAQTEYQVLARDAD
FT                   GTARVLLTPITGRSHQLRVHLLALGHPILGDGFYAPPQALALASRLLLHAQELRIVHPA
FT                   FATPMHFRCEADF"
FT   gene            complement(664938..667844)
FT                   /gene="hepA"
FT                   /locus_tag="ETAE_0606"
FT   CDS_pept        complement(664938..667844)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hepA"
FT                   /locus_tag="ETAE_0606"
FT                   /product="ATP-dependent helicase HepA"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0606"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83453"
FT                   /db_xref="GOA:D0ZC52"
FT                   /db_xref="InterPro:IPR000330"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR022737"
FT                   /db_xref="InterPro:IPR023949"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038718"
FT                   /db_xref="InterPro:IPR040765"
FT                   /db_xref="InterPro:IPR040766"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZC52"
FT                   /protein_id="ACY83453.1"
FT                   /translation="MPFTLGQRWISDTESELGLGTVVALDARMVTLLFPATGENRLYAR
FT                   NDSPITRVMFNPGDTITTHEGWQLCVEEVQEQEGLLTYIGSRSDSGESPVAVREVLLDS
FT                   RLTFSKPQDRLFAGQIDRMDRFALRYRARKYQSEQFRLPCSGLRGMRASLIPHQLHIAR
FT                   DVGQRHAPRVLLADEVGLGKTIEAGMIIHQQLLSGRAERVLIVVPETLQHQWLVEMLRR
FT                   FNLRVALFDDERYAEAAQDSSNPFETEQLVICSLDFVRRSRQRLEQLADASWDLLVVDE
FT                   AHHLAWSEQAPSREYQVIEQLAEQIPGVLLLTATPEQLGQESHFARLRLLDPNRFHDYA
FT                   QFIAEQQRYRPVADAVTLLLNDGHLQQDELNMLSEMVAEQDIEPLLKAANAGGEDSQQA
FT                   RAELVRMLMDRHGTSRVLFRNTRQGVKGFPQRTLHQITLPLPAQYQTAIKVSGIMGSKK
FT                   SVEAQANDMLYPERIYQEFEGENATWWNFDPRAEWLLDFLLTQRDEKVLVICAQAATAI
FT                   HLEQLLREREGIRAAVFHEGMSLIERDRAAAYFASQEEGAQVLLCSEIGSEGRNFQFAN
FT                   RLVMFDLPFNPDLLEQRIGRLDRIGQARDIQIYVPCLEGTAQSVLIRWYHQGLDAFEHT
FT                   CPTGRTIYDRYYDTLLEFLAKPTQLDGFDDFIKTCRADHDTLKSQLEKGRDRLLEMHSN
FT                   GGEAALALAESIAAQDNDVNLVNFALNLFDIVGINQEDRSDSLIVLTPSDHMLVPDFPG
FT                   LPQDGCTVTFDREQALSREDAQFISWEHPLMRNGLDLILSGDTGSSAVSLLKNKALPVG
FT                   TLLLEAVYVVEAQAPKQLQLTRFLPPTPVRMLLDAKGNNLAAQVEFESFNRQLNAVNRH
FT                   TASKLVNAVQPNVHAMLQSGEALIADQAQALIDAAKREADEALSAELARLESLKAVNPN
FT                   IRDDELETLEFTRRKVLETLDQAGWRLDALRLIVVSHQ"
FT   gene            complement(668108..670447)
FT                   /gene="polB"
FT                   /locus_tag="ETAE_0607"
FT   CDS_pept        complement(668108..670447)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="polB"
FT                   /locus_tag="ETAE_0607"
FT                   /product="DNA polymerase II"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0607"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83454"
FT                   /db_xref="GOA:D0ZC53"
FT                   /db_xref="InterPro:IPR006133"
FT                   /db_xref="InterPro:IPR006134"
FT                   /db_xref="InterPro:IPR006172"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR017964"
FT                   /db_xref="InterPro:IPR023211"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR042087"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZC53"
FT                   /protein_id="ACY83454.1"
FT                   /translation="MNTPHAGFILTRHWRDTPQGVCVTLWLATEHGPRCLTLPPEPAVA
FT                   FMDAAQRNAALRLLRGFPDVELRPVALRDFHHRPVLALYCRGYRQLQQIERRLGEQGIP
FT                   LLETDIRPADRYLMERFINAPLWFCGDAAGTEARIKPHPHYRPTLRTVSLDIETSPQGE
FT                   IYSIGLHGCDQRIVYMLGPANGDAQALDFTLEYVASRAALLDALNRWIARHDPDAIIGW
FT                   NLVQFDLRILQRHAEREGVPLLLGRAATPLEWREHGFRAGHFFASAPGRLIIDGIEALK
FT                   SAFWHFPSYSLDSVAQTLLGEGKVLDDPYRRMAEIARRFRQDKPALAHYNLKDCELVTR
FT                   IFAHTALMPFLLERASVTGLAPDRSGGSVAAFCHLYLPRMHRLGYVAPSLGEVAPQASP
FT                   GGFVMASRPGLYDSVLVLDYKSLYPAIIRSFLIDPVGLAVGGEQPDDTHSVPGFLGARF
FT                   SRTRHALPEIVRQLWQGREAAKRQDNAPLSQALKILMNAFYGVLGTSACRFFDPRLASS
FT                   ITLRGHEIMRQTRSLIEAQGYAVIYGDTDSTFVWLGKPHDEAQAEAIGQALAERVNAWC
FT                   REHLSQQYGLESALELEYECHYRRFLMPTLRGADLGSKKRYAGLCGDRLVFKGLETVRS
FT                   DWTPLAQRFQQELYRRVFLGQSYRDVIRRYADGLLAGEFDDQLIYRKRLRRPLAEYQRN
FT                   VPPHVRAARLADDYNHRLGRPLQYQNGGWISYIITRSGPQPLECVDAPADYQHYLERQL
FT                   QPVADAILPFLGDDFETLLTGQLGLF"
FT   gene            complement(670574..671287)
FT                   /gene="thiQ"
FT                   /locus_tag="ETAE_0608"
FT   CDS_pept        complement(670574..671287)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiQ"
FT                   /locus_tag="ETAE_0608"
FT                   /product="thiamin transporter ATP-binding subunit"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0608"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83455"
FT                   /db_xref="GOA:D0ZC54"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005968"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZC54"
FT                   /protein_id="ACY83455.1"
FT                   /translation="MIRLDNLLYRYQQQTLSFSLHAAAGERIAILGPSGAGKSTLLSLI
FT                   AGFLAPSSGDLYLNSIDCRCAPPSQRPVSMLFQEHNLFAHLTIAQNLGLGLDPGLRLDD
FT                   DQRRRLADIAELVGIHDYLPRLPGQLSGGQRQRAALARCLLRRQPILLLDEPFSALDPA
FT                   LRAEMLTLLDDVCRQRQLTLLMVSHNLDDAARIAPRTLVIDDGHIAYDGPTAALLTGSV
FT                   AAARLLGRKVPEQAE"
FT   gene            complement(671284..672891)
FT                   /gene="thiP"
FT                   /locus_tag="ETAE_0609"
FT   CDS_pept        complement(671284..672891)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiP"
FT                   /locus_tag="ETAE_0609"
FT                   /product="thiamin transporter membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0609"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83456"
FT                   /db_xref="GOA:D0ZC55"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR005947"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZC55"
FT                   /protein_id="ACY83456.1"
FT                   /translation="MAKRPEPLIPRWLWPGALAASLLLGIALLAFGALWYSAPAAAPAA
FT                   LWRDGYLWHVVRFSFWQALLSTLLSLLPAIALAIALFRRRFPGRTLLLRLCAMTLVLPV
FT                   LVAVFGLLSVYGRQGWLALLCQTLGIDYRFSPYGLQGILLAHVFFNLPLATRLLLQALE
FT                   SIPVEQRQLAAQLGMSPRQILRFVEWPYLRRQLPPAGALIFMLCFSSFATVLSLGSGPQ
FT                   ATTIELAIYQALSYDYDPARAAQLALLQLGCCLGLVLLSQRLSGILPVGHTRRMRWRDT
FT                   RDSLRLKLSDTLTIGLALLLLLPPLLAVIVDGLNQALGSVLRQPALWQALGTSLYIALG
FT                   AGALAVTLTMMLLWSSRELSLRGQRWRAQGMELCGMLILAMPGIVLATGFFLLLNATIG
FT                   LPTSPGLLVMVTNALMAIPYAMKVLEYPMRDLAERYDPLCLSLRIGGLNRLRWIELRAL
FT                   RRPLAQALAFACVLSLGDFGVVALFGSEQFRTLPFYLYQQLGAYRSADGAVTALLLLLF
FT                   CLTLFSLLERLPAGRKSP"
FT   gene            complement(672867..673862)
FT                   /gene="tbpA"
FT                   /locus_tag="ETAE_0610"
FT   CDS_pept        complement(672867..673862)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tbpA"
FT                   /locus_tag="ETAE_0610"
FT                   /product="thiamin transporter substrate binding subunit"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0610"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83457"
FT                   /db_xref="GOA:D0ZC56"
FT                   /db_xref="InterPro:IPR005948"
FT                   /db_xref="InterPro:IPR005967"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZC56"
FT                   /protein_id="ACY83457.1"
FT                   /translation="MLKKLFSTLALLTASLLAQAADKPVLTVYTYDSFAADWGPGPKIK
FT                   QAFEQSCHCELKLVPLEDGVAILNRLRMEGKNSPADVVLGLDNNLLTAARHSGLFSPSQ
FT                   TDTRGLQIPGGWHDANFVPYDYGYFAFVYDRQRVNNPPTSLKQLVEGPEKWRVIYQDPR
FT                   TSTPGLGLLLWMQKVYGDQAPAAWQKLAQKTVTVTKGWSEAYGLFLKGEADMVLSYTTS
FT                   PAYHQIEEHSDRYAAAMFDEGHYLQVEVAGVLKHSPQPALAHQFMQFITTPAFQNAIPT
FT                   GNWMYPTTAVALPPAFAALPKPQKTLSFTADDVAQHRAEWIRAWQSALSR"
FT   gene            complement(674044..675723)
FT                   /locus_tag="ETAE_0611"
FT   CDS_pept        complement(674044..675723)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAE_0611"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0611"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83458"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR025370"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZC57"
FT                   /protein_id="ACY83458.1"
FT                   /translation="MATPRLQHQFIRLWQHCQGNGCDTTLAELAAALNCSRRHVRTLLN
FT                   AMQQQGWLSWQAVSGRGKRSRLAFLCSALEVQQLRAEELMEQDHFEQLVQLVGDRDSAR
FT                   QMLLAQLGRSFRQGRHILRILYYRPLLGLQPASPLRRSETHLARQIFSGLTRINEENGE
FT                   LESDLAHHWQPLTPLHWRFYLRPAIHFHHGRELTMTDVIASLERLRTLPLFRHIAQVAS
FT                   PTPHVIDIHLLAEDAWLPWLLGSVPAMILPQEWQEMRDFARLPVGTGPYQVVRNTQSQL
FT                   KIRAFDGYFGYRALIDEVNIWVLPEISEALVHAGVQLQADGSGGDELESRLEEGCYFML
FT                   FDQRSAQMHDPAVRAWLCQTINPIALLNNASHLHQRYWSPAYGLLPRWHHNKMLSDRPK
FT                   PPQLTHLRITFYSEHSEFHALYQALQPLLATHGVTLEMQEIDYTRWHDGAAESDLWLGS
FT                   ANFYLPLEFSIFAMLYELPLLSHCTGLDLASEACRWREQRLPVAEWSQQLVQRHQLHPL
FT                   FHHWLKLHGQHSMRGVRMNTLGWFDFKSAWFAPPEHPPAASR"
FT   gene            676058..677530
FT                   /locus_tag="ETAE_0612"
FT   CDS_pept        676058..677530
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAE_0612"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0612"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83459"
FT                   /db_xref="GOA:D0ZC58"
FT                   /db_xref="InterPro:IPR001898"
FT                   /db_xref="InterPro:IPR030676"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZC58"
FT                   /protein_id="ACY83459.1"
FT                   /translation="MDKLTPLKPLPALIALAITLTLWFIIPAPAGVSANAWQLLALFVG
FT                   TIAAIIGKALPIGAVSVVAIALVALTGVTAPGKPAAALNDALSGFSNALIWLIGISIMV
FT                   SQSLNKTGLGERIGYWFIALCGKRTLGIAYGLALAETSLAPVTPSNTARGGGIIHPIMR
FT                   SIADSFGSHPQPGSTEKIGRYLSLVNYNINPITSAMFITATAPNPLIVNLIAKGTGHEF
FT                   ELTWGAWALAALLPALLSLLLMPLVVYWLYPPQIRHTPDAPRFARERLRALGPISLAEK
FT                   ITLAVFLLLLVLWADIPAWLLGDGWSVNATTAAFIGLAILLCSGVLSWDDLLKCKGAWD
FT                   TVMWFAALVMMATFLGKLGLIAWLSQSVSALIDGMGMHWVGGMLLLTLVYVYAHYFFAS
FT                   TTAHITAMFAAFFAAGLALGVPPALFALVLAFSSSLMMSLTHYGTGTAPIIFGSGYVTL
FT                   GEWWKTGFILSAVNLALWLSVGSLWWHWLGYW"
FT   gene            complement(677573..679402)
FT                   /locus_tag="ETAE_0613"
FT   CDS_pept        complement(677573..679402)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAE_0613"
FT                   /product="putative hemolysin secretion ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0613"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83460"
FT                   /db_xref="GOA:D0ZC59"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZC59"
FT                   /protein_id="ACY83460.1"
FT                   /translation="MFHWFERLTEPFPSPDPQKPPATLFGFCRHYTRGFERPLGAMALL
FT                   SAAVAVCEVMLLRYLGELVDLLSHAERATFWTDQRPSLIGMAILVLAVMPLLAWLHSNL
FT                   LHQSILGNYPMAVRWQVHRYLLGQSIAFFQRDFAGRVATKVMQSAQSVREVVMKMVDLL
FT                   IYILVYLISVLVMIASVDTLLLIPLLLWLATYILIQIRLLPRLRRIASEQANAQSVMSG
FT                   TIVDTYTHITTVKLFSHDQRESDYARHAMQRYLATVYRQMRTLTGLLFSVDIINYLLLF
FT                   SLAALSIALWQQQAVSVGVIAVGISLALRLQGMSKWIMWEVRALFESIGQVIDSIHTVA
FT                   NDIDVADKPGAVPLRLTRGEIRFNAVGFGYPGGRTLFDRLDLHIRPGEKVAIVGRSGAG
FT                   KSSLMHLLLRFYDLQSGSITLDAQNIAEVTQTSLRRQIGMITQDTALLHRSIRENLLYG
FT                   NPQASEAEMIAACRRAEAHDFICQLADDTGQRGYDTQVGERGVKLSGGQRQRIAIARVL
FT                   LKDAPILIMDEATSALDSEAEAAIQDNLAQMMAGKTVIAIAHRLSTIAAMDRLIVMDHG
FT                   RIVAQGSHRELLRQNGIYARLWAHQTGGFIGSD"
FT   gene            679514..680287
FT                   /locus_tag="ETAE_0614"
FT   CDS_pept        679514..680287
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAE_0614"
FT                   /product="ABC-type cobalamin/Fe3+-siderophores transport
FT                   system, ATPase component"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0614"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83461"
FT                   /db_xref="GOA:D0ZC60"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZC60"
FT                   /protein_id="ACY83461.1"
FT                   /translation="MFSLTNLEVVRGGREVLAIEHLTIPTDRLTVILGHNGSGKSTLVS
FT                   LLAGQLRPDGGQIALDGQALSSLSAGALARRVAFLPQKLPASAGLTVRELVRLGRFPWR
FT                   GMLGRWRREDRQLIDAAMAETGVAPFADTLVDTLSGGERQRAWVAMLLAQASPLLILDE
FT                   PTSALDIQHQYQLMALLSALPRGVLVILHDLNLALRYADHVIALKQGRVAFAGSAAALA
FT                   DEQRLSDLYQTPIRLTDHPHPTPGAPPHKVAIICA"
FT   gene            680287..681210
FT                   /locus_tag="ETAE_0615"
FT   CDS_pept        680287..681210
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAE_0615"
FT                   /product="ABC-type Fe3+-hydroxamate transport system,
FT                   periplasmic component"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0615"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83462"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZC61"
FT                   /protein_id="ACY83462.1"
FT                   /translation="MFNFIFRFFAPLALLISLFSFSAQALTVSDSRGTHQLPAVPTRAV
FT                   VLDWDLLEQTIELGVTPLAATDLDSYREWVAQPLIPAQTQSVGSREEPNLERIAALKPD
FT                   VILASEMQQALLPRLTQIAPVLYYTNFSAADDHAAVAIMQFRQLAQVFGREAIAEQKLA
FT                   AMQARFQHLSRALREAFHGQLPAVTVMRFASTTSTYLYTSNAMPVYVLRQLGITPALAP
FT                   PPARWGIVQQPIAGLQRVGQGYVLYFLPFHDAARLDATRLWQAMPFVRGQRVSAVRPVW
FT                   SYGGAMSLQYAAEAMAESLMALAAQK"
FT   gene            681207..683201
FT                   /locus_tag="ETAE_0616"
FT   CDS_pept        681207..683201
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAE_0616"
FT                   /product="ABC-type Fe3+-siderophore transport system,
FT                   permease component"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0616"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83463"
FT                   /db_xref="GOA:D0ZC62"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZC62"
FT                   /protein_id="ACY83463.1"
FT                   /translation="MSGGVRLAAPLLLLALAVASLQWAQPLTLLQQWQLLLAPQQAQSL
FT                   DDILWLYSQLPRLAITLLVGATLGLAGSVMQQLTQNELMSPLTMGTSSGAWLALVLLAA
FT                   FWPAQQAQWGALAAMGGALLAFALIVLIVGLDNMTGLPMVIAGMVINILLGALASAVLL
FT                   LQHPYAQNIFLWGSGELAQSDWGWVRWLLPRLAPALLLLLFAPRVLQLLRLGHQGAQAR
FT                   GVAVVPLFFALMLLTIWLVSAAVTAVGLIGFIGLLTPNIVRALGVRTPRGELYASLLGG
FT                   ALLLLLTDALAQGASLWLGQLLPTGVVAAAIGAPALILFSRRRLSAPDGLGAPLISARG
FT                   RVSRWVSAALAALFALALLGYLTYQPEAAGWPFAWPQAYQWALRWPRALAALSCGVALA
FT                   LAGVLLQRLIYNPLASPDLLGVSSGATLTLVLAMLWCGQTLTALLQWGVGLAGSLAVLA
FT                   ALMALGRRQRYAPASVILTGIAMTALLQALVQFCLAQGSQDSYRILQWLAGSTYRVTAA
FT                   QALLLSALTALLLLLALSVARALTLLSIGRAFSQARGLNSARAAALLLVLVALLCAIAT
FT                   AAIGPVAFVGLMAPHLAQMLGARTAKAQMGLAALLGAATLLWADWLGQALLYPRAMAAG
FT                   TLVAIIGAAYFLLLLIVGRLTRRRLQRVA"
FT   gene            683250..685478
FT                   /locus_tag="ETAE_0617"
FT   CDS_pept        683250..685478
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAE_0617"
FT                   /product="TonB-dependent receptor"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0617"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83464"
FT                   /db_xref="GOA:D0ZC63"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010105"
FT                   /db_xref="InterPro:IPR010917"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR030149"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039423"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZC63"
FT                   /protein_id="ACY83464.1"
FT                   /translation="MFLRNYYKNHFYFCFIYIREIMSSLRLSRMGVGLFGAISVGCTSV
FT                   AMAEESARPADEITVSGSQVALGDSYEGGQVARTGRLGMLGNSDFMDAPFTLTSYTSAL
FT                   IEQQQAASVADVLQNDSTVRVAKGFGNFQELYMIRGFPVYSDDMTLNGVYGILPRQFVA
FT                   AEMLERVEVLRGANTFLNGAAPGGSAVGGMVNLVPKRAGHAPLTRVTGGVQGDGQGYAA
FT                   LDVARRFGDDEANGIRVNLVGRDGKSAVAREKQRLGALSVGFDHRRDRLQLSADIGYQD
FT                   HHIDAPRPSVTPGGPTLPAAPSANKNYAQDWTYTDEKQLFGVVRGEYLLNDSTRVWLGA
FT                   GARQGKEHNLLANPTADGDGVLSAYLFENVRQDNVLSADVGVRHDLTTGRVNHTLVLSA
FT                   AAYQLRSKNGWAMSPTFSGFGTLNDMSSVARPEASFFGGSLSDARETERNSSHSVALAD
FT                   TLGLLEDKIKLTLGGRWQRLETRSYDYDSGALSGRYGKNALTPFVGALYQPSLDVALFA
FT                   NYAEALLPSGVAPATSNGVTVSNAGQVFAPFRARQIEAGAKYDNGTLGASVSLFQITRP
FT                   EFRLDGTTYTDNGEQRNRGIELTLFGKPHERVTMLGGVTLLDARQQKSSLGGQDGKRAI
FT                   GVPAVQANLNLGWETPFIDGLALEGRAVYTASQYADAANTLSIPAWVRVDLGARYALKL
FT                   DGHDVTLRARVENLSDKRYWSSVGGYPGSNYLVQGNPRTFILSASYDF"
FT   gene            complement(685518..686120)
FT                   /gene="leuD1"
FT                   /locus_tag="ETAE_0618"
FT   CDS_pept        complement(685518..686120)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="leuD1"
FT                   /locus_tag="ETAE_0618"
FT                   /product="3-isopropylmalate dehydratase small subunit"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0618"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83465"
FT                   /db_xref="GOA:D0ZC64"
FT                   /db_xref="InterPro:IPR000573"
FT                   /db_xref="InterPro:IPR004431"
FT                   /db_xref="InterPro:IPR015928"
FT                   /db_xref="InterPro:IPR033940"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZC64"
FT                   /protein_id="ACY83465.1"
FT                   /translation="MTEFTRHTGIVVPLDAANVDTDAIIPKQFLQKVTRSGFGRHLFHD
FT                   WRFLDAAGEQPNPAFVLNQPPFQQGSILLARENFGCGSSREHAPWALTDYGFRVVIAPS
FT                   FADIFYGNAFNSQLLPIILDEAQIATLFALVGASPGIAFNVDVEQQTLQAGDACYTFTL
FT                   DPFRRHCLIHGLDGIGLTLRQASAIADYEARRPAFLR"
FT   gene            complement(686113..687528)
FT                   /gene="leuC"
FT                   /locus_tag="ETAE_0619"
FT   CDS_pept        complement(686113..687528)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="leuC"
FT                   /locus_tag="ETAE_0619"
FT                   /product="3-isopropylmalate dehydratase large subunit"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0619"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83466"
FT                   /db_xref="GOA:D0ZC65"
FT                   /db_xref="InterPro:IPR001030"
FT                   /db_xref="InterPro:IPR004430"
FT                   /db_xref="InterPro:IPR015931"
FT                   /db_xref="InterPro:IPR018136"
FT                   /db_xref="InterPro:IPR033941"
FT                   /db_xref="InterPro:IPR036008"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZC65"
FT                   /protein_id="ACY83466.1"
FT                   /translation="MGKTLYQKLYDAHIVHQTPGETPLLYIDRHLVHEVTSPQAFDGLR
FT                   AQGRRVRRPEHTFATMDHNVSTQSRDIRACGEMAQIQMETLMANCREFGVQLYDLHHPH
FT                   QGIVHVIGPEQGMTLPGTTIVCGDSHTSTHGAFGALAFGIGTSEVEHVLATQTLKQDRA
FT                   RTMQIAIQGRCAAGISAKDIVLAVIGHLGHAGGTGYVVEFCGPAVQALSMEGRMTLCNM
FT                   AIELGAKAGLVAPDDTTFAYLQGRPFAPQGALWQQAVDHWRTLRSDADAQYDRVVTLQA
FT                   DDIAPQVTWGTNPGQVIAIDTPIPSPASLADPIARASAHKALAYMDLQPGTRMSDVAID
FT                   RVFIGSCTNSRIEDLRAAAAIARGRRVAPGVQAMVVPGSGPVKAQAEAEGLDKIFTEAG
FT                   FEWRLPGCSMCLAMNNDRLGSGERCASTSNRNFEGRQGRGGRTHLVSPAMAAAAAVCGH
FT                   FADIRQLQEHDHD"
FT   gene            complement(687531..688622)
FT                   /gene="leuB"
FT                   /locus_tag="ETAE_0620"
FT   CDS_pept        complement(687531..688622)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="leuB"
FT                   /locus_tag="ETAE_0620"
FT                   /product="3-isopropylmalate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0620"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83467"
FT                   /db_xref="GOA:D0ZC66"
FT                   /db_xref="InterPro:IPR004429"
FT                   /db_xref="InterPro:IPR019818"
FT                   /db_xref="InterPro:IPR024084"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZC66"
FT                   /protein_id="ACY83467.1"
FT                   /translation="MSHSHHIAVLPGDGIGPEIMAQANKVMDAVRSRFGLRITTSEYDI
FT                   GGIAIDRHGTPLPEATLRGCEQADAILFGSVGGPRWEHLPPASQPERGALLPLRKHFKL
FT                   FSNLRPARLYPGLESLCPLRADIAARGFDILCVRELTGGIYFGQPKGREGQGMHQRAFD
FT                   TEVYYRFEIERIARLAFEAAASRRARVTSIDKANVLQSSLLWREVVNEIAQDYPQVALN
FT                   HMYIDNATMQLIKDPAQFDVLLCSNLFGDILSDECAMLTGSMGMLPSASLNEHGFGLYE
FT                   PAGGSAPDIAGQNLANPIAQILSLALLLRHSLSAEAAAAAIERAVNQALTQGVKTADLA
FT                   ADAQAVSTDEMGDAIARLITQEA"
FT   gene            complement(688638..690218)
FT                   /gene="leuA"
FT                   /locus_tag="ETAE_0621"
FT   CDS_pept        complement(688638..690218)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="leuA"
FT                   /locus_tag="ETAE_0621"
FT                   /product="2-isopropylmalate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0621"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83468"
FT                   /db_xref="GOA:D0ZC67"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR002034"
FT                   /db_xref="InterPro:IPR005671"
FT                   /db_xref="InterPro:IPR013709"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR036230"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZC67"
FT                   /protein_id="ACY83468.1"
FT                   /translation="MSQQVIIFDTTLRDGEQALQASLSVKEKLQIALALERMGVDVMEV
FT                   GFPISSPGDFASVRAIAQRVKQSRVCALARCVDADIDAAAEALRAADAFRIHTFLATST
FT                   LHLESKLRRSFDDAIAMARHAILRARRYTDDVEFSCEDAGRTPIDNLCRIVEAAIDAGA
FT                   KTVNIPDTVGYTTPYQFGGIIHTLFERVPNIDQAVISVHCHDDLGMACANSISAVQAGA
FT                   RQVEGTLNGIGERAGNCALEEVIMAIRTRQDLLQVHTGIRHQEIYRTSQLVSQLCNMPI
FT                   PANKAVVGANAFAHSSGIHQDGVLKNRENYEIMTPESIGLPQTQLNLTSRSGRAAVKHR
FT                   MEEMGYREGNDFDLERLYQAFLRLADKKGQVFDYDLEALAFIDRQQEEADHFRLEYFSV
FT                   QSGSSVMATASVRLICGAETRAEAATGNGPVDAVYQAINRITDISVDIVKYQLSAKGQG
FT                   RDALGQVDIVAEHQGRRFHGVGLTTDIVESSAQALIHVLNHIWRARQVEQERQRLHSPA
FT                   PSISTSSTH"
FT   gene            complement(690467..690625)
FT                   /locus_tag="ETAE_0622"
FT   CDS_pept        complement(690467..690625)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAE_0622"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0622"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83469"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZC68"
FT                   /protein_id="ACY83469.1"
FT                   /translation="MLPLFLNILINAYPFMSTQLHMAMDNSNFDTLFNIYFQIAATGIT
FT                   TPRVITC"
FT   gene            690880..691815
FT                   /gene="leuO"
FT                   /locus_tag="ETAE_0623"
FT   CDS_pept        690880..691815
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="leuO"
FT                   /locus_tag="ETAE_0623"
FT                   /product="leucine transcriptional activator"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0623"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83470"
FT                   /db_xref="GOA:D0ZC69"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZC69"
FT                   /protein_id="ACY83470.1"
FT                   /translation="MIPAEPQSSAENSLRNVDLNLLTVFDAVMQVQSITRAARSLNMTQ
FT                   PAVSNAVARLKLMFNDELFMRYGRGIRPTNRAYQLFGPVRQALQIVRNELPGARFKPES
FT                   SERVFNIAITSPLDILLTAKLLQRIKSYALHVQVSFDSLVNEQITRKLRYQESDFLIDY
FT                   QDLSGDEFCCEALFDDEFVLAVAGQHPRIGETCSLRGLLLESHAVVSINQFSSVSRFFY
FT                   SHSDLIRQIAYQGTDLSSVLSMVSKTEMVAIAPRWMVEQYADYLQLRAVTLLDLESQRT
FT                   CFFNWHRASERDSAHVWLRKLLSEFAQQGR"
FT   gene            692077..693879
FT                   /locus_tag="ETAE_0624"
FT   CDS_pept        692077..693879
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAE_0624"
FT                   /product="putative AMP-binding enzyme-family protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0624"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83471"
FT                   /db_xref="GOA:D0ZC70"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZC70"
FT                   /protein_id="ACY83471.1"
FT                   /translation="MIKALDNYHLVARIQGQIANSPNRVALRDWSPTADVAYRWREVGE
FT                   QVSRLACALLALGVEVQERVAIFAHNSVAWSLADLAILHLRAVTVPVYATNTAAQAAYI
FT                   LNDASVRILFVDGQAQYDAALALRECCPQLTRIIALSDGIDLRGCAIACHLHAFAPGGD
FT                   SASLARLAQRIDAASLDDLFTLIYTSGTTGEPKGVMLDYRSLAAQLYLHDARLNVGEQD
FT                   VSLCFLPLSHVFERAWSFYVMHSGAQNVYLHDTNLVREAMQAVRPTMMCAVPRFYEKIF
FT                   SAVQAKVAQAPWLRRQLFRWAVWCGEQRFLRERAARPQGRLMTAMHRLADRLVLAKLRA
FT                   ILGGRVRFLPAAGAKLDDHVILFFQALGLNIKYGYGMTETCATVSCWEEQDFRFGSIGR
FT                   PLPGVEVRIGEENEIQVRGPIVMRGYFNKPQETAQTFTADGWLKTGDAGALDAQGHLFI
FT                   TERLKDLMKTSNGKYIAPQLVEGTLARDRFIEQVAVIADARKFVSALIVPCFDSLEEYA
FT                   RSINLKYHDRLDLLRHSHIVALFEQRLMEMQKELAKFEQVKRFTLLPQAFSMELGELTP
FT                   TLKLRRKIILSRYHQEIESMYLDR"
FT   gene            694204..695922
FT                   /gene="ilvI"
FT                   /locus_tag="ETAE_0625"
FT   CDS_pept        694204..695922
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ilvI"
FT                   /locus_tag="ETAE_0625"
FT                   /product="acetolactate synthase 3 catalytic subunit"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0625"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83472"
FT                   /db_xref="GOA:D0ZC71"
FT                   /db_xref="InterPro:IPR000399"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR012846"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR039368"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZC71"
FT                   /protein_id="ACY83472.1"
FT                   /translation="MEMLSGAEMVVRSLIDQGVKHLFGYPGGTVLDIYDALHTVGGIEH
FT                   ILVRHEQGAVHMADGYARATGQVGVVLVTSGPGATNAITGIATAYMDSVPLVVLSGQVP
FT                   TSLIGNDAFQECDMVGISRPVVKHSFLVKQSEEIPAVLKKAFYLASSGRPGPVVVDLPK
FT                   DILNPAQKYPYAYPQQVSMRSYNPTCQGHRGQIKRGLQVLLAARRPVIYAGGGVIGAGC
FT                   HEALRALAQQLNLPVTTSLMGLGAFPASHPQSLGMLGMHGTYEANLAMHHADVIFAVGV
FT                   RFDDRTTNNLAKYCPDATVVHIDIDPSSISKTVTADVPIVGDAGDVLGALLTLLAQGDC
FT                   RQDFDSLRDWWQRIEVWRDRQCLRYVSDGQRIKPQQVIETLHRLTAGEAYVASDVGQHQ
FT                   MFAALYYGFDQPRRWINSGGLGTMGFGLPAALGVRLALPQATVLCITGDGSIQMNIQEL
FT                   STALQYDLPIVVVNLNNRFLGMVKQWQDIIYAGRHSQSYMQSLPDFVRLAEAYGHVGIA
FT                   IRSVDELETKLREALSIRDRLVFVDVTVDETEHVYPMQIRGGAMNEMWLSKTQRS"
FT   gene            695925..696416
FT                   /gene="ilvH"
FT                   /locus_tag="ETAE_0626"
FT   CDS_pept        695925..696416
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ilvH"
FT                   /locus_tag="ETAE_0626"
FT                   /product="acetolactate synthase 3 regulatory subunit"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0626"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83473"
FT                   /db_xref="GOA:D0ZC72"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR004789"
FT                   /db_xref="InterPro:IPR019455"
FT                   /db_xref="InterPro:IPR027271"
FT                   /db_xref="InterPro:IPR039557"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZC72"
FT                   /protein_id="ACY83473.1"
FT                   /translation="MRRILSVLLENESGALSRVVGLFSQRGYNIESLTVAPTEDATLSR
FT                   MTIQTKGDAKVLEQIEKQLHKLVDVLRVSELVPGAHVEREIMLVKLRASGYGREEVKRS
FT                   TDIFRGQIVDVTASLYTVQLAGTSDKLDAFLAAVREVAEIVEVARSGVVGVARGDKIMR
FT                   "
FT   gene            696618..697622
FT                   /gene="fruR"
FT                   /locus_tag="ETAE_0627"
FT   CDS_pept        696618..697622
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fruR"
FT                   /locus_tag="ETAE_0627"
FT                   /product="DNA-binding transcriptional regulator FruR"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0627"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83474"
FT                   /db_xref="GOA:D0ZC73"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR001761"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR012781"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZC73"
FT                   /protein_id="ACY83474.1"
FT                   /translation="MKLDEIARLAGVSRTTASYVINGKAKQYRVSDKTVEKVMAVVREH
FT                   NYHPNAVAAGLRAGRTRSIGLVIPDLENTSYTRIANYLERQARQRGYQLLIACSEDQPD
FT                   NEMRCIEHLLQRQVDAIIVSTALPPEHPFYQRWANDPLPIIALDRALDPEHFISVVGAD
FT                   MDDAEMLAAELRRFPAQSVLYLGALPELSVSFLREQGFRKAWQGDERPVNYLYTNSYER
FT                   EAAGAAFSQWLQHNEMPQALFTTSFPLLQGVLDVTLKKHGHLPSDLAIATFGDNELLDF
FT                   LDCPVLSVGQRHRDIAERVLELVLASLDEPRKPKPGLSRMRRILLQRGRLNRQ"
FT   gene            698693..699052
FT                   /locus_tag="ETAE_0628"
FT   CDS_pept        698693..699052
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ETAE_0628"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0628"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83475"
FT                   /db_xref="GOA:D0ZC74"
FT                   /db_xref="InterPro:IPR003444"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR020603"
FT                   /db_xref="InterPro:IPR035642"
FT                   /db_xref="InterPro:IPR035644"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="InterPro:IPR038619"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZC74"
FT                   /protein_id="ACY83475.1"
FT                   /translation="MVCTIDLHHPCLLLYPLSQWEVIEQKLSRLSSMNPAERRVQRLLL
FT                   GHASECQMDGAGRLLIAATLRQHAGLHKQVMLVGQFNKFELWDEETWYQQVREDIEAEQ
FT                   SATEILSERLQDLSL"
FT   gene            699055..699996
FT                   /gene="mraW"
FT                   /locus_tag="ETAE_0629"
FT   CDS_pept        699055..699996
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mraW"
FT                   /locus_tag="ETAE_0629"
FT                   /product="S-adenosyl-methyltransferase MraW"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0629"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83476"
FT                   /db_xref="GOA:D0ZC75"
FT                   /db_xref="InterPro:IPR002903"
FT                   /db_xref="InterPro:IPR023397"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZC75"
FT                   /protein_id="ACY83476.1"
FT                   /translation="MSENFQHKTVLLDEAVAGLNLRSDGIYIDGTFGRGGHSRLILSQL
FT                   GAEGRLIAIDRDPQAIAAAAQIDDPRFSIVHGPFSALADYVQEMGLSGRIDGILLDLGV
FT                   SSPQLDDPERGFSFMRDGPLDMRMDPSRGLSAAQWLMQAEEEDIAWVLKTFGEERFAKR
FT                   IARAIVERNRTEPLTRTRELAALISEASPFKEKHKHPATRSFQAIRIYINSELDEIERA
FT                   LEGALVALAPQGRLSVISFHSLEDRLVKRFMRQYSRGPQVPKGLPLTEAQLQAQGGPQL
FT                   KALGKRMPGEREVADNPRARSSVLRVAERISR"
FT   gene            699993..700313
FT                   /gene="ftsL"
FT                   /locus_tag="ETAE_0630"
FT   CDS_pept        699993..700313
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsL"
FT                   /locus_tag="ETAE_0630"
FT                   /product="cell division protein FtsL"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0630"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83477"
FT                   /db_xref="GOA:D0ZC76"
FT                   /db_xref="InterPro:IPR011922"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZC76"
FT                   /protein_id="ACY83477.1"
FT                   /translation="MIGNERHSLISIIGGDLLRHGKLPVLLFIAVLLSALSVVTTTHKT
FT                   RLLTAEREQLVLERDALDIEWRNLILEENALGDHSRVERIATEKLQMQHVDPSQENIVV
FT                   QQ"
FT   gene            700352..702115
FT                   /gene="ftsI"
FT                   /locus_tag="ETAE_0631"
FT   CDS_pept        700352..702115
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsI"
FT                   /locus_tag="ETAE_0631"
FT                   /product="peptidoglycan synthetase/penicillin-binding
FT                   protein 2"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0631"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83478"
FT                   /db_xref="GOA:D0ZCJ7"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR005311"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR036138"
FT                   /db_xref="InterPro:IPR037532"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZCJ7"
FT                   /protein_id="ACY83478.1"
FT                   /translation="MKAVRSGKIRRQEEQASFVSWRFALLCGCILLALLGLLARAAYLQ
FT                   VISPEHLVREGDARSLRTQAIPTARGMIKDRAGRPLAVSVPVNAIWADPKEVNEHGGIT
FT                   LDTRWQALADALETPLDKMAARINANPRGRFVYLARQVNPAMGEYIHKLRLPGIYLKQE
FT                   SRRYYPAGQVTAHIIGVTNIDGQGIEGVEKSFDRWLTGQPGERTVRKDRFGRVIEDISS
FT                   IDSLAAHNLSLSIDERLQALVYRELTNAVAFNKAESGTAVLVDVNTGEVLAMANSPSYN
FT                   PNNLTDTPQEAMRNRAITDIFEPGSTVKPMVVMTALQRGIVRENSVLNTLPYYVNGHEI
FT                   KDVARYAELSITGILQKSSNVGVSKLALAMPSSALVETYSGFGFGKPTNLGLVGESSGI
FT                   YPKKQRWSDIERATFSFGYGLMVTPLQLARVYATIGSMGIYRPLSITKVDPPVPGERVF
FT                   PVALVRSVVHMMESVALPGGGGVKAAVKGYRVAVKTGTAKKVGPDGRYVNKYIAYTAGI
FT                   APASNPRFALVVVINDPQAGKYYGGAVSAPVFGAIMGGVLRTMNVEPDALPTGDKSELV
FT                   NNKKEGSGGRS"
FT   gene            702180..703589
FT                   /gene="murE"
FT                   /locus_tag="ETAE_0632"
FT   CDS_pept        702180..703589
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murE"
FT                   /locus_tag="ETAE_0632"
FT                   /product="UDP-N-acetylmuramyl tripeptide synthase"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0632"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83479"
FT                   /db_xref="GOA:D0ZCJ8"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005761"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR035911"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZCJ8"
FT                   /protein_id="ACY83479.1"
FT                   /translation="MDSRVAAAGDLFVAVVGHAADGRRFIPQAIAQGVAAVIAEAEGEA
FT                   EDGSVRELHGVPVVYLSHLNERLSALAGRFYGQPGADLRLVGVTGTNGKTTTTQLLAQW
FT                   AQLLGETGAVMGTVGNGLLGHVYPSENTTGSAVDVQHMLRTLADDGATLVAMEVSSHGL
FT                   VQNRVLALPFAASAFTNLSRDHLDYHGDMEHYAQAKWRLFSTHHSGEKIINADDETGRR
FT                   WLDKLPDAVAVTVSGALPAGWAGRWLAARSVAYHDGGATIAFDSCWGAGTLNSRLMGEF
FT                   NVSNLLVALATLLALGYPLAALCAASGQLQPVCGRMEVFQAPGKPTVVVDYAHTPDALE
FT                   KALLAARLHCQGLLWCLFGCGGDRDTGKRPLMGAIAEQYADRVVVTDDNPRSEEPRAII
FT                   NEILSGMLDPGLAMAIPGRAEAVTAAVMQAAPQDVILVAGKGHEDYQLVGNRRLDYSDR
FT                   VTVARLLGVVA"
FT   gene            703586..704962
FT                   /gene="murF"
FT                   /locus_tag="ETAE_0633"
FT   CDS_pept        703586..704962
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murF"
FT                   /locus_tag="ETAE_0633"
FT                   /product="UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D-alanine
FT                   ligase"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0633"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83480"
FT                   /db_xref="GOA:D0ZCJ9"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005863"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR035911"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZCJ9"
FT                   /protein_id="ACY83480.1"
FT                   /translation="MIATTLQTLADAIGATLIGADSPVTAVTTDTRKLTPGCLFVALQG
FT                   DNFDGHDFAAQAREGGAGALLVNRRLALDVPQLLVADTRLALGQLGAWVRRQVPARVVA
FT                   LTGSSGKTSVKEMSAAILGLCGNVLYTAGNLNNDIGVPLTLLRLEPQHDFAVIELGANH
FT                   VGEIAYSVALTRPHSALVNNLAAAHLEGFGSLSGVAQAKGEIFAGLPPQGTAIVNADSN
FT                   DWENWQHALTEQRVWRFSPQAGAGVDFYASAVRSDAAGTHFTLHTPAGQCDVLLPLPGR
FT                   HNIANALAAAALTMSVGATLTQVQQGLAGLQAVPGRLFPIRLGEHQLLLDDSYNANVGS
FT                   MSAAAEVLGHMPGYRVMVVGDMAELGAEAEACHRRVGQAARAAGIDKVLSVGGLSRLIG
FT                   EASGCGEHFMDKTALIERLKHLLCEHAAITILVKGSRSAAMEQVVRGVSVQEMQENQSC
FT                   "
FT   gene            704956..706038
FT                   /gene="mraY"
FT                   /locus_tag="ETAE_0634"
FT   CDS_pept        704956..706038
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mraY"
FT                   /locus_tag="ETAE_0634"
FT                   /product="phospho-N-acetylmuramoyl-pentapeptide-transferase"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0634"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83481"
FT                   /db_xref="GOA:D0ZCK0"
FT                   /db_xref="InterPro:IPR000715"
FT                   /db_xref="InterPro:IPR003524"
FT                   /db_xref="InterPro:IPR018480"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZCK0"
FT                   /protein_id="ACY83481.1"
FT                   /translation="MLVWLAEHLVKYFSGFNVFSYLTFRAIVSLLTALFISLWMGPHLI
FT                   AWLQKLQIGQVVRNDGPESHFSKRGTPTMGGLMILTSITISVLMWAYPSNPYVWCVLFV
FT                   LLGYGVVGFVDDYRKVVRKNTDGLIARWKYFWQSVIALVVAFTMYSIGKDTPATQLVVP
FT                   FFKDIMPQLGLLYILLSYFVIVGTSNAVNLTDGLDGLAIMPTVFVAAGMGLVAWATGNV
FT                   NFAAYLHIPYIRHAGELVIVCTAIVGAGLGFLWFNTYPAQVFMGDVGSLALGGALGTIA
FT                   VLLRQEFLLVIMGGVFVMETLSVILQVGSFKLRGQRIFRMAPIHHHYELKGWPEPRVIV
FT                   RFWIISLMLVLIGLATLKVR"
FT   gene            706040..707356
FT                   /gene="murD"
FT                   /locus_tag="ETAE_0635"
FT   CDS_pept        706040..707356
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murD"
FT                   /locus_tag="ETAE_0635"
FT                   /product="UDP-N-acetylmuramoylalanine-D-glutamate ligase"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0635"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83482"
FT                   /db_xref="GOA:D0ZCK1"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005762"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZCK1"
FT                   /protein_id="ACY83482.1"
FT                   /translation="MADYQGKRVVIIGLGLTGLSCVDFFMDRGVVPRVIDTRATPPGLD
FT                   KLPASVERHLGSIEQSWLMDADLIVASPGIPLSSPALDRAAQAGVEIVGDIELFCREAQ
FT                   APIVAITGSNGKSTVTTLVGEMARAAGWQVGVGGNIGVPALSLLKHECRLYVLELSSFQ
FT                   LETTSSLRAAAATILNVSEDHMNRYPLGLQQYRAAKLRIYENARTCVVNADDALTMPIH
FT                   GADTRCVSFGVDVGDYHLNRQQGEIWLRVRGEKILNTKEMQLTGMHNYTNALAALALAD
FT                   AVGLPRASSLRALTTFRGLAHRFQLVLEHSGVRWINDSKATNVGSTEAALKGLHLDGTL
FT                   HLLLGGDGKDADFTPLLPYLQGDRIRLYCFGRDAEPLMRLRPEVSRRFDTLEQAIRALA
FT                   PLTRGGDMVLLSPACASLDQFKNFEQRGDEFARLAREFG"
FT   gene            707356..708615
FT                   /gene="ftsW"
FT                   /locus_tag="ETAE_0636"
FT   CDS_pept        707356..708615
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsW"
FT                   /locus_tag="ETAE_0636"
FT                   /product="cell division protein FtsW"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0636"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83483"
FT                   /db_xref="GOA:D0ZCK2"
FT                   /db_xref="InterPro:IPR001182"
FT                   /db_xref="InterPro:IPR013437"
FT                   /db_xref="InterPro:IPR018365"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZCK2"
FT                   /protein_id="ACY83483.1"
FT                   /translation="MRLRLALPRPRLPHLRLPRFSLPLMGGALRLRDWVMGAGEADSAG
FT                   VVLYDRTLLWLTFGLAAMGFIMVTSASMPIGQRLADDPFLFAKRDALYLTLAFGLAMVT
FT                   LRIPMEFWQRWSNAMLLLSVAMLLVVLVVGSSVNGASRWIALGPLRIQPAEFSKLSLFC
FT                   YLASYLVRKVDEVRNNFWGFCKPMGVMVVLAVLLLAQPDLGTVVVLFVTTLGLLFLAGA
FT                   KLWQFLAIIGSGIFAVILLIIAEPYRMRRVTSFWNPWADPFGSGYQLTQSLMAFGRGEF
FT                   WGQGLGNSVQKLEYLPEAHTDFIFSILGEELGYFGVVLTLLMVFFVAFRAMSIGRRALE
FT                   ADQRFSGFLACAIGVWFSFQALVNVGAAAGMLPTKGLTLPLISYGGSSLIIMSTALVFL
FT                   LRIDYETRQANAQAVVKGSR"
FT   gene            708612..709691
FT                   /gene="murG"
FT                   /locus_tag="ETAE_0637"
FT   CDS_pept        708612..709691
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murG"
FT                   /locus_tag="ETAE_0637"
FT                   /product="N-acetylglucosaminyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0637"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83484"
FT                   /db_xref="GOA:D0ZCK3"
FT                   /db_xref="InterPro:IPR004276"
FT                   /db_xref="InterPro:IPR006009"
FT                   /db_xref="InterPro:IPR007235"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZCK3"
FT                   /protein_id="ACY83484.1"
FT                   /translation="MSGAANHQGNKRLMVMAGGTGGHVFPGLAVAHYLQAQGWQIRWLG
FT                   TADRMEAQLVPQHGIEIDFIQISGLRGKGLKALLGAPFRIARAVLQARRIIKAYRPDAV
FT                   LGMGGYVSGPGGLAAWLCGVPVVLHEQNGIAGLTNRWLSKIAKRVLQAFPGAFPHAPVV
FT                   GNPVREDVLALPAPAQRMAGRTGPVRVLVVGGSQGARILNQTLPAVAARLGERVTLWHQ
FT                   TGKGAQSSVEAEYQRLGLSEHRVTEFIDDMAAAYAWADVVVCRSGALTVSEIAAAGLPA
FT                   LFVPFMHKDRQQYWNAAALARTGAARIIEQPDFSVDAVVETLAGWDRPTLLLMAEKARA
FT                   AAITDATQRVAEAICDVAR"
FT   gene            709740..711215
FT                   /gene="murC"
FT                   /locus_tag="ETAE_0638"
FT   CDS_pept        709740..711215
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murC"
FT                   /locus_tag="ETAE_0638"
FT                   /product="UDP-N-acetylmuramate--L-alanine ligase"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0638"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83485"
FT                   /db_xref="GOA:D0ZCK4"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005758"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZCK4"
FT                   /protein_id="ACY83485.1"
FT                   /translation="MNKTVNTQQLAKLRTMVPEMRRVRHIHFVGIGGAGMGGIAEVLAN
FT                   EGYQISGSDLAPNAVTQQLSELGAQIYFNHRPENVRDASVVVVSTAIAADNPEIIAARE
FT                   ARIPVIRRAEMLAELMRFRHGIAIAGTHGKTTTTAMVSSIYAEAGLDPTFVNGGLVKAA
FT                   GTHARLGSSRYLIAEADESDASFLHLQPMVAIVTNIEADHMDTYHGDFENLKQTFINFL
FT                   HNLPFYGRAVLCIDDPVIRELLPRVGRQVTTYGFSQDADVRIEEYRQCGAQGTFFLCRQ
FT                   DRPRLAVTLNAPGRHNALNAAAAAAVASEEGIDDEAILRALGGFQGTGRRFDFLGEFSL
FT                   QHVNNKPGKVMLVDDYGHHPTEVDATIKAARAGWPDRRLVMVFQPHRFTRTRDLYDDFA
FT                   NVLSQVDVLLMLDVYPAGEHPIPGADSRSLCRTIRGRGKLDPVLVSEPATLAQTLAQFL
FT                   QEGDLILTQGAGNIGRVARVLAECRLQPSAVME"
FT   gene            711222..712142
FT                   /gene="ddl"
FT                   /locus_tag="ETAE_0639"
FT   CDS_pept        711222..712142
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ddl"
FT                   /locus_tag="ETAE_0639"
FT                   /product="D-alanine--D-alanine ligase"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0639"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83486"
FT                   /db_xref="GOA:D0ZCK5"
FT                   /db_xref="InterPro:IPR000291"
FT                   /db_xref="InterPro:IPR005905"
FT                   /db_xref="InterPro:IPR011095"
FT                   /db_xref="InterPro:IPR011127"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZCK5"
FT                   /protein_id="ACY83486.1"
FT                   /translation="MAEKVAVLLGGTSAERDVSLLSGQAVLNGLKEAGIDAYPVDTMRF
FT                   PATQLREAGFERVFIALHGRGGEDGTLQGVLEFLQLPYTGSGVMASALTMDKLRSKQVW
FT                   QAAGLPVAPYVAISREQFDEGLTMDTLREINDLGLPLIVKPSREGSSVGMSKVSEPCEF
FT                   DPALVEALRHDDEILIEKWLAGPEYTVAFIGDEILPSIRIQAAGAFYDYEAKYLSDKTE
FT                   YFCPSGLSDEQEQALAALVRRAYKALGCSGWGRVDVMQDAAGEFCLLEVNTAPGMTSHS
FT                   LVPMAARQAGMRFSQLVVRILELAD"
FT   gene            712222..713007
FT                   /gene="ftsQ"
FT                   /locus_tag="ETAE_0640"
FT   CDS_pept        712222..713007
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsQ"
FT                   /locus_tag="ETAE_0640"
FT                   /product="cell division protein FtsQ"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0640"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83487"
FT                   /db_xref="GOA:D0ZCK6"
FT                   /db_xref="InterPro:IPR005548"
FT                   /db_xref="InterPro:IPR013685"
FT                   /db_xref="InterPro:IPR026579"
FT                   /db_xref="InterPro:IPR034746"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZCK6"
FT                   /protein_id="ACY83487.1"
FT                   /translation="MRLAGMLFLLLVLAGIGWGGWVVVNWMKDASRMPMSKLVVTGERH
FT                   FTRNDDIRQAILALGPPGTFMTQNVDVIQQQIERLPWIKQASVRKQWPNELKIHVVEYV
FT                   PVARWNDLRLVDSDGKSFSVPADRTGKQPLPLLYGPEGSEMDVLEGYRAMSKTLAKDNF
FT                   TLKMVSMSARHSWQLGLDNDIRLELGREDVAGRLARFDELYPALQQQAQATHQRVSYVD
FT                   LRYDSGAAVGWAPAYIDTPPAGANQQQNQQQNQAQAKQQ"
FT   gene            713004..714260
FT                   /gene="ftsA"
FT                   /locus_tag="ETAE_0641"
FT   CDS_pept        713004..714260
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsA"
FT                   /locus_tag="ETAE_0641"
FT                   /product="cell division protein FtsA"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0641"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83488"
FT                   /db_xref="GOA:D0ZCK7"
FT                   /db_xref="InterPro:IPR003494"
FT                   /db_xref="InterPro:IPR020823"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZCK7"
FT                   /protein_id="ACY83488.1"
FT                   /translation="MIKSTDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRG
FT                   MDKGGVNDLESVVKCVQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEV
FT                   TQEDVENVVHTAKSVRVRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITC
FT                   HNDMAKNIVKAVERCGLKVDQLIFAGLASSYAVLTEDERELGVCVVDIGGGTMDMAVYT
FT                   GGALRHTKVIPYAGNVVTSDIAYAFGTPPTDAEAIKVRYGCALGSLVSKDESVEVPSVG
FT                   GRPPRSLQRQTLAEVIEPRYAELLNLVNDELLQLQEQLRQQGVKHHLAAGIVLTGGAAQ
FT                   IEGLAACAQRVFHTQVRIGQPLNITGLTDYAQAPYYSTAVGLLHYGKESHLSGEAEVEK
FT                   RASVGNWFKKINGWLRKEF"
FT   gene            714330..715490
FT                   /gene="ftsZ"
FT                   /locus_tag="ETAE_0642"
FT   CDS_pept        714330..715490
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsZ"
FT                   /locus_tag="ETAE_0642"
FT                   /product="cell division protein FtsZ"
FT                   /db_xref="EnsemblGenomes-Gn:ETAE_0642"
FT                   /db_xref="EnsemblGenomes-Tr:ACY83489"
FT                   /db_xref="GOA:D0ZCK8"
FT                   /db_xref="InterPro:IPR000158"
FT                   /db_xref="InterPro:IPR003008"
FT                   /db_xref="InterPro:IPR008280"
FT                   /db_xref="InterPro:IPR018316"
FT                   /db_xref="InterPro:IPR020805"
FT                   /db_xref="InterPro:IPR024757"
FT                   /db_xref="InterPro:IPR036525"
FT                   /db_xref="InterPro:IPR037103"
FT                   /db_xref="UniProtKB/TrEMBL:D0ZCK8"
FT                   /protein_id="ACY83489.1"
FT                   /translation="MFEPMELTNDAVIKVIGVGGGGGNAVEHMVRERIEGVEFFAVNTD
FT                   AQALRKTAVGQTIQIGSGITKGLGAGANPEVGRNAAEEDREALRSALDGADMVFIAAGM
FT                   GGGTGTGAAPVVAEVAKELGILTVAVVTKPFNFEGKRRMAFAEQGIAELSKHVDSLITI
FT                   PNDKLLKVLGRGISLLDAFGAANDVLKGAVQGIAELITRPGLMNVDFADVRTVMSEMGY
FT                   AMMGSGMASGEDRAEEAAEMAISSPLLEDIDLSGARGVLVNITAGFDLRLDEFETVGNT
FT                   IRAFASDNATVVIGTSLDPDMNDELRVTVVATGIGMDKRPEITLVSNKQGQQPVIDQRY
FT                   QQHGLSPLPQESKPAVAKVVNDQSVPSGKESDDYLDIPAFLRKQAD"
FT   gene            715596..716513
FT                   /gene="lpxC"
FT                   /locus_tag="ETAE_0643"
FT