(data stored in ACNUC10821 zone)

EMBL: CP001138

ID   CP001138; SV 1; circular; genomic DNA; STD; PRO; 4798660 BP.
XX
AC   CP001138; ABEK01000000-ABEK01000056;
XX
PR   Project:PRJNA20063;
XX
DT   24-AUG-2008 (Rel. 96, Created)
DT   15-MAY-2014 (Rel. 120, Last updated, Version 6)
XX
DE   Salmonella enterica subsp. enterica serovar Agona str. SL483, complete
DE   genome.
XX
KW   .
XX
OS   Salmonella enterica subsp. enterica serovar Agona str. SL483
OC   Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales;
OC   Enterobacteriaceae; Salmonella.
XX
RN   [1]
RP   1-4798660
RX   DOI; 10.1128/JB.00297-11.
RX   PUBMED; 21602358.
RA   Fricke W.F., Mammel M.K., McDermott P.F., Tartera C., White D.G.,
RA   Leclerc J.E., Ravel J., Cebula T.A.;
RT   "Comparative genomics of 28 Salmonella enterica isolates: evidence for
RT   CRISPR-mediated adaptive sublineage evolution";
RL   J. Bacteriol. 193(14):3556-3568(2011).
XX
RN   [2]
RP   1-4798660
RA   Ravel J., Fricke W.F., White D., McDermott P., Mammel M., Rosovitz M.,
RA   Leclerc J., Cebula T., Sebastian Y.;
RT   ;
RL   Submitted (19-AUG-2008) to the INSDC.
RL   J. Craig Venter Institute, 9704 Medical Center Drive, Rockville, MD 20850,
RL   USA
XX
DR   MD5; b10389c0a1db3691a71feaa3c0e657de.
DR   BioSample; SAMN02604068.
DR   COMPARE-RefGenome; SL483.
DR   EnsemblGenomes-Gn; EBG00001267835.
DR   EnsemblGenomes-Gn; EBG00001267836.
DR   EnsemblGenomes-Gn; EBG00001267837.
DR   EnsemblGenomes-Gn; EBG00001267838.
DR   EnsemblGenomes-Gn; EBG00001267839.
DR   EnsemblGenomes-Gn; EBG00001267840.
DR   EnsemblGenomes-Gn; EBG00001267841.
DR   EnsemblGenomes-Gn; EBG00001267842.
DR   EnsemblGenomes-Gn; EBG00001267843.
DR   EnsemblGenomes-Gn; EBG00001267844.
DR   EnsemblGenomes-Gn; EBG00001267845.
DR   EnsemblGenomes-Gn; EBG00001267846.
DR   EnsemblGenomes-Gn; EBG00001267847.
DR   EnsemblGenomes-Gn; EBG00001267848.
DR   EnsemblGenomes-Gn; EBG00001267849.
DR   EnsemblGenomes-Gn; EBG00001267850.
DR   EnsemblGenomes-Gn; EBG00001267851.
DR   EnsemblGenomes-Gn; EBG00001267852.
DR   EnsemblGenomes-Gn; EBG00001267853.
DR   EnsemblGenomes-Gn; EBG00001267854.
DR   EnsemblGenomes-Gn; EBG00001267855.
DR   EnsemblGenomes-Gn; EBG00001267856.
DR   EnsemblGenomes-Gn; EBG00001267857.
DR   EnsemblGenomes-Gn; EBG00001267858.
DR   EnsemblGenomes-Gn; EBG00001267859.
DR   EnsemblGenomes-Gn; EBG00001267860.
DR   EnsemblGenomes-Gn; EBG00001267861.
DR   EnsemblGenomes-Gn; EBG00001267862.
DR   EnsemblGenomes-Gn; EBG00001267863.
DR   EnsemblGenomes-Gn; EBG00001267864.
DR   EnsemblGenomes-Gn; EBG00001267865.
DR   EnsemblGenomes-Gn; EBG00001267866.
DR   EnsemblGenomes-Gn; EBG00001267867.
DR   EnsemblGenomes-Gn; EBG00001267868.
DR   EnsemblGenomes-Gn; EBG00001267869.
DR   EnsemblGenomes-Gn; EBG00001267870.
DR   EnsemblGenomes-Gn; EBG00001267871.
DR   EnsemblGenomes-Gn; EBG00001267872.
DR   EnsemblGenomes-Gn; EBG00001267873.
DR   EnsemblGenomes-Gn; EBG00001267874.
DR   EnsemblGenomes-Gn; EBG00001267875.
DR   EnsemblGenomes-Gn; EBG00001267876.
DR   EnsemblGenomes-Gn; EBG00001267877.
DR   EnsemblGenomes-Gn; EBG00001267878.
DR   EnsemblGenomes-Gn; EBG00001267879.
DR   EnsemblGenomes-Gn; EBG00001267880.
DR   EnsemblGenomes-Gn; EBG00001267881.
DR   EnsemblGenomes-Gn; EBG00001267882.
DR   EnsemblGenomes-Gn; EBG00001267883.
DR   EnsemblGenomes-Gn; EBG00001267884.
DR   EnsemblGenomes-Gn; EBG00001267885.
DR   EnsemblGenomes-Gn; EBG00001267886.
DR   EnsemblGenomes-Gn; EBG00001267887.
DR   EnsemblGenomes-Gn; EBG00001267888.
DR   EnsemblGenomes-Gn; EBG00001267889.
DR   EnsemblGenomes-Gn; EBG00001267890.
DR   EnsemblGenomes-Gn; EBG00001267891.
DR   EnsemblGenomes-Gn; EBG00001267892.
DR   EnsemblGenomes-Gn; EBG00001267893.
DR   EnsemblGenomes-Gn; EBG00001267894.
DR   EnsemblGenomes-Gn; EBG00001267895.
DR   EnsemblGenomes-Gn; EBG00001267896.
DR   EnsemblGenomes-Gn; EBG00001267897.
DR   EnsemblGenomes-Gn; EBG00001267898.
DR   EnsemblGenomes-Gn; EBG00001267899.
DR   EnsemblGenomes-Gn; EBG00001267900.
DR   EnsemblGenomes-Gn; EBG00001267901.
DR   EnsemblGenomes-Gn; EBG00001267902.
DR   EnsemblGenomes-Gn; EBG00001267903.
DR   EnsemblGenomes-Gn; EBG00001267904.
DR   EnsemblGenomes-Gn; EBG00001267905.
DR   EnsemblGenomes-Gn; EBG00001267906.
DR   EnsemblGenomes-Gn; EBG00001267907.
DR   EnsemblGenomes-Gn; EBG00001267908.
DR   EnsemblGenomes-Gn; EBG00001267909.
DR   EnsemblGenomes-Gn; EBG00001267910.
DR   EnsemblGenomes-Gn; EBG00001267911.
DR   EnsemblGenomes-Gn; EBG00001267912.
DR   EnsemblGenomes-Gn; EBG00001267913.
DR   EnsemblGenomes-Gn; EBG00001267914.
DR   EnsemblGenomes-Gn; EBG00001267915.
DR   EnsemblGenomes-Gn; EBG00001267916.
DR   EnsemblGenomes-Gn; EBG00001267917.
DR   EnsemblGenomes-Gn; EBG00001267918.
DR   EnsemblGenomes-Gn; EBG00001267919.
DR   EnsemblGenomes-Gn; EBG00001267920.
DR   EnsemblGenomes-Gn; EBG00001267921.
DR   EnsemblGenomes-Gn; EBG00001267922.
DR   EnsemblGenomes-Gn; EBG00001267923.
DR   EnsemblGenomes-Gn; EBG00001267924.
DR   EnsemblGenomes-Gn; EBG00001267925.
DR   EnsemblGenomes-Gn; EBG00001267926.
DR   EnsemblGenomes-Gn; EBG00001267927.
DR   EnsemblGenomes-Gn; EBG00001267928.
DR   EnsemblGenomes-Gn; EBG00001267929.
DR   EnsemblGenomes-Gn; EBG00001267930.
DR   EnsemblGenomes-Gn; EBG00001267931.
DR   EnsemblGenomes-Gn; EBG00001267932.
DR   EnsemblGenomes-Gn; EBG00001267933.
DR   EnsemblGenomes-Gn; EBG00001267934.
DR   EnsemblGenomes-Gn; EBG00001267935.
DR   EnsemblGenomes-Gn; EBG00001267936.
DR   EnsemblGenomes-Gn; EBG00001267937.
DR   EnsemblGenomes-Gn; EBG00001267938.
DR   EnsemblGenomes-Gn; EBG00001267939.
DR   EnsemblGenomes-Gn; EBG00001267940.
DR   EnsemblGenomes-Gn; EBG00001267941.
DR   EnsemblGenomes-Gn; EBG00001267942.
DR   EnsemblGenomes-Gn; EBG00001267943.
DR   EnsemblGenomes-Gn; EBG00001267944.
DR   EnsemblGenomes-Gn; EBG00001267945.
DR   EnsemblGenomes-Gn; EBG00001267946.
DR   EnsemblGenomes-Gn; EBG00001267947.
DR   EnsemblGenomes-Gn; EBG00001267948.
DR   EnsemblGenomes-Gn; EBG00001267949.
DR   EnsemblGenomes-Gn; EBG00001267950.
DR   EnsemblGenomes-Gn; EBG00001267951.
DR   EnsemblGenomes-Gn; EBG00001267952.
DR   EnsemblGenomes-Gn; EBG00001267953.
DR   EnsemblGenomes-Gn; EBG00001267954.
DR   EnsemblGenomes-Gn; EBG00001267955.
DR   EnsemblGenomes-Gn; EBG00001267956.
DR   EnsemblGenomes-Gn; EBG00001267957.
DR   EnsemblGenomes-Gn; EBG00001267958.
DR   EnsemblGenomes-Gn; EBG00001267959.
DR   EnsemblGenomes-Gn; EBG00001267960.
DR   EnsemblGenomes-Gn; EBG00001267961.
DR   EnsemblGenomes-Gn; EBG00001267962.
DR   EnsemblGenomes-Gn; EBG00001267963.
DR   EnsemblGenomes-Gn; EBG00001267964.
DR   EnsemblGenomes-Gn; EBG00001267965.
DR   EnsemblGenomes-Gn; EBG00001267966.
DR   EnsemblGenomes-Gn; EBG00001267967.
DR   EnsemblGenomes-Gn; EBG00001267968.
DR   EnsemblGenomes-Gn; EBG00001267969.
DR   EnsemblGenomes-Gn; EBG00001267970.
DR   EnsemblGenomes-Gn; EBG00001267971.
DR   EnsemblGenomes-Gn; EBG00001267972.
DR   EnsemblGenomes-Gn; EBG00001267973.
DR   EnsemblGenomes-Gn; EBG00001267974.
DR   EnsemblGenomes-Gn; EBG00001267975.
DR   EnsemblGenomes-Gn; EBG00001267976.
DR   EnsemblGenomes-Gn; EBG00001267977.
DR   EnsemblGenomes-Gn; EBG00001267978.
DR   EnsemblGenomes-Gn; EBG00001267979.
DR   EnsemblGenomes-Gn; EBG00001267980.
DR   EnsemblGenomes-Gn; EBG00001267981.
DR   EnsemblGenomes-Gn; EBG00001267982.
DR   EnsemblGenomes-Gn; EBG00001267983.
DR   EnsemblGenomes-Gn; EBG00001267984.
DR   EnsemblGenomes-Gn; EBG00001267985.
DR   EnsemblGenomes-Gn; EBG00001267986.
DR   EnsemblGenomes-Gn; EBG00001267987.
DR   EnsemblGenomes-Gn; EBG00001267988.
DR   EnsemblGenomes-Gn; EBG00001267989.
DR   EnsemblGenomes-Gn; EBG00001267990.
DR   EnsemblGenomes-Gn; EBG00001267991.
DR   EnsemblGenomes-Gn; EBG00001267992.
DR   EnsemblGenomes-Gn; EBG00001267993.
DR   EnsemblGenomes-Gn; EBG00001267994.
DR   EnsemblGenomes-Gn; EBG00001267995.
DR   EnsemblGenomes-Gn; EBG00001267996.
DR   EnsemblGenomes-Gn; EBG00001267997.
DR   EnsemblGenomes-Gn; EBG00001267998.
DR   EnsemblGenomes-Gn; EBG00001267999.
DR   EnsemblGenomes-Gn; EBG00001268000.
DR   EnsemblGenomes-Gn; EBG00001268001.
DR   EnsemblGenomes-Gn; EBG00001268002.
DR   EnsemblGenomes-Gn; EBG00001268003.
DR   EnsemblGenomes-Gn; EBG00001268004.
DR   EnsemblGenomes-Gn; EBG00001268005.
DR   EnsemblGenomes-Gn; EBG00001268006.
DR   EnsemblGenomes-Gn; EBG00001268007.
DR   EnsemblGenomes-Gn; EBG00001268008.
DR   EnsemblGenomes-Gn; EBG00001268009.
DR   EnsemblGenomes-Gn; EBG00001268010.
DR   EnsemblGenomes-Gn; EBG00001268011.
DR   EnsemblGenomes-Gn; EBG00001268012.
DR   EnsemblGenomes-Gn; EBG00001268013.
DR   EnsemblGenomes-Gn; EBG00001268014.
DR   EnsemblGenomes-Gn; EBG00001268015.
DR   EnsemblGenomes-Gn; EBG00001268016.
DR   EnsemblGenomes-Gn; EBG00001268017.
DR   EnsemblGenomes-Gn; EBG00001268018.
DR   EnsemblGenomes-Gn; EBG00001268019.
DR   EnsemblGenomes-Gn; EBG00001268020.
DR   EnsemblGenomes-Gn; EBG00001268021.
DR   EnsemblGenomes-Gn; EBG00001268022.
DR   EnsemblGenomes-Gn; EBG00001268023.
DR   EnsemblGenomes-Gn; EBG00001268024.
DR   EnsemblGenomes-Gn; EBG00001268025.
DR   EnsemblGenomes-Gn; EBG00001268026.
DR   EnsemblGenomes-Gn; EBG00001268027.
DR   EnsemblGenomes-Gn; EBG00001268028.
DR   EnsemblGenomes-Gn; EBG00001268029.
DR   EnsemblGenomes-Gn; EBG00001268030.
DR   EnsemblGenomes-Gn; EBG00001268031.
DR   EnsemblGenomes-Gn; EBG00001268032.
DR   EnsemblGenomes-Gn; EBG00001268033.
DR   EnsemblGenomes-Gn; EBG00001268034.
DR   EnsemblGenomes-Gn; EBG00001268035.
DR   EnsemblGenomes-Gn; EBG00001268036.
DR   EnsemblGenomes-Gn; EBG00001268037.
DR   EnsemblGenomes-Gn; EBG00001268038.
DR   EnsemblGenomes-Gn; EBG00001268039.
DR   EnsemblGenomes-Gn; EBG00001268040.
DR   EnsemblGenomes-Gn; EBG00001268041.
DR   EnsemblGenomes-Gn; EBG00001268042.
DR   EnsemblGenomes-Gn; EBG00001268043.
DR   EnsemblGenomes-Gn; EBG00001268044.
DR   EnsemblGenomes-Gn; EBG00001268045.
DR   EnsemblGenomes-Gn; EBG00001268046.
DR   EnsemblGenomes-Gn; EBG00001268047.
DR   EnsemblGenomes-Gn; EBG00001268048.
DR   EnsemblGenomes-Gn; EBG00001268049.
DR   EnsemblGenomes-Gn; EBG00001268050.
DR   EnsemblGenomes-Gn; EBG00001268051.
DR   EnsemblGenomes-Gn; EBG00001268052.
DR   EnsemblGenomes-Gn; EBG00001268053.
DR   EnsemblGenomes-Gn; EBG00001268054.
DR   EnsemblGenomes-Gn; EBG00001268055.
DR   EnsemblGenomes-Gn; EBG00001268056.
DR   EnsemblGenomes-Gn; EBG00001268057.
DR   EnsemblGenomes-Gn; EBG00001268058.
DR   EnsemblGenomes-Gn; EBG00001268059.
DR   EnsemblGenomes-Gn; EBG00001268060.
DR   EnsemblGenomes-Gn; EBG00001268061.
DR   EnsemblGenomes-Gn; EBG00001268062.
DR   EnsemblGenomes-Gn; EBG00001268063.
DR   EnsemblGenomes-Gn; EBG00001268064.
DR   EnsemblGenomes-Gn; EBG00001268065.
DR   EnsemblGenomes-Gn; EBG00001268066.
DR   EnsemblGenomes-Gn; EBG00001268067.
DR   EnsemblGenomes-Gn; EBG00001268068.
DR   EnsemblGenomes-Gn; EBG00001268069.
DR   EnsemblGenomes-Gn; SeAg_B0123.
DR   EnsemblGenomes-Gn; SeAg_B0255.
DR   EnsemblGenomes-Gn; SeAg_B0291.
DR   EnsemblGenomes-Gn; SeAg_B0292.
DR   EnsemblGenomes-Gn; SeAg_B0293.
DR   EnsemblGenomes-Gn; SeAg_B0295.
DR   EnsemblGenomes-Gn; SeAg_B0297.
DR   EnsemblGenomes-Gn; SeAg_B0298.
DR   EnsemblGenomes-Gn; SeAg_B0309.
DR   EnsemblGenomes-Gn; SeAg_B0338.
DR   EnsemblGenomes-Gn; SeAg_B0358.
DR   EnsemblGenomes-Gn; SeAg_B0508.
DR   EnsemblGenomes-Gn; SeAg_B0525.
DR   EnsemblGenomes-Gn; SeAg_B0542.
DR   EnsemblGenomes-Gn; SeAg_B0600.
DR   EnsemblGenomes-Gn; SeAg_B0708.
DR   EnsemblGenomes-Gn; SeAg_B0718.
DR   EnsemblGenomes-Gn; SeAg_B0719.
DR   EnsemblGenomes-Gn; SeAg_B0720.
DR   EnsemblGenomes-Gn; SeAg_B0721.
DR   EnsemblGenomes-Gn; SeAg_B0722.
DR   EnsemblGenomes-Gn; SeAg_B0723.
DR   EnsemblGenomes-Gn; SeAg_B0724.
DR   EnsemblGenomes-Gn; SeAg_B0787.
DR   EnsemblGenomes-Gn; SeAg_B0788.
DR   EnsemblGenomes-Gn; SeAg_B0789.
DR   EnsemblGenomes-Gn; SeAg_B0790.
DR   EnsemblGenomes-Gn; SeAg_B0791.
DR   EnsemblGenomes-Gn; SeAg_B0906.
DR   EnsemblGenomes-Gn; SeAg_B0955.
DR   EnsemblGenomes-Gn; SeAg_B1045.
DR   EnsemblGenomes-Gn; SeAg_B1134.
DR   EnsemblGenomes-Gn; SeAg_B1176.
DR   EnsemblGenomes-Gn; SeAg_B1177.
DR   EnsemblGenomes-Gn; SeAg_B1178.
DR   EnsemblGenomes-Gn; SeAg_B1253.
DR   EnsemblGenomes-Gn; SeAg_B1254.
DR   EnsemblGenomes-Gn; SeAg_B1315.
DR   EnsemblGenomes-Gn; SeAg_B1382.
DR   EnsemblGenomes-Gn; SeAg_B1383.
DR   EnsemblGenomes-Gn; SeAg_B1384.
DR   EnsemblGenomes-Gn; SeAg_B1385.
DR   EnsemblGenomes-Gn; SeAg_B1386.
DR   EnsemblGenomes-Gn; SeAg_B1387.
DR   EnsemblGenomes-Gn; SeAg_B1388.
DR   EnsemblGenomes-Gn; SeAg_B1497.
DR   EnsemblGenomes-Gn; SeAg_B1504.
DR   EnsemblGenomes-Gn; SeAg_B1518.
DR   EnsemblGenomes-Gn; SeAg_B1591.
DR   EnsemblGenomes-Gn; SeAg_B1750.
DR   EnsemblGenomes-Gn; SeAg_B1751.
DR   EnsemblGenomes-Gn; SeAg_B1804.
DR   EnsemblGenomes-Gn; SeAg_B1809.
DR   EnsemblGenomes-Gn; SeAg_B1906.
DR   EnsemblGenomes-Gn; SeAg_B1919.
DR   EnsemblGenomes-Gn; SeAg_B1934.
DR   EnsemblGenomes-Gn; SeAg_B1935.
DR   EnsemblGenomes-Gn; SeAg_B1998.
DR   EnsemblGenomes-Gn; SeAg_B2057.
DR   EnsemblGenomes-Gn; SeAg_B2065.
DR   EnsemblGenomes-Gn; SeAg_B2067.
DR   EnsemblGenomes-Gn; SeAg_B2101.
DR   EnsemblGenomes-Gn; SeAg_B2115.
DR   EnsemblGenomes-Gn; SeAg_B2117.
DR   EnsemblGenomes-Gn; SeAg_B2254.
DR   EnsemblGenomes-Gn; SeAg_B2279.
DR   EnsemblGenomes-Gn; SeAg_B2378.
DR   EnsemblGenomes-Gn; SeAg_B2404.
DR   EnsemblGenomes-Gn; SeAg_B2534.
DR   EnsemblGenomes-Gn; SeAg_B2554.
DR   EnsemblGenomes-Gn; SeAg_B2555.
DR   EnsemblGenomes-Gn; SeAg_B2559.
DR   EnsemblGenomes-Gn; SeAg_B2560.
DR   EnsemblGenomes-Gn; SeAg_B2561.
DR   EnsemblGenomes-Gn; SeAg_B2562.
DR   EnsemblGenomes-Gn; SeAg_B2674.
DR   EnsemblGenomes-Gn; SeAg_B2689.
DR   EnsemblGenomes-Gn; SeAg_B2714.
DR   EnsemblGenomes-Gn; SeAg_B2724.
DR   EnsemblGenomes-Gn; SeAg_B2725.
DR   EnsemblGenomes-Gn; SeAg_B2767.
DR   EnsemblGenomes-Gn; SeAg_B2769.
DR   EnsemblGenomes-Gn; SeAg_B2770.
DR   EnsemblGenomes-Gn; SeAg_B2839.
DR   EnsemblGenomes-Gn; SeAg_B2840.
DR   EnsemblGenomes-Gn; SeAg_B2936.
DR   EnsemblGenomes-Gn; SeAg_B2940.
DR   EnsemblGenomes-Gn; SeAg_B2941.
DR   EnsemblGenomes-Gn; SeAg_B2942.
DR   EnsemblGenomes-Gn; SeAg_B2943.
DR   EnsemblGenomes-Gn; SeAg_B2944.
DR   EnsemblGenomes-Gn; SeAg_B3047.
DR   EnsemblGenomes-Gn; SeAg_B3108.
DR   EnsemblGenomes-Gn; SeAg_B3128.
DR   EnsemblGenomes-Gn; SeAg_B3135.
DR   EnsemblGenomes-Gn; SeAg_B3136.
DR   EnsemblGenomes-Gn; SeAg_B3158.
DR   EnsemblGenomes-Gn; SeAg_B3159.
DR   EnsemblGenomes-Gn; SeAg_B3182.
DR   EnsemblGenomes-Gn; SeAg_B3192.
DR   EnsemblGenomes-Gn; SeAg_B3220.
DR   EnsemblGenomes-Gn; SeAg_B3222.
DR   EnsemblGenomes-Gn; SeAg_B3281.
DR   EnsemblGenomes-Gn; SeAg_B3385.
DR   EnsemblGenomes-Gn; SeAg_B3399.
DR   EnsemblGenomes-Gn; SeAg_B3436.
DR   EnsemblGenomes-Gn; SeAg_B3470.
DR   EnsemblGenomes-Gn; SeAg_B3478.
DR   EnsemblGenomes-Gn; SeAg_B3481.
DR   EnsemblGenomes-Gn; SeAg_B3518.
DR   EnsemblGenomes-Gn; SeAg_B3587.
DR   EnsemblGenomes-Gn; SeAg_B3588.
DR   EnsemblGenomes-Gn; SeAg_B3589.
DR   EnsemblGenomes-Gn; SeAg_B3590.
DR   EnsemblGenomes-Gn; SeAg_B3591.
DR   EnsemblGenomes-Gn; SeAg_B3592.
DR   EnsemblGenomes-Gn; SeAg_B3746.
DR   EnsemblGenomes-Gn; SeAg_B3846.
DR   EnsemblGenomes-Gn; SeAg_B3847.
DR   EnsemblGenomes-Gn; SeAg_B3968.
DR   EnsemblGenomes-Gn; SeAg_B4116.
DR   EnsemblGenomes-Gn; SeAg_B4117.
DR   EnsemblGenomes-Gn; SeAg_B4118.
DR   EnsemblGenomes-Gn; SeAg_B4120.
DR   EnsemblGenomes-Gn; SeAg_B4121.
DR   EnsemblGenomes-Gn; SeAg_B4122.
DR   EnsemblGenomes-Gn; SeAg_B4157.
DR   EnsemblGenomes-Gn; SeAg_B4158.
DR   EnsemblGenomes-Gn; SeAg_B4159.
DR   EnsemblGenomes-Gn; SeAg_B4160.
DR   EnsemblGenomes-Gn; SeAg_B4162.
DR   EnsemblGenomes-Gn; SeAg_B4218.
DR   EnsemblGenomes-Gn; SeAg_B4219.
DR   EnsemblGenomes-Gn; SeAg_B4220.
DR   EnsemblGenomes-Gn; SeAg_B4221.
DR   EnsemblGenomes-Gn; SeAg_B4223.
DR   EnsemblGenomes-Gn; SeAg_B4232.
DR   EnsemblGenomes-Gn; SeAg_B4234.
DR   EnsemblGenomes-Gn; SeAg_B4365.
DR   EnsemblGenomes-Gn; SeAg_B4374.
DR   EnsemblGenomes-Gn; SeAg_B4375.
DR   EnsemblGenomes-Gn; SeAg_B4376.
DR   EnsemblGenomes-Gn; SeAg_B4377.
DR   EnsemblGenomes-Gn; SeAg_B4379.
DR   EnsemblGenomes-Gn; SeAg_B4383.
DR   EnsemblGenomes-Gn; SeAg_B4384.
DR   EnsemblGenomes-Gn; SeAg_B4386.
DR   EnsemblGenomes-Gn; SeAg_B4387.
DR   EnsemblGenomes-Gn; SeAg_B4395.
DR   EnsemblGenomes-Gn; SeAg_B4422.
DR   EnsemblGenomes-Gn; SeAg_B4423.
DR   EnsemblGenomes-Gn; SeAg_B4424.
DR   EnsemblGenomes-Gn; SeAg_B4426.
DR   EnsemblGenomes-Gn; SeAg_B4557.
DR   EnsemblGenomes-Gn; SeAg_B4599.
DR   EnsemblGenomes-Gn; SeAg_B4630.
DR   EnsemblGenomes-Gn; SeAg_B4631.
DR   EnsemblGenomes-Gn; SeAg_B4632.
DR   EnsemblGenomes-Gn; SeAg_B4772.
DR   EnsemblGenomes-Gn; SeAg_B4874.
DR   EnsemblGenomes-Gn; SeAg_B4875.
DR   EnsemblGenomes-Gn; SeAg_B4876.
DR   EnsemblGenomes-Tr; EBT00001800241.
DR   EnsemblGenomes-Tr; EBT00001800242.
DR   EnsemblGenomes-Tr; EBT00001800243.
DR   EnsemblGenomes-Tr; EBT00001800244.
DR   EnsemblGenomes-Tr; EBT00001800245.
DR   EnsemblGenomes-Tr; EBT00001800246.
DR   EnsemblGenomes-Tr; EBT00001800247.
DR   EnsemblGenomes-Tr; EBT00001800248.
DR   EnsemblGenomes-Tr; EBT00001800249.
DR   EnsemblGenomes-Tr; EBT00001800250.
DR   EnsemblGenomes-Tr; EBT00001800251.
DR   EnsemblGenomes-Tr; EBT00001800252.
DR   EnsemblGenomes-Tr; EBT00001800253.
DR   EnsemblGenomes-Tr; EBT00001800254.
DR   EnsemblGenomes-Tr; EBT00001800255.
DR   EnsemblGenomes-Tr; EBT00001800256.
DR   EnsemblGenomes-Tr; EBT00001800257.
DR   EnsemblGenomes-Tr; EBT00001800258.
DR   EnsemblGenomes-Tr; EBT00001800259.
DR   EnsemblGenomes-Tr; EBT00001800260.
DR   EnsemblGenomes-Tr; EBT00001800261.
DR   EnsemblGenomes-Tr; EBT00001800262.
DR   EnsemblGenomes-Tr; EBT00001800263.
DR   EnsemblGenomes-Tr; EBT00001800264.
DR   EnsemblGenomes-Tr; EBT00001800265.
DR   EnsemblGenomes-Tr; EBT00001800266.
DR   EnsemblGenomes-Tr; EBT00001800267.
DR   EnsemblGenomes-Tr; EBT00001800268.
DR   EnsemblGenomes-Tr; EBT00001800269.
DR   EnsemblGenomes-Tr; EBT00001800270.
DR   EnsemblGenomes-Tr; EBT00001800271.
DR   EnsemblGenomes-Tr; EBT00001800272.
DR   EnsemblGenomes-Tr; EBT00001800273.
DR   EnsemblGenomes-Tr; EBT00001800274.
DR   EnsemblGenomes-Tr; EBT00001800275.
DR   EnsemblGenomes-Tr; EBT00001800276.
DR   EnsemblGenomes-Tr; EBT00001800277.
DR   EnsemblGenomes-Tr; EBT00001800278.
DR   EnsemblGenomes-Tr; EBT00001800279.
DR   EnsemblGenomes-Tr; EBT00001800280.
DR   EnsemblGenomes-Tr; EBT00001800281.
DR   EnsemblGenomes-Tr; EBT00001800282.
DR   EnsemblGenomes-Tr; EBT00001800283.
DR   EnsemblGenomes-Tr; EBT00001800284.
DR   EnsemblGenomes-Tr; EBT00001800285.
DR   EnsemblGenomes-Tr; EBT00001800286.
DR   EnsemblGenomes-Tr; EBT00001800287.
DR   EnsemblGenomes-Tr; EBT00001800288.
DR   EnsemblGenomes-Tr; EBT00001800289.
DR   EnsemblGenomes-Tr; EBT00001800290.
DR   EnsemblGenomes-Tr; EBT00001800291.
DR   EnsemblGenomes-Tr; EBT00001800292.
DR   EnsemblGenomes-Tr; EBT00001800293.
DR   EnsemblGenomes-Tr; EBT00001800294.
DR   EnsemblGenomes-Tr; EBT00001800295.
DR   EnsemblGenomes-Tr; EBT00001800296.
DR   EnsemblGenomes-Tr; EBT00001800297.
DR   EnsemblGenomes-Tr; EBT00001800298.
DR   EnsemblGenomes-Tr; EBT00001800299.
DR   EnsemblGenomes-Tr; EBT00001800300.
DR   EnsemblGenomes-Tr; EBT00001800301.
DR   EnsemblGenomes-Tr; EBT00001800302.
DR   EnsemblGenomes-Tr; EBT00001800303.
DR   EnsemblGenomes-Tr; EBT00001800304.
DR   EnsemblGenomes-Tr; EBT00001800305.
DR   EnsemblGenomes-Tr; EBT00001800306.
DR   EnsemblGenomes-Tr; EBT00001800307.
DR   EnsemblGenomes-Tr; EBT00001800308.
DR   EnsemblGenomes-Tr; EBT00001800309.
DR   EnsemblGenomes-Tr; EBT00001800310.
DR   EnsemblGenomes-Tr; EBT00001800311.
DR   EnsemblGenomes-Tr; EBT00001800312.
DR   EnsemblGenomes-Tr; EBT00001800313.
DR   EnsemblGenomes-Tr; EBT00001800314.
DR   EnsemblGenomes-Tr; EBT00001800315.
DR   EnsemblGenomes-Tr; EBT00001800316.
DR   EnsemblGenomes-Tr; EBT00001800317.
DR   EnsemblGenomes-Tr; EBT00001800318.
DR   EnsemblGenomes-Tr; EBT00001800319.
DR   EnsemblGenomes-Tr; EBT00001800320.
DR   EnsemblGenomes-Tr; EBT00001800321.
DR   EnsemblGenomes-Tr; EBT00001800322.
DR   EnsemblGenomes-Tr; EBT00001800323.
DR   EnsemblGenomes-Tr; EBT00001800324.
DR   EnsemblGenomes-Tr; EBT00001800325.
DR   EnsemblGenomes-Tr; EBT00001800326.
DR   EnsemblGenomes-Tr; EBT00001800327.
DR   EnsemblGenomes-Tr; EBT00001800328.
DR   EnsemblGenomes-Tr; EBT00001800329.
DR   EnsemblGenomes-Tr; EBT00001800330.
DR   EnsemblGenomes-Tr; EBT00001800331.
DR   EnsemblGenomes-Tr; EBT00001800332.
DR   EnsemblGenomes-Tr; EBT00001800333.
DR   EnsemblGenomes-Tr; EBT00001800334.
DR   EnsemblGenomes-Tr; EBT00001800335.
DR   EnsemblGenomes-Tr; EBT00001800336.
DR   EnsemblGenomes-Tr; EBT00001800337.
DR   EnsemblGenomes-Tr; EBT00001800338.
DR   EnsemblGenomes-Tr; EBT00001800339.
DR   EnsemblGenomes-Tr; EBT00001800340.
DR   EnsemblGenomes-Tr; EBT00001800341.
DR   EnsemblGenomes-Tr; EBT00001800342.
DR   EnsemblGenomes-Tr; EBT00001800343.
DR   EnsemblGenomes-Tr; EBT00001800344.
DR   EnsemblGenomes-Tr; EBT00001800345.
DR   EnsemblGenomes-Tr; EBT00001800346.
DR   EnsemblGenomes-Tr; EBT00001800347.
DR   EnsemblGenomes-Tr; EBT00001800348.
DR   EnsemblGenomes-Tr; EBT00001800349.
DR   EnsemblGenomes-Tr; EBT00001800350.
DR   EnsemblGenomes-Tr; EBT00001800351.
DR   EnsemblGenomes-Tr; EBT00001800352.
DR   EnsemblGenomes-Tr; EBT00001800353.
DR   EnsemblGenomes-Tr; EBT00001800354.
DR   EnsemblGenomes-Tr; EBT00001800355.
DR   EnsemblGenomes-Tr; EBT00001800356.
DR   EnsemblGenomes-Tr; EBT00001800357.
DR   EnsemblGenomes-Tr; EBT00001800358.
DR   EnsemblGenomes-Tr; EBT00001800359.
DR   EnsemblGenomes-Tr; EBT00001800360.
DR   EnsemblGenomes-Tr; EBT00001800361.
DR   EnsemblGenomes-Tr; EBT00001800362.
DR   EnsemblGenomes-Tr; EBT00001800363.
DR   EnsemblGenomes-Tr; EBT00001800364.
DR   EnsemblGenomes-Tr; EBT00001800365.
DR   EnsemblGenomes-Tr; EBT00001800366.
DR   EnsemblGenomes-Tr; EBT00001800367.
DR   EnsemblGenomes-Tr; EBT00001800368.
DR   EnsemblGenomes-Tr; EBT00001800369.
DR   EnsemblGenomes-Tr; EBT00001800370.
DR   EnsemblGenomes-Tr; EBT00001800371.
DR   EnsemblGenomes-Tr; EBT00001800372.
DR   EnsemblGenomes-Tr; EBT00001800373.
DR   EnsemblGenomes-Tr; EBT00001800374.
DR   EnsemblGenomes-Tr; EBT00001800375.
DR   EnsemblGenomes-Tr; EBT00001800376.
DR   EnsemblGenomes-Tr; EBT00001800377.
DR   EnsemblGenomes-Tr; EBT00001800378.
DR   EnsemblGenomes-Tr; EBT00001800379.
DR   EnsemblGenomes-Tr; EBT00001800380.
DR   EnsemblGenomes-Tr; EBT00001800381.
DR   EnsemblGenomes-Tr; EBT00001800382.
DR   EnsemblGenomes-Tr; EBT00001800383.
DR   EnsemblGenomes-Tr; EBT00001800384.
DR   EnsemblGenomes-Tr; EBT00001800385.
DR   EnsemblGenomes-Tr; EBT00001800386.
DR   EnsemblGenomes-Tr; EBT00001800387.
DR   EnsemblGenomes-Tr; EBT00001800388.
DR   EnsemblGenomes-Tr; EBT00001800389.
DR   EnsemblGenomes-Tr; EBT00001800390.
DR   EnsemblGenomes-Tr; EBT00001800391.
DR   EnsemblGenomes-Tr; EBT00001800392.
DR   EnsemblGenomes-Tr; EBT00001800393.
DR   EnsemblGenomes-Tr; EBT00001800394.
DR   EnsemblGenomes-Tr; EBT00001800395.
DR   EnsemblGenomes-Tr; EBT00001800396.
DR   EnsemblGenomes-Tr; EBT00001800397.
DR   EnsemblGenomes-Tr; EBT00001800398.
DR   EnsemblGenomes-Tr; EBT00001800399.
DR   EnsemblGenomes-Tr; EBT00001800400.
DR   EnsemblGenomes-Tr; EBT00001800401.
DR   EnsemblGenomes-Tr; EBT00001800402.
DR   EnsemblGenomes-Tr; EBT00001800403.
DR   EnsemblGenomes-Tr; EBT00001800404.
DR   EnsemblGenomes-Tr; EBT00001800405.
DR   EnsemblGenomes-Tr; EBT00001800406.
DR   EnsemblGenomes-Tr; EBT00001800407.
DR   EnsemblGenomes-Tr; EBT00001800408.
DR   EnsemblGenomes-Tr; EBT00001800409.
DR   EnsemblGenomes-Tr; EBT00001800410.
DR   EnsemblGenomes-Tr; EBT00001800411.
DR   EnsemblGenomes-Tr; EBT00001800412.
DR   EnsemblGenomes-Tr; EBT00001800413.
DR   EnsemblGenomes-Tr; EBT00001800414.
DR   EnsemblGenomes-Tr; EBT00001800415.
DR   EnsemblGenomes-Tr; EBT00001800416.
DR   EnsemblGenomes-Tr; EBT00001800417.
DR   EnsemblGenomes-Tr; EBT00001800418.
DR   EnsemblGenomes-Tr; EBT00001800419.
DR   EnsemblGenomes-Tr; EBT00001800420.
DR   EnsemblGenomes-Tr; EBT00001800421.
DR   EnsemblGenomes-Tr; EBT00001800422.
DR   EnsemblGenomes-Tr; EBT00001800423.
DR   EnsemblGenomes-Tr; EBT00001800424.
DR   EnsemblGenomes-Tr; EBT00001800425.
DR   EnsemblGenomes-Tr; EBT00001800426.
DR   EnsemblGenomes-Tr; EBT00001800427.
DR   EnsemblGenomes-Tr; EBT00001800428.
DR   EnsemblGenomes-Tr; EBT00001800429.
DR   EnsemblGenomes-Tr; EBT00001800430.
DR   EnsemblGenomes-Tr; EBT00001800431.
DR   EnsemblGenomes-Tr; EBT00001800432.
DR   EnsemblGenomes-Tr; EBT00001800433.
DR   EnsemblGenomes-Tr; EBT00001800434.
DR   EnsemblGenomes-Tr; EBT00001800435.
DR   EnsemblGenomes-Tr; EBT00001800436.
DR   EnsemblGenomes-Tr; EBT00001800437.
DR   EnsemblGenomes-Tr; EBT00001800438.
DR   EnsemblGenomes-Tr; EBT00001800439.
DR   EnsemblGenomes-Tr; EBT00001800440.
DR   EnsemblGenomes-Tr; EBT00001800441.
DR   EnsemblGenomes-Tr; EBT00001800442.
DR   EnsemblGenomes-Tr; EBT00001800443.
DR   EnsemblGenomes-Tr; EBT00001800444.
DR   EnsemblGenomes-Tr; EBT00001800445.
DR   EnsemblGenomes-Tr; EBT00001800446.
DR   EnsemblGenomes-Tr; EBT00001800447.
DR   EnsemblGenomes-Tr; EBT00001800448.
DR   EnsemblGenomes-Tr; EBT00001800449.
DR   EnsemblGenomes-Tr; EBT00001800450.
DR   EnsemblGenomes-Tr; EBT00001800451.
DR   EnsemblGenomes-Tr; EBT00001800452.
DR   EnsemblGenomes-Tr; EBT00001800453.
DR   EnsemblGenomes-Tr; EBT00001800454.
DR   EnsemblGenomes-Tr; EBT00001800455.
DR   EnsemblGenomes-Tr; EBT00001800456.
DR   EnsemblGenomes-Tr; EBT00001800457.
DR   EnsemblGenomes-Tr; EBT00001800458.
DR   EnsemblGenomes-Tr; EBT00001800459.
DR   EnsemblGenomes-Tr; EBT00001800460.
DR   EnsemblGenomes-Tr; EBT00001800461.
DR   EnsemblGenomes-Tr; EBT00001800462.
DR   EnsemblGenomes-Tr; EBT00001800463.
DR   EnsemblGenomes-Tr; EBT00001800464.
DR   EnsemblGenomes-Tr; EBT00001800465.
DR   EnsemblGenomes-Tr; EBT00001800466.
DR   EnsemblGenomes-Tr; EBT00001800467.
DR   EnsemblGenomes-Tr; EBT00001800468.
DR   EnsemblGenomes-Tr; EBT00001800469.
DR   EnsemblGenomes-Tr; EBT00001800470.
DR   EnsemblGenomes-Tr; EBT00001800471.
DR   EnsemblGenomes-Tr; EBT00001800472.
DR   EnsemblGenomes-Tr; EBT00001800473.
DR   EnsemblGenomes-Tr; EBT00001800474.
DR   EnsemblGenomes-Tr; EBT00001800475.
DR   EnsemblGenomes-Tr; SeAg_B0123-1.
DR   EnsemblGenomes-Tr; SeAg_B0255-1.
DR   EnsemblGenomes-Tr; SeAg_B0291-1.
DR   EnsemblGenomes-Tr; SeAg_B0292-1.
DR   EnsemblGenomes-Tr; SeAg_B0293-1.
DR   EnsemblGenomes-Tr; SeAg_B0295-1.
DR   EnsemblGenomes-Tr; SeAg_B0297-1.
DR   EnsemblGenomes-Tr; SeAg_B0298-1.
DR   EnsemblGenomes-Tr; SeAg_B0309-1.
DR   EnsemblGenomes-Tr; SeAg_B0338-1.
DR   EnsemblGenomes-Tr; SeAg_B0358-1.
DR   EnsemblGenomes-Tr; SeAg_B0508-1.
DR   EnsemblGenomes-Tr; SeAg_B0525-1.
DR   EnsemblGenomes-Tr; SeAg_B0542-1.
DR   EnsemblGenomes-Tr; SeAg_B0600-1.
DR   EnsemblGenomes-Tr; SeAg_B0708-1.
DR   EnsemblGenomes-Tr; SeAg_B0718-1.
DR   EnsemblGenomes-Tr; SeAg_B0719-1.
DR   EnsemblGenomes-Tr; SeAg_B0720-1.
DR   EnsemblGenomes-Tr; SeAg_B0721-1.
DR   EnsemblGenomes-Tr; SeAg_B0722-1.
DR   EnsemblGenomes-Tr; SeAg_B0723-1.
DR   EnsemblGenomes-Tr; SeAg_B0724-1.
DR   EnsemblGenomes-Tr; SeAg_B0787-1.
DR   EnsemblGenomes-Tr; SeAg_B0788-1.
DR   EnsemblGenomes-Tr; SeAg_B0789-1.
DR   EnsemblGenomes-Tr; SeAg_B0790-1.
DR   EnsemblGenomes-Tr; SeAg_B0791-1.
DR   EnsemblGenomes-Tr; SeAg_B0906-1.
DR   EnsemblGenomes-Tr; SeAg_B0955-1.
DR   EnsemblGenomes-Tr; SeAg_B1045-1.
DR   EnsemblGenomes-Tr; SeAg_B1134-1.
DR   EnsemblGenomes-Tr; SeAg_B1176-1.
DR   EnsemblGenomes-Tr; SeAg_B1177-1.
DR   EnsemblGenomes-Tr; SeAg_B1178-1.
DR   EnsemblGenomes-Tr; SeAg_B1253-1.
DR   EnsemblGenomes-Tr; SeAg_B1254-1.
DR   EnsemblGenomes-Tr; SeAg_B1315-1.
DR   EnsemblGenomes-Tr; SeAg_B1382-1.
DR   EnsemblGenomes-Tr; SeAg_B1383-1.
DR   EnsemblGenomes-Tr; SeAg_B1384-1.
DR   EnsemblGenomes-Tr; SeAg_B1385-1.
DR   EnsemblGenomes-Tr; SeAg_B1386-1.
DR   EnsemblGenomes-Tr; SeAg_B1387-1.
DR   EnsemblGenomes-Tr; SeAg_B1388-1.
DR   EnsemblGenomes-Tr; SeAg_B1497-1.
DR   EnsemblGenomes-Tr; SeAg_B1504-1.
DR   EnsemblGenomes-Tr; SeAg_B1518-1.
DR   EnsemblGenomes-Tr; SeAg_B1591-1.
DR   EnsemblGenomes-Tr; SeAg_B1750-1.
DR   EnsemblGenomes-Tr; SeAg_B1751-1.
DR   EnsemblGenomes-Tr; SeAg_B1804-1.
DR   EnsemblGenomes-Tr; SeAg_B1809-1.
DR   EnsemblGenomes-Tr; SeAg_B1906-1.
DR   EnsemblGenomes-Tr; SeAg_B1919-1.
DR   EnsemblGenomes-Tr; SeAg_B1934-1.
DR   EnsemblGenomes-Tr; SeAg_B1935-1.
DR   EnsemblGenomes-Tr; SeAg_B1998-1.
DR   EnsemblGenomes-Tr; SeAg_B2057-1.
DR   EnsemblGenomes-Tr; SeAg_B2065-1.
DR   EnsemblGenomes-Tr; SeAg_B2067-1.
DR   EnsemblGenomes-Tr; SeAg_B2101-1.
DR   EnsemblGenomes-Tr; SeAg_B2115-1.
DR   EnsemblGenomes-Tr; SeAg_B2117-1.
DR   EnsemblGenomes-Tr; SeAg_B2254-1.
DR   EnsemblGenomes-Tr; SeAg_B2279-1.
DR   EnsemblGenomes-Tr; SeAg_B2378-1.
DR   EnsemblGenomes-Tr; SeAg_B2404-1.
DR   EnsemblGenomes-Tr; SeAg_B2534-1.
DR   EnsemblGenomes-Tr; SeAg_B2554-1.
DR   EnsemblGenomes-Tr; SeAg_B2555-1.
DR   EnsemblGenomes-Tr; SeAg_B2559-1.
DR   EnsemblGenomes-Tr; SeAg_B2560-1.
DR   EnsemblGenomes-Tr; SeAg_B2561-1.
DR   EnsemblGenomes-Tr; SeAg_B2562-1.
DR   EnsemblGenomes-Tr; SeAg_B2674-1.
DR   EnsemblGenomes-Tr; SeAg_B2689-1.
DR   EnsemblGenomes-Tr; SeAg_B2714-1.
DR   EnsemblGenomes-Tr; SeAg_B2724-1.
DR   EnsemblGenomes-Tr; SeAg_B2725-1.
DR   EnsemblGenomes-Tr; SeAg_B2767-1.
DR   EnsemblGenomes-Tr; SeAg_B2769-1.
DR   EnsemblGenomes-Tr; SeAg_B2770-1.
DR   EnsemblGenomes-Tr; SeAg_B2839-1.
DR   EnsemblGenomes-Tr; SeAg_B2840-1.
DR   EnsemblGenomes-Tr; SeAg_B2936-1.
DR   EnsemblGenomes-Tr; SeAg_B2940-1.
DR   EnsemblGenomes-Tr; SeAg_B2941-1.
DR   EnsemblGenomes-Tr; SeAg_B2942-1.
DR   EnsemblGenomes-Tr; SeAg_B2943-1.
DR   EnsemblGenomes-Tr; SeAg_B2944-1.
DR   EnsemblGenomes-Tr; SeAg_B3047-1.
DR   EnsemblGenomes-Tr; SeAg_B3108-1.
DR   EnsemblGenomes-Tr; SeAg_B3128-1.
DR   EnsemblGenomes-Tr; SeAg_B3135-1.
DR   EnsemblGenomes-Tr; SeAg_B3136-1.
DR   EnsemblGenomes-Tr; SeAg_B3158-1.
DR   EnsemblGenomes-Tr; SeAg_B3159-1.
DR   EnsemblGenomes-Tr; SeAg_B3182-1.
DR   EnsemblGenomes-Tr; SeAg_B3192-1.
DR   EnsemblGenomes-Tr; SeAg_B3220-1.
DR   EnsemblGenomes-Tr; SeAg_B3222-1.
DR   EnsemblGenomes-Tr; SeAg_B3281-1.
DR   EnsemblGenomes-Tr; SeAg_B3385-1.
DR   EnsemblGenomes-Tr; SeAg_B3399-1.
DR   EnsemblGenomes-Tr; SeAg_B3436-1.
DR   EnsemblGenomes-Tr; SeAg_B3470-1.
DR   EnsemblGenomes-Tr; SeAg_B3478-1.
DR   EnsemblGenomes-Tr; SeAg_B3481-1.
DR   EnsemblGenomes-Tr; SeAg_B3518-1.
DR   EnsemblGenomes-Tr; SeAg_B3587-1.
DR   EnsemblGenomes-Tr; SeAg_B3588-1.
DR   EnsemblGenomes-Tr; SeAg_B3589-1.
DR   EnsemblGenomes-Tr; SeAg_B3590-1.
DR   EnsemblGenomes-Tr; SeAg_B3591-1.
DR   EnsemblGenomes-Tr; SeAg_B3592-1.
DR   EnsemblGenomes-Tr; SeAg_B3746-1.
DR   EnsemblGenomes-Tr; SeAg_B3846-1.
DR   EnsemblGenomes-Tr; SeAg_B3847-1.
DR   EnsemblGenomes-Tr; SeAg_B3968-1.
DR   EnsemblGenomes-Tr; SeAg_B4116-1.
DR   EnsemblGenomes-Tr; SeAg_B4117-1.
DR   EnsemblGenomes-Tr; SeAg_B4118-1.
DR   EnsemblGenomes-Tr; SeAg_B4120-1.
DR   EnsemblGenomes-Tr; SeAg_B4121-1.
DR   EnsemblGenomes-Tr; SeAg_B4122-1.
DR   EnsemblGenomes-Tr; SeAg_B4157-1.
DR   EnsemblGenomes-Tr; SeAg_B4158-1.
DR   EnsemblGenomes-Tr; SeAg_B4159-1.
DR   EnsemblGenomes-Tr; SeAg_B4160-1.
DR   EnsemblGenomes-Tr; SeAg_B4162-1.
DR   EnsemblGenomes-Tr; SeAg_B4218-1.
DR   EnsemblGenomes-Tr; SeAg_B4219-1.
DR   EnsemblGenomes-Tr; SeAg_B4220-1.
DR   EnsemblGenomes-Tr; SeAg_B4221-1.
DR   EnsemblGenomes-Tr; SeAg_B4223-1.
DR   EnsemblGenomes-Tr; SeAg_B4232-1.
DR   EnsemblGenomes-Tr; SeAg_B4234-1.
DR   EnsemblGenomes-Tr; SeAg_B4365-1.
DR   EnsemblGenomes-Tr; SeAg_B4374-1.
DR   EnsemblGenomes-Tr; SeAg_B4375-1.
DR   EnsemblGenomes-Tr; SeAg_B4376-1.
DR   EnsemblGenomes-Tr; SeAg_B4377-1.
DR   EnsemblGenomes-Tr; SeAg_B4379-1.
DR   EnsemblGenomes-Tr; SeAg_B4383-1.
DR   EnsemblGenomes-Tr; SeAg_B4384-1.
DR   EnsemblGenomes-Tr; SeAg_B4386-1.
DR   EnsemblGenomes-Tr; SeAg_B4387-1.
DR   EnsemblGenomes-Tr; SeAg_B4395-1.
DR   EnsemblGenomes-Tr; SeAg_B4422-1.
DR   EnsemblGenomes-Tr; SeAg_B4423-1.
DR   EnsemblGenomes-Tr; SeAg_B4424-1.
DR   EnsemblGenomes-Tr; SeAg_B4426-1.
DR   EnsemblGenomes-Tr; SeAg_B4557-1.
DR   EnsemblGenomes-Tr; SeAg_B4599-1.
DR   EnsemblGenomes-Tr; SeAg_B4630-1.
DR   EnsemblGenomes-Tr; SeAg_B4631-1.
DR   EnsemblGenomes-Tr; SeAg_B4632-1.
DR   EnsemblGenomes-Tr; SeAg_B4772-1.
DR   EnsemblGenomes-Tr; SeAg_B4874-1.
DR   EnsemblGenomes-Tr; SeAg_B4875-1.
DR   EnsemblGenomes-Tr; SeAg_B4876-1.
DR   EuropePMC; PMC3067318; 21278266.
DR   EuropePMC; PMC3098285; 21625519.
DR   EuropePMC; PMC3133335; 21602358.
DR   EuropePMC; PMC3163573; 21824423.
DR   EuropePMC; PMC3251573; 22238616.
DR   EuropePMC; PMC3356390; 22623967.
DR   EuropePMC; PMC3411829; 22880062.
DR   EuropePMC; PMC3716127; 23478955.
DR   EuropePMC; PMC4042001; 24885207.
DR   EuropePMC; PMC5007712; 27605332.
DR   EuropePMC; PMC5320704; 28348832.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00014; DsrA.
DR   RFAM; RF00018; CsrB.
DR   RFAM; RF00021; Spot_42.
DR   RFAM; RF00022; GcvB.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00029; Intron_gpII.
DR   RFAM; RF00033; MicF.
DR   RFAM; RF00034; RprA.
DR   RFAM; RF00035; OxyS.
DR   RFAM; RF00040; rne5.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00057; RyhB.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00077; SraB.
DR   RFAM; RF00078; MicA.
DR   RFAM; RF00079; OmrA-B.
DR   RFAM; RF00080; yybP-ykoY.
DR   RFAM; RF00081; ArcZ.
DR   RFAM; RF00082; SraG.
DR   RFAM; RF00083; GlmZ_SraJ.
DR   RFAM; RF00084; CsrC.
DR   RFAM; RF00101; SraC_RyeA.
DR   RFAM; RF00110; RybB.
DR   RFAM; RF00111; RyeB.
DR   RFAM; RF00112; CyaR_RyeE.
DR   RFAM; RF00113; QUAD.
DR   RFAM; RF00114; S15.
DR   RFAM; RF00118; rydB.
DR   RFAM; RF00121; MicC.
DR   RFAM; RF00126; ryfA.
DR   RFAM; RF00127; t44.
DR   RFAM; RF00128; GlmY_tke1.
DR   RFAM; RF00140; Alpha_RBS.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00240; RNA-OUT.
DR   RFAM; RF00368; sroB.
DR   RFAM; RF00369; sroC.
DR   RFAM; RF00370; sroD.
DR   RFAM; RF00371; sroE.
DR   RFAM; RF00382; DnaX.
DR   RFAM; RF00391; RtT.
DR   RFAM; RF00505; RydC.
DR   RFAM; RF00506; Thr_leader.
DR   RFAM; RF00512; Leu_leader.
DR   RFAM; RF00513; Trp_leader.
DR   RFAM; RF00514; His_leader.
DR   RFAM; RF00534; SgrS.
DR   RFAM; RF00552; rncO.
DR   RFAM; RF00630; P26.
DR   RFAM; RF01055; MOCO_RNA_motif.
DR   RFAM; RF01056; Mg_sensor.
DR   RFAM; RF01068; mini-ykkC.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01384; InvR.
DR   RFAM; RF01385; isrA.
DR   RFAM; RF01387; isrC.
DR   RFAM; RF01388; isrD.
DR   RFAM; RF01391; isrH.
DR   RFAM; RF01392; isrI.
DR   RFAM; RF01394; isrK.
DR   RFAM; RF01395; isrL.
DR   RFAM; RF01396; isrN.
DR   RFAM; RF01397; isrO.
DR   RFAM; RF01398; isrP.
DR   RFAM; RF01399; isrQ.
DR   RFAM; RF01400; istR.
DR   RFAM; RF01401; rseX.
DR   RFAM; RF01402; STnc150.
DR   RFAM; RF01403; STnc290.
DR   RFAM; RF01404; STnc440.
DR   RFAM; RF01407; STnc560.
DR   RFAM; RF01408; sraL.
DR   RFAM; RF01409; STnc250.
DR   RFAM; RF01517; iscRS.
DR   RFAM; RF01707; JUMPstart.
DR   RFAM; RF01766; cspA.
DR   RFAM; RF01769; greA.
DR   RFAM; RF01770; rimP.
DR   RFAM; RF01771; rnk_leader.
DR   RFAM; RF01794; sok.
DR   RFAM; RF01795; FourU.
DR   RFAM; RF01796; frnS.
DR   RFAM; RF01813; rdlD.
DR   RFAM; RF01830; StyR-44.
DR   RFAM; RF01832; ROSE_2.
DR   RFAM; RF01852; tRNA-Sec.
DR   RFAM; RF01859; Phe_leader.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   RFAM; RF01988; SECIS_2.
DR   RFAM; RF01989; SECIS_3.
DR   RFAM; RF02029; sraA.
DR   RFAM; RF02030; tp2.
DR   RFAM; RF02031; tpke11.
DR   RFAM; RF02048; STnc30.
DR   RFAM; RF02050; STnc470.
DR   RFAM; RF02051; STnc450.
DR   RFAM; RF02052; STnc630.
DR   RFAM; RF02053; STnc430.
DR   RFAM; RF02054; STnc420.
DR   RFAM; RF02055; STnc380.
DR   RFAM; RF02056; STnc390.
DR   RFAM; RF02057; STnc40.
DR   RFAM; RF02059; STnc50.
DR   RFAM; RF02060; STnc410.
DR   RFAM; RF02062; STnc361.
DR   RFAM; RF02063; STnc350.
DR   RFAM; RF02064; STnc370.
DR   RFAM; RF02065; STnc340.
DR   RFAM; RF02066; STnc320.
DR   RFAM; RF02067; STnc310.
DR   RFAM; RF02068; STnc480.
DR   RFAM; RF02069; STnc70.
DR   RFAM; RF02070; STnc300.
DR   RFAM; RF02071; STnc280.
DR   RFAM; RF02072; STnc590.
DR   RFAM; RF02073; STnc260.
DR   RFAM; RF02074; STnc240.
DR   RFAM; RF02075; STnc230.
DR   RFAM; RF02076; STnc100.
DR   RFAM; RF02077; STnc220.
DR   RFAM; RF02078; STnc210.
DR   RFAM; RF02079; STnc180.
DR   RFAM; RF02080; STnc170.
DR   RFAM; RF02081; STnc550.
DR   RFAM; RF02082; STnc540.
DR   RFAM; RF02084; STnc130.
DR   RFAM; RF02088; STnc510.
DR   RFAM; RF02194; HPnc0260.
DR   SILVA-LSU; CP001138.
DR   SILVA-SSU; CP001138.
XX
CC   The sequenced strain has been deposited at the Salmonella Genetic
CC   Stock Center at the University of Calgary under the care of Dr.
CC   K.E. Sanderson.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..4798660
FT                   /organism="Salmonella enterica subsp. enterica serovar
FT                   Agona str. SL483"
FT                   /sub_species="enterica"
FT                   /strain="SL483"
FT                   /mol_type="genomic DNA"
FT                   /serovar="Agona"
FT                   /db_xref="taxon:454166"
FT   misc_feature    184..311
FT                   /note="Threonine operon leader"
FT   gene            337..2799
FT                   /gene="thrA"
FT                   /locus_tag="SeAg_B0002"
FT   CDS_pept        337..2799
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thrA"
FT                   /locus_tag="SeAg_B0002"
FT                   /product="aspartokinase/homoserine dehydrogenase I"
FT                   /EC_number="2.7.2.4"
FT                   /EC_number="1.1.1.3"
FT                   /note="identified by match to protein family HMM PF00696;
FT                   match to protein family HMM PF00742; match to protein
FT                   family HMM PF01842; match to protein family HMM PF03447;
FT                   match to protein family HMM TIGR00657"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0002"
FT                   /db_xref="EnsemblGenomes-Tr:ACH51840"
FT                   /db_xref="GOA:B5F6C1"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001341"
FT                   /db_xref="InterPro:IPR001342"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR005106"
FT                   /db_xref="InterPro:IPR011147"
FT                   /db_xref="InterPro:IPR018042"
FT                   /db_xref="InterPro:IPR019811"
FT                   /db_xref="InterPro:IPR027795"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR041743"
FT                   /db_xref="UniProtKB/TrEMBL:B5F6C1"
FT                   /protein_id="ACH51840.1"
FT                   /translation="MRVLKFGGTSVANAERFLRVADILESNARQGQVATVLSAPAKITN
FT                   HLVAMIEKTIGGQDALPNISDAERIFSDLLAGLASAQPGFPLARLKMVVEQEFAQIKHV
FT                   LHGISLLGQCPNSINAALICRGEKMSIAIMAGLLEARGHRVTVIDPVEKLLAVGHYLES
FT                   TVDIAESTRRIAASQIPADHMILMAGFTAGNEKGELVVLGRNGSDYSAAVLAACLRADC
FT                   CEIWTDVDGVYTCDPRQVPDARLLKSMSYQEAMELSYFGAKVLHPRTITPIAQFQIPCL
FT                   IKNTGNPQAPGTLIGASSDDDNLPVKGISNLNNMAMFSVSGPGMKGMIGMAARVFAAMS
FT                   RAGISVVLITQSSSEYSISFCVPQSDCARARRAMQDEFYLELKEGLLEPLAVTERLAII
FT                   SVVGDGMRTLRGISAKFFAALARANINIVAIAQGSSERSISVVVNNDDATTGVRVTHQM
FT                   LFNTDQVIEVFVIGVGGVGGALLEQLKRQQTWLKNKHIDLRVCGVANSKALLTNVHGLN
FT                   LDNWQAELAQANAPFNLGRLIRLVKEYHLLNPVIVDCTSSQAVADQYADFLREGFHVVT
FT                   PNKKANTSSMDYYHQLRFAAAQSRRKFLYDTNVGAGLPVIENLQNLLNAGDELQKFSGI
FT                   LSGSLSFIFGKLEEGMSLSQATALAREMGYTEPDPRDDLSGMDVARKLLILARETGREL
FT                   ELSDIVIEPVLPDEFDASGDVTAFMAHLPQLDDAFAARVAKARDEGKVLRYVGNIEEDG
FT                   VCRVKIAEVDGNDPLFKVKNGENALAFYSHYYQPLPLVLRGYGAGNDVTAAGVFADLLR
FT                   TLSWKLGV"
FT   gene            2801..3730
FT                   /gene="thrB"
FT                   /locus_tag="SeAg_B0003"
FT   CDS_pept        2801..3730
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thrB"
FT                   /locus_tag="SeAg_B0003"
FT                   /product="homoserine kinase"
FT                   /EC_number="2.7.1.39"
FT                   /note="identified by match to protein family HMM PF00288;
FT                   match to protein family HMM PF08544; match to protein
FT                   family HMM TIGR00191"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0003"
FT                   /db_xref="EnsemblGenomes-Tr:ACH51034"
FT                   /db_xref="GOA:B5F6C2"
FT                   /db_xref="InterPro:IPR000870"
FT                   /db_xref="InterPro:IPR006203"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5F6C2"
FT                   /protein_id="ACH51034.1"
FT                   /translation="MVKVYAPASSANMSVGFDVLGAAVTPVDGTLLGDVVSVEAADHFR
FT                   LHNLGRFADKLPPEPRENIVYQCWERFCQALGKTIPVAMTLEKNMPIGSGLGSSACSVV
FT                   AALVAMNEHCGKPLNDTRLLALMGELEGRISGSIHYDNVAPCFLGGMQLMIEENGIISQ
FT                   QVPGFDEWLWVLAYPGIKVSTAEARAILPAQYRRQDCIAHGRHLAGFIHACYSRQPQLA
FT                   AALMKDVIAEPYRARLLPGFSQARQAVSEIGALASGISGSGPTLFALCDKPETAQRVAD
FT                   WLSKHYLQNQEGFVHICRLDTAGARVVG"
FT   gene            3734..5020
FT                   /gene="thrC"
FT                   /locus_tag="SeAg_B0004"
FT   CDS_pept        3734..5020
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thrC"
FT                   /locus_tag="SeAg_B0004"
FT                   /product="threonine synthase"
FT                   /EC_number="4.2.3.1"
FT                   /note="identified by match to protein family HMM PF00291;
FT                   match to protein family HMM TIGR00260"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0004"
FT                   /db_xref="EnsemblGenomes-Tr:ACH50268"
FT                   /db_xref="GOA:B5F6C3"
FT                   /db_xref="InterPro:IPR000634"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR004450"
FT                   /db_xref="InterPro:IPR029144"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="InterPro:IPR037158"
FT                   /db_xref="UniProtKB/TrEMBL:B5F6C3"
FT                   /protein_id="ACH50268.1"
FT                   /translation="MKLYNLKDHNEQVSFAQAVTQGLGKQQGLFFPHELPEFSLTEIDE
FT                   MLNQDFVSRSAKILSAFIGDEIPQQILEERVRAAFAFPAPVAQVESDVGCLELFHGPTL
FT                   AFKDFGGRFMAQMLTHISGDKPVTILTATSGDTGAAVAHAFYGLENVRVVILYPRGKIS
FT                   PLQEKLFCTLGGNIETVAIDGDFDACQALVKQAFDDEELKTALGLNSANSINISRLLAQ
FT                   ICYYFEAVAQLPQGARNQLVISVPSGNFGDLTAGLLAKSLGLPVKRFIAATNVNDTVPR
FT                   FLHDGKWAPKATQATLSNAMDVSQPNNWPRVEELFRRKIWRLTELGYAAVDDTTTQQTM
FT                   RELKAKGYISEPHAAVAYRALRDQLNPGEYGLFLGTAHPAKFKESVESILGETLALPEA
FT                   LAERADLPLLSHHLPADFAALRKLMMTRQ"
FT   gene            complement(5113..5886)
FT                   /locus_tag="SeAg_B0005"
FT   CDS_pept        complement(5113..5886)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0005"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF03883"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0005"
FT                   /db_xref="EnsemblGenomes-Tr:ACH50610"
FT                   /db_xref="InterPro:IPR005583"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5F6C4"
FT                   /protein_id="ACH50610.1"
FT                   /translation="MLILISPAKTLDYQSPLATTRYTQPELLDHSQQLIQQARQLSAPQ
FT                   ISRLMGISDKLADLNATRFHDWQPHFTPDNARQAILAFKGDVYTGLQAETFNDADFDFA
FT                   QQHLRMLSGLYGVLRPLDLMQPYRLEMGIRLENPRGKDLYQFWGDIITDKLNEALEAQG
FT                   DRVVVNLASEEYFKSVKPKKLNAELIKPVFLDEKNGKFKVVSFYAKKARGLMSRFIIEN
FT                   RLTKPEQLIAFDREGYFFDEETSTQDELVFKRYEQ"
FT   gene            complement(5965..7422)
FT                   /locus_tag="SeAg_B0006"
FT   CDS_pept        complement(5965..7422)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0006"
FT                   /product="amino-acid carrier protein AlsT"
FT                   /note="identified by match to protein family HMM PF01235;
FT                   match to protein family HMM TIGR00835"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0006"
FT                   /db_xref="EnsemblGenomes-Tr:ACH49229"
FT                   /db_xref="GOA:B5F6Y1"
FT                   /db_xref="InterPro:IPR001463"
FT                   /db_xref="UniProtKB/TrEMBL:B5F6Y1"
FT                   /protein_id="ACH49229.1"
FT                   /translation="MTASTRGTLMPEFFSFINEILWGSVMIYLLLGAGCWFTWRTGFIQ
FT                   FRYIRQFSRSLKGSFSPQPGGLTSFQALCTSLAARIGSGNLAGVALAIAAGGPGAVFWM
FT                   WVSAIIGMATSFAECSLAQLYKERDPTGQFRGGPAWYMARGLGMRWMGVVFALFLLVAY
FT                   GLIFNSVQANAVSRALHFAFNIPPLISGIALAFCALLIIIRGIKGVARLMQWLIPLIAL
FT                   LWVAGSVFICLWHIEQMPGVIASIVKSAFGWQEAAAGAAGYTLTQAITSGFQRGMFSNE
FT                   AGMGSTPNAAAAATSYPPHPVAQGIVQMIGVFSDTIIICTASAMIILLAGNHASHSSTE
FT                   GIQLLQHAMVSLTGEWGASFVALIVILFAFSSIVANYIYAENNLFFLRLHNAKAIWLLR
FT                   LATLGMVIAGTLISFPLIWQLADMIMACMAITNLTAILLLSPVVYTLAGDYLRQRKLGV
FT                   RPQFDPRRFPDIEPQLAPDTWDAASRD"
FT   gene            7664..8617
FT                   /gene="tal2"
FT                   /locus_tag="SeAg_B0007"
FT   CDS_pept        7664..8617
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tal2"
FT                   /locus_tag="SeAg_B0007"
FT                   /product="transaldolase"
FT                   /EC_number="2.2.1.2"
FT                   /note="identified by match to protein family HMM PF00923;
FT                   match to protein family HMM TIGR00874"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0007"
FT                   /db_xref="EnsemblGenomes-Tr:ACH49484"
FT                   /db_xref="GOA:B5F6Y2"
FT                   /db_xref="InterPro:IPR001585"
FT                   /db_xref="InterPro:IPR004730"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018225"
FT                   /db_xref="UniProtKB/TrEMBL:B5F6Y2"
FT                   /protein_id="ACH49484.1"
FT                   /translation="MTDKLTSLRQFTTVVADTGDIAAMKLYQPQDATTNPSLILNAAQI
FT                   PEYRKLIDDAVAWAKQQSSDRAQQVVDATDKLAVNIGLEILKLVPGRISTEVDARLSYD
FT                   TEASIAKAKRIIKLYNDAGISNDRILIKLASTWQGIRAAEQLEKEGINCNLTLLFSFAQ
FT                   ARACAEAGVYLISPFVGRILDWYKANTDKKDYAPAEDPGVVSVTEIYEYYKQHGYETVV
FT                   MGASFRNVGEILELAGCDRLTIAPALLKELAESEGAIERKLSFSGEVKARPERITEAEF
FT                   LWQHHQDPMAVDKLADGIRKFAVDQEKLEKMIGDLL"
FT   gene            8728..9318
FT                   /gene="mog"
FT                   /locus_tag="SeAg_B0008"
FT   CDS_pept        8728..9318
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mog"
FT                   /locus_tag="SeAg_B0008"
FT                   /product="molybdopterin biosynthesis protein Mog"
FT                   /note="identified by match to protein family HMM PF00994;
FT                   match to protein family HMM TIGR00177"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0008"
FT                   /db_xref="EnsemblGenomes-Tr:ACH52266"
FT                   /db_xref="GOA:B5F6Y3"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="InterPro:IPR008284"
FT                   /db_xref="InterPro:IPR036425"
FT                   /db_xref="UniProtKB/TrEMBL:B5F6Y3"
FT                   /protein_id="ACH52266.1"
FT                   /translation="MDTLRIGLVSISDRASSGVYQDKGIPALEEWLASALTTPFEVQRR
FT                   LIPDEQEIIEQTLCELVDEMSCHLVLTTGGTGPARRDVTPDATLAIADREMPGFGEQMR
FT                   QISLRFVPTAILSRQVGVIRKQALILNLPGQPKSIKETLEGVKADDGSVSVPGIFASVP
FT                   YCIQLLDGPYVETAPEVVAAFRPKSARRENMSS"
FT   gene            complement(9375..9941)
FT                   /locus_tag="SeAg_B0009"
FT   CDS_pept        complement(9375..9941)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0009"
FT                   /product="membrane protein, GPR1/FUN34/yaaH family"
FT                   /note="identified by match to protein family HMM PF01184"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0009"
FT                   /db_xref="EnsemblGenomes-Tr:ACH53007"
FT                   /db_xref="GOA:B5F6Y4"
FT                   /db_xref="InterPro:IPR000791"
FT                   /db_xref="UniProtKB/TrEMBL:B5F6Y4"
FT                   /protein_id="ACH53007.1"
FT                   /translation="MGNTKLANPAPLGLMGFGMTTILLNLHNAGFFALDGIILAMGIFY
FT                   GGIAQIFAGLLEYKKGNTFGLTAFTSYGSFWLTLVAILLMPKMGLTDAPDAQLLGAYLG
FT                   LWGVFTLFMFFGTLKAARALQFVFLSLTVLFALLAVGNITGNEAIIHIAGWVGLVCGAS
FT                   AIYLAMGEVLNEQFGRTILPIGEAH"
FT   gene            complement(10091..10804)
FT                   /locus_tag="SeAg_B0010"
FT   CDS_pept        complement(10091..10804)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0010"
FT                   /product="positive regulator for sigma H"
FT                   /note="identified by match to protein family HMM PF03667"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0010"
FT                   /db_xref="EnsemblGenomes-Tr:ACH51247"
FT                   /db_xref="InterPro:IPR021150"
FT                   /db_xref="InterPro:IPR025217"
FT                   /db_xref="UniProtKB/TrEMBL:B5F6Y5"
FT                   /protein_id="ACH51247.1"
FT                   /translation="MNVTYLHDEDLDFLQHCSEEQLADFARLLTHNEKGKARLSSVLSH
FT                   NELFKAMEGHPEQHRRNWQLIAGEFQHYGGDSIANKLRGHGKQYRAILLDVAKRLKLKA
FT                   DKSMSTFEIEQQLLEHFLRHTWQKMDAAHKQEFLQAVDAKVSELEELLPLLMKDRSLAK
FT                   GVSHLLSTQLTRILRTHAAMSILGHGLLRGAGLGGPVGAALNGVKAMSGSAYRVTIPAV
FT                   LQIACLRRMMAAVQA"
FT   gene            complement(10840..11244)
FT                   /locus_tag="SeAg_B0011"
FT   CDS_pept        complement(10840..11244)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0011"
FT                   /product="protein YaaI"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0011"
FT                   /db_xref="EnsemblGenomes-Tr:ACH49792"
FT                   /db_xref="InterPro:IPR020240"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5F6Y6"
FT                   /protein_id="ACH49792.1"
FT                   /translation="MRSVLTISAGLLFGLALSSVAHANDHKILGVIAMPRNETNDLALK
FT                   IPVCRIVKRIQLTADHGDIELSGASVYFKTARSASQSLNVPSSIKEGQTTGWININSDN
FT                   DNKRCVSKITFSGHTVNSSDMARLKVIGDD"
FT   gene            11299..11424
FT                   /locus_tag="SeAg_B0012"
FT   CDS_pept        11299..11424
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0012"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0012"
FT                   /db_xref="EnsemblGenomes-Tr:ACH48466"
FT                   /db_xref="UniProtKB/TrEMBL:B5F6Y7"
FT                   /protein_id="ACH48466.1"
FT                   /translation="MATIQFCNLFFLLQFLCEWYSLFNLFHECLSVWFSIAPSRH"
FT   gene            11593..13509
FT                   /gene="dnaK"
FT                   /locus_tag="SeAg_B0013"
FT   CDS_pept        11593..13509
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaK"
FT                   /locus_tag="SeAg_B0013"
FT                   /product="chaperone protein DnaK"
FT                   /note="identified by match to protein family HMM PF00012;
FT                   match to protein family HMM TIGR02350"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0013"
FT                   /db_xref="EnsemblGenomes-Tr:ACH49079"
FT                   /db_xref="GOA:B5F6Y8"
FT                   /db_xref="InterPro:IPR012725"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR018181"
FT                   /db_xref="InterPro:IPR029047"
FT                   /db_xref="InterPro:IPR029048"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5F6Y8"
FT                   /protein_id="ACH49079.1"
FT                   /translation="MGKIIGIDLGTTNSCVAIMDGTQARVLENAEGDRTTPSIIAYTQD
FT                   GETLVGQPAKRQAVTNPQNTLFAIKRLIGRRFQDEEVQRDVSIMPYKIIGADNGDAWLD
FT                   VKGQKMAPPQISAEVLKKMKKTAEDYLGEPVTEAVITVPAYFNDAQRQATKDAGRIAGL
FT                   EVKRIINEPTAAALAYGLDKEVGNRTIAVYDLGGGTFDISIIEIDEVDGEKTFEVLATN
FT                   GDTHLGGEDFDTRLINYLVDEFKKDQGIDLRNDPLAMQRLKEAAEKAKIELSSAQQTDV
FT                   NLPYITADATGPKHMNIKVTRAKLESLVEDLVNRSIEPLKVALQDAGLSVSDINDVILV
FT                   GGQTRMPMVQKKVAEFFGKEPRKDVNPDEAVAIGAAVQGGVLTGDVKDVLLLDVTPLSL
FT                   GIETMGGVMTPLITKNTTIPTKHSQVFSTAEDNQSAVTIHVLQGERKRASDNKSLGQFN
FT                   LDGINPAPRGMPQIEVTFDIDADGILHVSAKDKNSGKEQKITIKASSGLNEEEIQKMVR
FT                   DAEANAESDRKFEELVQTRNQGDHLLHSTRKQVEEAGDKLPADDKTAIESALSALETAL
FT                   KGEDKAAIEAKMQELAQVSQKLMEIAQQQHAQQQAGSADASANNAKDDDVVDAEFEEVK
FT                   DKK"
FT   gene            13595..14734
FT                   /gene="dnaJ"
FT                   /locus_tag="SeAg_B0014"
FT   CDS_pept        13595..14734
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaJ"
FT                   /locus_tag="SeAg_B0014"
FT                   /product="chaperone protein DnaJ"
FT                   /note="identified by match to protein family HMM PF00226;
FT                   match to protein family HMM PF00684; match to protein
FT                   family HMM PF01556; match to protein family HMM TIGR02349"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0014"
FT                   /db_xref="EnsemblGenomes-Tr:ACH52019"
FT                   /db_xref="GOA:B5F6Y9"
FT                   /db_xref="InterPro:IPR001305"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR002939"
FT                   /db_xref="InterPro:IPR008971"
FT                   /db_xref="InterPro:IPR012724"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="InterPro:IPR036410"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5F6Y9"
FT                   /protein_id="ACH52019.1"
FT                   /translation="MAKRDYYEILGVSKTAEEREIKKAYKRLAMKYHPDRNQGDKEAEA
FT                   KFKEIKEAYEVLTDAQKRAAYDQYGHAAFEQGGMGGGFGGGFNGGADFSDIFGDVFGDI
FT                   FGGGRGRQRAARGADLRYNMDLTLEEAVRGVTKEIRIPTLEECDVCHGSGAKAGTQPQT
FT                   CPTCHGSGQVQMRQGFFAVQQTCPHCQGRGTLIKDPCHKCHGHGRVEKSKTLSVKIPAG
FT                   VDTGDRIRLAGEGEAGEHGAPAGDLYVQVQVKQHPIFEREGNNLYCEVPINFAMAALGG
FT                   EIEVPTLDGRVMLKVPSETQTGKLFRMRGKGVKSVRGGAQGDLLCRVVVETPVGLSEKQ
FT                   KQLLKDLQESFGGPTGEKNSPRSKSFFDGVKKFFDDLTR"
FT   gene            14846..14959
FT                   /locus_tag="SeAg_B0015"
FT   CDS_pept        14846..14959
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0015"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0015"
FT                   /db_xref="EnsemblGenomes-Tr:ACH52987"
FT                   /db_xref="UniProtKB/TrEMBL:B5F6Z0"
FT                   /protein_id="ACH52987.1"
FT                   /translation="MFLLINKLMLISSFVYAYSLKKRDVMTLMIAFLDAVN"
FT   gene            15015..15962
FT                   /locus_tag="SeAg_B0016"
FT   CDS_pept        15015..15962
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0016"
FT                   /product="putative transcriptional regulator, LysR family"
FT                   /note="identified by match to protein family HMM PF00126"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0016"
FT                   /db_xref="EnsemblGenomes-Tr:ACH52957"
FT                   /db_xref="GOA:B5F6Z1"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B5F6Z1"
FT                   /protein_id="ACH52957.1"
FT                   /translation="MGSKGANKSFDYNLIKILDAVILSGNAAMAAKKLGITPAAVSLAL
FT                   KRLQSYYPEELFSRGKGGLIPTAKAVDIHQNFSQVMKLVDDTFLCNSKKDEAFQITLLG
FT                   SDIVESYYLSQLYNSDIFDRILINHFTVRNMSREHISELLFTAQGDLLISAEPLLESGI
FT                   ENQIIDSFKSFVCICSSKHMLSTLSQLSLHHFYSSRHALYQPGMGASVIYHDSELFKDE
FT                   LYYTGRRIVGYRSDSLNGLMSMIERTSLIALMPLKLALFYKNHRKYDIKFIQPPPELAL
FT                   KSVQVYASWNKNSRNISTINEMVSMLQTLSSFRR"
FT   gene            16131..16433
FT                   /locus_tag="SeAg_B0017"
FT   CDS_pept        16131..16433
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0017"
FT                   /product="putative bacteriophage protein"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0017"
FT                   /db_xref="EnsemblGenomes-Tr:ACH51070"
FT                   /db_xref="GOA:B5F6Z2"
FT                   /db_xref="InterPro:IPR032126"
FT                   /db_xref="UniProtKB/TrEMBL:B5F6Z2"
FT                   /protein_id="ACH51070.1"
FT                   /translation="MELEILLTIISIGAWGGFVSYLLRKDKTEYNSSHESIKYCLTQIV
FT                   ISCFTSFLLSAIAIEKECSFNIVLLAAGLGGVFASPILKILGRRIKKIIEGNNSD"
FT   gene            complement(16494..17027)
FT                   /locus_tag="SeAg_B0018"
FT   CDS_pept        complement(16494..17027)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0018"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF05838;
FT                   match to protein family HMM PF09374"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0018"
FT                   /db_xref="EnsemblGenomes-Tr:ACH51123"
FT                   /db_xref="InterPro:IPR008565"
FT                   /db_xref="InterPro:IPR018537"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:B5F6Z3"
FT                   /protein_id="ACH51123.1"
FT                   /translation="MNPIIDGIIALEGGYVFNPKDKGGATHWGITEATARAHGYAGDMR
FT                   DLTHAEAYAILEEDYWIKPGFDVISTLSWPVSFELCDAAVNIGAYHPSAWLQRWLNVFN
FT                   HEGKRYPDIHVDGNIGPRTLAALEHYLAWRGQEGEAVLVKALNCSQGTYYLNVAEKNHN
FT                   NEQFIYGWIKNRVT"
FT   gene            complement(17044..17487)
FT                   /locus_tag="SeAg_B0019"
FT   CDS_pept        complement(17044..17487)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0019"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0019"
FT                   /db_xref="EnsemblGenomes-Tr:ACH52620"
FT                   /db_xref="GOA:B5F6Z4"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:B5F6Z4"
FT                   /protein_id="ACH52620.1"
FT                   /translation="MKTYIINSNCIYNEGKYELRTVSNSQVIKMTAMRAKCLSFIIENA
FT                   HLEIIERQKITTALWGSRSHYVNDANLTQILYLIRRDLKALGINDLFITIPRQGLKVNS
FT                   DIAIIATDSETKGRKKQIVRQTIAALTTVFSVTLGSLMYLHIH"
FT   gene            complement(17614..17742)
FT                   /locus_tag="SeAg_B0020"
FT   CDS_pept        complement(17614..17742)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0020"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0020"
FT                   /db_xref="EnsemblGenomes-Tr:ACH52439"
FT                   /db_xref="UniProtKB/TrEMBL:B5F6Z5"
FT                   /protein_id="ACH52439.1"
FT                   /translation="MRLTTPSIEEKTTPLSARLLRSGESIVNIIYHVIKYHLISMK"
FT   gene            17868..19967
FT                   /locus_tag="SeAg_B0021"
FT   CDS_pept        17868..19967
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0021"
FT                   /product="exochitinase"
FT                   /note="identified by match to protein family HMM PF00704;
FT                   match to protein family HMM PF02839"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0021"
FT                   /db_xref="EnsemblGenomes-Tr:ACH49326"
FT                   /db_xref="GOA:B5F6Z6"
FT                   /db_xref="InterPro:IPR001223"
FT                   /db_xref="InterPro:IPR003610"
FT                   /db_xref="InterPro:IPR011583"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR029070"
FT                   /db_xref="InterPro:IPR036573"
FT                   /db_xref="UniProtKB/TrEMBL:B5F6Z6"
FT                   /protein_id="ACH49326.1"
FT                   /translation="MATSKLIQGDTITETTHAANGFDPATSDDKISYTSARVAKPVYNK
FT                   YKNSTTKPKVFGYYTDWSQYDSRLQGNMSQPGRGYDLTNVSPTAYDKLIFGFVGITGFR
FT                   KIDKEDRDVVAEAAAQCGKVKYEPTFLDPWGDFQSYINLGFETSGWDVDPKTVTQANAK
FT                   GMLGALRDMQAKAKAAGHTLALSMSIGGWSMSNGFHETAASDSSRKIFAKGVVKLFKQF
FT                   PMFSEVDIDWEYPNDEGAGNPFGPEDGANYALLIAELRKQLDSAGLSNVKISIAASAVT
FT                   TIFDYAKVKDLMAAGLYGINLMTYDFFGTPWAETLGHHTNRKALEEGGWAVETIVDHLL
FT                   AEGFSADRINIGYAGYTRNARQVEIESLSPLKGSYNPGSGPTTGSFESGTSEWYDVIYS
FT                   YLDLENQKGRNGFNVYTDQVADADYLYSPESKLFLSLDTPRTVKAKGEYAAKLGLGGVF
FT                   TWTIDQDNGVLVNAVREGLGYEIESEVIDMEPFYFEGINVEKDEEQSDSDDAQKVNHAP
FT                   KAAIELLVVGGSTVQLSGAGSSDEDNDELSFSWGVPSQITVADKTAEIIEVVVPEVSEK
FT                   TAFQFTLFVRDCYNEPSSQQRFVLTAVPALSQVQPEPEEEEEIIVPVPDEEEDTTPAED
FT                   DTSADDKTSPYAQWDASTVYGANWGSFEIVSWKGHNYQVKWWSMGDQPDLNCGVGGAWT
FT                   DLGAY"
FT   gene            20060..23056
FT                   /locus_tag="SeAg_B0022"
FT   CDS_pept        20060..23056
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0022"
FT                   /product="putative hydroxymethyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0022"
FT                   /db_xref="EnsemblGenomes-Tr:ACH49949"
FT                   /db_xref="GOA:B5F6Z7"
FT                   /db_xref="UniProtKB/TrEMBL:B5F6Z7"
FT                   /protein_id="ACH49949.1"
FT                   /translation="MTISIHASAFDVNSWYQKITLTFINESGNPVDMNHAAISFTASGH
FT                   IDPWGNSGGTLKGNLPLTLNDSSYGTLETNNIIINNSDALLLQPGERGTLSFSLAATQV
FT                   PVKMSAITLTLASSSSEDAESETPSDQETPAIPAADEQPAEPDVPEKDNDLQERGLTLN
FT                   VSELNTASWYQRVTFTLTNLYAQAVDLNQLQLNFTASAHPDPYSPFQGTMLGNQAVTLA
FT                   SDGGWPIEKNTITINHDGALMLAAGDTVELQCYLAATQMPVAISDLSATLAHDPARQGK
FT                   ICVHFPAMTQTVALKPAIELLFPAGETRRFVGEWGEVLTISDLSAGTYRLTVPALANDE
FT                   MQIAPVESSFTVTLQSGDAAAQVQVSCLPIVRYASARLMIDAPALGNAKLTVDIADTTQ
FT                   ADERTVTLIANQPQLITRLLAGHHYTVNLQPAMINNRFISAPIQLTGFIPAAAQVAEVA
FT                   VAYQQSALDTASFVTVDATLLGLPDGVAPQRYLFSSGKYQYSLMLESGSDRQTLALRFA
FT                   PGLYDVQTDDIFIDSVPWRCEQAGPLRLLQKVNHVALEFLPGVTLQVKGWPDYLAHGGV
FT                   TVNAPETVSLYRDIPFSALFKYDGFDGGGDPVPAAEVDVNGDGFLDYATLPIHKTVALV
FT                   RQIEKEAGRSVMPVMVIYTANASGGSALADLQDAQKLRNHFGNFITQCLAAQSYKDETH
FT                   PVPATFVLNPDFLGALQQGPYGYTVVRQKNSVPVNAQLAAAIQALPAMAGFIAPSLPTF
FT                   SDDLYGYIQAVNYLVRQFAPDVAFGWQTNVWATGTADWVLRDTADPVAEGQAIAGFIHE
FT                   LGVYSGEYAPDFIAFDKFERDCFSPDALAHYGWNATCWLNYLAMVKQVTKALLTPAMLW
FT                   QIPGGHMPTVEEGVSKISAAHFASGGTFFMGDARIGSDPDTLSLQLLNTALNSATYGVP
FT                   TVGDFLRKDKGYDWGQMQALNLPDFNVFSILWGGGSTISITTIHSNGEDGGWLADKMVE
FT                   YYAAPRYFR"
FT   gene            23337..24041
FT                   /locus_tag="SeAg_B0023"
FT   CDS_pept        23337..24041
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0023"
FT                   /product="putative cytoplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0023"
FT                   /db_xref="EnsemblGenomes-Tr:ACH51846"
FT                   /db_xref="InterPro:IPR041687"
FT                   /db_xref="UniProtKB/TrEMBL:B5F6Z8"
FT                   /protein_id="ACH51846.1"
FT                   /translation="MKKMMNDAFAKDNNENSLHSFLFSQQAKPHAAIDALFSALLPFGQ
FT                   PFTLGIGDEFYLQANDEHYIVLLESGVVSFCHNDKRLHISSSFAPSVVGMVDSYGATYN
FT                   VPARPEHFLLAETVCTGRFVRLPDFIKIADECDLWHDVARCLAYRLMVMSARDRELVGV
FT                   DSYLKVRALLTEIWAYPQAYRESIIVLNFIQRRTGISRSRTMKILSELKKGGYIHIDNG
FT                   RLTALGKLPVAY"
FT   gene            24471..25013
FT                   /locus_tag="SeAg_B0024"
FT   CDS_pept        24471..25013
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0024"
FT                   /product="fimbrial subunit"
FT                   /note="identified by match to protein family HMM PF00419"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0024"
FT                   /db_xref="EnsemblGenomes-Tr:ACH51218"
FT                   /db_xref="GOA:B5F6Z9"
FT                   /db_xref="InterPro:IPR000259"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="InterPro:IPR036937"
FT                   /db_xref="UniProtKB/TrEMBL:B5F6Z9"
FT                   /protein_id="ACH51218.1"
FT                   /translation="MKKPVLALMVSAIAFGGMLSTAQADTTTVTGGTVNFVGQVVDAAC
FT                   SVSADSVDQTVTLGQVRASKLTEAGMVANQKEDFTIKLEDCDTQTSQNAAVIFNGQQDA
FT                   NQPGSLANTAGAGSATNVALQLYGPDGQALNIGESSSTVTLNDGENVIPLSVDYIATGT
FT                   ATAGNVTATATFSMVYS"
FT   gene            24973..25800
FT                   /locus_tag="SeAg_B0025"
FT   CDS_pept        24973..25800
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0025"
FT                   /product="chaperone protein FimC"
FT                   /note="identified by match to protein family HMM PF00345;
FT                   match to protein family HMM PF02753"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0025"
FT                   /db_xref="EnsemblGenomes-Tr:ACH50842"
FT                   /db_xref="GOA:B5F700"
FT                   /db_xref="InterPro:IPR001829"
FT                   /db_xref="InterPro:IPR008962"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR016147"
FT                   /db_xref="InterPro:IPR016148"
FT                   /db_xref="InterPro:IPR036316"
FT                   /db_xref="UniProtKB/TrEMBL:B5F700"
FT                   /protein_id="ACH50842.1"
FT                   /translation="MLPRRRHLAWFIPDSLSGFFSRLLGGEKGALRASLRVTNRRHQDI
FT                   TQMKKNVPIFLRLLLLLSAAGLSFAAQAGGIALGATRVIYPQGSKQTSLPIINSSASNV
FT                   FLIQSWVANADGSRSTDFIITPPLFVIQPKKENILRIMYVGPSLPTDRESVFYLNSKAI
FT                   PSVDKNKLTGNSLQIATQSVIKLFIRPKNLAEAPAHAPSTLRCRNERGQLTITNPSPYY
FT                   VSMVELYSAGKKLPNTMVPPKGAITLPATPGQVSLRTVNDFGATTPARVCPAS"
FT   gene            25760..28426
FT                   /locus_tag="SeAg_B0026"
FT   CDS_pept        25760..28426
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0026"
FT                   /product="outer membrane usher protein FimD"
FT                   /note="identified by match to protein family HMM PF00577"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0026"
FT                   /db_xref="EnsemblGenomes-Tr:ACH52718"
FT                   /db_xref="GOA:B5F701"
FT                   /db_xref="InterPro:IPR000015"
FT                   /db_xref="InterPro:IPR018030"
FT                   /db_xref="InterPro:IPR025885"
FT                   /db_xref="InterPro:IPR025949"
FT                   /db_xref="InterPro:IPR037224"
FT                   /db_xref="InterPro:IPR042186"
FT                   /db_xref="UniProtKB/TrEMBL:B5F701"
FT                   /protein_id="ACH52718.1"
FT                   /translation="MAQRRQHAFVQLHDVMRNQLFMTRYYSSVTKPVLTPLALAIALAP
FT                   APGWAENYFNPAFLSDDPSAVADLSTFSRNAQAAGMYRVDVYLNNTFLATRDIAFQAVK
FT                   TTGKSAPTDDSGLRACLTPEMLKNMGVNTGAFPLLAKAAAGSCPDLASAIPAARTRFDF
FT                   AQQRLDISIPQAAMVASARGYIPPKYWDEGINALLLNYTFTGANSQDRSPGGSAENSYF
FT                   LGLNSGLNLGAWRLRDYSTWNANSGDQNSDSDWQHISTYLERDVVFLQGELTAGDSYTP
FT                   SALFDSLPFRGLQLASDDNMLPDSMKGFAPTIHGIARSNAQVTIRQNGYIINQRYVPPG
FT                   AFTINDLYPTAASGDLTVEVKESDGSINRYNVPYSAVPILQREGRLKYAATVAEYRSDS
FT                   SQKEKVKFSQATLIWGLPHGFTLYGGTQLSSHYHALAIGSGANLGDWGAVSLDVTQATS
FT                   TLADNNTYQGQSLRFLYAKSLAQSGTNLQLMGYRYSTSGFYTLDDTTWKRMSGYDDDSR
FT                   TDSDKSRPEWADYYNLYYTRRGKVQLDINQQLGGLGSLFITGSQQSYWHTDEKDSLLQV
FT                   GYSDTLAGIAWSVSYNNNKSAGDAERDQIFALNISVPLSQWLQHDDEVTRHHNVYATFS
FT                   TSTDKEHNVTQNAGLSGTLLDENNLSYNIQQGYQNHGIGESGAASLEYDGAKGNANIGY
FT                   NVSDNGDYQQVNYGLSGGLVAHAHGVTLSQPLGNTNILIAAPGAANVGVVDQPGIHTDA
FT                   RGYAVVPYATTYRQNRMALDVNAMADDVDIDDAVTRVVPTEGALVLARFKARVGARALV
FT                   TLNHNGKPVPFGATVTVNDRHAEAIVDEAGEVYLSGLSAQGVLHVRWGNLPDQQCVASY
FT                   HLSSSRQILSRQHAECH"
FT   gene            28427..29434
FT                   /locus_tag="SeAg_B0027"
FT   CDS_pept        28427..29434
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0027"
FT                   /product="mannose binding protein FimH"
FT                   /note="identified by match to protein family HMM PF00419"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0027"
FT                   /db_xref="EnsemblGenomes-Tr:ACH51967"
FT                   /db_xref="GOA:B5F702"
FT                   /db_xref="InterPro:IPR000259"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="InterPro:IPR036937"
FT                   /db_xref="UniProtKB/TrEMBL:B5F702"
FT                   /protein_id="ACH51967.1"
FT                   /translation="MKIPLLFALLAGSVVSQYAFADVCKNVNGVPSSINYDLTTTLTAE
FT                   QNQVGKTVQLEKSQEVNVQAVCPAGAATYSQTYRSYVSPYPVVETSGNWKYLKLDPDYL
FT                   EGGMRIEDSSAGDIYPPMNNVLMGYDENVKAGQPFYVRDSNLEFQLKIVKPFVGTVNIS
FT                   PKTMFNVYVMTAAGDPLTDVVYSILYSGTVTVPQSCEINAGQTILVNFGALYSGNFNHA
FT                   GQKPEGVRAKKFSVPVKCSGLDSQVNLTMRLIATPDSHVPQAIASDNADVGVVVETDEG
FT                   NALIPNDAQSVAPFITDSAGRANITLQAYPVSTTGETPAEGAFTALASLRVDFD"
FT   gene            29465..29980
FT                   /locus_tag="SeAg_B0028"
FT   CDS_pept        29465..29980
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0028"
FT                   /product="fimbrial subunit"
FT                   /note="identified by match to protein family HMM PF00419"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0028"
FT                   /db_xref="EnsemblGenomes-Tr:ACH51503"
FT                   /db_xref="GOA:B5F703"
FT                   /db_xref="InterPro:IPR000259"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="InterPro:IPR036937"
FT                   /db_xref="UniProtKB/TrEMBL:B5F703"
FT                   /protein_id="ACH51503.1"
FT                   /translation="MGLMLCPQINASADDLAYNLEFTGTIVAQTCDIDISSLSQSIDLG
FT                   QFAVGDFPSTGTTTKFKPFNINLKNCSRGIAGAKIWFTGEPDPDNPALLAITDTGMGSG
FT                   NMLASGVGVEILNDDQDTISINNADSVVYPLKAGRNTLSFYIRYKSTRPTVTSGNATAV
FT                   MYFDMQYE"
FT   gene            29996..30514
FT                   /locus_tag="SeAg_B0029"
FT   CDS_pept        29996..30514
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0029"
FT                   /product="fimbrial subunit"
FT                   /note="identified by match to protein family HMM PF00419"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0029"
FT                   /db_xref="EnsemblGenomes-Tr:ACH51013"
FT                   /db_xref="GOA:B5F704"
FT                   /db_xref="InterPro:IPR000259"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="InterPro:IPR036937"
FT                   /db_xref="UniProtKB/TrEMBL:B5F704"
FT                   /protein_id="ACH51013.1"
FT                   /translation="MRNDILYGIGMLLAASGVQAHDGRVYVSGTITDNTCSLSPGSENI
FT                   NVAMGAVSQRQFYRAGDGSAWQPFAIDLQNCGSTASGVTVSFSGAADSRNTDLLALTAG
FT                   ESDASGIGIALYDQNKTLIPLGQESDVVTLSPGQASAHLQFYARYLADGGAVTPGDANA
FT                   SATFILAYE"
FT   gene            30576..31211
FT                   /locus_tag="SeAg_B0030"
FT   CDS_pept        30576..31211
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0030"
FT                   /product="fimbrial chaperone"
FT                   /note="identified by match to protein family HMM PF00345;
FT                   match to protein family HMM PF02753"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0030"
FT                   /db_xref="EnsemblGenomes-Tr:ACH52511"
FT                   /db_xref="GOA:B5F705"
FT                   /db_xref="InterPro:IPR001829"
FT                   /db_xref="InterPro:IPR008962"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR016147"
FT                   /db_xref="InterPro:IPR016148"
FT                   /db_xref="InterPro:IPR018046"
FT                   /db_xref="InterPro:IPR036316"
FT                   /db_xref="UniProtKB/TrEMBL:B5F705"
FT                   /protein_id="ACH52511.1"
FT                   /translation="MVIGGTRFIYHAGAPALSVPVSNHSEASWLIDTHILPGGRWPGTK
FT                   NEGNITPFVVTPPLFMLSARQENSMRVVYTGGPLPADRESLFTLSIAAIPSGKPEANRV
FT                   QMAFRSALKLLYRPEGLAGNPQQAYRHLIWSLTPDGATVRNPTPYYVTLFLLRANERAQ
FT                   DNAGVVAPFATRQTDWCRHTVRCTVRWQSINDYGRVMPAQTVDLTRIH"
FT   gene            31276..32121
FT                   /pseudo
FT                   /locus_tag="SeAg_B0031"
FT                   /note="BcfH; this gene contains a frame shift which may be
FT                   the result of sequencing error; identified by match to
FT                   protein family HMM PF01323"
FT   gene            32160..32447
FT                   /pseudo
FT                   /locus_tag="SeAg_B0032"
FT                   /note="conserved hypothetical protein; this gene contains a
FT                   frame shift which may be the result of sequencing error"
FT   gene            complement(32547..32996)
FT                   /locus_tag="SeAg_B0033"
FT   CDS_pept        complement(32547..32996)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0033"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0033"
FT                   /db_xref="EnsemblGenomes-Tr:ACH48517"
FT                   /db_xref="GOA:B5F706"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:B5F706"
FT                   /protein_id="ACH48517.1"
FT                   /translation="MRQYTINNEFIYNESLREIISLHDKKVLKVTLMRARCLSYLFENA
FT                   YKKLITREMISHAVWGERSQFVSDANLTQLLYLLRRDLQQIGLFELFVTLPRQGIKIDE
FT                   RFIIDAADIPPQAIQHHTHRCNKIISIGIPTLFLLIVLFFLAPFI"
FT   gene            33366..34370
FT                   /locus_tag="SeAg_B0034"
FT   CDS_pept        33366..34370
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0034"
FT                   /product="putative transcriptional regulator"
FT                   /note="identified by match to protein family HMM PF00126"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0034"
FT                   /db_xref="EnsemblGenomes-Tr:ACH50481"
FT                   /db_xref="GOA:B5F707"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B5F707"
FT                   /protein_id="ACH50481.1"
FT                   /translation="MRPIKNAKKIDYNLIKVFDTVITEGNATRAARKLDVTPAAISQAL
FT                   LRLQNLYGEELFIRTRKGLVPSSKGKSLHQVFRQAIESIESTLCDKTDAQDSNELIVLG
FT                   SDITENYYFPALLDTVLMNRYIIKHYAIKKTGEYSPASMLTHGYADVIMGILEIKNEMI
FT                   ESYLIDNLSDFVCVCGEKSPLVGLEKMSLYNFYAARHAVYHSDMFSSFTTDSIDLFKSS
FT                   TPYAGRREIGYYSDSLFGVIGVVEKSDMVAILPGKIATYFRDVRRYNIKILRMPDEIIF
FT                   RTLPVYAYLATNSTHYKNAKKLISTFQSTFLFSQEKQPDALVEGSTSLCDLSV"
FT   gene            complement(34378..34815)
FT                   /locus_tag="SeAg_B0035"
FT   CDS_pept        complement(34378..34815)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0035"
FT                   /product="putative transcription regulator"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0035"
FT                   /db_xref="EnsemblGenomes-Tr:ACH51700"
FT                   /db_xref="GOA:B5F708"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:B5F708"
FT                   /protein_id="ACH51700.1"
FT                   /translation="MTIYLINSTHTYNDKTNELKNIKTGKMIKIAAMRIKCLEYMLNHA
FT                   QQEIIYKKQLTNELWGERSQFISDANLTQILYLLRRDLKGFGLSQFFSTVPRTGIKVDA
FT                   NIIISNEKKNLPSSLKKEEYKYIALFFALLTMVITVIYLIQ"
FT   gene            34827..34973
FT                   /locus_tag="SeAg_B0036"
FT   CDS_pept        34827..34973
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0036"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0036"
FT                   /db_xref="EnsemblGenomes-Tr:ACH52963"
FT                   /db_xref="UniProtKB/TrEMBL:B5F709"
FT                   /protein_id="ACH52963.1"
FT                   /translation="MGLIGVAIIICILNLWINWRDCNSVFFPEKIVSCHKNDGFLEKLK
FT                   FYF"
FT   gene            35338..37056
FT                   /locus_tag="SeAg_B0037"
FT   CDS_pept        35338..37056
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0037"
FT                   /product="arylsulfotransferase"
FT                   /note="identified by match to protein family HMM PF05935"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0037"
FT                   /db_xref="EnsemblGenomes-Tr:ACH52378"
FT                   /db_xref="GOA:B5F710"
FT                   /db_xref="InterPro:IPR010262"
FT                   /db_xref="InterPro:IPR035391"
FT                   /db_xref="InterPro:IPR038477"
FT                   /db_xref="UniProtKB/TrEMBL:B5F710"
FT                   /protein_id="ACH52378.1"
FT                   /translation="MNKKSSSMVNMPAPREPINQKIDTNNALVLNHNAIYEQRLAEITQ
FT                   SNTCDKAIVTVNPYGTAPLSLYLGVWMDEAAALEINVVDSEATTEEVRYQYDVHPGANL
FT                   IPVCGMVSAVNNQITLRLASQIVGQYTVMTDALPPTDSANVSLGFPIISVSCPAQQASL
FT                   MEEGLYFSTYFDRYNLAFDHNGIVRWYVSQEIPSYNFVRMDNGHFLATSQGINHCLNMY
FT                   EFDIMGRVYTVYLLDNEFHHSILPIENNLAIAPSEYSNGRPDGYSTGKDGVSIINLSTG
FT                   LEVAYYDMLYVMDYSRSPRPSGSAPGQDVSMDDWLHINQSYINEPNNLLICSGRHQSAI
FT                   FGVNVDSGELRFIMANHEDWSDEFKQYLLTPVDDDGVPLYDLTSPGGIDAADKNFWTWG
FT                   QHNIVEIPNDEPGILEFMVFDNGNYRSREDAKSLLPLDNFSRVVQFKINLNTMTVTRPY
FT                   EYGKTEVGNRGYSSFVSAKHLLTNGHLVIHFGATTVDEFEHTITAQPGSSDLVDPDEGQ
FT                   QALGRLVLQEINKETKEVLFEAMVTSGYFKNEETNGTNYRYDISAFRVYKMPLFA"
FT   gene            complement(37102..38664)
FT                   /locus_tag="SeAg_B0038"
FT   CDS_pept        complement(37102..38664)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0038"
FT                   /product="5'-Nucleotidase domain protein"
FT                   /note="identified by match to protein family HMM PF00149;
FT                   match to protein family HMM PF02872"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0038"
FT                   /db_xref="EnsemblGenomes-Tr:ACH51671"
FT                   /db_xref="GOA:B5F711"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR006146"
FT                   /db_xref="InterPro:IPR006179"
FT                   /db_xref="InterPro:IPR008334"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="InterPro:IPR036907"
FT                   /db_xref="UniProtKB/TrEMBL:B5F711"
FT                   /protein_id="ACH51671.1"
FT                   /translation="MNKKFSISLLSLCIGLSSAISFSADARDITIYYTNDLHAHVTPEI
FT                   IPYVSKTRPVGGFAPISKIVKDAKAKEKDVFFFDAGDYFTGPFISTLTKGEAIIDILNT
FT                   MPYDAVSVGNHEFDHGHENLVKQLSKLQFPVLLDNVFYSGTDTPLIKEPYTIVEKDGFK
FT                   IGVIGMHGVSAFYEAIAAGVREGVDCRDPIPYVKKQLEELKGKVDLTVLLAHEGVPGMQ
FT                   SSAGEADVARALKTDVDMAKSLEGYGLNVLITGHAHKGTPEPIKVGDTLVVSTDAYTIE
FT                   LGKLVLDWNPETKKVDSYNGKLITMYADTYKPDPVTQAKIDEWDNKVKKITDEVVAHSP
FT                   EVLTRSYGESAPTGNLITDALMATVPGADASFYNAGGIRTELPKGNITYGDVLSMYPFT
FT                   NDVMSMEISGKDLKSIMSHAADLKNGMLHVSKTVQFKYDSTKPLGQRIVEFDIKGKPVE
FT                   DNKLYTVALDSFIGKGGGGFTFTKGKNIKYIGIQTAPALVNYMKQVNNIQPDHTMRVDD
FT                   ISK"
FT   gene            complement(38772..39533)
FT                   /locus_tag="SeAg_B0039"
FT   CDS_pept        complement(38772..39533)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0039"
FT                   /product="putative outer membrane/exported protein"
FT                   /note="identified by match to protein family HMM PF07135"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0039"
FT                   /db_xref="EnsemblGenomes-Tr:ACH49773"
FT                   /db_xref="GOA:B5F712"
FT                   /db_xref="InterPro:IPR018013"
FT                   /db_xref="InterPro:IPR036777"
FT                   /db_xref="UniProtKB/TrEMBL:B5F712"
FT                   /protein_id="ACH49773.1"
FT                   /translation="MKNKKYINSLLAACVLFSCFNGQAAELKRVYGKLSFGYGDWNKGF
FT                   VNVDRGEVWKAVADFGAVFDRGEFASFYEMNVLNHPVEGRNHVTQFLGHYRVVEGSNFT
FT                   AMMKLYMSMENKFGDELNMMYGVGYLGLTSPSGFIKPYFAVHNLSNDYTSKKYGQATGF
FT                   NGYVLGWVAAYNFDMFNEKFVISNWNEVEMDRNDAYAEQQGGTTGLNGAVTFTWKFMPR
FT                   WTASVSYRYFNNKLGYDGYGDRMNYLIGFEF"
FT   gene            40128..41621
FT                   /locus_tag="SeAg_B0040"
FT   CDS_pept        40128..41621
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0040"
FT                   /product="sulfatase"
FT                   /note="identified by match to protein family HMM PF00884"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0040"
FT                   /db_xref="EnsemblGenomes-Tr:ACH50248"
FT                   /db_xref="GOA:B5F713"
FT                   /db_xref="InterPro:IPR000917"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR024607"
FT                   /db_xref="UniProtKB/TrEMBL:B5F713"
FT                   /protein_id="ACH50248.1"
FT                   /translation="MKRTVVASMIGLALCAGSVLSTAQAATAKRPNLVIILADDLGYGD
FT                   LATYGHRIVKTPNIDKLAQEGVKFTDYYAPAPLCSPSRAGLLTGRMPFRTGIRSWIPEG
FT                   KDVALGRNELTIANLLKQQGYDTAMMGKLHLNAGGDRTDQPQAKDMGFDYTLVNPAGFV
FT                   TDATLDNAKERPRYGVVHPTGWIRNGQHIGRADKMSGEFVSSEVVNWLDNKKDDNPFFL
FT                   YVAFTEVHSPLASPKKYLDMYSQYMTDYQKQHPDLFYGDWADKPWRGTGEYYANISYMD
FT                   EQVGKVLDKIKAMGEEDNTIVIFTSDNGPVTREARKVYELNLAGETDGLRGRKDNLWEG
FT                   GIRVPAIIKYGKHIPQGMVTDTPVYGLDWLPTLANMMDFKLPTDRTYDGQSLVPLLKDK
FT                   TLKRQKPLIFGIDMPFQDDPTDEWAIRDGDWKMIIDRQNKPKYLYNLKTDRFETLNQIG
FT                   KQPQIEKQLYGKFLKYKKDIDNDSLMKARGDKPTPVTWG"
FT   gene            41723..42910
FT                   /locus_tag="SeAg_B0041"
FT   CDS_pept        41723..42910
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0041"
FT                   /product="chondroitin sulfate/heparin utilization
FT                   regulation protein"
FT                   /note="identified by match to protein family HMM PF04055"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0041"
FT                   /db_xref="EnsemblGenomes-Tr:ACH48702"
FT                   /db_xref="GOA:B5F714"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR023885"
FT                   /db_xref="InterPro:IPR034491"
FT                   /db_xref="UniProtKB/TrEMBL:B5F714"
FT                   /protein_id="ACH48702.1"
FT                   /translation="MFGKSCQVMVKPTGSVCNLDCKYCFYLEKEKLYPDRKNHYKMSEE
FT                   TLELFIRQQIAAQDIDEVIFAWQGGEPTLMGIPFYRKAVEFQQRYCGGKTIVNTFQTNG
FT                   ILINDDWATFFREHDFLVGVSIDGDAALHDEWRVTRSGKPTHEKVENAVRCLAQHNVEF
FT                   NTLTVVNRTNMHHPVQVYRYLKSIGSRYMQFIPLVERCGENGLAQPQDKHIAMTPWSVD
FT                   SLQFGQFLNAVFDVWIREDIGDIGIQLFEQTLAAWCGLPPQVCVFAPTCGSAFAMEMNG
FT                   DVYNCDHFVYPQFKLGNIHQKTLRQMNQGEQNRQFGSDKQHSMAQECHRCQWKFACYGG
FT                   CPKHRFLPSASGATNHNYLCAGYQAFFSHTATAMSAMRTLYEKGISPAEIKSIFV"
FT   gene            42935..44182
FT                   /locus_tag="SeAg_B0042"
FT   CDS_pept        42935..44182
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0042"
FT                   /product="putative cytoplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0042"
FT                   /db_xref="EnsemblGenomes-Tr:ACH48598"
FT                   /db_xref="UniProtKB/TrEMBL:B5F715"
FT                   /protein_id="ACH48598.1"
FT                   /translation="MFSHINVDACKTPGCKNLGILGSPDYLPQGKNVLCRACGFLFPII
FT                   SARSLNLFRQAANQPWKGLVKSCPHCGGTSLKKYGFSTKGERRMYCRQCNKTFISYTAI
FT                   RSDARQENLATLIGEGASLVEIRAALAIDSTGFSRELQKLSRRANQAERDFVFPAFDIA
FT                   MSTRAFRVKFNGGDSSLYVLVTAEEESGKVVAISTNYSAQPVEADYQYHSDYEERLPSG
FT                   TLAHLVQRKEALTMRRNVLFDVDYGPAILYKNDPGMLVKPVLPAYRHFELVQALTDERS
FT                   LNVQHYLDHECFILGGCMMANFSYLRQGRCHISFVRERGVTPPKRDLPPRLFLSGGIRN
FT                   NVWRTFSTRDYAMAVCNLTGNKKVSLLRHATLNSATAFIRYVHNHPFLPHLNRMSPGNV
FT                   VAVLDYLKFEYNASRN"
FT   gene            44309..46024
FT                   /locus_tag="SeAg_B0043"
FT   CDS_pept        44309..46024
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0043"
FT                   /product="arylsulfotransferase"
FT                   /note="identified by match to protein family HMM PF05935"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0043"
FT                   /db_xref="EnsemblGenomes-Tr:ACH49263"
FT                   /db_xref="GOA:B5F716"
FT                   /db_xref="InterPro:IPR010262"
FT                   /db_xref="InterPro:IPR035391"
FT                   /db_xref="InterPro:IPR038477"
FT                   /db_xref="UniProtKB/TrEMBL:B5F716"
FT                   /protein_id="ACH49263.1"
FT                   /translation="MNTLTATSVVLPAPRPAINQGIDINNEMVLNHTAIYENCLAQVTQ
FT                   ENTVENALMLLDPYGTAPLSAYAGVWSLESAEIIVTVQDAAKTAMPVEHLYTLTPGANL
FT                   LPVLGLVADTENRIVFSQADTPLAVYTLTTQPLPPADSAEVVLGFPIINVTQPATDADK
FT                   MAPGFYFITHFDRYNYALDQNGLVRWYVTQDYPSYNFVRIDNGHFLTTSEAKNTYLDMY
FT                   EFDMMGRLHTFYNLDNQFHHSIWPWDSNTIVAPSEYTSGRPDDLKTNEDGVSVVDLTTG
FT                   LETAYYDMAKVLDTTRVSRPSGTAPGEDPTVKDWLHINQSYVNETNQLLIASGRHQSAV
FT                   FGVDLQTQALRFILSTHEDWDDAYQPYLLTPVDSEGVALYDFSKQEDIDAADRDFWTWG
FT                   QHNVVEIANNTPGIVEFMVFDNGNYRSRDDSKSLLPPDNYSRIVHFVVNMNEMTVMRPF
FT                   EYGKELGARGYSSCVSAKAIQQNGNIVVHFADCTFDENGRAISCQPGESDIIDPQAGSE
FT                   AMGLLILQEIAPTEKTVLFEATMTSGYYKNAETNGEGYRYDITSFRVYKMDLYA"
FT   gene            46187..47353
FT                   /gene="nhaA"
FT                   /locus_tag="SeAg_B0044"
FT   CDS_pept        46187..47353
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nhaA"
FT                   /locus_tag="SeAg_B0044"
FT                   /product="Na+/H+ antiporter NhaA"
FT                   /note="identified by match to protein family HMM PF06965;
FT                   match to protein family HMM TIGR00773"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0044"
FT                   /db_xref="EnsemblGenomes-Tr:ACH53002"
FT                   /db_xref="GOA:B5F717"
FT                   /db_xref="InterPro:IPR004670"
FT                   /db_xref="InterPro:IPR023171"
FT                   /db_xref="UniProtKB/TrEMBL:B5F717"
FT                   /protein_id="ACH53002.1"
FT                   /translation="MKHLHRFFSSDASGGIILIIAAALAMLMANMGATSGWYHDFLETP
FT                   VQLRVGALEINKNMLLWINDALMAVFFLLIGLEVKRELMQGSLASLRQAAFPVIAAIGG
FT                   MIVPALLYLAFNYSDPVTREGWAIPAATDIAFALGVLALLGSRVPLALKIFLMALAIID
FT                   DLGAIVIIALFYTSDLSIVSLGVAAFAIAVLALLNLCGVRRTGVYILVGAVLWTAVLKS
FT                   GVHATLAGVIVGFFIPLKEKHGRSPAKRLEHVLHPWVAYLILPLFAFANAGVSLQGVTI
FT                   DGLTSMLPLGIIAGLLIGKPLGISLFCWLALRFKLAHLPQGTTYQQIMAVGILCGIGFT
FT                   MSIFIASLAFGNVDPELINWAKLGILIGSLLSAVVGYSWLRARLNAPA"
FT   gene            47415..48314
FT                   /locus_tag="SeAg_B0045"
FT   CDS_pept        47415..48314
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0045"
FT                   /product="transcriptional activator protein NhaR"
FT                   /note="identified by match to protein family HMM PF00126"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0045"
FT                   /db_xref="EnsemblGenomes-Tr:ACH51262"
FT                   /db_xref="GOA:B5F718"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B5F718"
FT                   /protein_id="ACH51262.1"
FT                   /translation="MSMSHINYNHLYYFWHVYKEGSVVGAAEALFLTPQTITGQIKALE
FT                   ERLQGKLFKRKGRGLEPSELGELVFRYADKMFTLSQEMLDIVNYRKESNLLFDVGVADA
FT                   LSKRLVSSVLDAAVVVDEPIHLRCFESTHEMLLEQLSQHKLDMIISDCPIDSTQQEGLF
FT                   SVKIGECSVSFWCTNPLPEKAFPACLEERRLLVPGRRSMLGRKLLNWFNSQGLQVEILG
FT                   EFDDAALMKAFGATHDAIFVAPSLYSLDFYADESVIEIGRVENVMEEYHAIFAERMIQH
FT                   PAVQRICNADYSALFKLQ"
FT   gene            complement(48369..50408)
FT                   /locus_tag="SeAg_B0046"
FT   CDS_pept        complement(48369..50408)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0046"
FT                   /product="glycoside hydrolase, family 31"
FT                   /note="identified by match to protein family HMM PF01055"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0046"
FT                   /db_xref="EnsemblGenomes-Tr:ACH49910"
FT                   /db_xref="GOA:B5F719"
FT                   /db_xref="InterPro:IPR000322"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:B5F719"
FT                   /protein_id="ACH49910.1"
FT                   /translation="MPFMQQDPRRLVWQQNDRYLWIEPWGENSLRVRSGRHLPVMRNED
FT                   WALTEPVAESQCHIDYEHHQATLTNGKIIAIVNQKGQVTFYRHPHKPLLQEFWRLRGEI
FT                   GEDESSHGQYVSALNLEGREFRPIQGGKYSLKARFEATEGEKIYGMGQYQQANLDLKGC
FT                   VLELAQRNSQASVPFMLSSLGYGFLWNNPAVGRVTFAQNVTEWEAQVSEQLDYWITAGD
FT                   TPAEISRAYALATGTPPMMPDYAMGFWQCKLRYRTQEELLEVAREYKRRNLPISVIVID
FT                   FFHWPNQGDWMFDARDWPDPDAMIAELKSLGIELMVSVWPTVDNRTESYREMRENGWLV
FT                   QTERGLPINMDFLGNTTYFDATHPGARDYVWGKAKRNYYDKGVKLFWLDEAEPEFSVYD
FT                   YDNYRYHAGPVLEVGNIYPRMYAKTFFDGMKADGEDQVINLLRCAWAGSQKFGALVWSG
FT                   DIHSSFRSLRNQFAAGLNMGIAGIPWWTTDIGGFHGGNIHDPKFHELLIRWFQWGVFSP
FT                   VMRLHGNRDPQILPAQPYRDGIAQCPTGAPNEVWSYGEEVCEVLTGCLALREKLKPYIK
FT                   ALMEETHKHNTPVMRPLFFEFPEQETSWAITDQYCFGPDLLIAPVMHEGMRERDIWLPE
FT                   GETWTDLATGESYSGGQTLQYATPLNRIPVFIREGGQYRSLLNL"
FT   gene            complement(50448..51863)
FT                   /locus_tag="SeAg_B0047"
FT   CDS_pept        complement(50448..51863)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0047"
FT                   /product="xylose-proton symporter"
FT                   /note="identified by match to protein family HMM TIGR00792"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0047"
FT                   /db_xref="EnsemblGenomes-Tr:ACH50356"
FT                   /db_xref="GOA:B5F720"
FT                   /db_xref="InterPro:IPR001927"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="InterPro:IPR039672"
FT                   /db_xref="UniProtKB/TrEMBL:B5F720"
FT                   /protein_id="ACH50356.1"
FT                   /translation="MFFWAYRTNIGVIIMSSVIEDTQPSGSASLSLLQRISYGSLDVAG
FT                   NLLYCFGSTYILYFYTDVAGISLAVAGVILLLARIIDGIDAPIWGIIIDKTRSRYGKCR
FT                   PWFLWLPLPFAVFSALSFWSPDISMTGKAIYAAISYMIASILFTGLNTPLSAILPLMTL
FT                   SPKERLVLNSWRMTGGQIGVLLMNATALPLVAFLGNGDDHAGFIYTAITFAIISCALTL
FT                   FAFKNIREMDTDKIQHEPKLPMKKSFAAMKGNWPWILMVLANLIFWIALQQRNTTIVYY
FT                   LTYNLDRKDLVPLINSLATIQILFIIAIPFFSKYLAKTWIWVGGLLVATFGGVMMWLAA
FT                   DNITFLIAAWILGNIGSGIACSMPFAMLGFAVDFGAWKTGIKATGILIAFGSTFCIKMG
FT                   SGLGTAFAAWIMNSFGYVPNHAQSAAGLEGIIWAFIWAPALLFALAAIPLLFFRKYEAM
FT                   EEKIRHDLETVNS"
FT   gene            complement(52277..52540)
FT                   /gene="rpsT"
FT                   /locus_tag="SeAg_B0048"
FT   CDS_pept        complement(52277..52540)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsT"
FT                   /locus_tag="SeAg_B0048"
FT                   /product="ribosomal protein S20"
FT                   /note="identified by match to protein family HMM PF01649;
FT                   match to protein family HMM TIGR00029"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0048"
FT                   /db_xref="EnsemblGenomes-Tr:ACH48924"
FT                   /db_xref="GOA:B5F721"
FT                   /db_xref="InterPro:IPR002583"
FT                   /db_xref="InterPro:IPR036510"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5F721"
FT                   /protein_id="ACH48924.1"
FT                   /translation="MANIKSAKKRAVQSEKARKHNASRRSMMRTFIKKVYAAIEAGDKA
FT                   AALKAFNEMQPIVDRQAAKGLIHKNKAARHKANLTAQINKLA"
FT   gene            52715..52861
FT                   /locus_tag="SeAg_B0049"
FT   CDS_pept        52715..52861
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0049"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0049"
FT                   /db_xref="EnsemblGenomes-Tr:ACH50472"
FT                   /db_xref="InterPro:IPR020105"
FT                   /db_xref="UniProtKB/TrEMBL:B5F722"
FT                   /protein_id="ACH50472.1"
FT                   /translation="MRKIALSGGFWGGVCRMAMKSIFFMFHQGNSRLTLTAVQGILLRF
FT                   SLF"
FT   gene            52869..53807
FT                   /gene="ribF"
FT                   /locus_tag="SeAg_B0050"
FT   CDS_pept        52869..53807
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ribF"
FT                   /locus_tag="SeAg_B0050"
FT                   /product="riboflavin biosynthesis protein RibF"
FT                   /EC_number="2.7.1.26"
FT                   /EC_number="2.7.7.2"
FT                   /note="identified by match to protein family HMM PF01687;
FT                   match to protein family HMM PF06574; match to protein
FT                   family HMM TIGR00083"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0050"
FT                   /db_xref="EnsemblGenomes-Tr:ACH49953"
FT                   /db_xref="GOA:B5F723"
FT                   /db_xref="InterPro:IPR002606"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015864"
FT                   /db_xref="InterPro:IPR015865"
FT                   /db_xref="InterPro:IPR023465"
FT                   /db_xref="InterPro:IPR023468"
FT                   /db_xref="UniProtKB/TrEMBL:B5F723"
FT                   /protein_id="ACH49953.1"
FT                   /translation="MKLIRGIHNLSQAPHGCVLTIGNFDGVHRGHRALLQGLQEEGRRR
FT                   GLPVVVMIFEPQPLELFATDKAPARLTRLREKLHYLAQCGVDYVLCVKFDRRFAALTAQ
FT                   TFISELLVERLGVQFLAVGDDFRFGASRAGDFLLLQKAGAEYGFAVSSTQTFCEGGVRI
FT                   SSTAVRQALAEDNLALAESLLGHPFTISGRVVHGDELGRTIGFPTANLPLRRQVSPVKG
FT                   VYAVEVTGLGDKPLPGVANIGTRPTVAGVRQQLEVHLLDVVMDLYGRHIDVILRKKIRN
FT                   EQRFASLDELKAQIARDELTARKFFGLAGQV"
FT   gene            53816..56686
FT                   /gene="ileS"
FT                   /locus_tag="SeAg_B0051"
FT   CDS_pept        53816..56686
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ileS"
FT                   /locus_tag="SeAg_B0051"
FT                   /product="isoleucyl-tRNA synthetase"
FT                   /EC_number="6.1.1.5"
FT                   /note="identified by match to protein family HMM PF00133;
FT                   match to protein family HMM PF06827; match to protein
FT                   family HMM PF08264; match to protein family HMM PF09334;
FT                   match to protein family HMM TIGR00392"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0051"
FT                   /db_xref="EnsemblGenomes-Tr:ACH49575"
FT                   /db_xref="GOA:B5F724"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002301"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR010663"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR023585"
FT                   /db_xref="InterPro:IPR033708"
FT                   /db_xref="UniProtKB/TrEMBL:B5F724"
FT                   /protein_id="ACH49575.1"
FT                   /translation="MFIKPKYGTENLMSDYKSTLNLPETGFPMRGDLAKREPGMLARWT
FT                   DDDLYGIIRAAKKGKKTFILHDGPPYANGSIHIGHSVNKILKDIIVKSKGLSGFDSPYV
FT                   PGWDCHGLPIELKVEQEFGKPGEKFTAAEFRAKCREYAATQVDGQRKDFIRLGVLGDWS
FT                   HPYLTMDFKTEANIIRALGRIIKNGHLHKGAKPVHWCVDCRSALAEAEVEYYDKTSPSI
FT                   DVAFRAVDQDAVKAKFGLPGVSGPVSLVIWTTTPWTLPANRAISLAPDFDYALVQIDGQ
FT                   AVILAKDLVESVMQRIGAAEYTILGTVKGAELELLRFTHPFMGFDVPAILGDHVTLDAG
FT                   TGAVHTAPGHGPDDYVIGQKYGLETANPVGPDGAYLPGTYPTLDGVNVFKANDIVIELL
FT                   KEKGALLHVEKMQHSYPCCWRHKTPIIFRATPQWFVSMDKEGLRQQSLKEIKGVQWIPD
FT                   WGQARIESMVANRPDWCISRQRTWGVPMSLFVHKETQELLPIERTLAAMEEVAKRVEVD
FT                   GIQAWWDLDPKEILGEDADQYEKVPDTLDVWFDSGSTSYSVVDARPEFAGHAADMYLEG
FT                   SDQHRGWFMSSLMISVAMKGKAPYRQVLTHGFTVDGQGRKMSKSIGNTVSPQDVMNKLG
FT                   ADILRLWVASTDYTGEMAVSDEILKRAADSYRRIRNTARFLLANLNGFNPATDMVKPEE
FT                   MVVLDRWAVGCAKTAQQEILKAYEAYDFHEVVQRLMRFCSVEMGSFYLDIIKDRQYTAK
FT                   ADSVARRSCQTALYHIAEALVRWMAPIMSFTADEIWGYLPGEREKYVFTGEWYDGLFGL
FT                   EENEEFNDAFWDDVRYIKDQVNKELENQKANGIKSNLEAKVTLKYADDANGTIKKLKLL
FT                   GEEVRFIFITSQFVISEQAGGIDDENIQYNAGNTTVQAVVTRAEGDKCPRCWHYTTDVG
FT                   KVAEHADICGRCVSNIAGNGEQRKFA"
FT   gene            56686..57186
FT                   /gene="lspA"
FT                   /locus_tag="SeAg_B0052"
FT   CDS_pept        56686..57186
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lspA"
FT                   /locus_tag="SeAg_B0052"
FT                   /product="signal peptidase II"
FT                   /EC_number="3.4.23.36"
FT                   /note="identified by match to protein family HMM PF01252;
FT                   match to protein family HMM TIGR00077"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0052"
FT                   /db_xref="EnsemblGenomes-Tr:ACH49067"
FT                   /db_xref="GOA:B5F725"
FT                   /db_xref="InterPro:IPR001872"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5F725"
FT                   /protein_id="ACH49067.1"
FT                   /translation="MSKPLCSTGLRWLWLVVVVLIIDLGSKYLILQNFALGDTVGLFPS
FT                   LNLHYARNYGAAFSFLADSGGWQRWFFAGIAIGICVILLVMMYRSKATQKLNNIAYALI
FT                   IGGALGNLFDRLWHGFVVDMIDFYVGDWHFATFNLADSAICIGAALIVLEGFLPKPTAK
FT                   EQA"
FT   gene            57200..57331
FT                   /locus_tag="SeAg_B0053"
FT   CDS_pept        57200..57331
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0053"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0053"
FT                   /db_xref="EnsemblGenomes-Tr:ACH50630"
FT                   /db_xref="UniProtKB/TrEMBL:B5F726"
FT                   /protein_id="ACH50630.1"
FT                   /translation="MALIRFCRPDKRSAIRQTWCRMAVKTPYPAYGFIVLYASGQNT"
FT   gene            57341..57790
FT                   /gene="fkpB"
FT                   /locus_tag="SeAg_B0054"
FT   CDS_pept        57341..57790
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fkpB"
FT                   /locus_tag="SeAg_B0054"
FT                   /product="FKBP-type 16 kDa peptidyl-prolyl cis-trans
FT                   isomerase"
FT                   /EC_number="5.2.1.8"
FT                   /note="identified by match to protein family HMM PF00254"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0054"
FT                   /db_xref="EnsemblGenomes-Tr:ACH50134"
FT                   /db_xref="GOA:B5F727"
FT                   /db_xref="InterPro:IPR001179"
FT                   /db_xref="UniProtKB/TrEMBL:B5F727"
FT                   /protein_id="ACH50134.1"
FT                   /translation="MSKSVQSNSAILVHFTLKLDDGSTAESTRNNGKPALFRLGDTSLS
FT                   EGLEQQLLGLKEGEKKAFSLEPDAAFGVPSPDLIQYFSRREFMAAGEPEVGAIMLFTAM
FT                   DGSEMPGVIREINGDSITVDFNHPLAGHTVHFDIEVLEIDPALEA"
FT   gene            57793..58743
FT                   /gene="ispH"
FT                   /locus_tag="SeAg_B0055"
FT   CDS_pept        57793..58743
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ispH"
FT                   /locus_tag="SeAg_B0055"
FT                   /product="4-hydroxy-3-methylbut-2-enyl diphosphate
FT                   reductase"
FT                   /EC_number="1.17.1.2"
FT                   /note="identified by match to protein family HMM PF02401;
FT                   match to protein family HMM TIGR00216"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0055"
FT                   /db_xref="EnsemblGenomes-Tr:ACH52122"
FT                   /db_xref="GOA:B5F728"
FT                   /db_xref="InterPro:IPR003451"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5F728"
FT                   /protein_id="ACH52122.1"
FT                   /translation="MQILLANPRGFCAGVDRAISIVENALAIYGAPIYVRHEVVHNRYV
FT                   VDSLRQRGAIFIEQISEVPDGAILIFSAHGVSQAVRNEAKSRDLTVFDATCPLVTKVHM
FT                   EVARASRRGEESILIGHAGHPEVEGTMGQYSNPEGGMYLVESPEDVWTLNVKNEGKLSF
FT                   MTQTTLSVDDTSDVIDALRKRFPKIVGPRKDDICYATTNRQEAVRALAEQADVVLVVGS
FT                   KNSSNSNRLAELAQRMGRTAFLIDDAADIQEAWVKEAACVGVTAGASAPDILVQNVIAR
FT                   LREFGGGEAVTLEGREENIVFEVPKELRVDVREVE"
FT   gene            complement(58855..58983)
FT                   /locus_tag="SeAg_B0056"
FT   CDS_pept        complement(58855..58983)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0056"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0056"
FT                   /db_xref="EnsemblGenomes-Tr:ACH51713"
FT                   /db_xref="UniProtKB/TrEMBL:B5F729"
FT                   /protein_id="ACH51713.1"
FT                   /translation="MASNVGNPYFILPISLIPVGITTKKPATIVLVFQMNSKKVGH"
FT   gene            58994..60145
FT                   /locus_tag="SeAg_B0057"
FT   CDS_pept        58994..60145
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0057"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0057"
FT                   /db_xref="EnsemblGenomes-Tr:ACH48455"
FT                   /db_xref="UniProtKB/TrEMBL:B5F730"
FT                   /protein_id="ACH48455.1"
FT                   /translation="MDAASATVLELPAWERNYTGTIAGKPVNVNITRFGNTLYGYYCYE
FT                   PCNQHKAAIVLRGSLQDKRVHLEERVKALSGYWNAEISSSEIKGEWTSADKKRHFPVAL
FT                   IYLKPKNSPDIVLVTNTNDAGGYDPSKEIDCGNTPAISAIKLYRDGKLIQTLDTASVGT
FT                   CSPFMPQWGDVNFDGYPDLSIVTELLAGPDAPVQTWLYDPAKQRYVDAPASYQEITSPE
FT                   IDAEHKQIVSYWRGGCCSHGVNVYRWKGKTIELIDRGESYFQPVISKGKMYNCYMTPSY
FT                   ADGRIIYPLVRKNGHLTPPLSLDGTCQPFWLIGNVRTVIQAEKPGAEPESLEIQWQENK
FT                   ASPGRFCPLVPFIEGDKLSPRLVTDDDVPDTCISRAEYEDIKQ"
FT   gene            60161..61081
FT                   /locus_tag="SeAg_B0058"
FT   CDS_pept        60161..61081
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0058"
FT                   /product="Non-specific ribonucleoside hydrolase RihC"
FT                   /EC_number="3.2.-.-"
FT                   /note="identified by match to protein family HMM PF01156"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0058"
FT                   /db_xref="EnsemblGenomes-Tr:ACH51736"
FT                   /db_xref="GOA:B5F731"
FT                   /db_xref="InterPro:IPR001910"
FT                   /db_xref="InterPro:IPR022976"
FT                   /db_xref="InterPro:IPR023186"
FT                   /db_xref="InterPro:IPR036452"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5F731"
FT                   /protein_id="ACH51736.1"
FT                   /translation="MTASLHIILDTDPGIDDAAAIAAALFAPELDLQLITTVAGNVSVE
FT                   KTTRNALQLLHFWDADVPLAQGAATPLLRPLRDAAYVHGESGMEGYDFVDHQRQPLAKP
FT                   AFIAIRDVLMNAPEPMTLVAIGPLTNIALLLMHYPECACNIRRLVLMGGSAGRGNFTPN
FT                   AEFNIAVDPEAAAHVFRSGIEIVMCGLDVTNQAMLSPDFLSKLPALNRTGKMLHSLFNH
FT                   YRSGSMRTGVRMHDLCAIAWLVRPELFTLQSCFVAVETQGQYTAGTTVVDIEGRLGQPA
FT                   NAQVALALDVDGFRQWVAEVFACAP"
FT   gene            complement(61103..61789)
FT                   /locus_tag="SeAg_B0059"
FT   CDS_pept        complement(61103..61789)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0059"
FT                   /product="transcriptional regulatory protein CitB"
FT                   /note="identified by match to protein family HMM PF00072"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0059"
FT                   /db_xref="EnsemblGenomes-Tr:ACH49721"
FT                   /db_xref="GOA:B5F732"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR024187"
FT                   /db_xref="InterPro:IPR028141"
FT                   /db_xref="UniProtKB/TrEMBL:B5F732"
FT                   /protein_id="ACH49721.1"
FT                   /translation="MDSITTLIVEDEPMLAEILVDTIKLFPQFSIVGIADKLESAKKQI
FT                   RLYQPQLILLDNFLPDGKGIDLIRHTISTNYTGRIIFITADNHMDTISDALRMGVFDYL
FT                   IKPVHYQRLQHTLERFTRYRSSLRSSEQANQTHVDALFNIQAKEQTAEPNSGLRGIDEN
FT                   TFNRVRQIFADPQAVHTADTLAQILGSSKTTARRYLEQGVKNNFLEAEISYGKVGRPER
FT                   LYRGKV"
FT   gene            complement(61791..63449)
FT                   /locus_tag="SeAg_B0060"
FT   CDS_pept        complement(61791..63449)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0060"
FT                   /product="sensor kinase DpiB"
FT                   /EC_number="2.7.13.3"
FT                   /note="identified by match to protein family HMM PF02518"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0060"
FT                   /db_xref="EnsemblGenomes-Tr:ACH50231"
FT                   /db_xref="GOA:B5F733"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR016120"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR033463"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B5F733"
FT                   /protein_id="ACH50231.1"
FT                   /translation="MQENTVIKYLTTNMFIREITHWFARRSFQNRIFLLILFTSTIVML
FT                   AITWYLTDITKERLHYQVGQRALIQAMQISAMPELVEAVEAHDLSRIKALIDPMRSFSD
FT                   ATYITVGNEKGQRLYHVNPDEIGKYMEGGDSDDALYNAKSYVSVRKGSLGSSLRGKSPI
FT                   QDSTGKVIGIVSVGYTLEQLESWLNLQISSLLFPMALLLLVLLYCARRFSLHIKKQMLN
FT                   MEPQQLSQLLIQQSVLFESVFEGLIAIDSHHRITAINQTARRLLNLSQPESELIGYAIH
FT                   HVVLPEAFFYDAPQKNKKDEIVTFNQMKVIASRMAVIIDNQPQGWVISFRNKDDINTLS
FT                   LQLSQVRQYADNLRAVQHEHRNLISTIAGLLFLKRYDNALALIQQQSESHQKVLDFISH
FT                   NFRDHHLAGLLIGKYYRAKELGLELIFDPSSFVEHLPSSLSHNEWISIVGNLLDNAYNA
FT                   TLLNSEGSRQIECLINSEGNEVIIEVADQGCGIDENIRQHIFERGVTTHNNGDHGIGLW
FT                   LVHSYVKQANGDIIVDNNNPFGTIFTLYIPFTREE"
FT   gene            complement(63545..64846)
FT                   /locus_tag="SeAg_B0061"
FT   CDS_pept        complement(63545..64846)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0061"
FT                   /product="oxaloacetate decarboxylase beta chain"
FT                   /EC_number="4.1.1.3"
FT                   /note="identified by match to protein family HMM PF03977;
FT                   match to protein family HMM TIGR01109"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0061"
FT                   /db_xref="EnsemblGenomes-Tr:ACH51460"
FT                   /db_xref="GOA:B5F734"
FT                   /db_xref="InterPro:IPR005661"
FT                   /db_xref="UniProtKB/TrEMBL:B5F734"
FT                   /protein_id="ACH51460.1"
FT                   /translation="MESLNALLQGMGLMHLGAGQAIMLLVSLLLLWLAIAKKFEPLLLL
FT                   PIGFGGLLSNIPEAGMALTALESLLAHHDAGQLAVIAAKLNCAPDVHAIKEALALALPS
FT                   VQSQMENLAVDMGYTPGVLALFYKVAIGSGVAPLVIFMGVGAMTDFGPLLANPRTLLLG
FT                   AAAQFGIFATVLGALTLNYFGLISFTLPQAAAIGIIGGADGPTAIYLSGKLAPELLGAI
FT                   AVAAYSYMALVPLIQPPIMKALTTETERKIRMVQLRTVSKREKILFPVVLLMLVALLLP
FT                   DAAPLLGMFCFGNLMRESGVVERLSDTVQNGLINIVTIFLGLSVGAKLVADKFLQPQTL
FT                   GILLLGVIAFGIGTAAGVLMAKLMNLCSKNKINPLIGSAGVSAVPMAARVSNKVGLESD
FT                   PQNFLLMHAMGPNVAGVIGSAIAAGVMLKYVLAM"
FT   gene            complement(64862..66628)
FT                   /gene="oadA"
FT                   /locus_tag="SeAg_B0062"
FT   CDS_pept        complement(64862..66628)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="oadA"
FT                   /locus_tag="SeAg_B0062"
FT                   /product="oxaloacetate decarboxylase alpha subunit"
FT                   /EC_number="4.1.1.3"
FT                   /note="identified by match to protein family HMM PF00364;
FT                   match to protein family HMM PF00682; match to protein
FT                   family HMM PF02436; match to protein family HMM TIGR01108"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0062"
FT                   /db_xref="EnsemblGenomes-Tr:ACH51106"
FT                   /db_xref="GOA:B5F735"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR001882"
FT                   /db_xref="InterPro:IPR003379"
FT                   /db_xref="InterPro:IPR005776"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:B5F735"
FT                   /protein_id="ACH51106.1"
FT                   /translation="MTIAITDVVLRDAHQSLFATRLRLDDMLPIAAQLDDVGYGSLECW
FT                   GGATFDACIRFLGEDPWLRLRELKKAMPKTPLQMLLRGQNLLGYRHYADDVVERFVERA
FT                   VKNGMDVFRVFDAMNDPRNMKAALQAVRSHGAHAQGTLSYTTSPAHTLQTWLDLTEQLL
FT                   ETGVDSIAIKDMSGILTPMAAYELVSEIKKRFEVRLHLHCHATTGMAEMALLKAIEAGV
FT                   DGVDTAISSMSATYGHPATEALVATLAGTEHDTGLDILKLENIAAYFREVRKKYHAFEG
FT                   QLKGYDSRILVAQVPGGMLTNLESQLKQQNAADKLDQVLAEIPRVREDLGFIPLVTPTS
FT                   QIVGTQAVLNVLTGERYKTIAKETAGILKGEYGHTPVPVNAALQARVLEGGAPVTCRPA
FT                   DLLKPELAELEADVRRQAQEKGITLAGNAIDDVLTVALFPQIGLKFLENRHNPAAFEPV
FT                   PQAETAQPVAKAEKPAASGIYTVEVEGKAFVVKVSDGGDISQLTAAVPASAPAAAAPAG
FT                   AGTPVTAPLAGNIWKVIATEGQTVAEGDVLLILEAMKMETEIRAAQAGTVRGIAVKSGD
FT                   AVSVGDTLMTLA"
FT   gene            complement(66644..66883)
FT                   /locus_tag="SeAg_B0063"
FT   CDS_pept        complement(66644..66883)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0063"
FT                   /product="conserved domain protein"
FT                   /EC_number="4.1.1.3"
FT                   /note="identified by match to protein family HMM PF04277;
FT                   match to protein family HMM TIGR01195"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0063"
FT                   /db_xref="EnsemblGenomes-Tr:ACH50220"
FT                   /db_xref="GOA:B5F736"
FT                   /db_xref="InterPro:IPR005899"
FT                   /db_xref="InterPro:IPR023424"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5F736"
FT                   /protein_id="ACH50220.1"
FT                   /translation="MNEAVLLGEGFTLMFLGMGFVLSFLFLLIFAIRGMSAVITRFFPE
FT                   PVAAPAPRAVPAVDDFTRLKPVIAAAIHHHRLNA"
FT   gene            complement(67042..68382)
FT                   /locus_tag="SeAg_B0064"
FT   CDS_pept        complement(67042..68382)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0064"
FT                   /product="citrate-sodium symporter"
FT                   /note="identified by match to protein family HMM PF03390;
FT                   match to protein family HMM TIGR00783"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0064"
FT                   /db_xref="EnsemblGenomes-Tr:ACH49861"
FT                   /db_xref="GOA:B5F737"
FT                   /db_xref="InterPro:IPR004679"
FT                   /db_xref="InterPro:IPR018025"
FT                   /db_xref="UniProtKB/TrEMBL:B5F737"
FT                   /protein_id="ACH49861.1"
FT                   /translation="MTNMTQASATEKKGASDLLRFKIFGMPLPLYAFALITLLLSHFYN
FT                   AIPTDLVGGFALMFVMGAIFGEIGKRLPIFNKYIGGAPVMIFLVAAYFVYAGIFTQKEI
FT                   DAISNVMDKSNFLNLFIAVLITGAILSVNRKLLLKSLLGYIPTILAGIVGASLFGIVIG
FT                   LCFGIPVDRIMMLYVLPIMGGGNGAGAVPLSEIYHSVTGRSREEYYSTAIAILTIANIF
FT                   AIIFAALLDMIGKKYTWLSGEGELVRKASFKTEDDEKAGQITHRETAVGMVLSTTCFLL
FT                   AYVVAKKILPSIGGVSIHYFAWMVLIVAALNASGLCSPEIKAGAKRLADFFSKQLLWVL
FT                   MVGVGVCYTDLQEIIDALTFANVVIAAIIVVGAVVGAAIGGWLIGFYPIESSITAGLCM
FT                   ANRGGSGDLEVLSACNRMNLISYAQISSRLGGGIVLVIASIVFSMMV"
FT   gene            68639..69670
FT                   /gene="citC"
FT                   /locus_tag="SeAg_B0065"
FT   CDS_pept        68639..69670
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="citC"
FT                   /locus_tag="SeAg_B0065"
FT                   /product="[citrate (pro-3S)-lyase] ligase"
FT                   /EC_number="6.2.1.22"
FT                   /note="identified by match to protein family HMM PF00583;
FT                   match to protein family HMM PF08218; match to protein
FT                   family HMM TIGR00124; match to protein family HMM
FT                   TIGR00125"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0065"
FT                   /db_xref="EnsemblGenomes-Tr:ACH48905"
FT                   /db_xref="GOA:B5F738"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR005216"
FT                   /db_xref="InterPro:IPR013166"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:B5F738"
FT                   /protein_id="ACH48905.1"
FT                   /translation="MNLIFKRIYLQKDVLRRESVAMFLDGVGLALEDDCEIAVCAYWQG
FT                   EIVGCGSLAGNVLKCIAVSPVLQGEGLSLKLLTELLTLAYELNRSELFLFTKPQNRLLF
FT                   SGAGFWPIAQAGELAVLMENSSERLARFCRQLALYRQPGKTIGAIVMNANPFTLGHRYL
FT                   VEQAAAACDWLHLFVVKEDASFFSYTDRWALIEQGIAGIDNVTLHSGSAYMISRATFPG
FT                   YFLKEKGVVDDCHCQIDLQLFREHLAPALGVTHRFVGSEPFCPLTCAYNQRMHDILHDP
FT                   KRSGPVIEVVELARVEKNGAAISASRVRKLYSERNWSAISALVPAGTLAYLQRHAARHT
FT                   ETI"
FT   gene            69700..69993
FT                   /gene="citD"
FT                   /locus_tag="SeAg_B0066"
FT   CDS_pept        69700..69993
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="citD"
FT                   /locus_tag="SeAg_B0066"
FT                   /product="citrate lyase acyl carrier protein"
FT                   /EC_number="4.1.3.6"
FT                   /note="identified by match to protein family HMM PF04953;
FT                   match to protein family HMM TIGR01608"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0066"
FT                   /db_xref="EnsemblGenomes-Tr:ACH48557"
FT                   /db_xref="GOA:B5F739"
FT                   /db_xref="InterPro:IPR006495"
FT                   /db_xref="InterPro:IPR023439"
FT                   /db_xref="UniProtKB/TrEMBL:B5F739"
FT                   /protein_id="ACH48557.1"
FT                   /translation="MKIIKDALAGTLESSDVMIRIGPSSEPGIRLELESLVKQQFGAAI
FT                   EQVVRETLAKLGVERALVSVDDKGALECILRARVQAAALRAAEQTEIQWSAL"
FT   gene            69990..70859
FT                   /gene="citE"
FT                   /locus_tag="SeAg_B0067"
FT   CDS_pept        69990..70859
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="citE"
FT                   /locus_tag="SeAg_B0067"
FT                   /product="citrate (pro-3S)-lyase, beta subunit"
FT                   /EC_number="4.1.3.6"
FT                   /note="identified by match to protein family HMM PF03328;
FT                   match to protein family HMM TIGR01588"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0067"
FT                   /db_xref="EnsemblGenomes-Tr:ACH52241"
FT                   /db_xref="GOA:B5F740"
FT                   /db_xref="InterPro:IPR005000"
FT                   /db_xref="InterPro:IPR006475"
FT                   /db_xref="InterPro:IPR011206"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:B5F740"
FT                   /protein_id="ACH52241.1"
FT                   /translation="MRPRRSMLFIPGANAAMLSTSFVYGADAVMFDLEDAVALREKDTA
FT                   RLLVHHALQHPFYQDVEKVVRINPLNTPFGLADLEAVVRGGADIVRLPKTDSKNDVLEL
FT                   EAQVERIERECGREVGSTRLMAAIESAKGVVNAVDIATSSPRMVAIALAAFDYVMDMGT
FT                   SRGDGTELFYARCAVLHAARVAGIAAYDVVWSDINNEEGFLKEVQLAKGLGFNGKSLVN
FT                   PRQIELLHQAYSPTRKEVEHAYEVIAAAEEAESRGLGVVSLNGKMIDGPIIDHARKVVA
FT                   LSASGIRD"
FT   gene            70870..72390
FT                   /gene="citF"
FT                   /locus_tag="SeAg_B0068"
FT   CDS_pept        70870..72390
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="citF"
FT                   /locus_tag="SeAg_B0068"
FT                   /product="citrate lyase, alpha subunit"
FT                   /EC_number="2.8.3.10"
FT                   /note="identified by match to protein family HMM PF04223;
FT                   match to protein family HMM TIGR01584"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0068"
FT                   /db_xref="EnsemblGenomes-Tr:ACH50373"
FT                   /db_xref="GOA:B5F741"
FT                   /db_xref="InterPro:IPR006472"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:B5F741"
FT                   /protein_id="ACH50373.1"
FT                   /translation="MKETVTMLNQQYVVPEGLQPYQGVTANSPWLASETEKRRRKICDS
FT                   LEEAIRRSGLKNGMTISFHHAFRGGDKVVNMVMAKLAEMGFRDLTLASSSLIDAHWPLI
FT                   EHIKNGVVRQIYTSGLRGKLGEEISAGLMENPVQIHSHGGRVKLIQSGELNIDVAFLGV
FT                   PCCDEFGNANGFSGKSRCGSLGYAQVDAQYAKCVVLLTEEWVEFPNYPASIAQDQVDLI
FT                   VQVDEVGDPEKITAGAIRLSSNPRELLIARQAANVIEHSGYFCDGFSLQTGTGGASLAV
FT                   TRFLEDKMRRHNITASFGLGGITGTMVDLHEKGLIKALLDTQSFDGDAARSLAQNPHHI
FT                   EISTNQYANPGSKGAACERLNVVMLSALEIDVNFNVNVMTGSNGVLRGASGGHSDTAAG
FT                   ADLTIITAPLVRGRIPCVVEKVLTTVTPGASVDVLVTDHGIAVNPARQDLLDNLRAAGV
FT                   ALMTIEQLQQRAEQLTGKPQPIEFTDRVVAVVRYRDGSVIDVIRQVKG"
FT   gene            72390..72941
FT                   /gene="citX"
FT                   /locus_tag="SeAg_B0069"
FT   CDS_pept        72390..72941
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="citX"
FT                   /locus_tag="SeAg_B0069"
FT                   /product="holo-ACP synthase CitX"
FT                   /EC_number="2.7.7.61"
FT                   /note="identified by match to protein family HMM PF03802;
FT                   match to protein family HMM TIGR03124"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0069"
FT                   /db_xref="EnsemblGenomes-Tr:ACH48535"
FT                   /db_xref="GOA:B5F742"
FT                   /db_xref="InterPro:IPR005551"
FT                   /db_xref="UniProtKB/TrEMBL:B5F742"
FT                   /protein_id="ACH48535.1"
FT                   /translation="MKGTDLLYQGQAVTLEEMLQARDKRAARQRQALNCYRLPLISLTL
FT                   VAPGAVKNSAVWRRVADYAIAEILALCEQKEWVNVWEMQVNERSGPEWMAAVCAPAMAL
FT                   KQHMSTLEMRHPLGRLWDIDIIDSDGKSLSRRELGHPARPCLICQQDAHLCARGKHHTL
FT                   DLLLDEIARRIECYERERCD"
FT   gene            72919..73827
FT                   /gene="citG"
FT                   /locus_tag="SeAg_B0070"
FT   CDS_pept        72919..73827
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="citG"
FT                   /locus_tag="SeAg_B0070"
FT                   /product="triphosphoribosyl-dephospho-CoA synthase CitG"
FT                   /EC_number="2.4.2.52"
FT                   /note="identified by match to protein family HMM PF01874;
FT                   match to protein family HMM TIGR03125"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0070"
FT                   /db_xref="EnsemblGenomes-Tr:ACH48949"
FT                   /db_xref="GOA:B5F743"
FT                   /db_xref="InterPro:IPR002736"
FT                   /db_xref="InterPro:IPR017551"
FT                   /db_xref="UniProtKB/TrEMBL:B5F743"
FT                   /protein_id="ACH48949.1"
FT                   /translation="MNVSVVTERRTPAYSSLAAGELNGLVARALLTEARLTPKPGLVDI
FT                   RNSGAHRDMDLAAFERSTTAIAPWMEKFFIMGNNTAAVAAENVLVMLRPLGMACENDML
FT                   QATNGVNTHRGAIFAFGLLSAAIGRLLARGEPLEQNRICDQVARLSRNIVAHELSAKKA
FT                   GKLTKSETHFQCYGLSGARGEAESGFRTVRTQALPVFNRVVQEHDDTHLALLQTLLHLM
FT                   AWNDDTNLVSRGGLEGLYYVQQQAQKLLWQGGVLVEGGIEAMQSLDDELILRNLSPGGS
FT                   ADLLAVTWFLSHFPAGSLYPE"
FT   gene            74007..74828
FT                   /gene="dapB"
FT                   /locus_tag="SeAg_B0071"
FT   CDS_pept        74007..74828
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dapB"
FT                   /locus_tag="SeAg_B0071"
FT                   /product="dihydrodipicolinate reductase"
FT                   /EC_number="1.17.1.8"
FT                   /note="identified by match to protein family HMM PF01113;
FT                   match to protein family HMM PF05173; match to protein
FT                   family HMM TIGR00036"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0071"
FT                   /db_xref="EnsemblGenomes-Tr:ACH52391"
FT                   /db_xref="GOA:B5F744"
FT                   /db_xref="InterPro:IPR000846"
FT                   /db_xref="InterPro:IPR022663"
FT                   /db_xref="InterPro:IPR022664"
FT                   /db_xref="InterPro:IPR023940"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5F744"
FT                   /protein_id="ACH52391.1"
FT                   /translation="MHEAQIRVAIAGAGGRMGRQLIQAAMAMEGVQLGAALEREGSSLL
FT                   GSDAGELAGAGKSGVIVQSSLEAVKDDFDVFIDFTRPEGTLTHLAFCRQHGKGMVIGTT
FT                   GFDDAGKQAIREASQEIAIVFAANFSVGVNVMLKLLEKAAKVMGDYSDIEIIEAHHRHK
FT                   VDAPSGTALAMGEAIAGALDKNLKDCAVYSREGYTGERVPGTIGFATVRAGDIVGEHTA
FT                   MFADIGERVEITHKASSRMTFANGALRSALWLKTKKNGLFDMRDVLGLDVL"
FT   gene            complement(75287..75478)
FT                   /locus_tag="SeAg_B0072"
FT   CDS_pept        complement(75287..75478)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0072"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0072"
FT                   /db_xref="EnsemblGenomes-Tr:ACH52872"
FT                   /db_xref="UniProtKB/TrEMBL:B5F745"
FT                   /protein_id="ACH52872.1"
FT                   /translation="MTIENACASVSSQKTGWHDKKWTKWSNFTLKQQKTTIKIHLIAIN
FT                   TIKCIKNSKLSKLTTKTF"
FT   gene            75692..76840
FT                   /gene="carA"
FT                   /locus_tag="SeAg_B0073"
FT   CDS_pept        75692..76840
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="carA"
FT                   /locus_tag="SeAg_B0073"
FT                   /product="carbamoyl-phosphate synthase, small subunit"
FT                   /EC_number="6.3.5.5"
FT                   /note="identified by match to protein family HMM PF00117;
FT                   match to protein family HMM PF00988; match to protein
FT                   family HMM TIGR01368"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0073"
FT                   /db_xref="EnsemblGenomes-Tr:ACH51098"
FT                   /db_xref="GOA:B5F746"
FT                   /db_xref="InterPro:IPR002474"
FT                   /db_xref="InterPro:IPR006274"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR035686"
FT                   /db_xref="InterPro:IPR036480"
FT                   /db_xref="UniProtKB/TrEMBL:B5F746"
FT                   /protein_id="ACH51098.1"
FT                   /translation="MIKSALLVLEDGTQFHGRAIGATGSAVGEVVFNTSMTGYQEILTD
FT                   PSYSRQIVTLTYPHIGNVGTNEADEESSQVHAQGLVIRDLPLIASNFRNTEDLSSYLKR
FT                   HNIVAIADIDTRKLTRLLREKGAQNGCIIAGDSPDAKLALEKAKAFPGLNGMDLAKEVT
FT                   TAETYRWTQGSWTLKDGLPEAKSEDDLPFHVVAYDFGAKRNILRMLVDRGCRLTVVPAQ
FT                   TSAEEVLKMNPDGIFLSNGPGDPAPCDYAITAIQKFLETDIPLFGICLGHQLLALASGA
FT                   KTVKMKFGHHGGNHPVKDMDRNVVMITAQNHGFAVDEDSLPANLRVTHKSLFDGTLQGI
FT                   HRTDKPAFCFQGHPEASPGPHDAAPLFDHFIELIEQYRQSAK"
FT   gene            76859..80086
FT                   /gene="carB"
FT                   /locus_tag="SeAg_B0074"
FT   CDS_pept        76859..80086
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="carB"
FT                   /locus_tag="SeAg_B0074"
FT                   /product="carbamoyl-phosphate synthase, large subunit"
FT                   /EC_number="6.3.5.5"
FT                   /note="identified by match to protein family HMM PF00289;
FT                   match to protein family HMM PF02142; match to protein
FT                   family HMM PF02786; match to protein family HMM PF02787;
FT                   match to protein family HMM TIGR01369"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0074"
FT                   /db_xref="EnsemblGenomes-Tr:ACH51611"
FT                   /db_xref="GOA:B5F747"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005480"
FT                   /db_xref="InterPro:IPR005483"
FT                   /db_xref="InterPro:IPR006275"
FT                   /db_xref="InterPro:IPR011607"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR033937"
FT                   /db_xref="InterPro:IPR036897"
FT                   /db_xref="InterPro:IPR036914"
FT                   /db_xref="UniProtKB/TrEMBL:B5F747"
FT                   /protein_id="ACH51611.1"
FT                   /translation="MPKRTDIKSILILGAGPIVIGQACEFDYSGAQACKALREEGYRVI
FT                   LVNSNPATIMTDPEMADATYIEPIHWEVVRKIIEKERPDAVLPTMGGQTALNCALELER
FT                   QGVLEEFGVTMIGATADAIDKAEDRRRFDIAMKKIGLDTARSGIAHTMEEALAVAADVG
FT                   FPCIIRPSFTMGGTGGGIAYNREEFEEICERGLDLSPTNELLIDESLIGWKEYEMEVVR
FT                   DKNDNCIIVCSIENFDAMGIHTGDSITVAPAQTLTDKEYQIMRNASMAVLREIGVETGG
FT                   SNVQFAVNPKNGRLIVIEMNPRVSRSSALASKATGFPIAKVAAKLAVGYTLDELMNDIT
FT                   GGRTPASFEPSIDYVVTKIPRFNFEKFAGANDRLTTQMKSVGEVMAIGRTQQESLQKAL
FT                   RGLEVGATGFDPKVSLDDPEALTKIRRELKDAGADRIWYIADAFRAGLSVDGVFNLTNI
FT                   DRWFLVQIEELVRLEEKVAEVGITGLNADFLRQLKRKGFADARLAKLAGVREAEIRKLR
FT                   DQYNLHPVYKRVDTCAAEFATDTAYMYSTYEDECEANPSVDRDKIMVLGGGPNRIGQGI
FT                   EFDYCCVHASLALREDGYETIMVNCNPETVSTDYDTSDRLYFEPVTLEDVLEIVRIEKP
FT                   KGVIVQYGGQTPLKLARALEAAGVPVIGTSPDAIDRAEDRERFQHAVDRLKLKQPANAT
FT                   VTAIEQAVEKAKEIGYPLVVRPSYVLGGRAMEIVYDEADLRRYFQTAVSVSNDAPVLLD
FT                   RFLDDAVEVDVDAICDGEMVLIGGIMEHIEQAGVHSGDSACSLPAYTLSQEIQDVMRQQ
FT                   VQKLAFELQVRGLMNVQFAVKDNEVYLIEVNPRAARTVPFVSKATGVPLAKVAARVMAG
FT                   KSLTEQGVTKEIIPPYYSVKEVVLPFNKFPGVDPLLGPEMRSTGEVMGVGRTFAEAFAK
FT                   AQLGSNSTMKKQGRALLSVREGDKERVVDLAAKLLKQGFELDATHGTAIVLGEAGINPR
FT                   LVNKVHEGRPHIQDRIKNGEYTYIINTTAGRRAIEDSRVIRRSALQYKVHYDTTLNGGF
FT                   ATTMALNADATEKVTSVQEMHAQIKKS"
FT   gene            80360..80755
FT                   /pseudo
FT                   /locus_tag="SeAg_B0075"
FT                   /note="transcriptional activatory protein CaiF; this gene
FT                   contains a frame shift which may be the result of
FT                   sequencing error"
FT   gene            complement(80832..81428)
FT                   /locus_tag="SeAg_B0076"
FT   CDS_pept        complement(80832..81428)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0076"
FT                   /product="carnitine operon protein CaiE"
FT                   /note="identified by match to protein family HMM PF00132"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0076"
FT                   /db_xref="EnsemblGenomes-Tr:ACH49615"
FT                   /db_xref="GOA:B5F748"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR023446"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5F748"
FT                   /protein_id="ACH49615.1"
FT                   /translation="MSYYAFEGLIPVVHPDAFVHPSAVLIGDVIVGAGVYIGPLASLRG
FT                   DYGRLILEAGSNLQDGCIMHGYCDTDTIVHENGHIGHGAILHGCVVGRDALVGMNSVIM
FT                   DGAMIGEESIVAAMSFVKAGFQGEARQLLVGSPARVLRQVTDQELHWKRLNTKEYQDLA
FT                   IRCRTGLSETKPLTQVEENRPRLKGTTDVKPKSAQ"
FT   gene            complement(81538..82323)
FT                   /locus_tag="SeAg_B0077"
FT   CDS_pept        complement(81538..82323)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0077"
FT                   /product="carnitinyl-CoA dehydratase"
FT                   /EC_number="4.2.1.-"
FT                   /note="identified by match to protein family HMM PF00378"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0077"
FT                   /db_xref="EnsemblGenomes-Tr:ACH52388"
FT                   /db_xref="GOA:B5F749"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR022852"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5F749"
FT                   /protein_id="ACH52388.1"
FT                   /translation="MSESLHLTRNGPILEITLDRPKANAIDAKTSFAMGEAFLNFRDDP
FT                   ELRVAIITGGGEKFFSAGWDLKAAAEGEAPDADFGPGGFAGLTEIFDLDKPVIAAVNGY
FT                   AFGGGFELALAADFIVCAENASFALPEAKLGIVPDSGGVLRLPKLLPPAIVNEMVMTGR
FT                   RMSAEEALRWGIVNRVVSQSELMDSARELAQQLVNSAPLAIAALKEIYRATSEMPVEEG
FT                   YRYIRSGVLKHYPSVLHSEDALEGPQAFAEKRDPVWKGR"
FT   gene            complement(82377..83930)
FT                   /locus_tag="SeAg_B0078"
FT   CDS_pept        complement(82377..83930)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0078"
FT                   /product="probable crotonobetaine/carnitine-CoA ligase"
FT                   /EC_number="6.2.1.-"
FT                   /note="identified by match to protein family HMM PF00501"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0078"
FT                   /db_xref="EnsemblGenomes-Tr:ACH48610"
FT                   /db_xref="GOA:B5F750"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR023456"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5F750"
FT                   /protein_id="ACH48610.1"
FT                   /translation="MDIVGGQNLRQMWDDLAGVYGDKTALIFESCEGIVRQFSYASLNE
FT                   EINRTANLFYSLGIRKGDRVALHLDNCPEFIFCWFGLAKIGAIMVPINARLLGEESAWI
FT                   LQNSQVSLLVTSAQFYPMYREIRQDNSTPLNHICLIGEQLPADDGVSHFTQLQSRQSTT
FT                   LCYTPALSTDDTAEILFTSGTTSRPKGVVITHYNLRFAGYYSAWQIALRDDDVYMTVMP
FT                   AFHIDCQCTAAMPAFSAGSTFVLLEKYSARAFWDQVRKYQATVTECIPMMIRTLMVQPA
FT                   APTDRQHHLREVMFYLNLSEQEKDDFTERFGVRLLTSYGMTETIVGIIGDRPGDKRRWP
FT                   SIGRVGFSYEAEIRDDQNRPLPAGEIGEICIKGIPGKTIFKEYYMQPEATARALEPEGW
FT                   LHTGDSGYQDEDGYFYFVDRRCNMIKRGGENVSCVELENIISAHPKIQDIVVVGIKDAI
FT                   RDEAIKAFIVLNEGETLSEAEFFSFCENNMAKFKVPSFMEIRTDLPRNCSGKIIKKNLK
FT                   "
FT   gene            complement(83993..85213)
FT                   /locus_tag="SeAg_B0079"
FT   CDS_pept        complement(83993..85213)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0079"
FT                   /product="crotonobetainyl-CoA:carnitine CoA-transferase"
FT                   /EC_number="2.8.3.-"
FT                   /note="identified by match to protein family HMM PF02515"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0079"
FT                   /db_xref="EnsemblGenomes-Tr:ACH51511"
FT                   /db_xref="GOA:B5F751"
FT                   /db_xref="InterPro:IPR003673"
FT                   /db_xref="InterPro:IPR023452"
FT                   /db_xref="InterPro:IPR023606"
FT                   /db_xref="UniProtKB/TrEMBL:B5F751"
FT                   /protein_id="ACH51511.1"
FT                   /translation="MMNHLPMPTFGPLAGVRVVFSGIEIAGPFAGQMFAEWGAEVIWIE
FT                   NVAWADTIRVQPNYPQLSRRNLHALSLNIFKDEGREAFLKLMETTDIFIEASKGPAFAR
FT                   RGITDEVLWEHNPKLVIAHLSGFGQYGTEEYTNLPAYNTIAQAFSGYLIQNGDVDQPMP
FT                   AFPYTADYFSGMTATTAALAALHKVRETGKGESIDIAMYEVMLRMGQYFMMDYFNGGEI
FT                   CPRMTKGKDPYYAGCGLYKCADGYIVMELVGITQINECFKDIGLAHILGTPEVPEGTQL
FT                   IHRVECPYGPLVEEKLDAWLATHTIADVQARFAELNIACAKVLTIPELEGNPQYVARES
FT                   ITQWQTMDGRTCKGPNIMPKFKNNPGKIWRGMPSHGMDTAAILKNIGYSEADIKELVGK
FT                   GLAKVED"
FT   gene            complement(85322..86464)
FT                   /gene="caiA"
FT                   /locus_tag="SeAg_B0080"
FT   CDS_pept        complement(85322..86464)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="caiA"
FT                   /locus_tag="SeAg_B0080"
FT                   /product="crotonobetainyl-CoA dehydrogenase"
FT                   /EC_number="1.3.99.-"
FT                   /note="identified by match to protein family HMM PF00441;
FT                   match to protein family HMM PF02770; match to protein
FT                   family HMM PF02771; match to protein family HMM PF08028"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0080"
FT                   /db_xref="EnsemblGenomes-Tr:ACH52757"
FT                   /db_xref="GOA:B5F752"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR023450"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5F752"
FT                   /protein_id="ACH52757.1"
FT                   /translation="MDFNLNDEQELFVAGIRELMASENWEAYFAECDRDSVYPERFVKA
FT                   LADMGIDSLLIPEEHGGLEAGFVTVAAVWMELGRLGAPTYVLYQLPGGFNTFLREGTQE
FT                   QIDKIMAFRGTGKQMWNSAITEPGAGSDVGSLKTTYTRKNGKVYLNGSKCFITSSAYTP
FT                   YIVVMARDGASPDKPVYTEWFVDMSKAGIKVNKLEKLGLRMDSCCEITFDDVELDEKDM
FT                   FGREGNGFNRVKEEFDHERFLVALTNYGTAMCAFEDAARYANQRVQFGEAIGRFQLIQE
FT                   KFAHMAIKLNSMKNMLLEAAWKADNGTITSGDAAMCKYFCANAAFEVVDTAMQVLGGVG
FT                   IAGNHRITRFWRDLRVDRVSGGSDEMQILTLGRAVLKQYR"
FT   gene            complement(86499..88016)
FT                   /gene="caiT"
FT                   /locus_tag="SeAg_B0081"
FT   CDS_pept        complement(86499..88016)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="caiT"
FT                   /locus_tag="SeAg_B0081"
FT                   /product="L-carnitine/gamma-butyrobetaine antiporter"
FT                   /note="identified by match to protein family HMM PF02028;
FT                   match to protein family HMM TIGR00842"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0081"
FT                   /db_xref="EnsemblGenomes-Tr:ACH50508"
FT                   /db_xref="GOA:B5F753"
FT                   /db_xref="InterPro:IPR000060"
FT                   /db_xref="InterPro:IPR018093"
FT                   /db_xref="InterPro:IPR023449"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5F753"
FT                   /protein_id="ACH50508.1"
FT                   /translation="MKNEKKKSGIEPKVFFPPLIIVGILCWLTVRDLDAANVVINAVFS
FT                   YVTNVWGWAFEWYMVVMLFGWFWLVFGPYAKKRLGDEKPEFSTASWIFMMFASCTSAAV
FT                   LFWGSIEIYYYISTPPFGLEPNSTGAKEIGLAYSLFHWGPLPWATYSFLSVAFAYFFFV
FT                   RKMDVIRPSSTLVPLVGEKHAKGLFGTIVDNFYLVALIFAMGTSLGLATPLVTECMQWL
FT                   FGIPHTLQLDAIIITCWIILNAICVACGLQKGVRIASDVRSYLSFLMLGWVFIVSGASF
FT                   IMNYFTDSVGMLLMHLPRMLFYTDAIGKGGFPQGWTVFYWAWWVIYAIQMSIFLARISR
FT                   GRTVRELCFGMVMGLTASTWILWTVLGSNTLLLMDKNILNIPQLIEQHGVARAIIETWA
FT                   ALPLSTATMWGFFILCFIATVTLINACSYTLAMSTCREVRDGEEPPLLVRIGWSVLVGI
FT                   IGIVLLALGGLKPIQTAIIAGGCPLFFVNIMVTLSFIKDAKVHWKDK"
FT   gene            88158..88274
FT                   /locus_tag="SeAg_B0082"
FT   CDS_pept        88158..88274
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0082"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0082"
FT                   /db_xref="EnsemblGenomes-Tr:ACH51263"
FT                   /db_xref="GOA:B5F754"
FT                   /db_xref="UniProtKB/TrEMBL:B5F754"
FT                   /protein_id="ACH51263.1"
FT                   /translation="MILLSSSHFFALIILCLNFDFCFIYQLIGCGFLTFLSI"
FT   gene            88244..88429
FT                   /locus_tag="SeAg_B0083"
FT   CDS_pept        88244..88429
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0083"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0083"
FT                   /db_xref="EnsemblGenomes-Tr:ACH49496"
FT                   /db_xref="UniProtKB/TrEMBL:B5F755"
FT                   /protein_id="ACH49496.1"
FT                   /translation="MWFFNFFKYLTFNIVEPANNIENFHIWHISFNIGEVRNTIESYEY
FT                   QCVTFSILVIKVLFPN"
FT   gene            88497..89267
FT                   /gene="fixA"
FT                   /locus_tag="SeAg_B0084"
FT   CDS_pept        88497..89267
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fixA"
FT                   /locus_tag="SeAg_B0084"
FT                   /product="protein FixA"
FT                   /note="identified by match to protein family HMM PF01012"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0084"
FT                   /db_xref="EnsemblGenomes-Tr:ACH49754"
FT                   /db_xref="GOA:B5F756"
FT                   /db_xref="InterPro:IPR000049"
FT                   /db_xref="InterPro:IPR012255"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014730"
FT                   /db_xref="InterPro:IPR023463"
FT                   /db_xref="InterPro:IPR033948"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5F756"
FT                   /protein_id="ACH49754.1"
FT                   /translation="MKIITCYKCVPDEQDIAINNADGTLDFSKADSKISQYDLNAIEAA
FT                   CQLKQQLGDAQVVAMSVGGKALTNAKGRKDVLSRGPDELIVVIDDQFEQALPQQTASAL
FT                   AAAAQKSGFDLLICGDGSSDLYAQQVGLLVGEALNIPAINGVSKILSLTDSTLTVEREL
FT                   EDEVETLSIPLPAVIAVSTDINTPQIPSMKAILGAAKKPVQVWSPADIGLNSVPAYSAQ
FT                   QVAAPKQRERQRVVIEGDGEEQIAAFVENLRKII"
FT   gene            89283..90224
FT                   /gene="fixB"
FT                   /locus_tag="SeAg_B0085"
FT   CDS_pept        89283..90224
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fixB"
FT                   /locus_tag="SeAg_B0085"
FT                   /product="electron transfer flavoprotein, alpha subunit"
FT                   /note="identified by match to protein family HMM PF00766;
FT                   match to protein family HMM PF01012"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0085"
FT                   /db_xref="EnsemblGenomes-Tr:ACH51996"
FT                   /db_xref="GOA:B5F757"
FT                   /db_xref="InterPro:IPR001308"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014730"
FT                   /db_xref="InterPro:IPR014731"
FT                   /db_xref="InterPro:IPR018206"
FT                   /db_xref="InterPro:IPR023461"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5F757"
FT                   /protein_id="ACH51996.1"
FT                   /translation="MNKFSSVWVFSDTPSRLPELMSGAQAVGEKVNAFVLNEADSATAC
FT                   HLGADHVWLLSGKPEDRMIEDYAAAMAETIRQHSEGGAVLLPNTRRGKLLAAKLGYRLS
FT                   AAVSNDASDVSLQDGKAAVKHMVYGGLAIGAETIASPFAVITLSSGTFDAQQPDASRSG
FT                   EMHTVQWQAPATAVTRTATQARQSNSVDLDKARLVVSVGRGIGSKENISLAEALCQTIG
FT                   AELACSRPVAENEKWMEHERYVGISNLMLKPELYLAVGISGQIQHMVGANGAQTIFAIN
FT                   KDKNAPIFQYADFGIVGDALKILPALTAALAR"
FT   gene            90274..91560
FT                   /gene="fixC"
FT                   /locus_tag="SeAg_B0086"
FT   CDS_pept        90274..91560
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fixC"
FT                   /locus_tag="SeAg_B0086"
FT                   /product="protein FixC"
FT                   /note="identified by match to protein family HMM PF00890;
FT                   match to protein family HMM PF01266; match to protein
FT                   family HMM PF01494; match to protein family HMM PF03486"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0086"
FT                   /db_xref="EnsemblGenomes-Tr:ACH52486"
FT                   /db_xref="GOA:B5F758"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR039651"
FT                   /db_xref="UniProtKB/TrEMBL:B5F758"
FT                   /protein_id="ACH52486.1"
FT                   /translation="MSEDIFDAIIVGAGLAGSVAALVLAREGAQVLVIERGNSAGAKNV
FT                   TGGRLYAHSLERIIPGFADQAPIERMITHEKLAFMTDKGAMTMDYCNGEDAASSQVSYS
FT                   VLRSKFDAWLMEQAEEAGAQLITGIRVDNVVQRDGKVVGVEADGDILEAKVVILADGVN
FT                   SLLAEKLGMAKRVEASHVAVGVKELIELPKSVIEDRFQLQGNEGAACLFAGAPTDGLMG
FT                   GGFLYTNETTLSLGLVCGLHHLKDAKKSVPQMLEDFKQHPAVAPLIAGGKLVEYAAHVV
FT                   PEAGMNMQPELVGDGVLIAGDAAGMCMNLGFTIRGMDLAISAGEAAAKTVLSAMKRDDF
FT                   SKQSLGEYRQHLDEGPMRDMRMYQKLPAFLDNPRMFTAYPEMAVSIARDLFTVDGSAPV
FT                   PMRKKILRHAKKVGFINLMKDGLKGVTVL"
FT   gene            91557..91844
FT                   /locus_tag="SeAg_B0087"
FT   CDS_pept        91557..91844
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0087"
FT                   /product="ferredoxin-like protein ydiT"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0087"
FT                   /db_xref="EnsemblGenomes-Tr:ACH51683"
FT                   /db_xref="GOA:B5F759"
FT                   /db_xref="InterPro:IPR012206"
FT                   /db_xref="UniProtKB/TrEMBL:B5F759"
FT                   /protein_id="ACH51683.1"
FT                   /translation="MTSPVNVDVKLGVNKFNVDEDSPHIILKTDPDKQALEVLIKACPA
FT                   GLYKKQDDGSVRFDYAGCLECGTCRILGLDTALEKWEYPRGTFGVEFRYG"
FT   gene            91925..93331
FT                   /locus_tag="SeAg_B0088"
FT   CDS_pept        91925..93331
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0088"
FT                   /product="putative metabolite transport protein YaaU"
FT                   /note="identified by match to protein family HMM PF00083;
FT                   match to protein family HMM PF07690"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0088"
FT                   /db_xref="EnsemblGenomes-Tr:ACH50455"
FT                   /db_xref="GOA:B5F760"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B5F760"
FT                   /protein_id="ACH50455.1"
FT                   /translation="MAAETPYPAYRCALPVLTQDITMQQPRNFDDLKFSSIHRRIMLWG
FT                   SGGPFLDGYVLVIIGVALEQLTPLLHLDAEWIGALGAATLAGLFIGTSLFGYICDKVGR
FT                   RKMFLLDIIAIGVISVATMFVSTPLELLVMRVLIGIVIGADYPIATSMITEFSNTRQRA
FT                   FSIGFIAAMWYVGATCANLVGYWLYDMEGGWRWMLGSAFIPCLIILIGRFDLPESPRWL
FT                   LRKGRVKECEQMMIKLFGEPVCFDDEPPQETRFLQLFNRRHFPFVLFVAAIWTCQVIPM
FT                   FAIYTFGPQIVGLLGWEQGRNAALGNVVISLFFMLGCIPAMFWLNSIGRRPLLIGSFAM
FT                   MTIALALLGLVSNLGIILVVVAFAVYAFFSGGPGILQWLYPNELFPTDIRASAVGVIMS
FT                   LSRIGTIVSTWALPIFITRYGINNVMLIGALISLVGLGVSVMFAPETRGLTLTQTGNMT
FT                   LRGTPSDNPR"
FT   gene            93420..93650
FT                   /locus_tag="SeAg_B0089"
FT   CDS_pept        93420..93650
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0089"
FT                   /product="conserved domain protein"
FT                   /note="identified by match to protein family HMM PF06004"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0089"
FT                   /db_xref="EnsemblGenomes-Tr:ACH48522"
FT                   /db_xref="InterPro:IPR010305"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="UniProtKB/TrEMBL:B5F761"
FT                   /protein_id="ACH48522.1"
FT                   /translation="MQKRLMTALFTAAILFTVAGCSSNQAVETTDGKTIVTDGKPEVDN
FT                   DTGMVSYKNAATGKTEQINRDQLKNMSELDN"
FT   gene            93936..94358
FT                   /locus_tag="SeAg_B0090"
FT   CDS_pept        93936..94358
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0090"
FT                   /product="probable secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0090"
FT                   /db_xref="EnsemblGenomes-Tr:ACH49135"
FT                   /db_xref="UniProtKB/TrEMBL:B5F762"
FT                   /protein_id="ACH49135.1"
FT                   /translation="MKLKLIPFYLLALFSAASGATEINACKDLIGTWKTTADNPPYTMT
FT                   ILPPVEGCGEKCVKLNVQYELDVTHRNALYCHEGQEGVKGQGPMVIAFEGAYGGHAIGT
FT                   YNRQLQLLWAGVIPKNKKGKWITKMENYWFRQVKAH"
FT   gene            complement(94362..94478)
FT                   /locus_tag="SeAg_B0091"
FT   CDS_pept        complement(94362..94478)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0091"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0091"
FT                   /db_xref="EnsemblGenomes-Tr:ACH49635"
FT                   /db_xref="UniProtKB/TrEMBL:B5F763"
FT                   /protein_id="ACH49635.1"
FT                   /translation="MLALFFINSSSGAGKPLECARAGSKPFVNKTVLRAVLW"
FT   gene            complement(94582..94872)
FT                   /locus_tag="SeAg_B0092"
FT   CDS_pept        complement(94582..94872)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0092"
FT                   /product="probable secreted protein"
FT                   /note="identified by match to protein family HMM PF07338"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0092"
FT                   /db_xref="EnsemblGenomes-Tr:ACH50416"
FT                   /db_xref="InterPro:IPR010854"
FT                   /db_xref="InterPro:IPR025543"
FT                   /db_xref="InterPro:IPR036275"
FT                   /db_xref="UniProtKB/TrEMBL:B5F764"
FT                   /protein_id="ACH50416.1"
FT                   /translation="MKKRIIAAALLATVASFSTLAAEQVSKQEISHFKLVKVGTINVSQ
FT                   SGGQISSPSDLREKLSELADAKGGKYYHIIAAREHGPNFEAVAEVYNDATK"
FT   gene            95769..97658
FT                   /locus_tag="SeAg_B0093"
FT   CDS_pept        95769..97658
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0093"
FT                   /product="sulfatase"
FT                   /note="identified by match to protein family HMM PF00884;
FT                   match to protein family HMM TIGR01409"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0093"
FT                   /db_xref="EnsemblGenomes-Tr:ACH48900"
FT                   /db_xref="GOA:B5F765"
FT                   /db_xref="InterPro:IPR000917"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:B5F765"
FT                   /protein_id="ACH48900.1"
FT                   /translation="MSNKKNLSAEETDLTRRKLLTSAGILAAGGMLSGAVKADEKCAVK
FT                   AKPAWDKPFTGEIPEKLPEGYNILLVVTDQERFFPTFPFPVPGRERLMKTGVTFCNHQN
FT                   TSNVCTPSRSVLYTGLHMPQTKMFDNLGLPWMPYDLDPALGTTGHMMRELGYYTAYKGK
FT                   WHLTEKLEKPLPDEKDEDIDVGDIPEPELHKIMEKYGFADYHGIGDIIGHSKGGYFYDS
FT                   TTTAQTINWLRCKGQPLNDQHKPWFLAVNLVNPHDVMFIDTDKEGEKVQWRGELDQDDN
FT                   TLAPTQPPENELYQASWPNYPLPANRHQSFNEQGRPPAHLEYQTARAALEGQFPDEDRR
FT                   WRKLLDYYFNCIRDCDTHLDRILNELDALKLTDKTIVVFTADHGELGGSHQMHGKGASV
FT                   YKEQIHVPMIISHPAYPGNKKCQALTCHLDIAPTLVGLTGLPEEKQHQALGNRKGVNFS
FT                   GLLKNPEGVAVNAVRNASLYCYGMILYTDAHYLHRVIALQRDKQKTVAQIKQEISHLHP
FT                   DFSHRSGTRMINDGRYKFARYFSLREHNTPETWEDLIKYNDLELYDLKNDPDENHNLAA
FT                   DKQKYQDLILTMNEKLNKIIKDEIGVDDGSFMPDAAHEPWDLTIEQFNRMAKD"
FT   gene            98212..98742
FT                   /gene="kefF"
FT                   /locus_tag="SeAg_B0094"
FT   CDS_pept        98212..98742
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kefF"
FT                   /locus_tag="SeAg_B0094"
FT                   /product="glutathione-regulated potassium-efflux system
FT                   ancillary protein kefF"
FT                   /note="identified by match to protein family HMM PF02525"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0094"
FT                   /db_xref="EnsemblGenomes-Tr:ACH49054"
FT                   /db_xref="GOA:B5F766"
FT                   /db_xref="InterPro:IPR003680"
FT                   /db_xref="InterPro:IPR023948"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5F766"
FT                   /protein_id="ACH49054.1"
FT                   /translation="MILIIYAHPYPHHSHANKRMLEQAGTLENVEIRSLYHLYPDFNID
FT                   VAAEQEALSRASLIVWQHPMQWYSVPPLLKLWMDKVLTHGWAYGHGGTALHGKHLLWAV
FT                   TTGGGENHFAIGSHPGFDVLSQPLQATALYCGLKWLPPFAMHCTFICDDDTLQAQARQY
FT                   KQRLLAWQEVNHG"
FT   gene            98735..100597
FT                   /locus_tag="SeAg_B0095"
FT   CDS_pept        98735..100597
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0095"
FT                   /product="glutathione-regulated potassium-efflux system
FT                   protein KefC"
FT                   /note="identified by match to protein family HMM PF00999;
FT                   match to protein family HMM PF02254; match to protein
FT                   family HMM TIGR00932"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0095"
FT                   /db_xref="EnsemblGenomes-Tr:ACH52204"
FT                   /db_xref="GOA:B5F767"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR004771"
FT                   /db_xref="InterPro:IPR006036"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR023941"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5F767"
FT                   /protein_id="ACH52204.1"
FT                   /translation="MDSHTLLQALIYLGSAALIVPIAVRLGLGSVLGYLIAGCIIGPWG
FT                   LRLVTDAESILHFAEIGVVLMLFVIGLELDPQRLWKLRASVFGGGALQMVVCGGLIGLF
FT                   CMFLGLRWQVAELIGMTLALSSTAIAMQAMNERNLTVSQVGRSAFAVLLFQDIAAIPLV
FT                   AMIPLLAASGASTTLGAFALSALKVAGALALVVLLGRYVTRPALRFVARSGLREVFSAV
FT                   ALFLVFGFGLLLEEVGLSMAMGAFLAGVLLASSEYRHALESDIEPFKGLLLGLFFIGVG
FT                   MSIDFGTLVENPLRILLLLAGFLAIKIVMLWLVARPLGVPAKQRRWFAVLLGQGSEFAF
FT                   VVFGAAQMADVLEPEWAKALTLAVALSMAATPIFLVLLTRMEKTATGEAREADEIDEEQ
FT                   PRVIVAGFGRFGQIAGRLLLSSGVKMVVLDHDPDHIETLRKFGMKVFYGDATRMDLLES
FT                   AGAAKAEVLINAIDDPQTNLQLSELVKTHFPHLQIIARARDVDHYIRLRQAGVAMPERE
FT                   TFEGALKSGRQALEALGLGRYEARERADLFRHFNTRMVEEMAKGENDPLSRAAAYKRTS
FT                   AMLSEIITEDREHLSLIQRHGWQGTAEGKHSGEVADEPEVKPSI"
FT   gene            100796..101275
FT                   /gene="folA"
FT                   /locus_tag="SeAg_B0096"
FT   CDS_pept        100796..101275
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folA"
FT                   /locus_tag="SeAg_B0096"
FT                   /product="dihydrofolate reductase"
FT                   /EC_number="1.5.1.3"
FT                   /note="identified by match to protein family HMM PF00186"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0096"
FT                   /db_xref="EnsemblGenomes-Tr:ACH52922"
FT                   /db_xref="GOA:B5F768"
FT                   /db_xref="InterPro:IPR001796"
FT                   /db_xref="InterPro:IPR012259"
FT                   /db_xref="InterPro:IPR017925"
FT                   /db_xref="InterPro:IPR024072"
FT                   /db_xref="UniProtKB/TrEMBL:B5F768"
FT                   /protein_id="ACH52922.1"
FT                   /translation="MISLIAALAVDRVIGMENAMPWNLPADLAWFKRNTLNKPVVMGRH
FT                   TWESIGRPLPGRKNIVISSQPGTDDRVQWVKSVDEAIAACGDAPEIMVIGGGRVYEQFL
FT                   PKAQKLYLTHIDAEVEGDTHFPDYEPDDWESVFSEFHDADAQNSHSYCFEILERR"
FT   gene            complement(101381..102229)
FT                   /locus_tag="SeAg_B0097"
FT   CDS_pept        complement(101381..102229)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0097"
FT                   /product="bis(5'-nucleosyl)-tetraphosphatase (symmetrical)"
FT                   /EC_number="3.6.1.41"
FT                   /note="identified by match to protein family HMM PF00149;
FT                   match to protein family HMM TIGR00668"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0097"
FT                   /db_xref="EnsemblGenomes-Tr:ACH52622"
FT                   /db_xref="GOA:B5F769"
FT                   /db_xref="InterPro:IPR004617"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5F769"
FT                   /protein_id="ACH52622.1"
FT                   /translation="MATYLIGDVHGCYDELIALLQQVEFTPDTDTLWLTGDLVARGPGS
FT                   LDVLRYVKSLGNSVRLVLGNHDLHLLAVFAGISRNKPKDRLTPLLEAPDADELLNWLRR
FT                   QPLLQVDEEKKLVMAHAGITPQWDLQTAKECARDVEAVLSSDSYPFFLDAMYGDMPNNW
FT                   SPELSGLARLRFITNAFTRMRYCFPNGQLDMYSKASPENAPAPLKPWFAIPGPVSEAYS
FT                   IAFGHWASLEGKGTPEGIYALDTGCCWGGELTCLRWEDKQYFVQPSNRQMDMGEGEAVN
FT                   A"
FT   gene            complement(102240..102617)
FT                   /gene="apaG"
FT                   /locus_tag="SeAg_B0098"
FT   CDS_pept        complement(102240..102617)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="apaG"
FT                   /locus_tag="SeAg_B0098"
FT                   /product="protein ApaG"
FT                   /note="identified by match to protein family HMM PF04379"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0098"
FT                   /db_xref="EnsemblGenomes-Tr:ACH51818"
FT                   /db_xref="InterPro:IPR007474"
FT                   /db_xref="InterPro:IPR023065"
FT                   /db_xref="InterPro:IPR036767"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5F770"
FT                   /protein_id="ACH51818.1"
FT                   /translation="MINSPRVCIQVQSVYIEAQSSPDDERYVFAYTVTIRNLGRAPVQL
FT                   LGRYWLITNGHGRETEVQGEGVVGVQPRIAPGEEYQYTSGAVIETPLGTMQGHYEMIDE
FT                   NGDAFTIDIPVFRLAVPTLIH"
FT   gene            complement(102620..103441)
FT                   /gene="ksgA"
FT                   /locus_tag="SeAg_B0099"
FT   CDS_pept        complement(102620..103441)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ksgA"
FT                   /locus_tag="SeAg_B0099"
FT                   /product="dimethyladenosine transferase"
FT                   /EC_number="2.1.1.-"
FT                   /note="identified by match to protein family HMM PF00398;
FT                   match to protein family HMM TIGR00755"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0099"
FT                   /db_xref="EnsemblGenomes-Tr:ACH50298"
FT                   /db_xref="GOA:B5F771"
FT                   /db_xref="InterPro:IPR001737"
FT                   /db_xref="InterPro:IPR011530"
FT                   /db_xref="InterPro:IPR020596"
FT                   /db_xref="InterPro:IPR020598"
FT                   /db_xref="InterPro:IPR023165"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5F771"
FT                   /protein_id="ACH50298.1"
FT                   /translation="MNNRVHQGHLARKRFGQNFLNDRFVIDSIVSAINPQKGQAMVEIG
FT                   PGLAALTEPVGERLDKLTVIELDRDLAARLQTHPFLGPKLTIYQQDAMTMNFGELSAQL
FT                   GQPLRVFGNLPYNISTPLMFHLFSYTDAIADMHFMLQKEVVNRLVAGPNSKAYGRLSVM
FT                   AQYYCQVIPVLEVPPSAFTPPPKVDSAVVRLVPHATMPYPVKDIRVLSRITTEAFNQRR
FT                   KTIRNSLGNLFSVETLTEMGIDPAMRAENISVAQYCQMANYLSENAPLKES"
FT   gene            complement(103438..104427)
FT                   /gene="pdxA"
FT                   /locus_tag="SeAg_B0100"
FT   CDS_pept        complement(103438..104427)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pdxA"
FT                   /locus_tag="SeAg_B0100"
FT                   /product="4-hydroxythreonine-4-phosphate dehydrogenase"
FT                   /EC_number="1.1.1.262"
FT                   /note="identified by match to protein family HMM PF04166;
FT                   match to protein family HMM TIGR00557"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0100"
FT                   /db_xref="EnsemblGenomes-Tr:ACH48507"
FT                   /db_xref="GOA:B5F772"
FT                   /db_xref="InterPro:IPR005255"
FT                   /db_xref="InterPro:IPR037510"
FT                   /db_xref="UniProtKB/TrEMBL:B5F772"
FT                   /protein_id="ACH48507.1"
FT                   /translation="MSSAQRVVITPGEPAGIGPDLVVQLAQRAWPIELVVCADGALLTE
FT                   RAAMLGLPLSLLPYSPDVPAAPQPAGTLTLLPVSLRAPAISGQLTVENGPYVVETLARA
FT                   CDGCLNGEFAALITGPVHKGVINDAGIPFTGHTEFFEERSQAKKVVMMLATEELRVALA
FT                   TTHLPLRAIADAITPALLHEVIAILHHDLRTKFGIAEPRILVCGLNPHAGEGGHMGTEE
FT                   IDTIIPVLDELRAQGMKLNGPLPADTLFQPKYLDNADAVLAMYHDQGLPVLKYQGFGRG
FT                   VNITLGLPFIRTSVDHGTALELAGRGKADVGSFITALNLAIKMIVNTQ"
FT   gene            complement(104427..105713)
FT                   /gene="surA"
FT                   /locus_tag="SeAg_B0101"
FT   CDS_pept        complement(104427..105713)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="surA"
FT                   /locus_tag="SeAg_B0101"
FT                   /product="chaperone/peptidyl-prolyl cis-trans isomerase
FT                   SurA"
FT                   /EC_number="5.2.1.8"
FT                   /note="identified by match to protein family HMM PF00639;
FT                   match to protein family HMM PF09312"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0101"
FT                   /db_xref="EnsemblGenomes-Tr:ACH49933"
FT                   /db_xref="GOA:B5F773"
FT                   /db_xref="InterPro:IPR000297"
FT                   /db_xref="InterPro:IPR015391"
FT                   /db_xref="InterPro:IPR023034"
FT                   /db_xref="InterPro:IPR023058"
FT                   /db_xref="InterPro:IPR027304"
FT                   /db_xref="UniProtKB/TrEMBL:B5F773"
FT                   /protein_id="ACH49933.1"
FT                   /translation="MKNWKTLLLGIAMIANTSFAAPQVVDKVAAVVNNGVVLESDVDGL
FT                   MQSVKLNAGQAGQQLPDDATLRHQILERLIMDQIILQMGQKMGVKITDEQLDQAIANIA
FT                   KQNNMTMDQMRSRLAYDGLNYSTYRNQIRKEMIISEVRNNEVRRRITVLPQEVDALAKQ
FT                   IGTQNDASTELNLSHILIALPENPTSEQVNDAQRQAESIVEEARNGADFGKLAITYSAD
FT                   QQALKGGQMGWGRIQELPGIFAQALSTAKKGDIVGPIRSGVGFHILKVNDLRGQSQSIS
FT                   VTEVHARHILLKPSPIMNDQQARLKLEEIAADIKSGKTTFAAAAKEYSQDPGSANQGGD
FT                   LGWATPDIFDPAFRDALTKLHKGQISAPVHSSFGWHLIELLDTRKVDKTDAAQKDRAYR
FT                   MLMNRKFSEEAATWMQEQRASAYVKILSN"
FT   gene            complement(105767..108127)
FT                   /gene="imp"
FT                   /locus_tag="SeAg_B0102"
FT   CDS_pept        complement(105767..108127)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="imp"
FT                   /locus_tag="SeAg_B0102"
FT                   /product="LPS-assembly protein"
FT                   /note="identified by match to protein family HMM PF03968;
FT                   match to protein family HMM PF04453"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0102"
FT                   /db_xref="EnsemblGenomes-Tr:ACH51830"
FT                   /db_xref="GOA:B5F774"
FT                   /db_xref="InterPro:IPR005653"
FT                   /db_xref="InterPro:IPR007543"
FT                   /db_xref="InterPro:IPR020889"
FT                   /db_xref="UniProtKB/TrEMBL:B5F774"
FT                   /protein_id="ACH51830.1"
FT                   /translation="MKKRIPTLLATMIASALYSHQGLAADLASQCMLGVPSYDRPLVKG
FT                   DTNDLPVTINADNAKGNYPDDAVFTGNVDIMQGNSRLQADEVQLHQKQAEGQPEPVRTV
FT                   DALGNVHYDDNQVILKGPKGWANLNTKDTNVWEGDYQMVGRQGRGKADLMKQRGENRYT
FT                   ILENGSFTSCLPGSDTWSVVGSEVIHDREEQVAEIWNARFKVGPVPIFYSPYLQLPVGD
FT                   KRRSGFLIPNAKYTTKNYFEFYLPYYWNIAPNMDATITPHYMHRRGNIMWENEFRYLTQ
FT                   AGEGVMELDYLPSDKVYEDDHPKEGDKHRWLFYWQHSGVMDQVWRFNVDYTKVSDSSYF
FT                   NDFDSKYGSSTDGYATQKFSVGYAVQNFDATVSTKQFQVFNDQNTSSYSAEPQLDVNYY
FT                   HNDLGPFDTRIYGQAVHFVNTKDNMPEATRVHLEPTINLPLSNRWGSLNTEAKLMATHY
FT                   QQTNLDSYNSDPNNKNKLKDSVNRVMPQFKVDGKLIFERDMAMLAPGYTQTLEPRVQYL
FT                   YVPYRDQSGIYNYDSSLLQSDYNGLFRDRTYGGLDRIASANQVTTGVTTRIYDDAAVER
FT                   FNVSVGQIYYFTESRTGDDNIKWENDDKTGSLVWAGDTYWRISERWGLRSGVQYDTRLD
FT                   SVATSSSSLEYRRDQDRLVQLNYRYASPEYIQATLPSYYSTAEQYKNGINQVGAVASWP
FT                   IADRWSIVGAYYFDTNSSKPADQMLGLQYNSCCYAIRVGYERKLNGWDNDKQHAIYDNA
FT                   IGFNIELRGLSSNYGLGTQEMLRSNILPYQSSM"
FT   gene            complement(108137..108298)
FT                   /locus_tag="SeAg_B0103"
FT   CDS_pept        complement(108137..108298)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0103"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0103"
FT                   /db_xref="EnsemblGenomes-Tr:ACH51594"
FT                   /db_xref="UniProtKB/TrEMBL:B5F775"
FT                   /protein_id="ACH51594.1"
FT                   /translation="MWDIAYNLHYHTCHSMPCLTPQTLNGRINTGAAKMSKLGCDRLSR
FT                   ATLPMMEQ"
FT   gene            108381..109193
FT                   /locus_tag="SeAg_B0104"
FT   CDS_pept        108381..109193
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0104"
FT                   /product="DnaJ domain protein"
FT                   /note="identified by match to protein family HMM PF00226"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0104"
FT                   /db_xref="EnsemblGenomes-Tr:ACH50961"
FT                   /db_xref="GOA:B5F776"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR007791"
FT                   /db_xref="InterPro:IPR023749"
FT                   /db_xref="InterPro:IPR029024"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:B5F776"
FT                   /protein_id="ACH50961.1"
FT                   /translation="MQYWGKIIGVAVALMMGGGFWGVVLGLLVGHMFDKARSRKMAWFA
FT                   NQRERQALFFATTFEVMGHLTKSKGRVTEADIHIASQLMDRMNLHGDSRTAAQNAFRVG
FT                   KADNYPLREKMRQFRSVCFGRFDLIRMFLEIQIQAAFADGSLHPNEREVLYVIAEELGI
FT                   SRVQFDQFLRMMQGGAQFGGGYHQQSGGGWQQAQRGPTLEDACNVLGVKTTDDATTIKR
FT                   AYRKLMSEHHPDKLVAKGLPPEMMEMAKQKAQEIQKAYELIKEQKGFK"
FT   gene            complement(109288..109947)
FT                   /locus_tag="SeAg_B0105"
FT   CDS_pept        complement(109288..109947)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0105"
FT                   /product="pseudouridine synthase, RluA family"
FT                   /note="identified by match to protein family HMM PF00849"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0105"
FT                   /db_xref="EnsemblGenomes-Tr:ACH51896"
FT                   /db_xref="GOA:B5F777"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR006224"
FT                   /db_xref="InterPro:IPR006225"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/TrEMBL:B5F777"
FT                   /protein_id="ACH51896.1"
FT                   /translation="MGMENYNPPQEPWLVILYQDEHIMVVNKPSGLLSVPGRLEAHKDS
FT                   IMTRIQRDYPQAESVHRLDMATSGVIVVALTKAAERELKRQFREREPKKQYVARVWGHP
FT                   SPAEGLVDLPLICDWPNRPKQKVCYETGKPAQTEYNVVEFAADNTARVVLKPITGRSHQ
FT                   LRVHMLALGHPILGDRFYASPEALSLAPRLQLHAEMLTITHPAYGNSMTFKVPADF"
FT   gene            complement(109959..112865)
FT                   /gene="rapA"
FT                   /locus_tag="SeAg_B0106"
FT   CDS_pept        complement(109959..112865)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rapA"
FT                   /locus_tag="SeAg_B0106"
FT                   /product="RNA polymerase associated protein RapA"
FT                   /EC_number="3.6.1.-"
FT                   /note="identified by match to protein family HMM PF00176;
FT                   match to protein family HMM PF00271; match to protein
FT                   family HMM PF04851"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0106"
FT                   /db_xref="EnsemblGenomes-Tr:ACH49248"
FT                   /db_xref="GOA:B5F778"
FT                   /db_xref="InterPro:IPR000330"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR022737"
FT                   /db_xref="InterPro:IPR023949"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038718"
FT                   /db_xref="InterPro:IPR040765"
FT                   /db_xref="InterPro:IPR040766"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5F778"
FT                   /protein_id="ACH49248.1"
FT                   /translation="MPFTLGQRWISDTESELGLGTVVAMDARTVTLLFPSTGENRLYAR
FT                   SDSPVTRVMFNPGDTITSHEGWQLHIDEVKEENGLLVYVGTRLDTEETNVTLREVLLDS
FT                   KLVFSKPQDRLFAGQIDRMDRFALRYRARKFQSEQYRMPYSGLRGQRTNLIPHQLNIAH
FT                   DVGRRHAPRVLLADEVGLGKTIEAGMILHQQLLSGAAERVLIIVPETLQHQWLVEMLRR
FT                   FNLRFALFDDERYTEAQHDAYNPFETEQLVICSLDFARRNKQRLEHLCDAEWDLLVVDE
FT                   AHHLVWSTDAPSREYMAIEQLAERVPGVLLLTATPEQLGMESHFARLRLLDPNRFHDFE
FT                   QFVEEQKNYRPVADAVAMLLAGNKLSNDELNRLGDLIGEQDIEPLLQAANSDRDDAQAA
FT                   RDELVSMLMDRHGTSRVLFRNTRNGVKGFPKRELHTVKLPLPTQYQTAIKVSGIMGARK
FT                   SAEDRARDMLYPEQIYQEFEGDTGTWWNFDPRVEWLMGYLTSHRSQKVLVICAKATTAL
FT                   QLEQVLREREGIRAAVFHEGMSIIERDRAAAWFAEEDTGAQVLLCSEIGSEGRNFQFAS
FT                   NLVMFDLPFNPDLLEQRIGRLDRIGQAHDIQIHVPYLEKTAQSVLVRWYHEGLDAFEHT
FT                   CPTGRAIYDSAYASLINYLAAPEETDGFDDLIKSCREQHEALKAQLEQGRDRLLEIHSN
FT                   GGEKAQQLAQSIEEQDDDTNLIAFAMNLFDIVGINQDDRGDNLIVLTPSDHMLVPDFPG
FT                   LPEDGCTITFERDVALSREDAQFITWEHPLIRNGLDLILSGDTGSSTISLLKNKALPVG
FT                   TLLVELVYVVEAQAPKQLQLNRFLPPTPVRMLLDKNGNNLAAQVEFETFNRQLSAVNRH
FT                   TGSKLVNAVQQDVHAILQLGETQIEKSARALIDNARREADEKLSGELSRLEALRAVNPN
FT                   IRDDELAAIDSNRQQVLESLNQAGWRLDALRLIVVTHQ"
FT   gene            complement(113085..115391)
FT                   /pseudo
FT                   /locus_tag="SeAg_B0107"
FT                   /note="DNA polymerase II (Pol II); this gene contains a
FT                   frame shift which may be the result of sequencing error;
FT                   identified by match to protein family HMM PF00136; match to
FT                   protein family HMM PF03104"
FT   gene            complement(115435..115665)
FT                   /locus_tag="SeAg_B0108"
FT   CDS_pept        complement(115435..115665)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0108"
FT                   /product="putative secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0108"
FT                   /db_xref="EnsemblGenomes-Tr:ACH48895"
FT                   /db_xref="UniProtKB/TrEMBL:B5F779"
FT                   /protein_id="ACH48895.1"
FT                   /translation="MELRWRTALLVSDPLHMLRLKTIAQDNGIDSRSSPTRSTRYKSWW
FT                   AQTRFLLRETFYYSGYRLLRYMPVQNNSITP"
FT   gene            116194..117399
FT                   /pseudo
FT                   /locus_tag="SeAg_B0109"
FT                   /note="homologous to EryA gene product in L07626; this gene
FT                   contains a frame shift which may be the result of
FT                   sequencing error; identified by match to protein family HMM
FT                   PF01385; match to protein family HMM PF07282; match to
FT                   protein family HMM TIGR01766"
FT   gene            complement(117469..117966)
FT                   /locus_tag="SeAg_B0110"
FT   CDS_pept        complement(117469..117966)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0110"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF02698"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0110"
FT                   /db_xref="EnsemblGenomes-Tr:ACH49960"
FT                   /db_xref="GOA:B5F780"
FT                   /db_xref="InterPro:IPR003848"
FT                   /db_xref="UniProtKB/TrEMBL:B5F780"
FT                   /protein_id="ACH49960.1"
FT                   /translation="MINIRQQKYLTLKAILSLKYPLHPSWGTNSFMKYRYIIRIAAGII
FT                   LIMATVFIHNAIAIYQFSQQNQTRIADCAIVAGAGVSGKTPSPVFQARLDHAIWLYQQH
FT                   IVRALVLTGGYGAGATVSDAAIARQYVLEKGIPVKAIFIEERSTVTRENIRYAKQILRQ
FT                   QH"
FT   gene            118391..118810
FT                   /locus_tag="SeAg_B0111"
FT   CDS_pept        118391..118810
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0111"
FT                   /product="putative cytoplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0111"
FT                   /db_xref="EnsemblGenomes-Tr:ACH51579"
FT                   /db_xref="InterPro:IPR031855"
FT                   /db_xref="UniProtKB/TrEMBL:B5F781"
FT                   /protein_id="ACH51579.1"
FT                   /translation="MNVSMQARLVGSDRYLFVNTQRANPSIKTVSRFFEYKTWTEQIWR
FT                   TEIIENGNAFFHWQGHDRKNGHRDTIINYLLNGQRWQSTIEDYIFFHALEGKAWQGHYD
FT                   NIIEYVSSDHYVYQSAFAEYITDQTHQRAPHGTRF"
FT   gene            complement(118816..119511)
FT                   /gene="araD"
FT                   /locus_tag="SeAg_B0112"
FT   CDS_pept        complement(118816..119511)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="araD"
FT                   /locus_tag="SeAg_B0112"
FT                   /product="L-ribulose-5-phosphate 4-epimerase"
FT                   /EC_number="5.1.3.4"
FT                   /note="identified by match to protein family HMM PF00596;
FT                   match to protein family HMM TIGR00760"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0112"
FT                   /db_xref="EnsemblGenomes-Tr:ACH50921"
FT                   /db_xref="GOA:B5F782"
FT                   /db_xref="InterPro:IPR001303"
FT                   /db_xref="InterPro:IPR004661"
FT                   /db_xref="InterPro:IPR033748"
FT                   /db_xref="InterPro:IPR036409"
FT                   /db_xref="UniProtKB/TrEMBL:B5F782"
FT                   /protein_id="ACH50921.1"
FT                   /translation="MLEDLKRQVLEANLALPKHNLVTLTWGNVSAVDRERGVLVIKPSG
FT                   VDYSVMIADDMVVVSLETGEVVEGHKKPSSDTPTHRLLYQAFPTIGGIVHTHSRHATIW
FT                   AQAGQPIPATGTTHADYFYGTIPCTRKMTEAEINGEYEWETGNVIVETFEKQGIDAAQM
FT                   PGVLVHSHGPFAWGKNAEDAVHNAIVLEEVAYMGIFCRQLAPQLPDMQQSLLDKHYLRK
FT                   HGAKAYYGQ"
FT   gene            complement(119652..121154)
FT                   /gene="araA"
FT                   /locus_tag="SeAg_B0113"
FT   CDS_pept        complement(119652..121154)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="araA"
FT                   /locus_tag="SeAg_B0113"
FT                   /product="L-arabinose isomerase"
FT                   /EC_number="5.3.1.4"
FT                   /note="identified by match to protein family HMM PF02610"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0113"
FT                   /db_xref="EnsemblGenomes-Tr:ACH52537"
FT                   /db_xref="GOA:B5F783"
FT                   /db_xref="InterPro:IPR003762"
FT                   /db_xref="InterPro:IPR004216"
FT                   /db_xref="InterPro:IPR009015"
FT                   /db_xref="InterPro:IPR024664"
FT                   /db_xref="InterPro:IPR038583"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5F783"
FT                   /protein_id="ACH52537.1"
FT                   /translation="MTIFDNYEVWFVIGSQHLYGAETLRQVTQHAEHVVNALNTKAKLP
FT                   CKLVLKPLGTSPDEITAICRDANYDDRCAGLVVWLHTFSPAKMWINGLSILNKPLLQFH
FT                   TQFNAALPWDSIDMDFMNLNQTAHGGREFGFIGARMRQQHAVVTGHWQDKEAHTRIGAW
FT                   MRQAVSKQDTRQLKVCRFGDNMREVAVTDGDKVAAQIKFGFSVNTWAVGDLVQVVNSIG
FT                   DGDINALIDEYESSYTLTPATQIHGDKRQNVREAARIELGMKRFLEQGGFHAFTTTFED
FT                   LHGLKQLPGLAVQRLMQQGYGFAGEGDWKTAALLRIMKVMSTGLQGGTSFMEDYTYHFE
FT                   KGNDLVLGSHMLEVCPSIAVEEKPILDVQHLGIGGKEDPARLIFNTQTGPAIVASLIDL
FT                   GDRYRLLVNCIDTVKTPHSLPKLPVANALWKAQPDLPTASEAWILAGGAHHTVFSHALD
FT                   LNDMRQFAEIHDIEIAVIDNDTRLPAFKDALRWNEVYYGLKR"
FT   gene            complement(121165..122874)
FT                   /gene="araB"
FT                   /locus_tag="SeAg_B0114"
FT   CDS_pept        complement(121165..122874)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="araB"
FT                   /locus_tag="SeAg_B0114"
FT                   /product="L-ribulokinase"
FT                   /EC_number="2.7.1.16"
FT                   /note="identified by match to protein family HMM PF00370;
FT                   match to protein family HMM PF02782; match to protein
FT                   family HMM TIGR01234"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0114"
FT                   /db_xref="EnsemblGenomes-Tr:ACH49543"
FT                   /db_xref="GOA:B5F784"
FT                   /db_xref="InterPro:IPR005929"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5F784"
FT                   /protein_id="ACH49543.1"
FT                   /translation="MAIAIGLDFGSDSVRALAVDCATGDEIATSVEWYPRWQEGRYCDG
FT                   PNNQFRHHPRDYMESMEAALKAVLAQLSSAQRANVVGIGVDSTGSTPAPIDADGNVLAL
FT                   RPEFAENPNAMFVLWKDHTAVEEADEITRLCHKPGKVDYSRYIGGIYSSEWFWAKILHV
FT                   TRQDSAVAQAAVSWIELCDWVPALLSGTTRPQDIRRGRCSAGHKTLWHESWGGLPPSSF
FT                   FDELDPCINRHLRYPLFSETFTADLPVGTLCAEWAQRLGLPESVVISGGAFDCHMGAVG
FT                   AGAQPNTLVKVIGTSTCDILIADKQSVGDRAVKGICGQVDGSVVPNFIGLEAGQSAFGD
FT                   IYAWFSRVLSWPLEQLAAQHPELKTQINASQKQLLPALTDAWAKNPSLDHLPVVLDWFN
FT                   GRRTPNANQRLKGVITDLNLATDAPALFGGLVASTAFGARAIQECFTDQGIAVNNVMAL
FT                   GGIARKNQVIMQVCCDVLNRPLQIVASDQCCALGAAIFAAVAAKIHADIPAAQQSMASA
FT                   VERTLRPRPEQAQRLEQLYRRYQQWALSAEQHYLPTAAPAPTTPANQAILTH"
FT   gene            123215..124060
FT                   /locus_tag="SeAg_B0115"
FT   CDS_pept        123215..124060
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0115"
FT                   /product="arabinose operon regulatory protein"
FT                   /note="identified by match to protein family HMM PF00165;
FT                   match to protein family HMM PF02311"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0115"
FT                   /db_xref="EnsemblGenomes-Tr:ACH48911"
FT                   /db_xref="GOA:B5F785"
FT                   /db_xref="InterPro:IPR003313"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="InterPro:IPR037923"
FT                   /db_xref="UniProtKB/TrEMBL:B5F785"
FT                   /protein_id="ACH48911.1"
FT                   /translation="MAETQNDPLLPGYSFNAHLVAGLTPIEANGYLDFFIDRPLGMKGY
FT                   ILNLTIRGEGVINNNGEQFVCRPGDILLFPPGEIHHYGRHPDASEWYHQWVYFRPRAYW
FT                   QEWLTWPTIFAQTGFFRPDEARQPHFSELFGQIISAGQGEGRYSELLAINLLEQLLLRR
FT                   MAVINESLHPPMDSRVRDACQYISDHLADSHFDIASVAQHVCLSPSRLSHLFRQQLGIS
FT                   VLSWREDQRISQAKLLLSTTRMPIASVGRNVGFDDQLYFSRVFKKCTGASPSEFRAGCE
FT                   "
FT   gene            124179..124946
FT                   /locus_tag="SeAg_B0116"
FT   CDS_pept        124179..124946
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0116"
FT                   /product="inner membrane protein YabI"
FT                   /note="identified by match to protein family HMM PF09335"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0116"
FT                   /db_xref="EnsemblGenomes-Tr:ACH50523"
FT                   /db_xref="GOA:B5F786"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="InterPro:IPR032818"
FT                   /db_xref="UniProtKB/TrEMBL:B5F786"
FT                   /protein_id="ACH50523.1"
FT                   /translation="MQALLEHFITQSTLYSLIAVLLVAFLESLALVGLILPGTVLMAGL
FT                   GALIGSGELNFWHAWLVGIIGCLMGDWISFWLGWRFKKPLHRWSFMKKNKSLLDKTEHA
FT                   LHQHSMFTILVGRFVGPTRPLVPMVAGMLDLPVAKFIGPNLIGCLLWPPFYFLPGILAG
FT                   AAIDIPSDMQSGDFKWLLLATALLLWVGGWLCWRLWRSGKAAVDRLTAYFPRSRLLYLA
FT                   PLTLGIGVVALVVLVRHPLMPVYIDILRKVVGY"
FT   gene            complement(124985..125692)
FT                   /gene="thiQ"
FT                   /locus_tag="SeAg_B0117"
FT   CDS_pept        complement(124985..125692)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiQ"
FT                   /locus_tag="SeAg_B0117"
FT                   /product="thiamine ABC transporter, ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005;
FT                   match to protein family HMM TIGR01277"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0117"
FT                   /db_xref="EnsemblGenomes-Tr:ACH49896"
FT                   /db_xref="GOA:B5F7U0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005968"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B5F7U0"
FT                   /protein_id="ACH49896.1"
FT                   /translation="MLKLIDITWLYHHLPMRFTLAVERGEQVAILGPSGAGKSTLLNLI
FT                   AGFLAPASGTLLIAGEDHTLTPPSRRPVSMLFQENNLFSHLNVQQNIGLGLNPGLTLNA
FT                   SQREKRDAIAHQMGIESLMTRLPGELSGGQRQRVALARCLVREQPVLLLDEPFSALDPA
FT                   LRQEMLTLVSDICRERQLTLLMVSHSVEDAARIAPRSIVVADGRIAWQGKTDELLSGQA
FT                   SASALLGIKSHIL"
FT   gene            complement(125676..127286)
FT                   /gene="thiP"
FT                   /locus_tag="SeAg_B0118"
FT   CDS_pept        complement(125676..127286)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiP"
FT                   /locus_tag="SeAg_B0118"
FT                   /product="thiamine/thiamine pyrophosphate ABC transporter,
FT                   permease protein"
FT                   /note="identified by match to protein family HMM PF00528;
FT                   match to protein family HMM TIGR01253"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0118"
FT                   /db_xref="EnsemblGenomes-Tr:ACH49723"
FT                   /db_xref="GOA:B5F7U1"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR005947"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B5F7U1"
FT                   /protein_id="ACH49723.1"
FT                   /translation="MATRRQPLIPGWLIPGLCAAALMITVSLAAFLALWLNAPSGAWST
FT                   IWRDSYLWHVVRFSFWQAFLSAVLSVVPAVFLARALYRRRFPGRLALLRLCAMTLILPV
FT                   LVAVFGILSVYGRQGWLASLWQMLGLQWTFSPYGLQGILLAHVFFNLPMASRLLLQSLE
FT                   SIPGEQRQLAAQLGMRGWHFFRFVEWPWLRRQIPPVAALIFMLCFASFATVLSLGGGPQ
FT                   ATTIELAIFQALSYDYDPARAAMLALIQMVCCLALVLLSQRLSKAIAPGMTLTQGWRDP
FT                   DDRLHSRLTDALLIVLALLLLLPPLVAVVVDGVNRSLPEVLAQPILWQAVWTSLRIALA
FT                   AGVLCVVLTMMLLWSSRELRQRQQVFAGQTLELSGMLILAMPGIVLATGFFLLLNNSVG
FT                   LPESADGIVIFTNALMAIPYALKVLENPMRDITARYGMLCQSLGIEGWLRLKIVELRAL
FT                   KRPLAQALAFACVLSIGDFGVVALFGNDNFRTLPFYLYQQIGSYRSQDGAVTALILLLL
FT                   CFTLFTLIEKLPGRHAKTD"
FT   gene            complement(127262..128245)
FT                   /gene="thiB"
FT                   /locus_tag="SeAg_B0119"
FT   CDS_pept        complement(127262..128245)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiB"
FT                   /locus_tag="SeAg_B0119"
FT                   /product="thiamin/thiamin pyrophosphate ABC transporter,
FT                   periplasmic thiamin/thiamin pyrophospate-binding protein"
FT                   /note="identified by match to protein family HMM PF01547;
FT                   match to protein family HMM TIGR01254; match to protein
FT                   family HMM TIGR01276"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0119"
FT                   /db_xref="EnsemblGenomes-Tr:ACH51427"
FT                   /db_xref="GOA:B5F7U2"
FT                   /db_xref="InterPro:IPR005948"
FT                   /db_xref="InterPro:IPR005967"
FT                   /db_xref="InterPro:IPR006061"
FT                   /db_xref="UniProtKB/TrEMBL:B5F7U2"
FT                   /protein_id="ACH51427.1"
FT                   /translation="MLKKYLPLLLLCAAPAFAKPVLTVYTYDSFAADWGPGPAVKKAFE
FT                   ADCNCELKLVALEDGVSLLNRLRMEGKNSKADVVLGLDNNLLEAATQTKLFAKSGVANE
FT                   AVKVPGGWENDTFVPFDYGYFAFVYDKSKLKNPPKSLKELVESDQKWRVIYQDPRTSTP
FT                   GLGLLLWMRKVYGDNAPQAWQKLAAKTVTVTKGWSEAYGLFLKGESDLVLSYTTSPAYH
FT                   IIEEKKDNYAAANFSEGHYLQVEVAARTVASKQPELAEKFLKFMVSPAFQNAIPTGNWM
FT                   YPVADVALPAGFESLAKPATTLEFTPQQVAAQRQAWISEWQRAVSR"
FT   misc_binding    complement(128277..128376)
FT                   /bound_moiety="thiamin/thiamin pyrophosphate"
FT                   /note="TPP riboswitch (THI element)"
FT   gene            complement(128290..128409)
FT                   /locus_tag="SeAg_B0121"
FT   CDS_pept        complement(128290..128409)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0121"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0121"
FT                   /db_xref="EnsemblGenomes-Tr:ACH50985"
FT                   /db_xref="UniProtKB/TrEMBL:B5F7U3"
FT                   /protein_id="ACH50985.1"
FT                   /translation="MLPGNKITTLTPNSTGCRAHARAEKIPVEPDPDNAGEGI"
FT   gene            complement(128423..130081)
FT                   /gene="sgrR"
FT                   /locus_tag="SeAg_B0122"
FT   CDS_pept        complement(128423..130081)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sgrR"
FT                   /locus_tag="SeAg_B0122"
FT                   /product="sugar transport-related sRNA regulator SgrR"
FT                   /note="identified by match to protein family HMM PF00496"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0122"
FT                   /db_xref="EnsemblGenomes-Tr:ACH52599"
FT                   /db_xref="GOA:B5F7U4"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR023767"
FT                   /db_xref="InterPro:IPR025370"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:B5F7U4"
FT                   /protein_id="ACH52599.1"
FT                   /translation="MPSGRLQQQFIRLWQCCDGKTQDTTLNELADLLNCSRRHMRTLLN
FT                   TMQARGWLTWEAEVGRGKRSRLTFLYTGLALQQQRAEDLLEQDRIDQLVQLVGDKSAVR
FT                   QMLISHLGRSFRQGRHILRVLYYRPMHNLLPGTALRRSETHIARQIFSSLTRVNEENGE
FT                   LEADIAHHWQQISPLLWRFYLRPGIHFHHGRELEMEDVIASLTRINTLPLYSHITKIDS
FT                   PTAWTLDIHLSQPDRWLPWLLGQVPAMILPREWETLANFASHPIGTGPYAVRRNTPNQL
FT                   KILAFDDYFGYRALIDEVNVWVLPDISEEPACGLMLEGPIQGGEKAIESRLEEGCYYLL
FT                   FDARTPRGAHPQVREWVSHVLSPTNLLYHADEPLQQLWFPAYGLLPRWHHARPGPGEKP
FT                   AGLETLTLTFYREHIEHRVIARIMSALLAEHQVHLHIQEIDYDQWHAGDIESDIWLNSA
FT                   NFTLPLDFSLFAHLCEVPLLQNCIPRDWQGDAAQWRAGEMNLANWCQQLLTNKAIVPLI
FT                   HHWLIIQGQRSMRGLRMNTLGWFDFKSAWFAPPDP"
FT   gene            130149..130386
FT                   /locus_tag="SeAg_B0123"
FT   ncRNA           130149..130386
FT                   /locus_tag="SeAg_B0123"
FT                   /product="SgrS RNA"
FT                   /ncRNA_class="other"
FT   gene            130498..130611
FT                   /locus_tag="SeAg_B0125"
FT   CDS_pept        130498..130611
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0125"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0125"
FT                   /db_xref="EnsemblGenomes-Tr:ACH52196"
FT                   /db_xref="UniProtKB/TrEMBL:B5F7U5"
FT                   /protein_id="ACH52196.1"
FT                   /translation="MPEYPRHERLMSNPALDGATLIRPTGYSGNLVILHNL"
FT   gene            complement(130632..131237)
FT                   /gene="leuD"
FT                   /locus_tag="SeAg_B0126"
FT   CDS_pept        complement(130632..131237)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="leuD"
FT                   /locus_tag="SeAg_B0126"
FT                   /product="3-isopropylmalate dehydratase, small subunit"
FT                   /EC_number="4.2.1.33"
FT                   /note="identified by match to protein family HMM PF00694;
FT                   match to protein family HMM TIGR00171"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0126"
FT                   /db_xref="EnsemblGenomes-Tr:ACH49536"
FT                   /db_xref="GOA:B5F7U6"
FT                   /db_xref="InterPro:IPR000573"
FT                   /db_xref="InterPro:IPR004431"
FT                   /db_xref="InterPro:IPR015928"
FT                   /db_xref="InterPro:IPR033940"
FT                   /db_xref="UniProtKB/TrEMBL:B5F7U6"
FT                   /protein_id="ACH49536.1"
FT                   /translation="MAEKFTQHTGLVVPLDAANVDTDAIIPKQFLQKVTRTGFGAHLFN
FT                   DWRFLDEKGQQPNPEFVLNFPEYQGASILLARENFGCGSSREHAPWALTDYGFKVVIAP
FT                   SFADIFYGNSFNNQLLPVTLSDAQVDELFALVKANPGIKFEVDLEAQVVKAGDKTYSFK
FT                   IDDFRRHCMLNGLDSIGLTLQHEDAIAAYENKQPAFMR"
FT   gene            complement(131248..132648)
FT                   /gene="leuC"
FT                   /locus_tag="SeAg_B0127"
FT   CDS_pept        complement(131248..132648)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="leuC"
FT                   /locus_tag="SeAg_B0127"
FT                   /product="3-isopropylmalate dehydratase, large subunit"
FT                   /EC_number="4.2.1.33"
FT                   /note="identified by match to protein family HMM PF00330;
FT                   match to protein family HMM TIGR00170"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0127"
FT                   /db_xref="EnsemblGenomes-Tr:ACH48928"
FT                   /db_xref="GOA:B5F7U7"
FT                   /db_xref="InterPro:IPR001030"
FT                   /db_xref="InterPro:IPR004430"
FT                   /db_xref="InterPro:IPR015931"
FT                   /db_xref="InterPro:IPR018136"
FT                   /db_xref="InterPro:IPR033941"
FT                   /db_xref="InterPro:IPR036008"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5F7U7"
FT                   /protein_id="ACH48928.1"
FT                   /translation="MAKTLYEKLFDAHVVFEAPNETPLLYIDRHLVHEVTSPQAFDGLR
FT                   AHHRPVRQPGKTFATMDHNVSTQTKDINASGEMARIQMQELIKNCNEFGVELYDLNHPY
FT                   QGIVHVMGPEQGVTLPGMTIVCGDSHTATHGAFGALAFGIGTSEVEHVLATQTLKQGRA
FT                   KTMKIEVTGNAAPGITAKDIVLAIIGKTGSAGGTGHVVEFCGDAIRALSMEGRMTLCNM
FT                   AIEMGAKAGLVAPDETTFNYVKGRLHAPKGRDFDEAVEYWKTLKTDDGATFDTVVTLRA
FT                   EEIAPQVTWGTNPGQVISVTDIIPDPASFSDPVERASAEKALAYMGLQPGVPLTDVAID
FT                   KVFIGSCTNSRIEDLRAAAEVAKGRKVAPGVQALVVPGSGPVKAQAEAEGLDKIFIEAG
FT                   FEWRLPGCSMCLAMNNDRLNPGERCASTSNRNFEGRQGRGGRTHLVSPAMAAAAAVTGH
FT                   FADIRSIK"
FT   gene            complement(132651..133742)
FT                   /gene="leuB"
FT                   /locus_tag="SeAg_B0128"
FT   CDS_pept        complement(132651..133742)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="leuB"
FT                   /locus_tag="SeAg_B0128"
FT                   /product="3-isopropylmalate dehydrogenase"
FT                   /EC_number="1.1.1.85"
FT                   /note="identified by match to protein family HMM PF00180;
FT                   match to protein family HMM TIGR00169"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0128"
FT                   /db_xref="EnsemblGenomes-Tr:ACH50288"
FT                   /db_xref="GOA:B5F7U8"
FT                   /db_xref="InterPro:IPR004429"
FT                   /db_xref="InterPro:IPR019818"
FT                   /db_xref="InterPro:IPR024084"
FT                   /db_xref="UniProtKB/TrEMBL:B5F7U8"
FT                   /protein_id="ACH50288.1"
FT                   /translation="MSKNYHIAVLPGDGIGPEVMAQALKVMDAVRSRFDMRITTSRYDV
FT                   GGIAIDNHGHPLPKATVEGCEQADAILFGSVGGPKWENLPPESQPERGALLPLRKHFKL
FT                   FSNLRPAKLYQGLEAFCPLRADIAANGFDILCVRELTGGIYFGQPKGREGSGQYEKAFD
FT                   TEVYHRFEIERIARIAFESARKRRRKVTSIDKANVLQSSILWREIVNDVAKTYPDVELA
FT                   HMYIDNATMQLIKDPSQFDVLLCSNLFGDILSDECAMITGSMGMLPSASLNEQGFGLYE
FT                   PAGGSAPDIAGKNIANPIAQILSLALLLRYSLDANDAATAIEQAINRALEEGVRTGDLA
FT                   RGAAAVSTDEMGDIIARYVAEGV"
FT   gene            complement(133742..135313)
FT                   /gene="leuA"
FT                   /locus_tag="SeAg_B0129"
FT   CDS_pept        complement(133742..135313)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="leuA"
FT                   /locus_tag="SeAg_B0129"
FT                   /product="2-isopropylmalate synthase"
FT                   /EC_number="2.3.3.13"
FT                   /note="identified by match to protein family HMM PF00682;
FT                   match to protein family HMM PF08502; match to protein
FT                   family HMM TIGR00973"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0129"
FT                   /db_xref="EnsemblGenomes-Tr:ACH49674"
FT                   /db_xref="GOA:B5F7U9"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR002034"
FT                   /db_xref="InterPro:IPR005671"
FT                   /db_xref="InterPro:IPR013709"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR036230"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5F7U9"
FT                   /protein_id="ACH49674.1"
FT                   /translation="MSQQVIIFDTTLRDGEQALQASLSAKEKLQIALALERMGVDVMEV
FT                   GFPVSSPGDFESVQTIARTIKNSRVCALARCVEKDIDVAAQALKVADAFRIHTFIATSP
FT                   MHIATKLRSTLDEVIERAVYMVKRARNYTDDVEFSCEDAGRTPVDDLARVVEAAINAGA
FT                   RTINIPDTVGYTMPFEFAGIISGLYERVPNIDKAIISVHTHDDLGIAVGNSLAAVHAGA
FT                   RQVEGAMNGIGERAGNCALEEVIMAIKVRKDIMNVHTNINHHEIWRTSQTVSQICNMPI
FT                   PANKAIVGSGAFAHSSGIHQDGVLKNRENYEIMTPESIGLNQIQLNLTSRSGRAAVKHR
FT                   MEEMGYKDTDYNMDHLYDAFLKLADKKGQVFDYDLEALAFINKQQEEPEHFRLDYFSVQ
FT                   SGSSDIATASVKLACGEEIKAEAANGNGPVDAIYQAINRLTGYDVELVKYDLNAKGQGK
FT                   DALGQVDIVVNHHGRRFHGVGLATDIVESSAKAMVHVLNNIWRAAEVEKELQRKAQNKE
FT                   NNKETV"
FT   misc_feature    complement(135354..135501)
FT                   /note="Leucine operon leader"
FT   gene            136063..137088
FT                   /locus_tag="SeAg_B0131"
FT   CDS_pept        136063..137088
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0131"
FT                   /product="probable HTH-type transcriptional regulator LeuO"
FT                   /note="identified by match to protein family HMM PF00126;
FT                   match to protein family HMM PF03466"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0131"
FT                   /db_xref="EnsemblGenomes-Tr:ACH52510"
FT                   /db_xref="GOA:B5F7V0"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B5F7V0"
FT                   /protein_id="ACH52510.1"
FT                   /translation="MHGKSYFQELFLPSARKRELSVTVELNMPEVKTEKPHLLDMGKPQ
FT                   LRMVDLNLLTVFDAVMQEQNITRAAHTLGMSQPAVSNAVARLKVMFNDELFVRYGRGIQ
FT                   PTARAFQLFGSVRQALQLVQNELPGSGFEPTSSERVFNLCVCSPLDNILTSQIYNRVEK
FT                   IAPNIHVVFKASLNQNTEHQLRYQETEFVISYEEFRRPEFTSVPLFKDEMVLVASRKHP
FT                   RISGPLLEGDVYNEQHAVVSLDRYASFSQPWYDTPDKQSSVAYQGMALISVLNVVSQTH
FT                   LVAIAPRWLAEEFAESLDLQILPLPLKLNSRTCYLSWHEAAGRDKGHQWMEDLLVSVCK
FT                   R"
FT   gene            137380..139134
FT                   /gene="ilvB"
FT                   /locus_tag="SeAg_B0132"
FT   CDS_pept        137380..139134
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ilvB"
FT                   /locus_tag="SeAg_B0132"
FT                   /product="acetolactate synthase, large subunit,
FT                   biosynthetic type"
FT                   /EC_number="2.2.1.6"
FT                   /note="identified by match to protein family HMM PF00205;
FT                   match to protein family HMM PF02775; match to protein
FT                   family HMM PF02776; match to protein family HMM TIGR00118"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0132"
FT                   /db_xref="EnsemblGenomes-Tr:ACH49926"
FT                   /db_xref="GOA:B5F7V1"
FT                   /db_xref="InterPro:IPR000399"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR012846"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR039368"
FT                   /db_xref="UniProtKB/TrEMBL:B5F7V1"
FT                   /protein_id="ACH49926.1"
FT                   /translation="MMTGIKWRQAVEMLSGAEMVVRSLIDQGVKQVFGYPGGAVLDIYD
FT                   ALHTVGGIDHVLVRHEQAAVHMADGLARATGDVGVVLVTSGPGATNAITGIATAYMDSI
FT                   PLVILSGQVATSLIGYDAFQECDMVGISRPVVKHSFLVKQTEDIPQVLKKAFWLAASGR
FT                   PGPVVVDLPKDILNPAKKMPYVWPETVSMRSYNPTTSGHKGQIKRALQTLASAKKPVVY
FT                   VGGGAISAACYVPLRHIIETFNLPVVSSLMGLGAFPATHRQSLGMLGMHGTYEANMTMH
FT                   NADVIFAVGVRFDDRTTNNLAKYCPNATVLHIDIDPTSISKTVNADIPVVGDARLVLEQ
FT                   MLELLAQDAPSQPQDDIRDWWQQIESWRARQCLKYDAESESIKPQAVIETLWRLTKGDA
FT                   YVTSDVGQHQMFAALYYPFDKPRRWINSGGLGTMGFGLPAALGVKMALPKEMVVCVTGD
FT                   GSIQMNIQELSTALQYELPVLVLNLNNRYLGMVKQWQDMIYSGRHSQSYMQSLPDFVRL
FT                   AEAYGHVGLQINRPDELESKLSEALEHVRNNRLVFVDVTVDGSEHVYPMQIRGGGMDEM
FT                   WLSKTERT"
FT   gene            139134..139628
FT                   /gene="ilvH"
FT                   /locus_tag="SeAg_B0133"
FT   CDS_pept        139134..139628
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ilvH"
FT                   /locus_tag="SeAg_B0133"
FT                   /product="acetolactate synthase, small subunit, isozyme
FT                   III"
FT                   /EC_number="2.2.1.6"
FT                   /note="identified by match to protein family HMM PF01842;
FT                   match to protein family HMM TIGR00119"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0133"
FT                   /db_xref="EnsemblGenomes-Tr:ACH49152"
FT                   /db_xref="GOA:B5F7V2"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR004789"
FT                   /db_xref="InterPro:IPR019455"
FT                   /db_xref="InterPro:IPR027271"
FT                   /db_xref="InterPro:IPR039557"
FT                   /db_xref="UniProtKB/TrEMBL:B5F7V2"
FT                   /protein_id="ACH49152.1"
FT                   /translation="MMRRILSVLLENESGALSRVIGLFSQRGYNIESLTVAPTDDPTLS
FT                   RMTIQTVGDEKVLEQIEKQLHKLVDVLRVSELGQGAHVEREIMLVKIQASGYGREEVKR
FT                   NTEIFRGQIIDVTPTLYTVQLAGTSDKLDAFLASLRDVAKIVEVARSGVVGLSRGDKIM
FT                   R"
FT   gene            complement(139618..139740)
FT                   /locus_tag="SeAg_B0134"
FT   CDS_pept        complement(139618..139740)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0134"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0134"
FT                   /db_xref="EnsemblGenomes-Tr:ACH49262"
FT                   /db_xref="UniProtKB/TrEMBL:B5F7V3"
FT                   /protein_id="ACH49262.1"
FT                   /translation="MADIRQTCLMALRLSDLGQISACRPDKTHARRHPANLLSA"
FT   gene            139912..140916
FT                   /gene="fruR"
FT                   /locus_tag="SeAg_B0135"
FT   CDS_pept        139912..140916
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fruR"
FT                   /locus_tag="SeAg_B0135"
FT                   /product="fructose repressor"
FT                   /note="identified by match to protein family HMM PF00356;
FT                   match to protein family HMM PF00532; match to protein
FT                   family HMM TIGR02417"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0135"
FT                   /db_xref="EnsemblGenomes-Tr:ACH48580"
FT                   /db_xref="GOA:B5F7V4"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR001761"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR012781"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:B5F7V4"
FT                   /protein_id="ACH48580.1"
FT                   /translation="MKLDEIARLAGVSRTTASYVINGKAKQYRVSDKTVEKVMAVVREH
FT                   NYHPNAVAAGLRAGRTRSIGLVIPDLENTSYTRIANYLERQARQRGYQLLIACSEDQPD
FT                   NEMRCIEHLLQRQVDAIIVSTSLPPEHPFYQRWANDPFPIVALDRALDREHFTSVVGAD
FT                   QDDAEMLAEELRKFPAETVLYLGALPELSVSFLREQGFRTAWKDDPREVNFLYANSYER
FT                   EAAAQLFEKWLETHPMPQALFTTSFALLQGVMDVTLRRDGKLPSDLAIATFGDHELLDF
FT                   LQCPVLAVAQRHRDVAERVLEIVLASLDEPRKPKPGLTRIRRNLYRRGILSRS"
FT   gene            141522..141980
FT                   /gene="mraZ"
FT                   /locus_tag="SeAg_B0136"
FT   CDS_pept        141522..141980
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mraZ"
FT                   /locus_tag="SeAg_B0136"
FT                   /product="mraZ protein"
FT                   /note="identified by match to protein family HMM PF02381;
FT                   match to protein family HMM TIGR00242"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0136"
FT                   /db_xref="EnsemblGenomes-Tr:ACH50445"
FT                   /db_xref="GOA:B5F7V5"
FT                   /db_xref="InterPro:IPR003444"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR020603"
FT                   /db_xref="InterPro:IPR035642"
FT                   /db_xref="InterPro:IPR035644"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="InterPro:IPR038619"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5F7V5"
FT                   /protein_id="ACH50445.1"
FT                   /translation="MFRGATLVNLDSKGRLTVPTRYREQLIESATGQMVCTIDIHHPCL
FT                   LLYPLPEWEIIEQKLSRLSSMNPVERRVQRLLLGHASECQMDGAGRLLIAPVLRQHAGL
FT                   TKEVMLVGQFNKFELWDETTWYQQVKEDIDAEQSATETLSERLQDLSL"
FT   gene            141982..142923
FT                   /gene="mraW"
FT                   /locus_tag="SeAg_B0137"
FT   CDS_pept        141982..142923
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mraW"
FT                   /locus_tag="SeAg_B0137"
FT                   /product="S-adenosyl-methyltransferase MraW"
FT                   /EC_number="2.1.1.-"
FT                   /note="identified by match to protein family HMM PF01795;
FT                   match to protein family HMM TIGR00006"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0137"
FT                   /db_xref="EnsemblGenomes-Tr:ACH49787"
FT                   /db_xref="GOA:B5F7V6"
FT                   /db_xref="InterPro:IPR002903"
FT                   /db_xref="InterPro:IPR023397"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5F7V6"
FT                   /protein_id="ACH49787.1"
FT                   /translation="MMENFKHTTVLLDEAVNGLNIRPDGIYIDGTFGRGGHSRLILSQL
FT                   GEEGRLLAIDRDPQAIAVAQTINDPRFSIIHGPFSALADYVAERELTGKIDGILLDLGV
FT                   SSPQLDDAERGFSFMRDGPLDMRMDPTRGQSAAEWLQTAEEADIAWVLKTFGEERFAKR
FT                   IARAIVERNREQPMTRTKELAEVVAAATPVKDKFKHPATRTFQAVRIWVNSELEEIEQA
FT                   LKSSLSVLAPGGRLSIISFHSLEDRIVKRFMREQSRGPQVPAGLPMTEAQLKKLGGREL
FT                   RALGKLMPGEKEVAENPRARSSVLRIAERTNA"
FT   gene            142920..143285
FT                   /gene="ftsL"
FT                   /locus_tag="SeAg_B0138"
FT   CDS_pept        142920..143285
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsL"
FT                   /locus_tag="SeAg_B0138"
FT                   /product="cell division protein FtsL"
FT                   /note="identified by match to protein family HMM PF04999;
FT                   match to protein family HMM TIGR02209"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0138"
FT                   /db_xref="EnsemblGenomes-Tr:ACH51673"
FT                   /db_xref="GOA:B5F7V7"
FT                   /db_xref="InterPro:IPR011922"
FT                   /db_xref="UniProtKB/TrEMBL:B5F7V7"
FT                   /protein_id="ACH51673.1"
FT                   /translation="MISRVTEALSKVKGSIGSNERHALPGVIGDDLLRFGKLPLCLFIC
FT                   IILTAVTVVTTAHHTRLLTAQREQLVLERDALDIEWRNLILEENALGDHSRVERIATEK
FT                   LQMQHVDPSQENIVVQK"
FT   gene            143301..145067
FT                   /gene="ftsI"
FT                   /locus_tag="SeAg_B0139"
FT   CDS_pept        143301..145067
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsI"
FT                   /locus_tag="SeAg_B0139"
FT                   /product="peptidoglycan synthetase FtsI"
FT                   /EC_number="2.4.1.129"
FT                   /note="identified by match to protein family HMM PF00905;
FT                   match to protein family HMM PF03717"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0139"
FT                   /db_xref="EnsemblGenomes-Tr:ACH51086"
FT                   /db_xref="GOA:B5F7V8"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR005311"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR036138"
FT                   /db_xref="InterPro:IPR037532"
FT                   /db_xref="UniProtKB/TrEMBL:B5F7V8"
FT                   /protein_id="ACH51086.1"
FT                   /translation="MKAAAKTQKSKRQEEQTNFISWRFALLCGCILLALVFLLGRAAWL
FT                   QIIAPDMLVRQGDMRSLRVQEVSTSRGMITDRSGRPLAVSVPVKAIWADPKEVHDAGGI
FT                   SVGDRWKALSTALNIPLDQLSARINANPKGRFIYLARQVNPDMADYIKKLKLPGIHLRE
FT                   ESRRYYPSGEVTAHLIGFTNVDSQGIEGVEKSFDKWLTGQPGERIVRKDRYGRVIEDIS
FT                   STDSQAAHNLALSIDERLQALVYRELNNAVAFNKAESGSAVLVDVNTGEVLAMANSPSY
FT                   NPNNLAGTPKDAMRNRTITDVFEPGSTVKPMVVMTALQRGIVNENTVLNTVPYRINGHE
FT                   IKDVARYSELTLTGVLQKSSNVGVSKLALAMPSSALVDTYSRFGLGKATNLGLVGERSG
FT                   LYPQKQRWSDIERATFSFGYGLMVTPLQLARVYATIGSYGIYRPLSITKVDPPVPGERI
FT                   FPESTVRTVVHMMESVALPGGGGVKAAIKGYRIAIKTGTAKKVGPDGRYINKYIAYTAG
FT                   VAPASQPRFALVVVINDPQAGKYYGGAVSAPVFGAIMGGVLRTMNIEPDALATGEKNEF
FT                   VINQGEGTGGRS"
FT   gene            145054..146541
FT                   /gene="murE"
FT                   /locus_tag="SeAg_B0140"
FT   CDS_pept        145054..146541
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murE"
FT                   /locus_tag="SeAg_B0140"
FT                   /product="UDP-N-acetylmuramoylalanyl-D-glutamate--2,
FT                   6-diaminopimelate ligase"
FT                   /EC_number="6.3.2.13"
FT                   /note="identified by match to protein family HMM PF01225;
FT                   match to protein family HMM PF02875; match to protein
FT                   family HMM PF08245; match to protein family HMM TIGR01085"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0140"
FT                   /db_xref="EnsemblGenomes-Tr:ACH53014"
FT                   /db_xref="GOA:B5F7V9"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005761"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR035911"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:B5F7V9"
FT                   /protein_id="ACH53014.1"
FT                   /translation="MADRNLRDLLAPWVAGLPARELREMTLDSRVAAAGDLFVAVVGHQ
FT                   ADGRRYIPQAIAQGVAAIIAEAKDEASDGEIREMHGVPVVYLSQLNERLSALAGRFYHE
FT                   PSENMRLVAVTGTNGKTTTTQLLAQWSQLLGETSAVMGTVGNGLLGKVIPTENTTGSAV
FT                   DVQHVLANLVAQGATFGAMEVSSHGLVQHRVAALKFAASVFTNLSRDHLDYHGDMAHYE
FT                   AAKWMLYSTHHHGQAIVNADDEVGRRWLASLPDAVAVSMEGHINPNCHGRWLKAEAVEY
FT                   HDRGATIRFASSWGEGEIESRLMGAFNVSNLLLALATLLALGYPLTDLLKTAARLQPVC
FT                   GRMEVFTAPGKPTVVVDYAHTPDALEKALQAARLHCAGKLWCVFGCGGDRDKGKRPLMG
FT                   AIAEEFADIVVVTDDNPRTEEPRAIINDILAGMLDAGQVRVMEGRAEAVTNAIMQAKDN
FT                   DVVLIAGKGHEDYQIVGTQRLDYSDRVTAARLLGVIA"
FT   gene            146538..147896
FT                   /gene="murF"
FT                   /locus_tag="SeAg_B0141"
FT   CDS_pept        146538..147896
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murF"
FT                   /locus_tag="SeAg_B0141"
FT                   /product="UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D-alanine
FT                   ligase"
FT                   /EC_number="6.3.2.10"
FT                   /note="identified by match to protein family HMM PF01225;
FT                   match to protein family HMM PF02875; match to protein
FT                   family HMM PF08245; match to protein family HMM TIGR01143"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0141"
FT                   /db_xref="EnsemblGenomes-Tr:ACH52561"
FT                   /db_xref="GOA:B5F7W0"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005863"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR035911"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:B5F7W0"
FT                   /protein_id="ACH52561.1"
FT                   /translation="MISVTLSKIADVLGAEHRGADLTLDTVITDTRKVTPGCLFVALKG
FT                   ERFDAHDFADKAKANGAGALLVSRPLDIDLPQVIVKDTRQAFGQLAAWVRMQVPARVVA
FT                   LTGSSGKTSVKEMTAAILSQCGNTLYTAGNFNNDIGVPITLLRLNHDYDYAVIELGANH
FT                   QGEIAWTVSLTRPEAALVNNLAAAHLEGFGSLAGVAKAKGEIYTGLPENGIAIMNADNN
FT                   DWLNWQSIIGDRQVWRFSPNAANSDFTAANIHVTSHGTEFTLQTPMGSIDVLLPLPGRH
FT                   NIANALAAAALSMAVGATLAAVKAGLAALKAVPGRLFPIQLSENQLVLDDAYNANVGSM
FT                   TAAVQVLSEMPGYRVLVVGDMAELGTESEACHLQVGEAAKAAGIDRVLSTGKLSQAISH
FT                   ASGVGEHFADKAALIARLHALLQEQPMMTILVKGSRSAAMEDVVHALQEKGSC"
FT   gene            147890..148972
FT                   /gene="mraY"
FT                   /locus_tag="SeAg_B0142"
FT   CDS_pept        147890..148972
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mraY"
FT                   /locus_tag="SeAg_B0142"
FT                   /product="phospho-N-acetylmuramoyl-pentapeptide-transferase"
FT                   /EC_number="2.7.8.13"
FT                   /note="identified by match to protein family HMM PF00953;
FT                   match to protein family HMM TIGR00445"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0142"
FT                   /db_xref="EnsemblGenomes-Tr:ACH49444"
FT                   /db_xref="GOA:B5F7W1"
FT                   /db_xref="InterPro:IPR000715"
FT                   /db_xref="InterPro:IPR003524"
FT                   /db_xref="InterPro:IPR018480"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5F7W1"
FT                   /protein_id="ACH49444.1"
FT                   /translation="MLVWLAEHLVKYYSGFNVFSYLTFRAIVSLLTALFISLWMGPRMI
FT                   ARLQKLSFGQVVRNDGPESHFSKRGTPTMGGIMILTAIVISVLLWAYPSNPYVWCVLVV
FT                   LIGYGIIGFVDDYRKVVRKDTKGLIARWKYFWMSVIALGVAFALYLVGKDTPATQLVVP
FT                   FFKDVMPQLGLFYILLSYFVIVGTGNAVNLTDGLDGLAIMPTVFVAAGFALVAWATGNM
FT                   NFANYLHIPYLRHAGELVIVCTAIVGAGLGFLWFNTYPAQVFMGDVGSLALGGALGIIA
FT                   VLLRQEFLLVIMGGVFVVETLSVILQVGSFKLRGQRIFRMAPIHHHYELKGWPEPRVIV
FT                   RFWIISLMLVLIGLATLKVR"
FT   gene            148975..150291
FT                   /gene="murD"
FT                   /locus_tag="SeAg_B0143"
FT   CDS_pept        148975..150291
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murD"
FT                   /locus_tag="SeAg_B0143"
FT                   /product="UDP-N-acetylmuramoylalanine--D-glutamate ligase"
FT                   /EC_number="6.3.2.9"
FT                   /note="identified by match to protein family HMM PF02875;
FT                   match to protein family HMM PF08245; match to protein
FT                   family HMM TIGR01087"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0143"
FT                   /db_xref="EnsemblGenomes-Tr:ACH49249"
FT                   /db_xref="GOA:B5F7W2"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005762"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:B5F7W2"
FT                   /protein_id="ACH49249.1"
FT                   /translation="MADYQDKNVVIIGLGLTGLSCVDFFLARGVTPRVMDTRVTPPGLD
FT                   KLPQEVERHVGGLNDEWLLAADLIVASPGIALAHPSLSAAASAGVEIVGDIELFCREAQ
FT                   APIVAITGSNGKSTVTTLVGEMAKAAGVNVGVGGNIGLPALMLLDADRELYVLELSSFQ
FT                   LETTSSLQAAAATVLNVTEDHMDRYPFGLQQYRAAKLRVYEKAKVCVVNADDALTMPVR
FT                   GADERCVSFGVNMGDYHLNRQQGETWLRVKGEKVLNVKEMKLSGQHNYTNALAALALAD
FT                   AVGLPRASSLKALTTFTGLAHRFQLALEHNGVRWINDSKATNVGSTEAALNGLHVDGTL
FT                   HLLLGGDGKSADFSPLARYLTGDRIRLYCFGRDGAQFAALRPEIAQQTETMEEAMRLLA
FT                   PRVQPGDMVLLSPACASLDQFKNFEQRGDVFTRLAKELG"
FT   gene            150291..151535
FT                   /gene="ftsW"
FT                   /locus_tag="SeAg_B0144"
FT   CDS_pept        150291..151535
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsW"
FT                   /locus_tag="SeAg_B0144"
FT                   /product="cell division protein FtsW"
FT                   /note="identified by match to protein family HMM PF01098;
FT                   match to protein family HMM TIGR02614"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0144"
FT                   /db_xref="EnsemblGenomes-Tr:ACH49287"
FT                   /db_xref="GOA:B5F7W3"
FT                   /db_xref="InterPro:IPR001182"
FT                   /db_xref="InterPro:IPR013437"
FT                   /db_xref="InterPro:IPR018365"
FT                   /db_xref="UniProtKB/TrEMBL:B5F7W3"
FT                   /protein_id="ACH49287.1"
FT                   /translation="MRLSLPRLRMPRVPGFGLLAWLFAALKGWVMASRDKDADSLIMYD
FT                   RTLLWLTFGLAAIGFVMVTSASMPVGQRLANDPFLFAKRDALYIFLAFCLAMVTLRLPM
FT                   TFWQKYSTTMLIASIIMLLIVLVVGSSVNGASRWIALGPLRIQPAEFTKLSLFCYLANY
FT                   LVRKVDEVRNNLRGFLKPMGVILVLAVLLLAQPDLGTVVVLFVTTLAMLFLAGAKLWQF
FT                   IAIIGMGISAVILLILAEPYRIRRVTSFWNPWEDPFGSGYQLTQSLMAFGRGEIWGQGL
FT                   GNSVQKLEYLPEAHTDFIFAIIGEELGYIGVVLALLMVFFVAFRAMSIGRKALEIDHRF
FT                   SGFLACSIGIWFSFQALVNVGAAAGMLPTKGLTLPLISYGGSSLLIMSTAIMFLLRIDY
FT                   ETRLEKAQAFTRGSR"
FT   gene            151532..152599
FT                   /gene="murG"
FT                   /locus_tag="SeAg_B0145"
FT   CDS_pept        151532..152599
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murG"
FT                   /locus_tag="SeAg_B0145"
FT                   /product="undecaprenyldiphospho-muramoylpentapeptide
FT                   beta-N-acetylglucosaminyltransferase"
FT                   /EC_number="2.4.1.227"
FT                   /note="identified by match to protein family HMM PF03033;
FT                   match to protein family HMM PF04101; match to protein
FT                   family HMM TIGR01133"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0145"
FT                   /db_xref="EnsemblGenomes-Tr:ACH51932"
FT                   /db_xref="GOA:B5F7W4"
FT                   /db_xref="InterPro:IPR004276"
FT                   /db_xref="InterPro:IPR006009"
FT                   /db_xref="InterPro:IPR007235"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5F7W4"
FT                   /protein_id="ACH51932.1"
FT                   /translation="MSGQPKRLMVMAGGTGGHVFPGLAVAHHLMAQGWQVRWLGTADRM
FT                   EADLVPKHGIDIDFIRISGLRGKGVKALLAAPLRIFNAWRQARAIMKRFKPDVVLGMGG
FT                   YVSGPGGLAAWSLGIPVVLHEQNGIAGLTNQWLAKIATTVMQAFPGAFPNAEVVGNPVR
FT                   TDVLALPLPQVRLAGRDGPIRVLVVGGSQGARVLNQTMPQVAARLGDTVTIWHQSGKGA
FT                   QLTVEQAYAGAGQPQHKVTEFIDDMAAAYAWADVVVCRSGALTVSEIAAAGLPAIFVPF
FT                   QHKDRQQYWNALPLENAGAAKIFEQPQFTVEAVADTLAGWSREALLTMAERARAVSIPD
FT                   ATERVASEVSRVART"
FT   gene            152718..154193
FT                   /gene="murC"
FT                   /locus_tag="SeAg_B0146"
FT   CDS_pept        152718..154193
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murC"
FT                   /locus_tag="SeAg_B0146"
FT                   /product="UDP-N-acetylmuramate--alanine ligase"
FT                   /EC_number="6.3.2.8"
FT                   /note="identified by match to protein family HMM PF01225;
FT                   match to protein family HMM PF02875; match to protein
FT                   family HMM PF08245; match to protein family HMM TIGR01082"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0146"
FT                   /db_xref="EnsemblGenomes-Tr:ACH48746"
FT                   /db_xref="GOA:B5F7W5"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005758"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5F7W5"
FT                   /protein_id="ACH48746.1"
FT                   /translation="MNTQQLAKLRSIVPEMRRVRHIHFVGIGGAGMGGIAEVLANEGYQ
FT                   ISGSDLAPNPVTQQLTSLGATIFFNHRPENVRDASVVVVSSAISADNPEIVAAHEARIP
FT                   VIRRAEMLAELMRFRHGIAIAGTHGKTTTTAMVSSIYAEAGLDPTFVNGGLVKAAGVHA
FT                   RLGHSRYLIAEADESDASFLHLQPMVAIVTNIEADHMDTYHGDFENLKQTFINFLHNLP
FT                   FYGRAVMCVDDPVIRELLPRVGRQTTTYGFSEDADVRVEDYQQIGPQGHFTLLRQGMPD
FT                   LHVTLNAPGRHNALNAAAAVAVATEEGIDDDAILRALESFQGTGRRFDFLGEFPLEPVN
FT                   GKAGTAMLVDDYGHHPTEVDATIKAARAGWPDKNLVMLFQPHRYTRTRDLYDDFANVLT
FT                   QVDALLMLDVYPAGEAPIPGADSRSLCRTIRNRGKIDPILVSDPAQVATMLAPVLTGND
FT                   LILVQGAGNVGKIARYLSEIKLKPQIQEEEQHG"
FT   gene            154186..155106
FT                   /gene="ddlB"
FT                   /locus_tag="SeAg_B0147"
FT   CDS_pept        154186..155106
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ddlB"
FT                   /locus_tag="SeAg_B0147"
FT                   /product="D-alanine--D-alanine ligase B"
FT                   /EC_number="6.3.2.4"
FT                   /note="identified by match to protein family HMM PF01820;
FT                   match to protein family HMM PF07478; match to protein
FT                   family HMM TIGR01205"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0147"
FT                   /db_xref="EnsemblGenomes-Tr:ACH48649"
FT                   /db_xref="GOA:B5F7W6"
FT                   /db_xref="InterPro:IPR000291"
FT                   /db_xref="InterPro:IPR005905"
FT                   /db_xref="InterPro:IPR011095"
FT                   /db_xref="InterPro:IPR011127"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:B5F7W6"
FT                   /protein_id="ACH48649.1"
FT                   /translation="MADKIAVLLGGTSAERDVSLNSGAAVLAGLREGGIDAYPVDPQEV
FT                   DVAQLKAMGFQKVFIALHGRGGEDGTLQGMLELLGLPYTGSGVMASALSMDKLRSKLLW
FT                   QGAGLPVAPWVALTRAEFEKGLSEEQKARISALGLPLIVKPSREGSSVGMTKVVEENAL
FT                   QGALSLAFQHDDEILIEKWLCGPEFTVAIVGEEILPSIRIQPAGTFYDYEAKYLSDETQ
FT                   YFCPAGLEASQEAALQSLVLQAWKALGCTGWGRIDVMLDSDGQFYLLEANTSPGMTSHS
FT                   LVPMAARQAGMSFSQLVVRILELAD"
FT   gene            155108..155938
FT                   /gene="ftsQ"
FT                   /locus_tag="SeAg_B0148"
FT   CDS_pept        155108..155938
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsQ"
FT                   /locus_tag="SeAg_B0148"
FT                   /product="cell division protein FtsQ"
FT                   /note="identified by match to protein family HMM PF03799;
FT                   match to protein family HMM PF08478"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0148"
FT                   /db_xref="EnsemblGenomes-Tr:ACH50104"
FT                   /db_xref="GOA:B5F7W7"
FT                   /db_xref="InterPro:IPR005548"
FT                   /db_xref="InterPro:IPR013685"
FT                   /db_xref="InterPro:IPR026579"
FT                   /db_xref="InterPro:IPR034746"
FT                   /db_xref="UniProtKB/TrEMBL:B5F7W7"
FT                   /protein_id="ACH50104.1"
FT                   /translation="MSQAALNTRNSDEETPSSRRNNGTRLAGILFLLTVLCTVFVSGWV
FT                   VLGWMEDAQRLPLSKLVLTGERHYTRNDDIRQAILALGAPGTFMTQDVNIIQSQIERLP
FT                   WIKQASVRKQWPDELKIHLVEYVPIARWNDQHMVDAEGNTFSVPSDRIGKQVLPMLYGP
FT                   EGSASEVLQGYREMGQVLAKDKFTLKEAAMTARRSWQLTLNNGIKLNLGRGDTMKRLAR
FT                   FVELYPVLQQQAQTDGKRISYVDLRYDSGAAVGWAPLPPEESNQQQNQAQAEQQ"
FT   gene            155935..157197
FT                   /gene="ftsA"
FT                   /locus_tag="SeAg_B0149"
FT   CDS_pept        155935..157197
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsA"
FT                   /locus_tag="SeAg_B0149"
FT                   /product="cell division protein FtsA"
FT                   /note="identified by match to protein family HMM PF02491;
FT                   match to protein family HMM TIGR01174"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0149"
FT                   /db_xref="EnsemblGenomes-Tr:ACH50742"
FT                   /db_xref="GOA:B5F7W8"
FT                   /db_xref="InterPro:IPR003494"
FT                   /db_xref="InterPro:IPR020823"
FT                   /db_xref="UniProtKB/TrEMBL:B5F7W8"
FT                   /protein_id="ACH50742.1"
FT                   /translation="MIKATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRG
FT                   MDKGGVNDLESVVKCVQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEV
FT                   TQEDVENVVHTAKSVRVRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITC
FT                   HNDMAKNIVKAVERCGLKVDQLIFAGLAASYSVLTEDERELGVCVVDIGGGTMDIAVYT
FT                   GGALRHTKVIPYAGNVVTSDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVG
FT                   GRPPRSLQRQTLAEVIEPRYTELLNLVNEEILQLQEQLRQQGVKHHLAAGIVLTGGAAQ
FT                   IEGLAACAQRVFHTQVRIGAPLNITGLTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEK
FT                   RVTASVGSWIKRLNSWLRKEF"
FT   gene            157258..158409
FT                   /gene="ftsZ"
FT                   /locus_tag="SeAg_B0150"
FT   CDS_pept        157258..158409
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsZ"
FT                   /locus_tag="SeAg_B0150"
FT                   /product="cell division protein FtsZ"
FT                   /note="identified by match to protein family HMM PF00091;
FT                   match to protein family HMM PF03953; match to protein
FT                   family HMM TIGR00065"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0150"
FT                   /db_xref="EnsemblGenomes-Tr:ACH50820"
FT                   /db_xref="GOA:B5F7W9"
FT                   /db_xref="InterPro:IPR000158"
FT                   /db_xref="InterPro:IPR003008"
FT                   /db_xref="InterPro:IPR008280"
FT                   /db_xref="InterPro:IPR018316"
FT                   /db_xref="InterPro:IPR020805"
FT                   /db_xref="InterPro:IPR024757"
FT                   /db_xref="InterPro:IPR036525"
FT                   /db_xref="UniProtKB/TrEMBL:B5F7W9"
FT                   /protein_id="ACH50820.1"
FT                   /translation="MFEPMELTNDAVIKVIGVGGGGGNAVEHMVRERIEGVEFFAVNTD
FT                   AQALRKTAVGQTIQIGSGITKGLGAGANPEVGRNAADEDREALRAALEGADMVFIAAGM
FT                   GGGTGTGAAPVVAEVAKDLGILTVAVVTKPFNFEGKKRMAFAEQGITELSKHVDSLITI
FT                   PNDKLLKVLGRGISLLDAFGAANDVLKGAVQGIAELITRPGLMNVDFADVRTVMSEMGY
FT                   AMMGSGVASGEDRAEEAAEMAISSPLLEDIDLSGARGVLVNITAGFDLRLDEFETVGNT
FT                   IRAFASDNATVVIGTSLDPDMNDELRVTVVATGIGMDKRPEITLVTNKQVQQPVLDRYQ
FT                   QHGMAPLTQEQKTVAKVVNDNTPQAAKEPDYLDIPAFLRKQAD"
FT   gene            158510..159427
FT                   /gene="lpxC"
FT                   /locus_tag="SeAg_B0151"
FT   CDS_pept        158510..159427
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lpxC"
FT                   /locus_tag="SeAg_B0151"
FT                   /product="UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine
FT                   deacetylase"
FT                   /EC_number="3.5.1.-"
FT                   /note="identified by match to protein family HMM PF03331;
FT                   match to protein family HMM TIGR00325"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0151"
FT                   /db_xref="EnsemblGenomes-Tr:ACH50944"
FT                   /db_xref="GOA:B5F7X0"
FT                   /db_xref="InterPro:IPR004463"
FT                   /db_xref="InterPro:IPR011334"
FT                   /db_xref="InterPro:IPR015870"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5F7X0"
FT                   /protein_id="ACH50944.1"
FT                   /translation="MIKQRTLKRIVQATGVGLHTGKKVTLTLRPAPANTGVIYRRTDLN
FT                   PPVDFPADAKSVRDTMLCTCLVNEHDVRISTVEHLNAALAGLGIDNIVIEVNAPEIPIM
FT                   DGSAAPFVYLLLDAGIDELNCAKKFVRIKETVRVEDGDKWAEFRPYNGFTLDFTIDFNH
FT                   PAIDSSSQRYAMNFSADAFMRQISRARTFGFMRDIEYLQSRGLCLGGSFDCAIVVDDYR
FT                   VLNEDGLRFEDEFVRHKMLDAIGDLFMCGHNIIGAFTAYKSGHALNNKLLQAVLAKQEA
FT                   WEFVTFQDDAELPLAFKAPSTVLA"
FT   gene            159706..160203
FT                   /pseudo
FT                   /gene="secM"
FT                   /locus_tag="SeAg_B0152"
FT                   /note="secretion monitor protein; this gene contains a
FT                   frame shift which may be the result of sequencing error;
FT                   identified by match to protein family HMM PF06558"
FT   gene            160265..162970
FT                   /gene="secA"
FT                   /locus_tag="SeAg_B0153"
FT   CDS_pept        160265..162970
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secA"
FT                   /locus_tag="SeAg_B0153"
FT                   /product="preprotein translocase, SecA subunit"
FT                   /note="identified by match to protein family HMM PF01043;
FT                   match to protein family HMM PF02810; match to protein
FT                   family HMM PF07516; match to protein family HMM PF07517;
FT                   match to protein family HMM TIGR00963"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0153"
FT                   /db_xref="EnsemblGenomes-Tr:ACH49957"
FT                   /db_xref="GOA:B5F7X1"
FT                   /db_xref="InterPro:IPR000185"
FT                   /db_xref="InterPro:IPR004027"
FT                   /db_xref="InterPro:IPR011115"
FT                   /db_xref="InterPro:IPR011116"
FT                   /db_xref="InterPro:IPR011130"
FT                   /db_xref="InterPro:IPR014018"
FT                   /db_xref="InterPro:IPR020937"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036266"
FT                   /db_xref="InterPro:IPR036670"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5F7X1"
FT                   /protein_id="ACH49957.1"
FT                   /translation="MLIKLLTKVFGSRNDRTLRRMRKAVSLINAMEPEMEKLSDDELKA
FT                   KTNEFRARIEKGESVESLIPEAFAVVREASKRVFGMRHFDVQLLGGMVLNDRCIAEMRT
FT                   GEGKTLTATLPAYLNALSGKGVHVVTVNDYLAQRDAENNRPLFEFLGMSVGINLPGMPA
FT                   PAKREAYAADITYGTNNEYGFDYLRDNMAFSPEERVQRKLHYALVDEVDSILIDEARTP
FT                   LIISGPAEDSSEMYKKVNKIIPHLIRQEKEDSDTFQGEGHFSVDEKARQVNLTERGLVL
FT                   IEELLVQEGIMDEGESLYSPGNIMLMHHVTAALRAHALFTRDVDYIVKDGEVIIVDEHT
FT                   GRTMQGRRWSDGLHQAVEAKEGVEIQNENQTLASITFQNYFRLYEKLAGMTGTADTEAF
FT                   EFSSIYKLDTVVVPTNRPMIRKDLPDLVYMTEAEKIQAIIEDIKERTANGQPVLVGTIS
FT                   IEKSEVVSRELTKAGIKHNVLNAKFHANEAGIVAQAGYPAAVTIATNMAGRGTDIMLGG
FT                   SWQAEVAALEAPTEEQIAQIKADWQVRHDAVLAAGGLHIIGTERHESRRIDNQLRGRSG
FT                   RQGDPGSSRFYLSMEDALMRIFASDRVSGMMRKLGMKPGEAIEHPWVTKAIANAQRKVE
FT                   SRNFDIRKQLLEYDDVANDQRRAIYTQRNELLDVSDVSDTINSIREDVFKATIDAYIPP
FT                   QSLEEMWDIPGLQERLKNDFDLEMPIAEWLDKEPELHEETLRERILAQSIEVYQRKEEV
FT                   VGAEMMRHFEKGVMLQTLDSLWKEHLAAMDYLRQGIHLRGYAQKDPKQEYKRESFAMFA
FT                   AMLESLKYEVISTLSKVQVRMPEEVEAMEMQRREEAERLAQMQQLSHQDDDAAVAADLA
FT                   AQTGERKIGRNDPCPCGSGKKYKQCHGRLS"
FT   gene            163122..163517
FT                   /locus_tag="SeAg_B0154"
FT   CDS_pept        163122..163517
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0154"
FT                   /product="mutator MutT protein"
FT                   /EC_number="3.6.1.-"
FT                   /note="identified by match to protein family HMM PF00293;
FT                   match to protein family HMM TIGR00586"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0154"
FT                   /db_xref="EnsemblGenomes-Tr:ACH51771"
FT                   /db_xref="GOA:B5F7X2"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR003561"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="UniProtKB/TrEMBL:B5F7X2"
FT                   /protein_id="ACH51771.1"
FT                   /translation="MKKLQIAVGIIRNPNDEIFITRRAADAHMANKLEFPGGKIEADET
FT                   PEQALIRELQEEVGITPTQVTLFDTLEYQFPDRHITLWFWLVERWEGEPWGKEGQPGRW
FT                   IAQNALNTEDFPPANEPIIRKLRQFAS"
FT   gene            complement(163551..164540)
FT                   /locus_tag="SeAg_B0155"
FT   CDS_pept        complement(163551..164540)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0155"
FT                   /product="aldo-keto reductase yakc (NADP+)"
FT                   /EC_number="1.1.1.-"
FT                   /note="identified by match to protein family HMM PF00248"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0155"
FT                   /db_xref="EnsemblGenomes-Tr:ACH48878"
FT                   /db_xref="GOA:B5F7X3"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:B5F7X3"
FT                   /protein_id="ACH48878.1"
FT                   /translation="MQYRTLGANGPRVSAIGLGCMGMSAFYGAHDDSTSIKTLHYALDQ
FT                   GVTLLDTADMYGPYTNERLVGRAIADRRDRVFLATKFGIVLDPANPMARGVNGRPEYVR
FT                   RSCEQSLQRLGVDHIDLYYQHRVDPSVPIEETVGAMADLVREGKVRYLGLSEASTQTLE
FT                   RAHNVHPITALQSEYSLWSREAEISALSTCERLGIGFVAYSPLGRGFLTGTIKTPEDFA
FT                   ANDFRRTNPRFMGENFSRNLRLAEAIKQMAREKECTPAQLALAWLLARNRHIVPIPGTR
FT                   HCARVDENLGALSLILSPQELAAIEAVFPHDAAAGPRYWPEIMSTLNR"
FT   gene            164644..165567
FT                   /locus_tag="SeAg_B0156"
FT   CDS_pept        164644..165567
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0156"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="identified by match to protein family HMM PF00126;
FT                   match to protein family HMM PF03466"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0156"
FT                   /db_xref="EnsemblGenomes-Tr:ACH49028"
FT                   /db_xref="GOA:B5F7X4"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B5F7X4"
FT                   /protein_id="ACH49028.1"
FT                   /translation="MRHDVMSILHAFCMIAENHSFTRAAAQLHISTSALSQNMRQLEDE
FT                   LGVKLLNRTTRRVGLTEAGHAFLASIRPALNHIDEAMEHARQSRDIPGGTLRLTVPRTA
FT                   ATLLLQPNLAGFMRDYPDIRLDIDVNDGFVDLINERFDAGIRFGDAVQLDMNVVPLGDV
FT                   LRPAIVASPAYLARFGTPLHPQELINHRCLCHRFTRESGLYRWEFVHGAQRLEITPEAA
FT                   LMVNDKALRLSAARDGAGLTYVFEQDVHEDLQDGRLCSVLEEWLPAADRFYLYYPGRAH
FT                   MAPKLRVFIDYFCHKAILPSQQSHHC"
FT   gene            complement(165564..165755)
FT                   /locus_tag="SeAg_B0157"
FT   CDS_pept        complement(165564..165755)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0157"
FT                   /product="zinc-binding protein YacG"
FT                   /note="identified by match to protein family HMM PF03884"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0157"
FT                   /db_xref="EnsemblGenomes-Tr:ACH49695"
FT                   /db_xref="GOA:B5F7X5"
FT                   /db_xref="InterPro:IPR005584"
FT                   /db_xref="InterPro:IPR013088"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5F7X5"
FT                   /protein_id="ACH49695.1"
FT                   /translation="MSDVTVVNCPTCGKPVVWGEISPFRPFCSKRCQLIDLGEWAAEEK
FT                   RIASSGDQSDSDDWSEER"
FT   gene            complement(165765..166508)
FT                   /locus_tag="SeAg_B0158"
FT   CDS_pept        complement(165765..166508)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0158"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF07072"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0158"
FT                   /db_xref="EnsemblGenomes-Tr:ACH48689"
FT                   /db_xref="GOA:B5F7X6"
FT                   /db_xref="InterPro:IPR009777"
FT                   /db_xref="InterPro:IPR027462"
FT                   /db_xref="InterPro:IPR036268"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5F7X6"
FT                   /protein_id="ACH48689.1"
FT                   /translation="MHTQVLFEHPLNEKMRTWLRIEFLIQQLSINLPIADHAGALHFFR
FT                   NISDLLDVFERGEVRTELLKELERQQRKLQAWVEVPGVDQDRIEALRQQLKSAGSVLIS
FT                   APRIGQQLREDRLIALVRQRLSIPGGCCSFDLPTLHIWLHLQQAQRDAQIESWLASLNP
FT                   LTQALTLVLDLIRNSAPFRKQTSLNGFYQDNGDDADLLRLMLMLDSQLYPQISGHKSRF
FT                   AIRFMPLDSENGLVPERLDFELACC"
FT   gene            complement(166508..167128)
FT                   /gene="coaE"
FT                   /locus_tag="SeAg_B0160"
FT   CDS_pept        complement(166508..167128)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="coaE"
FT                   /locus_tag="SeAg_B0160"
FT                   /product="dephospho-CoA kinase"
FT                   /EC_number="2.7.1.24"
FT                   /note="identified by match to protein family HMM PF01121;
FT                   match to protein family HMM TIGR00152"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0160"
FT                   /db_xref="EnsemblGenomes-Tr:ACH52846"
FT                   /db_xref="GOA:B5F7X7"
FT                   /db_xref="InterPro:IPR001977"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B5F7X7"
FT                   /protein_id="ACH52846.1"
FT                   /translation="MRYTVALTGGIGSGKSTVADAFADLGITVIDADIIARQMVEPGQP
FT                   ALNAIAEHFGSELIAADGTLRRRALRERIFSHPEEKAWLNALLHPLIQQETQRQFQQAT
FT                   SPYVLWVVPLLVENRLYQKANRVLVVDVTPETQLIRTMQRDDVTREHVEHILAAQATRE
FT                   ARLAVADDVIDNNGAPDAIASDVARLHASYLKLASQFVSQEKP"
FT   gene            167354..168397
FT                   /gene="guaC"
FT                   /locus_tag="SeAg_B0161"
FT   CDS_pept        167354..168397
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="guaC"
FT                   /locus_tag="SeAg_B0161"
FT                   /product="guanosine monophosphate reductase"
FT                   /EC_number="1.7.1.7"
FT                   /note="identified by match to protein family HMM PF00478;
FT                   match to protein family HMM TIGR01305"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0161"
FT                   /db_xref="EnsemblGenomes-Tr:ACH52013"
FT                   /db_xref="GOA:B5F7X8"
FT                   /db_xref="InterPro:IPR001093"
FT                   /db_xref="InterPro:IPR005993"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR015875"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5F7X8"
FT                   /protein_id="ACH52013.1"
FT                   /translation="MRIEEDLKLGFKDVLIRPKRSTLKSRSDVELERQFTFKHSGQTWS
FT                   GVPIIAANMDTVGTFEMAQALAGFDILTAVHKHYTVEEWAAFINTASADVLKHVMVSTG
FT                   TSDADFEKTVQILALNPALNFVCIDVANGYSEHFVQFVAKAREAWPTKTICAGNVVTGE
FT                   MCEELILSGADIVKVGIGPGSVCTTRVKTGVGYPQLSAVIECADAAHGLGGMIVSDGGC
FT                   TMPGDVAKAFGGGADFVMLGGMLAGHEESGGSVVEENGEKFMLFYGMSSESAMNRHVGG
FT                   VAKYRAAEGKTVKLPLRGPVGNTARDILGGLRSACTYVGASRLKELTKRTTFIRVQEQE
FT                   NRIFNSL"
FT   gene            complement(168428..169630)
FT                   /locus_tag="SeAg_B0162"
FT   CDS_pept        complement(168428..169630)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0162"
FT                   /product="protein transport protein HofC"
FT                   /note="identified by match to protein family HMM PF00482"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0162"
FT                   /db_xref="EnsemblGenomes-Tr:ACH51602"
FT                   /db_xref="GOA:B5F7X9"
FT                   /db_xref="InterPro:IPR003004"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="InterPro:IPR042094"
FT                   /db_xref="UniProtKB/TrEMBL:B5F7X9"
FT                   /protein_id="ACH51602.1"
FT                   /translation="MSVKQLWRWQGVNDKGQLEQDVVWADNRLALIITLQHQRIMPLRI
FT                   KRMGVNAALWKEEQSAEIIHQLATLIHAGLTLSEGLELLAKQHPHRQWQALLRTLAHEL
FT                   EQGVPFSSALVSWPQVFPPLYQTMIRTGELTGKLAECCFELARQQKAQRQITVSVKKAL
FT                   RYPVIILTMAALVVFAMLHFVLPEFAAIYRSFNTPLPLLTRGIIAIAQWGSTWGWLILF
FT                   LTMLIAIAHRRVKQKPSWQAQRQRLLLRLPIMGRLIRGQKLAQIFTVLALTQSAGIPFL
FT                   QGLESAIESLGCPYWSQRLTQVHQEIAAGNPVWLALKNTQEFSPLCLQLVRTGEASGSL
FT                   DIMLHNLARHHSETTLALADNLASLLEPALLIITGLIIGTLVVAMYLPIFHLGDAMSGM
FT                   G"
FT   gene            complement(169620..171005)
FT                   /locus_tag="SeAg_B0163"
FT   CDS_pept        complement(169620..171005)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0163"
FT                   /product="protein transport protein HofB"
FT                   /note="identified by match to protein family HMM PF00437"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0163"
FT                   /db_xref="EnsemblGenomes-Tr:ACH51945"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR007831"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B5F7Y0"
FT                   /protein_id="ACH51945.1"
FT                   /translation="MKDAQLNTLCQRHQAVLINSASNSITVAVVDAPSHALLDALHFAT
FT                   QKQIDIVCWTRQQMENHRHKPDQAPSTNAAKGGETAAQLLNQTLRSAMAKRSSDIHLEP
FT                   GASRYRIRLRIDGVLHILQDIAKETGLALTARLKVLGNLDIAEHRLPQDGQFTVDLTGD
FT                   SISFRIATLPCKEGEKVVLRLLHQVEQTLDLDTLGMYGAQLTAFRQALQQPQGLVLVTG
FT                   PTGSGKTVTLYSALQTRNTPDINLCSVEDPIEIPLDGINQTQIHPRAGLTFQNVLRALL
FT                   RQDPDIIMVGEIRDGDTAEIAIKAAQTGHLVLSTLHTNSTSETLIRLQQMGVARWMISS
FT                   ALTLVVAQRLVRKLCPHCKQRLSDPVVLSPNLWPSALPRWQASGCQHCYHGFYGRTALF
FT                   EVLTVTPALRQLIASGASAQALEAHLQQTGTGTLFENGCHAVEQGMTSFEEILRVLGMP
FT                   HER"
FT   gene            complement(171015..171452)
FT                   /locus_tag="SeAg_B0164"
FT   CDS_pept        complement(171015..171452)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0164"
FT                   /product="prepilin peptidase dependent protein D"
FT                   /note="identified by match to protein family HMM PF07963;
FT                   match to protein family HMM TIGR02532"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0164"
FT                   /db_xref="EnsemblGenomes-Tr:ACH52831"
FT                   /db_xref="GOA:B5F7Y1"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:B5F7Y1"
FT                   /protein_id="ACH52831.1"
FT                   /translation="MEKQRGFTLIELMVVIGIIAILSAIGIPAYQNYLRKAALTDMLQT
FT                   FVPYRTAVELCALEHGGTNTCDAGVNGIPSPVITRYVSGMSVEKGVITLTGQESLSGLS
FT                   VIMTPAWDNANGITGWARNCNIQSDSALQQACEDVFRFDAN"
FT   gene            complement(171674..172609)
FT                   /gene="nadC"
FT                   /locus_tag="SeAg_B0165"
FT   CDS_pept        complement(171674..172609)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nadC"
FT                   /locus_tag="SeAg_B0165"
FT                   /product="nicotinate-nucleotide diphosphorylase"
FT                   /EC_number="2.4.2.19"
FT                   /note="identified by match to protein family HMM PF01729;
FT                   match to protein family HMM PF02749; match to protein
FT                   family HMM TIGR00078"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0165"
FT                   /db_xref="EnsemblGenomes-Tr:ACH48787"
FT                   /db_xref="GOA:B5F7Y2"
FT                   /db_xref="InterPro:IPR002638"
FT                   /db_xref="InterPro:IPR004393"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022412"
FT                   /db_xref="InterPro:IPR027277"
FT                   /db_xref="InterPro:IPR036068"
FT                   /db_xref="InterPro:IPR037128"
FT                   /db_xref="UniProtKB/TrEMBL:B5F7Y2"
FT                   /protein_id="ACH48787.1"
FT                   /translation="MFLPYDSLAIWSFIMPPRRYNPDDRRDALLERINLDIPAAVAKAL
FT                   REDLGGEVDAGNDITAQLLPADTQAHATVITREDGVFCGKRWVEEVFIQLAGDDVRLTW
FT                   HVDDGDAIHANQTVFELNGPARVLLTGERTALNFVQTLSGVASEVRRYVGLLAGTQTQL
FT                   LDTRKTLPGLRTALKYAVLCGGGANHRLGLTDAFLIKENHIIASGSVRQAVEKAFWLHP
FT                   DVPVEVEVENLDELDDALKAGADIIMLDNFNTDQMREAVKRVNGQARLEVSGNVTAETL
FT                   REFAETGVDFISVGALTKHVRALDLSMRFR"
FT   gene            172655..173218
FT                   /locus_tag="SeAg_B0166"
FT   CDS_pept        172655..173218
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0166"
FT                   /product="N-acetyl-anhydromuramyl-L-alanine amidase"
FT                   /note="identified by match to protein family HMM PF01510"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0166"
FT                   /db_xref="EnsemblGenomes-Tr:ACH49532"
FT                   /db_xref="GOA:B5F7Y3"
FT                   /db_xref="InterPro:IPR002502"
FT                   /db_xref="InterPro:IPR036505"
FT                   /db_xref="UniProtKB/TrEMBL:B5F7Y3"
FT                   /protein_id="ACH49532.1"
FT                   /translation="MLPDKGWLVEARRVPSPHYDCRPDDEKPSLLVVHNISLPPGEFGG
FT                   PWIDALFTGTIDPDAHPFFAEIAHLRVSAHCLIRRDGEIVQYVPFDKRAWHAGVSNYQG
FT                   RERCNDFSIGIELEGTDTLAYTDAQYQQLAAVTRTLIACYPAIADNMTGHCNIAPDRKT
FT                   DPGPAFDWPRFRALVALSSHKEMT"
FT   gene            173215..174069
FT                   /locus_tag="SeAg_B0167"
FT   CDS_pept        173215..174069
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0167"
FT                   /product="AmpE protein"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0167"
FT                   /db_xref="EnsemblGenomes-Tr:ACH50070"
FT                   /db_xref="GOA:B5F7Y4"
FT                   /db_xref="InterPro:IPR031347"
FT                   /db_xref="UniProtKB/TrEMBL:B5F7Y4"
FT                   /protein_id="ACH50070.1"
FT                   /translation="MTLFTTLLVLIVERLFKLGEHWQLDHRLEALFRRITHFSMLRTMG
FT                   MTAIAMVVTFLLLQALKGLLFNVPTLVVWILLGVLCIGAGKVRVHYHAWLKAASRNEPH
FT                   PCEAMASELTLIHGVPPDCNEREFLRELQNALLWINFRFYLAPLFWFIVGGPWGPVTLV
FT                   GYAFLRAWQTWLARYQTPHQRLQSGIDAILHVLDWIPVRLAGVVYALLGHGEKALPAWF
FT                   ASLADLHTSQYQVLTRLAQFSLAREPHTDKVETPKAAVSMAKKASFVVVVIIALLTIYG
FT                   ALV"
FT   gene            complement(174161..175111)
FT                   /locus_tag="SeAg_B0168"
FT   CDS_pept        complement(174161..175111)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0168"
FT                   /product="alpha-N-arabinofuranosidase 2"
FT                   /EC_number="3.2.1.55"
FT                   /note="identified by match to protein family HMM PF04616"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0168"
FT                   /db_xref="EnsemblGenomes-Tr:ACH50847"
FT                   /db_xref="GOA:B5F7Y5"
FT                   /db_xref="InterPro:IPR006710"
FT                   /db_xref="InterPro:IPR016828"
FT                   /db_xref="InterPro:IPR023296"
FT                   /db_xref="UniProtKB/TrEMBL:B5F7Y5"
FT                   /protein_id="ACH50847.1"
FT                   /translation="MANWPNPFIEQRADPFILRDGSDYYFIASVPEYDRLEIRRANSLE
FT                   GLRAADPVVVWRKPESGPMSQLIWAPEMHRINGKWYIYFAATHTQALDKLGMFQHRMFA
FT                   LECADADPLTGKWTEKGQIKTPFDTFALDATTFYHQGKQWYLWAQKAPDIAGNSNIYLA
FT                   ELENPWTLKGEPVRLSKPEYDWECRGFWVNEGPAVVVHGDKLFISYSASATDENYCMGL
FT                   LWINVNDDPRDPANWHKSPRPVFTTSYENRQYGPGHNSFTQTPEGEDVLVYHARNYTEI
FT                   EGDPLYDPNRHTRLKRVRWDENGMPDFGVPPADTI"
FT   gene            complement(175111..176517)
FT                   /locus_tag="SeAg_B0170"
FT   CDS_pept        complement(175111..176517)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0170"
FT                   /product="Na+/galactoside symporter"
FT                   /note="identified by match to protein family HMM PF07690;
FT                   match to protein family HMM TIGR00792"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0170"
FT                   /db_xref="EnsemblGenomes-Tr:ACH51332"
FT                   /db_xref="GOA:B5F7Y6"
FT                   /db_xref="InterPro:IPR001927"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="InterPro:IPR039672"
FT                   /db_xref="UniProtKB/TrEMBL:B5F7Y6"
FT                   /protein_id="ACH51332.1"
FT                   /translation="MDKGRLSVREKIGYGMGDAGCNIIFGAIMLFVNYFYTDIFGLAPA
FT                   LVGVLLLSVRVIDAVTDPVMGALADRTQSKYGRFRPWLLWIAFPYALFSVLMFTTPDWG
FT                   YNSKVVYAFVTYFLLSVTYTAINIPYCSLGGVITNDPKERVACQAYRFVLVGIATLLLS
FT                   LTLLPMVDWFGGGDKAKGYQLAMTVLAIIGMGMFLFCFASVRERVRPAVPTHDDMKNDF
FT                   KDVWKNDQWVRILLLTLCNVCPGFIRMAATMYYVTWVMGQSTHFATLFISLGVVGMMIG
FT                   SMLAKVLTDRWCKLKVFFWTNIALAIFSCAFYFFDPKATVMIVALYFLLNILHQIPSPL
FT                   HWSLMADVDDYGEWKTGKRITGISFSGNLFFLKLGLAIAGAMVGFLLSWYGYDASAKAQ
FT                   SASAMNGIMLLFTVIPGVGYLITAGVVRLLKVDRELMKKIQDDLEKRRTNYRELSELQE
FT                   LKAAESVRKA"
FT   gene            176471..176596
FT                   /locus_tag="SeAg_B0169"
FT   CDS_pept        176471..176596
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0169"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0169"
FT                   /db_xref="EnsemblGenomes-Tr:ACH50851"
FT                   /db_xref="UniProtKB/TrEMBL:B5F7Y7"
FT                   /protein_id="ACH50851.1"
FT                   /translation="MPYPIFSLTESLPLSIETSPHQMMAVIIRLRAFFCVAGSRR"
FT   gene            complement(176681..178051)
FT                   /locus_tag="SeAg_B0171"
FT   CDS_pept        complement(176681..178051)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0171"
FT                   /product="aromatic amino acid transport protein AroP"
FT                   /note="identified by match to protein family HMM PF00324"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0171"
FT                   /db_xref="EnsemblGenomes-Tr:ACH49236"
FT                   /db_xref="GOA:B5F7Y8"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004840"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniProtKB/TrEMBL:B5F7Y8"
FT                   /protein_id="ACH49236.1"
FT                   /translation="MDSQQHGEQLKRGLKNRHIQLIALGGAIGTGLFLGSASVIQSAGP
FT                   GIILGYAIAGFIAFLIMRQLGEMVVEEPVAGSFSHFAYKYWGGFAGFASGWNYWVLYVL
FT                   VAMAELTAVGKYIQFWYPEIPTWASAAAFFVIINAINLTNVKVFGEMEFWFAIIKVIAV
FT                   IAMILFGAWLLFSDTAGPQATVRNLWEQGGFLPHGWTGLVMMMAIIMFSFGGLELVGIT
FT                   AAEADNPEQSIPKATNQVIYRILIFYIGSLAVLLSLLPWTRVTADTSPFVLIFHELGDT
FT                   FVANALNIVVLTAALSVYNSCVYCNSRMLFGLAQQGNAPKALLNVDKRGVPVSSILVSA
FT                   VVTALCVLLNYLAPESAFGLLMALVVSALVINWAMISLAHMMFRRAKQQQGVKTRFPAL
FT                   FYPFGNVLCLLFMAAVLIIMLMTPGMAISVWLIPVWLLILGVGYLCKEKTAKTVKAH"
FT   gene            178260..178382
FT                   /locus_tag="SeAg_B0172"
FT   CDS_pept        178260..178382
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0172"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0172"
FT                   /db_xref="EnsemblGenomes-Tr:ACH49779"
FT                   /db_xref="GOA:B5F7Y9"
FT                   /db_xref="UniProtKB/TrEMBL:B5F7Y9"
FT                   /protein_id="ACH49779.1"
FT                   /translation="MRKKKALVNTSFYFPLQMLICFYSLFMHKNAFNLLLNRFR"
FT   gene            178617..179381
FT                   /locus_tag="SeAg_B0173"
FT   CDS_pept        178617..179381
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0173"
FT                   /product="transcriptional regulator, GntR family"
FT                   /EC_number="1.8.1.4"
FT                   /note="identified by match to protein family HMM PF00392;
FT                   match to protein family HMM PF07729"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0173"
FT                   /db_xref="EnsemblGenomes-Tr:ACH50331"
FT                   /db_xref="GOA:B5F7Z0"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B5F7Z0"
FT                   /protein_id="ACH50331.1"
FT                   /translation="MAYSKIRQPKLSDVIEQQLEFLILEGTLRPGEKLPPERELAKQFD
FT                   VSRPSLREAIQRLEAKGLLLRRQGGGTFVQSSLWQSFSDPLVELLSDHPESQFDLLETR
FT                   HALEGIAAYYAALRSTDEDKDRIRELHHAIELAQESGDLDAESEAVLQYQIAVTEAAHN
FT                   VVLLHLLRCMEPMLAQNVRQNFELLYARREMLPLVSTHRTRIFEAIMAGKPEEAREASH
FT                   RHLAFIEEIMLDRSREESRRERALRRLEQRKN"
FT   gene            179541..182204
FT                   /gene="aceE"
FT                   /locus_tag="SeAg_B0174"
FT   CDS_pept        179541..182204
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aceE"
FT                   /locus_tag="SeAg_B0174"
FT                   /product="pyruvate dehydrogenase (acetyl-transferring),
FT                   homodimeric type"
FT                   /EC_number="1.2.4.1"
FT                   /note="identified by match to protein family HMM TIGR00759"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0174"
FT                   /db_xref="EnsemblGenomes-Tr:ACH51439"
FT                   /db_xref="GOA:B5F7Z1"
FT                   /db_xref="InterPro:IPR004660"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR035807"
FT                   /db_xref="InterPro:IPR041621"
FT                   /db_xref="UniProtKB/TrEMBL:B5F7Z1"
FT                   /protein_id="ACH51439.1"
FT                   /translation="MSERFPNDVDPIETRDWLQAIESVIREEGVERAQYLIDQLLSEAR
FT                   KGGVKVAAGAGASNYINTIAVEDEPEYPGNLELERRIRSAIRWNAIMTVLRASKKDLEL
FT                   GGHMASFQSSATIYDVCFNHFFRARNEQDGGDLVYFQGHISPGIYARAFLEGRLTQEQM
FT                   DNFRQEVHGNGLSSYPHPKLMPEFWQFPTVSMGLGPIGAIYQAKFLKYLEHRGLKDTSK
FT                   QTVYAFLGDGEMDEPESKGAITIATREKLDNLVFVINCNLQRLDGPVTGNGKIVNELEG
FT                   IFAGAGWNVIKVMWGGRWDELLRKDTSGKLIQLMNETVDGDYQTFKSKDGAYVREHFFG
FT                   KYPETAALVADWTDEQIWALNRGGHDPKKVYAALKKAQETKGKATVILAHTIKGYGMGD
FT                   TAEGKNIAHQVKKMNMDGVRYVRDRFNVPVADADLEKLPYITFPEGSEEHKYLHERRQA
FT                   LHGYLPSRQPNFTEKLELPQLSDFGALLEEQSKEISTTIAFVRALNVMLKNKSIKDRLV
FT                   PIIADEARTFGMEGLFRQIGIYSPNGQQYTPQDREQVAYYKEDEKGQILQEGINELGAG
FT                   ASWLAAATSYSTNDLPMIPFYIYYSMFGFQRIGDLCWQAGDQQARGFLIGGTSGRTTLN
FT                   GEGLQHEDGHSHIQSLTIPNCISYDPAYAYEVAVIMHDGLERMYGEKQENVYYYITTLN
FT                   ENYHMPAMPAGAEEGIRKGIYKLETLEGSKGKVQLLGSGSILRHVREAAQILAKDYGVG
FT                   SDVYSVTSFTELARDGQDCERWNMLHPLETPRVPYIAQVMNDAPAVASTDYMKLFAEQV
FT                   RTYVPADDYRVLGTDGFGRSDSRENLRHHFEVDASYVVVAALGELAKRGEIDKKVVADA
FT                   ITKFNIDADKVNPRLA"
FT   gene            182219..184108
FT                   /gene="aceF"
FT                   /locus_tag="SeAg_B0175"
FT   CDS_pept        182219..184108
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aceF"
FT                   /locus_tag="SeAg_B0175"
FT                   /product="dihydrolipoyllysine-residue acetyltransferase"
FT                   /EC_number="2.3.1.12"
FT                   /note="identified by match to protein family HMM PF00198;
FT                   match to protein family HMM PF00364; match to protein
FT                   family HMM PF02817; match to protein family HMM TIGR01348"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0175"
FT                   /db_xref="EnsemblGenomes-Tr:ACH52101"
FT                   /db_xref="GOA:B5F7Z2"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001078"
FT                   /db_xref="InterPro:IPR003016"
FT                   /db_xref="InterPro:IPR004167"
FT                   /db_xref="InterPro:IPR006256"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR036625"
FT                   /db_xref="UniProtKB/TrEMBL:B5F7Z2"
FT                   /protein_id="ACH52101.1"
FT                   /translation="MAIEIKVPDIGTDEVEITEILVKVGDKVEAEQSLITVEGDKASME
FT                   VPSPQAGVVKEIKVSVGDKTETGALIMIFDSADGAADAAPAKAEEKKEAAPAAAPAAAA
FT                   AKDVHVPDIGSDEVEVTEVMVKVGDTVEAEQSLITVEGDKASMEVPAPFAGTVKEIKVN
FT                   TGDKVSTGSLIMVFEVAGAAPAAAPAKAEAAPAAAAPAAATGVKDVNVPDIGGDEVEVT
FT                   EVMVKVGDKVAAEQSLITVEGDKASMEVPAPFAGTVKEIKISTGDKVKTGSLIMVFEVE
FT                   GAAPAAAPAKQEAAAPAPAAKAEKPAAPAAKAEGKSEFAENDAYVHATPLIRRLAREFG
FT                   VNLAKVKGTGRKGRILREDVQAYVKDAIKRAEAAPAATGGGIPGMLPWPKVDFSKFGEV
FT                   EEVELGRIQKISGANLSRNWVMIPHVTHFDKTDITDLEAFRKQQNAEAEKRKLDVKYTP
FT                   VVFIMKAVAAALEQMPRFNSSLSEDGQRLTLKKYINIGVAVDTPNGLVVPVFKDVNKKS
FT                   VTELSRELTTISKKARDGKLTAGEMQGGCFTISSIGGLGTTHFAPIVNAPEVAILGVSK
FT                   SAMEPVWNGKEFVPRLMMPISLSFDHRVIDGADGARFITIINNMLSDIRRLVM"
FT   gene            184306..185733
FT                   /gene="lpdA"
FT                   /locus_tag="SeAg_B0176"
FT   CDS_pept        184306..185733
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lpdA"
FT                   /locus_tag="SeAg_B0176"
FT                   /product="dihydrolipoamide dehydrogenase"
FT                   /EC_number="1.8.1.4"
FT                   /note="identified by match to protein family HMM PF00070;
FT                   match to protein family HMM PF01134; match to protein
FT                   family HMM PF02852; match to protein family HMM PF07992;
FT                   match to protein family HMM TIGR01350"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0176"
FT                   /db_xref="EnsemblGenomes-Tr:ACH52726"
FT                   /db_xref="GOA:B5F7Z3"
FT                   /db_xref="InterPro:IPR001100"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR006258"
FT                   /db_xref="InterPro:IPR012999"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B5F7Z3"
FT                   /protein_id="ACH52726.1"
FT                   /translation="MMSTEIKTQVVVLGAGPAGYSAAFRCADLGLETVIVERYNTLGGV
FT                   CLNVGCIPSKALLHVAKVIEEAKALAEHGIVFGEPKTDIDKIRTWKEKVITQLTGGLAG
FT                   MAKGRKVKVVNGLGKFTGANTLEVEGENGKTVINFDNAIIAAGSRPIQLPFIPHEDPRV
FT                   WDSTDALELKEVPKRMLVMGGGIIGLEMGTVYHALGSEIDVVEMFDQVIPAADKDIVKV
FT                   FTKRISKKFNLMLETKVTAVEAKEDGIYVSMEGKKAPAEAQRYDAVLVAIGRVPNGKNL
FT                   DAGKAGVEVDDRGFIRVDKQLRTNVPHIFAIGDIVGQPMLAHKGVHEGHVAAEVIAGKK
FT                   HYFDPKVIPSIAYTEPEVAWVGLTEKEAKEKGISYETATFPWAASGRAIASDCADGMTK
FT                   LIFDKESHRVIGGAIVGTNGGELLGEIGLAIEMGCDAEDIALTIHAHPTLHESVGLAAE
FT                   VFEGSITDLPNPKAKKK"
FT   gene            185820..185939
FT                   /locus_tag="SeAg_B0177"
FT   CDS_pept        185820..185939
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0177"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0177"
FT                   /db_xref="EnsemblGenomes-Tr:ACH49333"
FT                   /db_xref="UniProtKB/TrEMBL:B5F7Z4"
FT                   /protein_id="ACH49333.1"
FT                   /translation="MMAKDNETAKFIFSAAVRFSKLMPSVVPLSVIFDQLIVS"
FT   gene            186022..186306
FT                   /locus_tag="SeAg_B0178"
FT   CDS_pept        186022..186306
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0178"
FT                   /product="probable secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0178"
FT                   /db_xref="EnsemblGenomes-Tr:ACH48745"
FT                   /db_xref="UniProtKB/TrEMBL:B5F7Z5"
FT                   /protein_id="ACH48745.1"
FT                   /translation="MKLFLTTAALTATLISGMAFASDPVIPWATNSGGTESTHIAAMGE
FT                   DLNAQHQQITHTHEGVWAANSGSIQADEAALTSNKPPVQGHPELMPHQG"
FT   gene            complement(186344..187135)
FT                   /locus_tag="SeAg_B0179"
FT   CDS_pept        complement(186344..187135)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0179"
FT                   /product="probable secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0179"
FT                   /db_xref="EnsemblGenomes-Tr:ACH49433"
FT                   /db_xref="InterPro:IPR021556"
FT                   /db_xref="UniProtKB/TrEMBL:B5F7Z6"
FT                   /protein_id="ACH49433.1"
FT                   /translation="MKKVMLSALLLSLPLLGYAQERFPSPEAAASAFAAAVAGKNETQL
FT                   TALLGDDWRQFLPPEGADPEAVARFNRDWREGHRIVQKDNTAHLNVGREDWQLPVPMVK
FT                   ETGGWRFDMAAAGNEILTRTIGRNELSTLQAMHAYVDAQQDYYLQNHRWAHRIISSEGQ
FT                   KDGLYWPTKAGDVPSPLGPNFSPAAPDEGYHGYHFRIISDNDGHGAALLAWPMHYGETG
FT                   VMSFMVNQDDRIYQADLGKETESKVQAITRFAPDAQWQVAE"
FT   gene            complement(187148..188770)
FT                   /locus_tag="SeAg_B0180"
FT   CDS_pept        complement(187148..188770)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0180"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0180"
FT                   /db_xref="EnsemblGenomes-Tr:ACH50120"
FT                   /db_xref="InterPro:IPR021728"
FT                   /db_xref="UniProtKB/TrEMBL:B5F7Z7"
FT                   /protein_id="ACH50120.1"
FT                   /translation="MTLPFKPHLIALVCSAGLFAASGVLYVKSRAPEAPAQAAAPAPEP
FT                   TQTAVPAPVAKTTFTTAQIDQWVAPVALYPDALLSQVLMASTYPANVVQAVQWSRDNPT
FT                   LQGDAAIQAVASQPWDPSVKSLIAFPQLMALMGENPQWVQNLGDAFLAQPQDVMDAVQR
FT                   LRLLAQQTGSLKSTPQQTVTSVPKSSASTAVTTTTTTSASTPATPSTVIKIEPANPQVV
FT                   YVPNYNPATVYGAWPNTAYPPVYLPPPPGQQFADSFVKGFGYSLGVATTYALFSSIDWD
FT                   DDDHHHHDDDHHDDDYHHGGNGYQHNGDNININVNNFNRISGQNLPGQTMGWQHNPAWR
FT                   NGVPYPNNTVAQRFHPTNVSGGLSTTQQAPVSRDSQRQAAMTQFQQRSHTSPANLSGET
FT                   SRDRQRKAASQQLNQIAQRNNYRGYDGTQNSSRREAAQQTLNKSTTQQHRSELKAKAQQ
FT                   HPVSQQQRDTARQRIESSTPQQRQAFRQNMHANVFSGNDSRSPSWQSQQLRGLESRRGS
FT                   HLNTEQRAAAREHFSEHHEFHRR"
FT   gene            189159..191756
FT                   /gene="acnB"
FT                   /locus_tag="SeAg_B0181"
FT   CDS_pept        189159..191756
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="acnB"
FT                   /locus_tag="SeAg_B0181"
FT                   /product="aconitate hydratase 2"
FT                   /EC_number="4.2.1.3"
FT                   /note="identified by match to protein family HMM PF00330;
FT                   match to protein family HMM PF06434; match to protein
FT                   family HMM TIGR00117"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0181"
FT                   /db_xref="EnsemblGenomes-Tr:ACH50735"
FT                   /db_xref="GOA:B5F7Z8"
FT                   /db_xref="InterPro:IPR001030"
FT                   /db_xref="InterPro:IPR004406"
FT                   /db_xref="InterPro:IPR015928"
FT                   /db_xref="InterPro:IPR015929"
FT                   /db_xref="InterPro:IPR015931"
FT                   /db_xref="InterPro:IPR015932"
FT                   /db_xref="InterPro:IPR015933"
FT                   /db_xref="InterPro:IPR018136"
FT                   /db_xref="InterPro:IPR036008"
FT                   /db_xref="InterPro:IPR036288"
FT                   /db_xref="UniProtKB/TrEMBL:B5F7Z8"
FT                   /protein_id="ACH50735.1"
FT                   /translation="MLEEYRKHVAERAAQGIVPKPLDATQMAALVELLKTPPVGEEEFL
FT                   LDLLINRVPPGVDEAAYVKAGFLAAVAKGDTTSPLVSPEKAIELLGTMQGGYNIHPLID
FT                   ALDDAKLAPIAAKALSHTLLMFDNFYDVEEKAKAGNEYAKQVMQSWADAEWFLSRPPLA
FT                   EKITVTVFKVTGETNTDDLSPAPDAWSRPDIPLHALAMLKNAREGIDPDQPGSVGPIKQ
FT                   IEALQKKGFPLAYVGDVVGTGSSRKSATNSVLWFMGDDIPNVPNKRGGGLCLGGKIAPI
FT                   FFNTMEDAGALPVEVDVSRLNMGDVIDVYPYKGEVRNHETGELLATFELKTDVLIDEVR
FT                   AGGRIPLIIGRGLTTKAREALGLPHSDVFRQAKDVAESSRGFSLAQKMVGRACGVKGIR
FT                   PGAYCEPKMTSVGSQDTTGPMTRDELKDLACLGFSADLVMQSFCHTAAYPKPVDVTTHH
FT                   TLPDFIMNRGGVSLRPGDGVIHSWLNRMLLPDTVGTGGDSHTRFPIGISFPAGSGLVAF
FT                   AAATGVMPLDMPESVLVRFKGKMQPGITLRDLVHAIPLYAIKQGLLTVEKKGKKNIFSG
FT                   RILEIEGLPDLKVEQAFELTDASAERSAAGCTIKLNKEPIVEYLTSNIVLLKWMIAEGY
FT                   GDRRTLERRIQGMEKWLADPQLLEADADAEYAAVIDIDLADIKEPILCAPNDPDDARLL
FT                   SDVQGEKIDEVFIGSCMTNIGHFRAAGKLLDSHKGQLPTRLWVAPPTRMDAAQLTEEGY
FT                   YSVFGKSGARIEIPGCSLCMGNQARVADGATVVSTSTRNFPNRLGTGANVFLASAELAA
FT                   VAALIGKLPTPEEYQTYVAQVDKTAVDTYRYLNFDQLSQYTEKADGVIFQTAV"
FT   gene            complement(191788..192759)
FT                   /locus_tag="SeAg_B0182"
FT   CDS_pept        complement(191788..192759)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0182"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0182"
FT                   /db_xref="EnsemblGenomes-Tr:ACH51330"
FT                   /db_xref="InterPro:IPR025538"
FT                   /db_xref="UniProtKB/TrEMBL:B5F7Z9"
FT                   /protein_id="ACH51330.1"
FT                   /translation="MTYFKWLSVLLCFITSYHAYANDSAVGETNGSIEFLQQNEISMAK
FT                   ERLLIASDRINVDYVFINHSAQDITVPVAFPMPAISQRYMGDRTEGIANFKISVDGKPV
FT                   KSESRWRVIHDLGGKGEEDITAKLLQTGWTIPQLRHVLNREGKASIEEGYKEGKQQLPS
FT                   EWFDDGYLNIAVQQYFIWQQRFPAGKEIVIHHSYTPSESTGVPDSLDSLLGDEFGDQCL
FT                   TAATRKALKQLDAGIKYKNEDGSANIGWGYLGYILKTGANWKEGVIGDFTLRIHKKDET
FT                   EVVVPCFNYPLKQIDPLTLEFKQKNFKPDENMDIHFYYDSSR"
FT   gene            192832..193920
FT                   /locus_tag="SeAg_B0183"
FT   CDS_pept        192832..193920
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0183"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0183"
FT                   /db_xref="EnsemblGenomes-Tr:ACH51881"
FT                   /db_xref="InterPro:IPR027826"
FT                   /db_xref="UniProtKB/TrEMBL:B5F800"
FT                   /protein_id="ACH51881.1"
FT                   /translation="MRYYLFLLLIICQNTFAEEIKPLPQGDTWRKYIALSLRDEEGLED
FT                   GLFNLRRIEANSSIAYVCGLIKDKNDNFLTDGQNQYHLYDRVMAIGYRWSWGSVVRFDK
FT                   TIASPQDVHCHYGKNVPLTSALLREQVAAQGRKNICQPVKASDPLRSDILNGLRASYIG
FT                   DSNSLTLNGPLPTVKFIVEDLCATEDYAYFLGKATGDKTSFFIHDDANNRLRVVLKKSP
FT                   DGVWRPQPENNLLTQQSKVSSGYYSDGTLRETDLAQLAQACRVEGDTVNLTGTLRQQGD
FT                   GESAYWTLTPDSPLTCVRDANKQQPGWNQTMQLVLTPQERESLNNLVGKKVSVGGDIFL
FT                   ALSASHHTPLLLDNIFRLTEIK"
FT   gene            193945..194262
FT                   /locus_tag="SeAg_B0184"
FT   CDS_pept        193945..194262
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0184"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0184"
FT                   /db_xref="EnsemblGenomes-Tr:ACH52696"
FT                   /db_xref="UniProtKB/TrEMBL:B5F801"
FT                   /protein_id="ACH52696.1"
FT                   /translation="MLLMLCGNADAAAKLQYLHVTNGGMMAFYDDGNAKMCARCEPMVQ
FT                   NLKSMNNKAPYARWKQMGDVIKLKSPNGESDYEFYQQGEILSTWWIFNYKTLHALVDLS
FT                   E"
FT   gene            complement(194277..195209)
FT                   /locus_tag="SeAg_B0185"
FT   CDS_pept        complement(194277..195209)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0185"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0185"
FT                   /db_xref="EnsemblGenomes-Tr:ACH51997"
FT                   /db_xref="InterPro:IPR025538"
FT                   /db_xref="UniProtKB/TrEMBL:B5F802"
FT                   /protein_id="ACH51997.1"
FT                   /translation="MKKIAFGFPLLLAVLPYPAQANEAVANSSLHLLAQSDIQLAKERL
FT                   LIERERINADYLFVNPTAQDITVPVVFPMPPLSFSDVDEAGEDYIPGIRNIKIRVDGQI
FT                   VTPQPRWTVVLNAPQEEITDKLQQAGWTVEQLIAALSDGEFSPPADLPALPPEWFKDNQ
FT                   PQFTIQRNFIWQQTFPAGKAVTIHQVYTPSVSLSALMSTDELDNNNTCPTAENRQQIQQ
FT                   ALDQLMTKQGPAGALGQNRMDVVLTGDPAWKEGDIGEFTLRLHGDAITTCFQPPLTRIN
FT                   ATTLEFKQKNFRPAENLAVTFYSLSSMYE"
FT   gene            195284..196417
FT                   /locus_tag="SeAg_B0186"
FT   CDS_pept        195284..196417
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0186"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0186"
FT                   /db_xref="EnsemblGenomes-Tr:ACH52701"
FT                   /db_xref="InterPro:IPR027826"
FT                   /db_xref="UniProtKB/TrEMBL:B5F803"
FT                   /protein_id="ACH52701.1"
FT                   /translation="MRYFLLVLMMICCNLYASDMFPLKPDENPRGAIALTLREEVGLLN
FT                   ARFDIKRIEINETRELAYFCGLLKDTDGQYIKDEDDKYYLFDRILLDSGTEGWVSTVYL
FT                   DEEFSAPEQAKCHFAGNVDLKSQELCALVKQYGRIAACLPVEKGDPLRTQLLDAVRENY
FT                   VGDLNRKTTLNNTPVPSFVVTQLCAAQKYAYFCGEPANADADWYSQDSKKLDVVLQKDA
FT                   NNTWWLPVPQFQGISRQSSLAWCNHSTDILPVKTVEEMAKKRQQRCVREGDTVSLRGIL
FT                   AEQKSGAQRYWVVKLEEPLTCVQDADMRTADWNGQVQLLLSDEIIERVKVQYGDDLLNQ
FT                   EIVVTGDVLLALSSDHHTPLVLENIVELMPVMEGPGW"
FT   gene            196419..196598
FT                   /locus_tag="SeAg_B0187"
FT   CDS_pept        196419..196598
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0187"
FT                   /product="aconitate hydratase"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0187"
FT                   /db_xref="EnsemblGenomes-Tr:ACH52064"
FT                   /db_xref="InterPro:IPR015931"
FT                   /db_xref="UniProtKB/TrEMBL:B5F804"
FT                   /protein_id="ACH52064.1"
FT                   /translation="MRLPIFNDCVIPAHNKRSSTDRFPASAELAAVDTYRYLNFDQLSQ
FT                   YTEKADGVIFQTAV"
FT   gene            complement(196638..197102)
FT                   /locus_tag="SeAg_B0188"
FT   CDS_pept        complement(196638..197102)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0188"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0188"
FT                   /db_xref="EnsemblGenomes-Tr:ACH49416"
FT                   /db_xref="GOA:B5F805"
FT                   /db_xref="UniProtKB/TrEMBL:B5F805"
FT                   /protein_id="ACH49416.1"
FT                   /translation="MSVFRRIIYHSGWFILFGPLIGAAIAIGIINFLPAIIGGPDSFLF
FT                   YFCRTIPELVIITGWIYSLLPAWLTGVACALIPLKLYQKIINRMILCAIAGGLITTLFN
FT                   FARYGFDISILPLIYGEVLIMLIPAIVAGAIMGGVITYLPGLREVKRNNK"
FT   gene            complement(197512..197835)
FT                   /locus_tag="SeAg_B0189"
FT   CDS_pept        complement(197512..197835)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0189"
FT                   /product="low molecular weight phosphotyrosine protein
FT                   phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0189"
FT                   /db_xref="EnsemblGenomes-Tr:ACH48795"
FT                   /db_xref="InterPro:IPR016919"
FT                   /db_xref="InterPro:IPR023485"
FT                   /db_xref="InterPro:IPR036196"
FT                   /db_xref="UniProtKB/TrEMBL:B5F806"
FT                   /protein_id="ACH48795.1"
FT                   /translation="MNVLFICSRNQWRSPTAEQVFRRYPGLSVRSAGTSRNAKKSVSCG
FT                   LLQWADVICVMEQKHKDRLMAEYRRIIENKPLHVLDIPDDYRYMDPELVRQLEELVPEV
FT                   LGI"
FT   gene            complement(197807..197923)
FT                   /locus_tag="SeAg_B0190"
FT   CDS_pept        complement(197807..197923)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0190"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0190"
FT                   /db_xref="EnsemblGenomes-Tr:ACH50753"
FT                   /db_xref="UniProtKB/TrEMBL:B5F807"
FT                   /protein_id="ACH50753.1"
FT                   /translation="MLRAAPWGIESPRLTNSPLAKRDLEEYLFNECAFHMQP"
FT   gene            198106..198468
FT                   /locus_tag="SeAg_B0191"
FT   CDS_pept        198106..198468
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0191"
FT                   /product="protein YacL"
FT                   /note="identified by match to protein family HMM PF06062"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0191"
FT                   /db_xref="EnsemblGenomes-Tr:ACH49981"
FT                   /db_xref="InterPro:IPR008249"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5F808"
FT                   /protein_id="ACH49981.1"
FT                   /translation="MDYEFLRDVTGGVKVRMSMGHEVVGHWFNEEVKDNLSLLDEVEQA
FT                   ARTVKGSERSWQRAGHEYTIWMDGEEVMIRANQLDFSGDEMEEGMSYYDEESLSLCGME
FT                   DFLRVVAAYREFVSKA"
FT   gene            198511..198624
FT                   /locus_tag="SeAg_B0192"
FT   CDS_pept        198511..198624
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0192"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0192"
FT                   /db_xref="EnsemblGenomes-Tr:ACH51855"
FT                   /db_xref="UniProtKB/TrEMBL:B5F809"
FT                   /protein_id="ACH51855.1"
FT                   /translation="MGAVVETKSPHIPAGSIPAFLLQNDFLIFINHFKTVI"
FT   gene            198703..199656
FT                   /locus_tag="SeAg_B0193"
FT   CDS_pept        198703..199656
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0193"
FT                   /product="2-keto-3-deoxygluconate permease"
FT                   /note="identified by match to protein family HMM PF03812"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0193"
FT                   /db_xref="EnsemblGenomes-Tr:ACH51054"
FT                   /db_xref="GOA:B5F810"
FT                   /db_xref="InterPro:IPR004684"
FT                   /db_xref="UniProtKB/TrEMBL:B5F810"
FT                   /protein_id="ACH51054.1"
FT                   /translation="MNIKKAIERVPGGMMVVPLVIGAVINTFAPQALEIGGFTTALFKN
FT                   GAAPLIGAFLLCMGAGISVKAAPQALLQGGTITLTKLLVAIGIGLGVEHLFGAEGIFGL
FT                   SGVAIIAAMSNSNGGLYAALVGEFGNERDVGAISILSLNDGPFFTMIALGAAGMANIPI
FT                   MALVAVLVPLVVGMILGNLDPHMRDFLTKGGPLLIPFFAFALGAGINLEMLLQGGLAGI
FT                   LLGVLTTFVGGFFNIRADRLVGGTGIAGAAASSTAGNAVATPLAIAQADPSLAEVAAAA
FT                   APLIAASVITTAILTPVLTSWVAKKQARQASLEKNA"
FT   gene            199653..200924
FT                   /locus_tag="SeAg_B0194"
FT   CDS_pept        199653..200924
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0194"
FT                   /product="putative inner membrane protein"
FT                   /note="identified by match to protein family HMM PF07005"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0194"
FT                   /db_xref="EnsemblGenomes-Tr:ACH51374"
FT                   /db_xref="InterPro:IPR010737"
FT                   /db_xref="InterPro:IPR031475"
FT                   /db_xref="InterPro:IPR037051"
FT                   /db_xref="InterPro:IPR042213"
FT                   /db_xref="UniProtKB/TrEMBL:B5F811"
FT                   /protein_id="ACH51374.1"
FT                   /translation="MKMMVIADDFTGSNDTGVQLAKKGARTEVMLSASQKPSRRADVLV
FT                   INTESRAMPADQAASAVYAALSPWCETSPAPLVYKKIDSTFRGNIGAEVTAAMRASQRK
FT                   LAVIAAAIPAAGRTTLEGKCLVNGVPLLETEFASDPKTPIVSSRIAEIVALQSEIPVYE
FT                   VFLQDVRRGGLSALLTAYAAEGEGIIVVDAVEERDLTLIAQAACEQPSMPLLVGAAGLA
FT                   NALPVELFMQDRQRLPVLVVAGSMSEATRRQVDNALCRGRAEVVDIDAARMVSDSAEQE
FT                   IASVVEQACALLSQHRHTILRTSRRAEDRQLIDALCEKFAMSRQQLGERLSQRLGVVTL
FT                   NIIEQARIGGLFLTGGDIATAVAGALGAEGYRIQSEVAPCIPCGTFVNSEIDDLPVITK
FT                   AGGFGSDSTLCDALYYIEEMYCGD"
FT   gene            200914..201897
FT                   /gene="pdxA"
FT                   /locus_tag="SeAg_B0195"
FT   CDS_pept        200914..201897
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pdxA"
FT                   /locus_tag="SeAg_B0195"
FT                   /product="4-hydroxythreonine-4-phosphate dehydrogenase"
FT                   /EC_number="1.1.1.262"
FT                   /note="identified by match to protein family HMM PF04166;
FT                   match to protein family HMM TIGR00557"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0195"
FT                   /db_xref="EnsemblGenomes-Tr:ACH50901"
FT                   /db_xref="GOA:B5F812"
FT                   /db_xref="InterPro:IPR005255"
FT                   /db_xref="UniProtKB/TrEMBL:B5F812"
FT                   /protein_id="ACH50901.1"
FT                   /translation="METKTVAITMGDPAGIGPEIIVKALSEDGLNGAPLVVIGCLATLK
FT                   RLQAKGITPNVELRAIERVAEARFAPGTIHVIDEPLAQPEALEAGKVQAQAGDLAYRCV
FT                   KRATELALRGDVQAIATAPLNKEALHLAGHNYPGHTELLATLTHSRDYAMVLYTDKLKV
FT                   IHVSTHIALRKFLDTLSTTRVETVIGIADTFLKRVGYVKPRIAVAGVNPHAGENGLFGD
FT                   EETRILTPAITDARAKGMDVYGPCPPDTVFLQAYEGQYDMVVAMYHDQGHIPLKLLGFY
FT                   DGVNITAGLPFIRTSADHGTAFDIAWTGKAKSESMAVSIKLAMQLA"
FT   gene            201907..202674
FT                   /locus_tag="SeAg_B0196"
FT   CDS_pept        201907..202674
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0196"
FT                   /product="DeoR-family transcriptional regulator"
FT                   /note="identified by match to protein family HMM PF00455;
FT                   match to protein family HMM PF08220"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0196"
FT                   /db_xref="EnsemblGenomes-Tr:ACH52661"
FT                   /db_xref="GOA:B5F813"
FT                   /db_xref="InterPro:IPR001034"
FT                   /db_xref="InterPro:IPR014036"
FT                   /db_xref="InterPro:IPR018356"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:B5F813"
FT                   /protein_id="ACH52661.1"
FT                   /translation="MKGQHRLDLIVAYLKNHTLVTVEQLVEAVDASPATIRRDLIKLDE
FT                   QGVISRSHGGVALRRFEPAQPTTNEKQLRSPAEKRAIARVAASLVNAGDAVVLDAGTTM
FT                   MELAKCLTHLPLRVITVDLHIALFLAEFRQIEVTIVGGRIDDSSQSCIGEHGRKLLRSV
FT                   YPNIAFMSCNSWGVKTGVTTPTEDKAGLKQEIIANAQRKVLLADSSKYGAHSLFNVVPL
FT                   ERFNDVITDVNLPPSAQVELKGRAFALTLVQPE"
FT   gene            complement(202704..203498)
FT                   /gene="speD"
FT                   /locus_tag="SeAg_B0197"
FT   CDS_pept        complement(202704..203498)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="speD"
FT                   /locus_tag="SeAg_B0197"
FT                   /product="S-adenosylmethionine decarboxylase proenzyme"
FT                   /EC_number="4.1.1.50"
FT                   /note="identified by match to protein family HMM PF02675;
FT                   match to protein family HMM TIGR03331"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0197"
FT                   /db_xref="EnsemblGenomes-Tr:ACH52132"
FT                   /db_xref="GOA:B5F814"
FT                   /db_xref="InterPro:IPR003826"
FT                   /db_xref="InterPro:IPR009165"
FT                   /db_xref="InterPro:IPR016067"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5F814"
FT                   /protein_id="ACH52132.1"
FT                   /translation="MKKLKLHGFNNLTKSLSFCIYDICYAKTAEERDGYIAYIDELYNA
FT                   NRLTEILSETCSIIGANILNIARQDYEPQGASVTILVSEEPIDPKLIDQTEHPGPLPET
FT                   VVAHLDKSHICVHTYPESHPEGGLCTFRADIEVSTCGVISPLKALNYLIHQLESDIVTI
FT                   DYRVRGFTRDVNGMKHFIDHEINSIQNFMSEDMKSLYDMVDVNVYQENIFHTKMLLKEF
FT                   DLKHYMFHTKPEDLTETERQEITAALWKEMREIYYGRNISAV"
FT   gene            complement(203519..204379)
FT                   /gene="speE"
FT                   /locus_tag="SeAg_B0198"
FT   CDS_pept        complement(203519..204379)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="speE"
FT                   /locus_tag="SeAg_B0198"
FT                   /product="spermidine synthase"
FT                   /EC_number="2.5.1.16"
FT                   /note="identified by match to protein family HMM PF01564;
FT                   match to protein family HMM TIGR00417"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0198"
FT                   /db_xref="EnsemblGenomes-Tr:ACH48827"
FT                   /db_xref="GOA:B5F815"
FT                   /db_xref="InterPro:IPR001045"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR030373"
FT                   /db_xref="InterPro:IPR030374"
FT                   /db_xref="InterPro:IPR035246"
FT                   /db_xref="InterPro:IPR037163"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5F815"
FT                   /protein_id="ACH48827.1"
FT                   /translation="MAENTMWHETLHDQFGQYFAVDNVLYHEKTDHQDLIIFENAAFGR
FT                   VMALDGVVQTTERDEFIYHEMMTHVPLLAHGHAKHVLIIGGGDGAMLREVTRHKNVETI
FT                   TMVEIDAGVVSFCRQYLPNHNAGSYDDPRFTLVIDDGVNFVNQTHQTFDVIISDCTDPI
FT                   GPGESLFTSAFYEGCKRCLNPGGIFVAQNGVCFLQQDEALDSHRKLSHYFSDVGFYQAA
FT                   IPTYYGGIMTFAWATDNDALRHLSSEIIQARFHAAGLKCRYYNPAIHAAAFALPQYLHD
FT                   ALSAQ"
FT   gene            complement(204486..204812)
FT                   /locus_tag="SeAg_B0199"
FT   CDS_pept        complement(204486..204812)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0199"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0199"
FT                   /db_xref="EnsemblGenomes-Tr:ACH50369"
FT                   /db_xref="InterPro:IPR019114"
FT                   /db_xref="InterPro:IPR038432"
FT                   /db_xref="UniProtKB/TrEMBL:B5F816"
FT                   /protein_id="ACH50369.1"
FT                   /translation="MLFGSLMALCANSYALTESEAEDMADLTAVFVFLKNDCGYQNLPN
FT                   SQIRRALVFFAQQNQWDLSNYDTFDMKSLGEDSYRDLSGIGIPVAKKCKALARDSLSLL
FT                   AYVK"
FT   gene            205035..206645
FT                   /locus_tag="SeAg_B0200"
FT   CDS_pept        205035..206645
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0200"
FT                   /product="blue copper oxidase CueO"
FT                   /note="identified by match to protein family HMM PF07731;
FT                   match to protein family HMM PF07732; match to protein
FT                   family HMM TIGR01409"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0200"
FT                   /db_xref="EnsemblGenomes-Tr:ACH50142"
FT                   /db_xref="GOA:B5F817"
FT                   /db_xref="InterPro:IPR001117"
FT                   /db_xref="InterPro:IPR002355"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR011706"
FT                   /db_xref="InterPro:IPR011707"
FT                   /db_xref="UniProtKB/TrEMBL:B5F817"
FT                   /protein_id="ACH50142.1"
FT                   /translation="MLRRDFLKYSVALGVASALPLWSRAAFAAERPALPIPDLLTADAS
FT                   NRMQLIVKAGQSTFAGKNATTWGYNGNLLGPAVQLHKGKSVTVDIHNQLAEDTTLHWHG
FT                   LEIPGIVDGGPQGIIPAGGTRTVTFTPQQRAATCWIHPHKHGKTGRQVAMGLAGLVLIE
FT                   DDEIRKLRLPKQWGIDDVPVIIQDKRFSADGQIDYQLDIMTAAVGWFGDTLLTNGAIYP
FT                   QHSAPKGWLRLRLLNGCNARSLNIAASDNRPLYVIASDGGLLAEPVKVTELPLLMGERF
FT                   EVLVDISDGKAFDLVTLPVSQMGMAIAPFDKPHPVMRIQPLRITASGTLPDTLTTMPAL
FT                   PSLEGLTVRNLKLSMDPRLDMMGMQMLMKKYGAQAMSGMDHDSMNAHMQGGNMGHGEMD
FT                   HGNMDHSGMNHGAMGNMNHGGKFDFHNANFINGQVFDMNKPMFAAQKGRHERWVISGVG
FT                   DMMLHPFHIHGTQFRILSENGKAPAAHRTGWKDTVRVEGGISEVLVKFDHDAPKEHAYM
FT                   AHCHLLEHEDTGMMLGFTV"
FT   gene            complement(206723..208966)
FT                   /gene="gcd"
FT                   /locus_tag="SeAg_B0201"
FT   CDS_pept        complement(206723..208966)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gcd"
FT                   /locus_tag="SeAg_B0201"
FT                   /product="quinoprotein glucose dehydrogenase"
FT                   /EC_number="1.1.5.2"
FT                   /note="identified by match to protein family HMM PF01011;
FT                   match to protein family HMM TIGR03074"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0201"
FT                   /db_xref="EnsemblGenomes-Tr:ACH49707"
FT                   /db_xref="GOA:B5F818"
FT                   /db_xref="InterPro:IPR001479"
FT                   /db_xref="InterPro:IPR002372"
FT                   /db_xref="InterPro:IPR011047"
FT                   /db_xref="InterPro:IPR017511"
FT                   /db_xref="InterPro:IPR018391"
FT                   /db_xref="UniProtKB/TrEMBL:B5F818"
FT                   /protein_id="ACH49707.1"
FT                   /translation="MLVVAGLLWRSKRAALWLYAALLLATMIWGVWEVGFDFWALTPRS
FT                   DILVFFGIWLILPFVWHRLVVPSSGAVAALVVALLISGGILTWAGFNDPQEINGTLRAD
FT                   ATPAATSSSIADEDWPAYGRNQEGQRYSPLKQITADNVHQLKEAWVFRTGDLKQPNDPG
FT                   EITNEVTPIKVGDTLYLCTAHQRLFALDAASGKEKWHFDPQLKTDSSFQHVTCRGVSYH
FT                   EAKADTASSEVIADCPRRIILPVNDGRLFAVNAETGKLCETFANKGVLNLQTNMPDTTP
FT                   GLYEPTSPPIITDKTIVIAGSVTDNFSTRETSGVIRGFDVNTGKLLWAFDPGAKDPNAI
FT                   PADEHAFTFNSPNSWAPAAYDAKLDLVYLPMGVTTPDIWGGNRTPEQERYASSILALNA
FT                   TTGKLAWSYQTVHHDLWDMDLPAQPTLADITVDGTTVPVIYAPAKTGNIFVLDRRNGEL
FT                   VVPAPEKPVPQGAAKGDYVAKTQPFSDLTFRPKKDLSGADMWGATMFDQLVCRVMFHQL
FT                   RYEGIFTPPSEQGTLVFPGNLGMFEWGGISVDPDRQVAIANPMALPFVSKLIPRGPGNP
FT                   MEPPKDAKGTGTEAGIQPQYGVPFGVTLNPFLSPFGLPCKQPAWGYISALDLKTNEIVW
FT                   KKRIGTPRDSMPFPMPVPVPFNMGMPMLGGPISTAGNVLFIAATADNYLRAYNMSNGEK
FT                   LWQGRLPAGGQATPMTYEVNGKQYVVVSAGGHGSFGTKMGDYIVAYALPDDAK"
FT   gene            209319..209855
FT                   /gene="hpt"
FT                   /locus_tag="SeAg_B0202"
FT   CDS_pept        209319..209855
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hpt"
FT                   /locus_tag="SeAg_B0202"
FT                   /product="hypoxanthine phosphoribosyltransferase"
FT                   /EC_number="2.4.2.8"
FT                   /note="identified by match to protein family HMM PF00156;
FT                   match to protein family HMM TIGR01203"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0202"
FT                   /db_xref="EnsemblGenomes-Tr:ACH51956"
FT                   /db_xref="GOA:B5F819"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005904"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:B5F819"
FT                   /protein_id="ACH51956.1"
FT                   /translation="MKHTVEVMIPEAEIKARIAELGRQITERYKDSGSEMVLVGLLRGS
FT                   FMFMADLCREVQVPHEVDFMTASSYGSGMSTTRDVKILKDLDEDIRGKDVLIVEDIIDS
FT                   GNTLSKVREILGLREPKSLAICTLLDKPSRREVDVPVEFVGFSIPDEFVVGYGIDYAQR
FT                   YRHLPYVGKVVLLDE"
FT   gene            complement(209913..210575)
FT                   /locus_tag="SeAg_B0203"
FT   CDS_pept        complement(209913..210575)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0203"
FT                   /product="carbonate dehydratase"
FT                   /note="identified by match to protein family HMM PF00484"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0203"
FT                   /db_xref="EnsemblGenomes-Tr:ACH52479"
FT                   /db_xref="GOA:B5F820"
FT                   /db_xref="InterPro:IPR001765"
FT                   /db_xref="InterPro:IPR015892"
FT                   /db_xref="InterPro:IPR036874"
FT                   /db_xref="UniProtKB/TrEMBL:B5F820"
FT                   /protein_id="ACH52479.1"
FT                   /translation="MKDIDTLISNNALWSKMLVEEDPGFFEKLAQAQKPRFLWIGCSDS
FT                   RVPAERLTGLEPGELFVHRNVANLVIHTDLNCLSVVQYAVDVLEVEHIIICGHSGCGGI
FT                   KAAVENPELGLINNWLLHIRDIWLKHSSLLGKMPEEQRLDALYELNVMEQVYNLGHSTI
FT                   MQSAWKRGQNVTIHGWAYSINDGLLRDLDVTATNRETLENGYHKGISALSLKYIPHQ"
FT   gene            210684..211610
FT                   /locus_tag="SeAg_B0204"
FT   CDS_pept        210684..211610
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0204"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0204"
FT                   /db_xref="EnsemblGenomes-Tr:ACH52832"
FT                   /db_xref="GOA:B5F821"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B5F821"
FT                   /protein_id="ACH52832.1"
FT                   /translation="MTIALELQQLKKTYPGGVQALRGIDLQVEAGDFYALLGPNGAGKS
FT                   TTIGIISSLVNKTSGRVNVFGYDLEKDVVNAKRQLGLVPQEFNFNPFETVQQIVVNQAG
FT                   YYGVEHKEAVLRSEKYLKQLDLWEKRSERARMLSGGMKRRLMIARALMHEPKLLILDEP
FT                   TAGVDIELRRSMWGFLKDLNAKGTTIILTTHYLEEAEMLCRNIGIIQHGELVENTSMKN
FT                   LLSKLKSETFILDLAPKSPLPKLTGYQYRLVDTSTLEVEVLREQGVNSVFSQLSEQGVQ
FT                   VLSMRNKANRLEELFVSLVHEKQGDRA"
FT   gene            211607..212377
FT                   /locus_tag="SeAg_B0205"
FT   CDS_pept        211607..212377
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0205"
FT                   /product="ABC transporter, permease protein"
FT                   /note="identified by match to protein family HMM PF01061"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0205"
FT                   /db_xref="EnsemblGenomes-Tr:ACH51607"
FT                   /db_xref="GOA:B5F822"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/TrEMBL:B5F822"
FT                   /protein_id="ACH51607.1"
FT                   /translation="MMQLYWVALKSIWAKEIHRFMRIWVQTLVPPVITMTLYFIIFGNL
FT                   IGSRIGEMHGFSYMQFIVPGLIMMAVITNSYANVASSFFSAKFQRNIEELLVAPVPTHV
FT                   IIAGFVGGGVARGLCVGILVTAISLFFVPFQVHSWVFVALTLILTAILFSLAGLLNAVF
FT                   AKTFDDISLIPTFVLTPLTYLGGVFYSLTLLPPFWQGLSHLNPIVYMISGFRYGFLGIH
FT                   DVPLVTTFGVLVIFIAAFYLLCWSLIQRGRGLRS"
FT   gene            complement(212486..213562)
FT                   /locus_tag="SeAg_B0206"
FT   CDS_pept        complement(212486..213562)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0206"
FT                   /product="putative fimbriae"
FT                   /note="identified by match to protein family HMM PF00419"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0206"
FT                   /db_xref="EnsemblGenomes-Tr:ACH49948"
FT                   /db_xref="GOA:B5F823"
FT                   /db_xref="InterPro:IPR000259"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="InterPro:IPR036937"
FT                   /db_xref="UniProtKB/TrEMBL:B5F823"
FT                   /protein_id="ACH49948.1"
FT                   /translation="MKNLWMLLALALFSGHALAEGTMGNGSGWCQPTNGTHNFPFSFNQ
FT                   TITDTDGNQTGTIVEEHWSAGGEYSAKCDCDNSDYRGYNYFTATTGDLTQKGTHSETRY
FT                   YGHMDYYVLVAGKLEIGTEAYVAGKLNQNIPVPFSSISNEDSSAGGCGDAEMKSMTAGN
FT                   KGTVRIYITHPLVGEISIPQTTIMNLYLSKMPGSSGDNIPPAVPPVAHVTMSGTITVPQ
FT                   SCSINAGQVIEVRLPDIEGKDIRNLGDSPQNSHVTTQVNFTCSNVADGTNLSMSLNGET
FT                   DPHNPEYLKTDNENLGIRISDKYDKTIVPGGSAELPIEDYTDGKGSTEFTAAPVNTTGH
FT                   VPHTGEYQATATLEIQIR"
FT   gene            complement(213571..216117)
FT                   /locus_tag="SeAg_B0207"
FT   CDS_pept        complement(213571..216117)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0207"
FT                   /product="outer membrane usher protein FimD"
FT                   /note="identified by match to protein family HMM PF00577"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0207"
FT                   /db_xref="EnsemblGenomes-Tr:ACH50570"
FT                   /db_xref="GOA:B5F824"
FT                   /db_xref="InterPro:IPR000015"
FT                   /db_xref="InterPro:IPR025885"
FT                   /db_xref="InterPro:IPR025949"
FT                   /db_xref="InterPro:IPR037224"
FT                   /db_xref="InterPro:IPR042186"
FT                   /db_xref="UniProtKB/TrEMBL:B5F824"
FT                   /protein_id="ACH50570.1"
FT                   /translation="MRKRQHRVFYLSRCAVCIALGSTFAHVAWARDYFNPAFIENHGQA
FT                   SRTSVDLSTFDNDKSQLPGTYYVTININKTEIGARNVDFQLTTLSDGQQALQGCLRLQE
FT                   LKDNSVKTDLFPTLESEKGCVDLSVIPGASQRFDFQQQTLSVSIPQLYIANNARGYVPP
FT                   EKWQEGITALMLNYSFSGYKEYGSSEDSDDAESKYLALQPGFNLGPWRFRNYSNWSSNN
FT                   GESGSWNSVYNYLQRDIIALKSQFTAGDSNTPSDVFDSVPFRGLQLTSDDQMQPNSQRG
FT                   YAPTIRGIARSNAQVIVRQNGYIAYQTAVSPGEFEINDMFPTGSNGDYDVTVKEADGSE
FT                   QHFIVPYSSLPILQRTGRAKYSVTVGKYRDYNNHTLDDFGQATLLYGLPWGITLYGGSQ
FT                   IAGDKYQSVAFGVGQNMQMLGAISLDGIWSHAKFDDGRKEIGQSWRVRYSKGVVSTGTT
FT                   FSLAGYRYASENYNSLSEVINPDDDFYDNYGKRHNRFEASVNQQISDTLGSLTLSWVKE
FT                   DYWHSAQQMESLSASYNNSWGPVSYSLSYSYNKNTYQYRSDNDDDDNDDDRYNQNDRLF
FT                   TLSLHVPFTVFDSRLYASYMLNTRKHDATVNSTTLSGTALRDRNLNWSLQQSHSTQDGD
FT                   SGGVNASYKGTYANLNAGYNQSPDSQQVSYGISGGILAHENGITLSQPITGAAILIKAP
FT                   GASGVSVENQTGVATDFRGYTVIPNVTPYYRYDISLDSSTFADNVDIPLNNQTVYPTRN
FT                   AVVRASYDTHKGYRVLLTLTRSNGEPVPFGATASVDGQDANLASIVGDKGQVFLSGLPE
FT                   EGLLLVNWGSASCRADYRLDISKNMNGIVMANAVCQ"
FT   gene            complement(216144..216827)
FT                   /locus_tag="SeAg_B0208"
FT   CDS_pept        complement(216144..216827)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0208"
FT                   /product="chaperone protein FimC"
FT                   /note="identified by match to protein family HMM PF00345;
FT                   match to protein family HMM PF02753"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0208"
FT                   /db_xref="EnsemblGenomes-Tr:ACH48920"
FT                   /db_xref="GOA:B5F825"
FT                   /db_xref="InterPro:IPR001829"
FT                   /db_xref="InterPro:IPR008962"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR016147"
FT                   /db_xref="InterPro:IPR016148"
FT                   /db_xref="InterPro:IPR036316"
FT                   /db_xref="UniProtKB/TrEMBL:B5F825"
FT                   /protein_id="ACH48920.1"
FT                   /translation="MNSLAKAGLLCCLLCGSLAHAAGINIGTTRVIFHGDAKDASISIS
FT                   NNDNVPYLIQSWAQSISETGASGDAPFMVTPPLFRLNGGQKNVLRIIRTGGNLPEDRES
FT                   LYWLDIKSIPSSNPDNKHNTLMLAVKAEFKLIYRPKALTQKPEEVADRLTWSRQGRTLT
FT                   VKNPTPYYMNFATLSVGSQKVKAPRYVAPFGNAQYTLPAAASGPIVWSIINDFGGIGPE
FT                   HKQTP"
FT   gene            complement(216875..217408)
FT                   /locus_tag="SeAg_B0209"
FT   CDS_pept        complement(216875..217408)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0209"
FT                   /product="putative fimbrial subunit"
FT                   /note="identified by match to protein family HMM PF00419"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0209"
FT                   /db_xref="EnsemblGenomes-Tr:ACH49118"
FT                   /db_xref="GOA:B5F826"
FT                   /db_xref="InterPro:IPR000259"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="InterPro:IPR036937"
FT                   /db_xref="UniProtKB/TrEMBL:B5F826"
FT                   /protein_id="ACH49118.1"
FT                   /translation="MKLTLKTLTVALAAITLSPAALADTAKDGTVHITGLIKQNACTVK
FT                   TDSVEVTLQDEFASLFTAAGQTAGDKDFTIELENCDANVYSSVQARFEGTLDGTDATIL
FT                   KNEDDAENIGVQILDKSSTPMTFNDLQAWSAAVALTEGVTELSMPFTARYISTAVPVKS
FT                   GTVDATATFYLQYN"
FT   gene            complement(217422..217550)
FT                   /locus_tag="SeAg_B0210"
FT   CDS_pept        complement(217422..217550)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0210"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0210"
FT                   /db_xref="EnsemblGenomes-Tr:ACH49241"
FT                   /db_xref="UniProtKB/TrEMBL:B5F827"
FT                   /protein_id="ACH49241.1"
FT                   /translation="MYSEFFFAPQKSSDIIFTHSAIKRTITSHTIDIVTMSIFIIS"
FT   gene            complement(217577..217747)
FT                   /locus_tag="SeAg_B0211"
FT   CDS_pept        complement(217577..217747)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0211"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0211"
FT                   /db_xref="EnsemblGenomes-Tr:ACH50242"
FT                   /db_xref="UniProtKB/TrEMBL:B5F828"
FT                   /protein_id="ACH50242.1"
FT                   /translation="MMSACFFGRQYTMTTIIFYSKKFALFLKLLTAFIESGPLKGNHGD
FT                   SIKQTLTKIID"
FT   gene            217778..218218
FT                   /locus_tag="SeAg_B0212"
FT   CDS_pept        217778..218218
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0212"
FT                   /product="PTS system, IIA component"
FT                   /note="identified by match to protein family HMM PF03610"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0212"
FT                   /db_xref="EnsemblGenomes-Tr:ACH52323"
FT                   /db_xref="GOA:B5F829"
FT                   /db_xref="InterPro:IPR004701"
FT                   /db_xref="InterPro:IPR033887"
FT                   /db_xref="InterPro:IPR036662"
FT                   /db_xref="UniProtKB/TrEMBL:B5F829"
FT                   /protein_id="ACH52323.1"
FT                   /translation="MLGWVISCHDDRAQEMLEGLEKKYGPLAQCRAVNFWRGLSVNMLS
FT                   RMMCDALHATDSGEGVIFLTDISGAAPYRVASLMSHKHSQCEVISGVSYSLMEEMIPWR
FT                   ESMSSSAFRDQIVALGAPDVTSLWHQQQKNPPFVLLHDSYEF"
FT   gene            218286..219509
FT                   /locus_tag="SeAg_B0213"
FT   CDS_pept        218286..219509
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0213"
FT                   /product="polysaccharide deacetylase"
FT                   /note="identified by match to protein family HMM PF01522"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0213"
FT                   /db_xref="EnsemblGenomes-Tr:ACH49388"
FT                   /db_xref="GOA:B5F830"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:B5F830"
FT                   /protein_id="ACH49388.1"
FT                   /translation="MRVVLILLFFFAGNVLAALPARYMQTTKDAAIWSQIGDKMVTVGN
FT                   IRAGQILSVTPVAADYYAFKFGFGVGFIDKGHLESVQGKQKVEDGLGDLNKPLSNQNLV
FT                   TWKDTPVYNAPDISSAPFGVLVDNLRYPIISKLQGRLHQTWYQIRIGDRLAYVSAMDAQ
FT                   EDNGIPILTYHHILRDEENTRFRHTSTTTSVRAFSNQMTWLRDRGYATLTMYQLEDYIH
FT                   NRANFPARAVVITFDDGLKSVSRYAYPVLKQYGMKATAFIISSRIKRHPQTWNPRSLQF
FT                   MSVSELRKISDVFDFQSHTHFLHRVDGHRRPILYSRSYHNILFDFERSRRALAQFTPHV
FT                   FYLSYPFGGYNATAIKAAKDAGFHLAVTTVRGKVKPGDNPMLLKRLYILRTDSLETMSR
FT                   LISNQPQG"
FT   gene            complement(219516..219896)
FT                   /gene="panD"
FT                   /locus_tag="SeAg_B0214"
FT   CDS_pept        complement(219516..219896)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="panD"
FT                   /locus_tag="SeAg_B0214"
FT                   /product="aspartate 1-decarboxylase"
FT                   /EC_number="4.1.1.11"
FT                   /note="identified by match to protein family HMM PF02261;
FT                   match to protein family HMM TIGR00223"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0214"
FT                   /db_xref="EnsemblGenomes-Tr:ACH51716"
FT                   /db_xref="GOA:B5F831"
FT                   /db_xref="InterPro:IPR003190"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5F831"
FT                   /protein_id="ACH51716.1"
FT                   /translation="MIRTMLQGKLHRVKVTQADLHYEGSCAIDQDFLDASGILENEAID
FT                   IWNVTNGKRFSTYAIAAERGSRIISVNGAAAHCAEVGDIVIIASFVTMSDEEARTWRPK
FT                   VAYFEGDNEMKRTAKAIPVQVA"
FT   gene            complement(219991..220845)
FT                   /gene="panC"
FT                   /locus_tag="SeAg_B0215"
FT   CDS_pept        complement(219991..220845)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="panC"
FT                   /locus_tag="SeAg_B0215"
FT                   /product="pantoate--beta-alanine ligase"
FT                   /EC_number="6.3.2.1"
FT                   /note="identified by match to protein family HMM PF02569;
FT                   match to protein family HMM TIGR00018; match to protein
FT                   family HMM TIGR00125"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0215"
FT                   /db_xref="EnsemblGenomes-Tr:ACH51091"
FT                   /db_xref="GOA:B5F832"
FT                   /db_xref="InterPro:IPR003721"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR042176"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5F832"
FT                   /protein_id="ACH51091.1"
FT                   /translation="MLIIETLPLLRQHIRRLRQEGKRVALVPTMGNLHDGHMKLVDEAK
FT                   ARADVVIVSIFVNPMQFDRPDDLVRYPRTLQEDCEKLNKRKVDYVFAPAVEEIYPQGLE
FT                   GQTYVDVPGLSTMLEGASRPGHFRGVSTIVSKLFNLIQPDIACFGEKDFQQLALIRKMV
FT                   ADMSYDIEIVGVPIIRAKDGLALSSRNGYLTAEQRKIAPGLHNVMNSIAEKLIAGNREL
FT                   QEIIAIAEQELNEKGFRADDIQIRDADTLQELTETSKRAVILAAAWLGQARLIDNQSVT
FT                   LAQ"
FT   gene            complement(220971..221762)
FT                   /gene="panB"
FT                   /locus_tag="SeAg_B0216"
FT   CDS_pept        complement(220971..221762)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="panB"
FT                   /locus_tag="SeAg_B0216"
FT                   /product="3-methyl-2-oxobutanoate hydroxymethyltransferase"
FT                   /EC_number="2.1.2.11"
FT                   /note="identified by match to protein family HMM PF02548;
FT                   match to protein family HMM TIGR00222"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0216"
FT                   /db_xref="EnsemblGenomes-Tr:ACH49912"
FT                   /db_xref="GOA:B5F833"
FT                   /db_xref="InterPro:IPR003700"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5F833"
FT                   /protein_id="ACH49912.1"
FT                   /translation="MKPTTISLLQKCKQEKKRFATITAYDYSFAKLFADEGINVMLVGD
FT                   SLGMTIQGHDSTLPVTVEDIAYHTRAVRRGAPNCLLLSDLPFMAYATPEQACENAAIVM
FT                   RAGANMVKIEGGAWLVDTVKMLTERAVPVCGHLGLTPQSVNIFGGYKIQGRGDAGQMLL
FT                   DDALALEAAGAQLLVLECVPVELAKRVTEALSIPVIGIGAGNVTDGQILVMHDAFGITG
FT                   GHIPKFAKNFLAEAGDMRAAVRQYMAEVESGVYPGEEHSFH"
FT   gene            complement(221883..222362)
FT                   /gene="folK"
FT                   /locus_tag="SeAg_B0217"
FT   CDS_pept        complement(221883..222362)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folK"
FT                   /locus_tag="SeAg_B0217"
FT                   /product="2-amino-4-hydroxy-6-hydroxymethyldihydropteridine
FT                   pyrophosphokinase"
FT                   /EC_number="2.7.6.3"
FT                   /note="identified by match to protein family HMM PF01288;
FT                   match to protein family HMM TIGR01498"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0217"
FT                   /db_xref="EnsemblGenomes-Tr:ACH51459"
FT                   /db_xref="GOA:B5F834"
FT                   /db_xref="InterPro:IPR000550"
FT                   /db_xref="InterPro:IPR035907"
FT                   /db_xref="UniProtKB/TrEMBL:B5F834"
FT                   /protein_id="ACH51459.1"
FT                   /translation="MTIAYIALGSNLASPLEQVNAALKAIADIPDSRIVTVSSFYRTPP
FT                   LGPQDQPDYLNAAVALDTALAPEELLNHTQRIELQQGRVRKAERWGPRTLDLDIMLFGD
FT                   EVINTDRLTVPHYDMKNRGFMLWPLFEIAPELIFPDGISLHQHLTHLGAAKPAHW"
FT   gene            complement(222359..223723)
FT                   /locus_tag="SeAg_B0218"
FT   CDS_pept        complement(222359..223723)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0218"
FT                   /product="poly(A) polymerase (PAP) (Plasmid copy number
FT                   protein)"
FT                   /EC_number="2.7.7.19"
FT                   /note="identified by match to protein family HMM PF01743;
FT                   match to protein family HMM TIGR01942"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0218"
FT                   /db_xref="EnsemblGenomes-Tr:ACH50273"
FT                   /db_xref="GOA:B5F835"
FT                   /db_xref="InterPro:IPR002646"
FT                   /db_xref="InterPro:IPR010206"
FT                   /db_xref="InterPro:IPR025866"
FT                   /db_xref="InterPro:IPR032828"
FT                   /db_xref="UniProtKB/TrEMBL:B5F835"
FT                   /protein_id="ACH50273.1"
FT                   /translation="MLSREESEAEQAVARPHMTIIPREQHAISRKDISENALKVLYRLN
FT                   KAGYEAYLVGGGVRDLLLGKKPKDFDVTTNATPDQVRKLFRNCRLVGRRFRLAHVMFGP
FT                   EIIEVATFRGHHEGSESDRTTSQRGQNGMLLRDNIFGSIEEDAQRRDFTINSLYYSVAD
FT                   FTVRDYVGGMQDLQEGVIRLIGNPETRYREDPVRMLRAVRFAAKLNMRISPETAEPIPR
FT                   LATLLNDIPPARLFEESLKLLQAGNGYETYQQLREYHLFQPLFPTITRYFTENGDSAME
FT                   RIIAQVLKNTDNRIRNEMRVNPAFLFAAMFWYPLLEMAQKIAQESGLAYYDAFALAMND
FT                   VLDEACRSLAIPKRLTTLTRDIWQLQLRMSRRQGKRAWKLMEHPKFRAAFDLLELRAQV
FT                   ENNTELQRLAQWWAEFQASAPPEQKGMLNELDDDPAPRRRRSRPRKRAPRREGTV"
FT   gene            complement(223918..224859)
FT                   /locus_tag="SeAg_B0219"
FT   CDS_pept        complement(223918..224859)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0219"
FT                   /product="glutamyl-Q tRNA"
FT                   /EC_number="6.1.1.-"
FT                   /note="identified by match to protein family HMM PF00749"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0219"
FT                   /db_xref="EnsemblGenomes-Tr:ACH49728"
FT                   /db_xref="GOA:B5F836"
FT                   /db_xref="InterPro:IPR000924"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020058"
FT                   /db_xref="InterPro:IPR022380"
FT                   /db_xref="UniProtKB/TrEMBL:B5F836"
FT                   /protein_id="ACH49728.1"
FT                   /translation="MTGGSFPALFFIARSMTDSHYIGRFAPSPSGELHFGSLIAALGSY
FT                   LQARAQRGIWRVRIEDIDPPREVPGAAATILRQLEHYGLHWDGEVLWQSQRHEAYREAL
FT                   AWLHEQGLSYYCTCPRSRIQRLGGIYDGHCRTLCHGPENAAVRIKQQHPVMRFHDALRG
FT                   DIQADPQLASEDFIIHRRDGLFAYNLAVVVDDHFQGVTEIVRGADLIEPTVRQLSLYKQ
FT                   FGWRAPGYVHLPLALNEQGAKLSKQNHAPALATGDPRPVLVQALRFLGQRDVVAWQEMS
FT                   VEELLRFAVTHWRLTAVPTSANVNPAFSNASR"
FT   gene            complement(224883..225338)
FT                   /gene="dksA"
FT                   /locus_tag="SeAg_B0220"
FT   CDS_pept        complement(224883..225338)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dksA"
FT                   /locus_tag="SeAg_B0220"
FT                   /product="RNA polymerase-binding protein DksA"
FT                   /note="identified by match to protein family HMM PF01258;
FT                   match to protein family HMM TIGR02420"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0220"
FT                   /db_xref="EnsemblGenomes-Tr:ACH49203"
FT                   /db_xref="GOA:B5F837"
FT                   /db_xref="InterPro:IPR000962"
FT                   /db_xref="InterPro:IPR012784"
FT                   /db_xref="InterPro:IPR020458"
FT                   /db_xref="InterPro:IPR020460"
FT                   /db_xref="InterPro:IPR037187"
FT                   /db_xref="UniProtKB/TrEMBL:B5F837"
FT                   /protein_id="ACH49203.1"
FT                   /translation="MQEGQNRKTSSLSILAIAGVEPYQEKPGEEYMNEAQLSHFKRILE
FT                   AWRNQLRDEVDRTVTHMQDEAANFPDPVDRAAQEEEFSLELRNRDRERKLIKKIEKTLK
FT                   KVEDEDFGYCESCGVEIGIRRLEARPTADLCIDCKTLAEIREKQMAG"
FT   gene            complement(225515..226219)
FT                   /gene="sfsA"
FT                   /locus_tag="SeAg_B0221"
FT   CDS_pept        complement(225515..226219)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sfsA"
FT                   /locus_tag="SeAg_B0221"
FT                   /product="sugar fermentation stimulation protein"
FT                   /note="identified by match to protein family HMM PF03749;
FT                   match to protein family HMM TIGR00230"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0221"
FT                   /db_xref="EnsemblGenomes-Tr:ACH49242"
FT                   /db_xref="GOA:B5F838"
FT                   /db_xref="InterPro:IPR005224"
FT                   /db_xref="InterPro:IPR040452"
FT                   /db_xref="InterPro:IPR041465"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5F838"
FT                   /protein_id="ACH49242.1"
FT                   /translation="MLFSPPLQRATLIQRYKRFLADVITPDGTTLTLHCPNTGAMTGCA
FT                   TPGDTVWYSTSENTKRKYPHTWELTETQFGAFICVNTLRANQLTKEAIQENRLPALEGY
FT                   NILKSEVKYGAERSRIDFMLQADFRPDCYIEVKSVTLAEKENGYFPDAITERGQKHLRE
FT                   LMGVAAAGHRAVVVFAVLHSAITRFSPARHIDIKYAQLLSEAQNKGVEVLAYKAELSAQ
FT                   KMELNEPVPITL"
FT   gene            complement(226236..226766)
FT                   /locus_tag="SeAg_B0222"
FT   CDS_pept        complement(226236..226766)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0222"
FT                   /product="2'-5' RNA ligase"
FT                   /EC_number="6.5.1.-"
FT                   /note="identified by match to protein family HMM PF02834;
FT                   match to protein family HMM TIGR02258"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0222"
FT                   /db_xref="EnsemblGenomes-Tr:ACH52738"
FT                   /db_xref="GOA:B5F839"
FT                   /db_xref="InterPro:IPR004175"
FT                   /db_xref="InterPro:IPR009097"
FT                   /db_xref="InterPro:IPR014051"
FT                   /db_xref="UniProtKB/TrEMBL:B5F839"
FT                   /protein_id="ACH52738.1"
FT                   /translation="MSEPKRLFFAIDLPDDARAQIIAWRAAHFASEDGRPVAAANLHLT
FT                   LAFLGDVSSDKQRALAQLAGRIRQPGFTLHLDDAGQWLRSRVVWLGMRQPPRGLLQLAN
FT                   MLRAQAARSGCYQSPQPFHPHITLLRDASHTVAIPPPGFCWSFPVTSFALYASSYGQGR
FT                   TRYAELQRWTLGE"
FT   gene            226794..229268
FT                   /gene="hrpB"
FT                   /locus_tag="SeAg_B0223"
FT   CDS_pept        226794..229268
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hrpB"
FT                   /locus_tag="SeAg_B0223"
FT                   /product="ATP-dependent helicase HrpB"
FT                   /EC_number="3.6.1.-"
FT                   /note="identified by match to protein family HMM PF00270;
FT                   match to protein family HMM PF00271; match to protein
FT                   family HMM PF04408; match to protein family HMM PF08482;
FT                   match to protein family HMM TIGR01970"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0223"
FT                   /db_xref="EnsemblGenomes-Tr:ACH48816"
FT                   /db_xref="GOA:B5F840"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR007502"
FT                   /db_xref="InterPro:IPR010225"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR013689"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B5F840"
FT                   /protein_id="ACH48816.1"
FT                   /translation="MLQCGAKKVNPVEPFVTSLPVAAVLPELLTALKTAPQVLLSAPTG
FT                   AGKSTWLPLQLLQQGPVAGKILLLEPRRLAARNVAQRLAEALNEKPGETVGYRMRAQSC
FT                   VGPRTRLEVVTEGVLTRMIQRDPELRGVGLVILDEFHERSLQADLALALLLDIQQGLRD
FT                   DLRLLIMSATLDNDRLCQRLPDAPTIVSEGRAFPVERRYQPLAAHLRFDEAVAMATAEL
FT                   LRNENGSLLLFLPGVGEIQRVHEHLASRVGSDVLLCPLYGALSLEAQRKAIVPAPAGMR
FT                   KVVLATNIAETSLTIEGIRLVVDSAQERVARFDARTGLTRLVMQRISQASMTQRAGRAG
FT                   RLAPGICLHLLAKEQAERAAAQSDPEILHSDLSGLLMEVLQWGCHDPASLFWLDRPPEV
FT                   NLQAARRLLLMLGALEGERLSARGRKMAAMGNDPRLAAMLVNADEGDSAATAAMLAAIL
FT                   EDPPRGGGTDLSVLFSRRQPGWQQRSQQLLKRLQVRNGEPDSALIMPLLARAFSDRIAR
FT                   RRGQEGRYQLANGMGTMLDADDALGRHEWLIAPLLLQGSASPDARILLAQPLDIASLIQ
FT                   ACPDLLRQSDTVEWDEAQGTLKAWRRMRIGQLTVSVQPLAKPSEEELHQAMLNGIRDRG
FT                   LAVLNWTPEAEQFRLRLHCAAKWLPEYDWPAVDEASLLATLENWLLPHMTGVQSLRSLK
FT                   SLNVTQALRGLLDYAMLQRLDSELPGHYTVPTGSRITIRYHEDNPPALAVRMQEMFGEA
FT                   KTPTIAQGRVSLVLELLSPAQRPLQITRDLSAFWQGAYREVQKEMKGRYPKHVWPDDPA
FT                   NTAPTRRTKKYS"
FT   gene            229270..229422
FT                   /locus_tag="SeAg_B0224"
FT   CDS_pept        229270..229422
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0224"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0224"
FT                   /db_xref="EnsemblGenomes-Tr:ACH51806"
FT                   /db_xref="UniProtKB/TrEMBL:B5F841"
FT                   /protein_id="ACH51806.1"
FT                   /translation="MLYVASRPDKALIAIRQKGKLRDFFFCRLAEEYRIGPLRLYVAEK
FT                   KHGGE"
FT   gene            229409..231931
FT                   /gene="mrcB"
FT                   /locus_tag="SeAg_B0225"
FT   CDS_pept        229409..231931
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mrcB"
FT                   /locus_tag="SeAg_B0225"
FT                   /product="penicillin-binding protein 1B"
FT                   /note="identified by match to protein family HMM PF00905;
FT                   match to protein family HMM PF00912; match to protein
FT                   family HMM TIGR02071"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0225"
FT                   /db_xref="EnsemblGenomes-Tr:ACH52403"
FT                   /db_xref="GOA:B5F842"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR011813"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR028166"
FT                   /db_xref="InterPro:IPR032730"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/TrEMBL:B5F842"
FT                   /protein_id="ACH52403.1"
FT                   /translation="MAGNDREPIGRKGKPSRPVKQKVSRRRQHDDDYDDDYEDEEPMPR
FT                   KGKGKGRKPRGKRGWLWLLLKLFIVFVVLFAIYGVYLDQKIRSRIDGKVWQLPAAVYGR
FT                   MVNLEPDMPVSKNEMVKLLEATQYRLVTKMTRPGEFTVQANSIEMIRRPFDFPDSKEGQ
FT                   VRARLTFSDGRLETIVNLDNNRQFGFFRLDPRLITMLSSPNGEQRLFVPRSGFPDLLVD
FT                   TLLATEDRHFYEHDGISLYSIGRAVLANLTAGRTVQGASTLTQQLVKNLFLSSERSYWR
FT                   KANEAYMALIMDARYSKDRILELYMNEVYLGQSGDNEIRGFPLASLYYFGRPVEELSLD
FT                   QQALLVGMVKGASIYNPWRNPKLALERRNLVLRLLQQQKIIDQELYDMLSARPLGVQPR
FT                   GGVISPQPAFMQMVRQELQAKLGDKIKDLSGVKIFTTFDSVAQDAAEKAVVEGIPALKK
FT                   QRKLSDLETAMVVVDRFSGEVRAMVGGAEPQYAGYNRAMQARRSIGSLAKPATYLTALS
FT                   QPNLYRLNTWIADAPISLRQPNGQVWSPQNDDRRYSESGKVMLVDALTRSMNVPTVNLG
FT                   MALGLPAVTDTWTKLGVPKDQLNPVPAMLLGALNLTPIEVAQAFQTIASGGNRAPLSAL
FT                   RSVIAEDGKVLYQSYPQAERAVPAQAAYLTLWTMQQVVQRGTGRQLGAKYPGLHLAGKT
FT                   GTTNNNVDTWFAGIDGSQVTITWVGRDNNQPTKLYGASGAMAIYQRYLANQTPTPLVLT
FT                   PPEDVVDMGVDYDGNFVCSGGMRTLPVWTDDPNTLCQQGEMMQQQQQPSGNPFDQSSQP
FT                   QQPAQQQPPKEEKSDGVAGWIKEMFGGN"
FT   gene            complement(232070..232210)
FT                   /locus_tag="SeAg_B0226"
FT   CDS_pept        complement(232070..232210)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0226"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0226"
FT                   /db_xref="EnsemblGenomes-Tr:ACH51261"
FT                   /db_xref="UniProtKB/TrEMBL:B5F843"
FT                   /protein_id="ACH51261.1"
FT                   /translation="MKVNDNVNDNYYYNRSMIGEISSQWQAIRGPTKTKGLRNNQMKRK
FT                   G"
FT   gene            232224..234467
FT                   /gene="fhuA"
FT                   /locus_tag="SeAg_B0227"
FT   CDS_pept        232224..234467
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fhuA"
FT                   /locus_tag="SeAg_B0227"
FT                   /product="ferrichrome-iron receptor"
FT                   /note="identified by match to protein family HMM PF00593;
FT                   match to protein family HMM PF07715; match to protein
FT                   family HMM TIGR01783"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0227"
FT                   /db_xref="EnsemblGenomes-Tr:ACH51827"
FT                   /db_xref="GOA:B5F844"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010105"
FT                   /db_xref="InterPro:IPR010916"
FT                   /db_xref="InterPro:IPR010917"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039423"
FT                   /db_xref="UniProtKB/TrEMBL:B5F844"
FT                   /protein_id="ACH51827.1"
FT                   /translation="MARLKTAQPNSSLRKIAVVVATAVSGMSVYAQAAVQPKEETITVT
FT                   AAPAAQESAWGPAATIAARQSATATKTDTPIQKVPQSISVVTAEEMALHQPKSVKEALS
FT                   YTPGVAVGTRGASNTYDYLIIRGFAADGQSQNNYLNGLKMQGNFYNDAVIDPYMLERAE
FT                   VMRGPVSVLYGKSSPGGLLNMVSKRPTTEPLKEIQFKMGTDSLFQTGFDFSDALDEEGV
FT                   YSYRLTGLARSANAQQDRAEEQRYAIAPAFTWRPDDKTNFTFLSYFQNEPETGYYGWLP
FT                   KEGTVEPLPNGKRLPTDFNEGAKNNTYSRNEKMVGYSFDHEFNDTFTVRQNLRYAENKV
FT                   SQNSVYGYGVCSDPANRDSKQCAALAPADKGHYLARKYVVDDEKLQNFSVDTQLQSKFA
FT                   TGEVDHTLLTGVDFMRMRNDINAWFGYDDSVPLLDLYNPVYTDFDFASRDPATSGPYQI
FT                   LNKQKQTGLYVQDQAQWDKVLVTLGGRYDWADQESLNRTTGITSKRDDKQFTWRGGVNY
FT                   LFDNGITPYFSYSESFEPASQTGENGKIFAPSKGKQYEAGVKYVPNDRPIVITGAVYQL
FT                   TKTNNLMADPAGSFFSVEGGEIRARGVELEAKAALSASINVVGSYTYTDAEYTTDTTYK
FT                   GNTPAQVPKHMASLWGDYTFFDGPLSGLTLGTGGRFTGSSYGDPANSFKVGSYTVVDAL
FT                   VRYDLARVGMAGSNVALHVNNLFDREYVASCFQTYGCFWGAERQVVATATFRF"
FT   gene            234516..235313
FT                   /gene="fhuC"
FT                   /locus_tag="SeAg_B0228"
FT   CDS_pept        234516..235313
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fhuC"
FT                   /locus_tag="SeAg_B0228"
FT                   /product="ferrichrome ABC transporter, ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0228"
FT                   /db_xref="EnsemblGenomes-Tr:ACH49195"
FT                   /db_xref="GOA:B5F8Q4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B5F8Q4"
FT                   /protein_id="ACH49195.1"
FT                   /translation="MQENHIHSDTTFALRSVAFRVPGRTLLHPLSLTFPAGRVTGLIGH
FT                   NGSGKSTLLKMLGRHQPPSEGDILLDNQPLASWSSKAFARKVAYLPQQLPQAEGMTVRE
FT                   LVAIGRYPWHGALGRFGVADREKVDEAITLVGLKPLAHRLVDSLSGGERQRAWIAMLVA
FT                   QDSRCLLLDEPTSALDIAHQVDVLALVHRLSQQRGLTVVAVLHDINMAARYCDYLVALR
FT                   GGEMIAQGTPAELMRSDTLERIYGIPMGILPHPAGAAPVSFVY"
FT   gene            235313..236203
FT                   /locus_tag="SeAg_B0229"
FT   CDS_pept        235313..236203
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0229"
FT                   /product="ferrichrome-binding periplasmic protein"
FT                   /note="identified by match to protein family HMM PF01497"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0229"
FT                   /db_xref="EnsemblGenomes-Tr:ACH49655"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:B5F8Q5"
FT                   /protein_id="ACH49655.1"
FT                   /translation="MRDLYPLTRRRLLTAMALSPLLWQMNTAQAAAIDPRRIVALEWLP
FT                   VELLLALGITPYGVADVPNYKLWVSEPPLPDSVIDVGLRTEPNLELLTEMKPSFMVWSA
FT                   GYGPSPEKLARIAPGRGFDFSDGKKPLAVARRSLVELAQTLNLEAAAEKHLAQYDRFIA
FT                   SQKPHFIRRGGRPLLMTTLIDPRHMLVLGPNCLFQEVLDEYGIVNAWQGETNFWGSTAV
FT                   SLDRLAMYKEADVICFDHGNSTDMNALMATPLWQAMPFVRAGRFHRVPAVWFYGATLST
FT                   MHFVRILNNVLGGKA"
FT   gene            236200..238257
FT                   /locus_tag="SeAg_B0230"
FT   CDS_pept        236200..238257
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0230"
FT                   /product="ferrichrome transport system permease protein
FT                   FhuB"
FT                   /note="identified by match to protein family HMM PF01032;
FT                   match to protein family HMM TIGR01409"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0230"
FT                   /db_xref="EnsemblGenomes-Tr:ACH48672"
FT                   /db_xref="GOA:B5F8Q6"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:B5F8Q6"
FT                   /protein_id="ACH48672.1"
FT                   /translation="MSRKREMPDGGAKNALSDLRFGRFVGRIRRSRHPALLLLALFVAA
FT                   CWLTWVNFSVALPRSQWQQAIWSPDIDIIEQMIFHYSLLPRLAISLLVGAGLGLVGVLF
FT                   QQVLRNPLAEPTTLGVATGAQLGITVTTLWAIPGALTTQFAALTGACIVGALVFGVAWG
FT                   KRLSPVTLILAGLVVSLYCGAINQLLVIFHHDQLQSMFLWSTGTLTQTDWSGVQRLWPQ
FT                   LLGGVMLTLLLLRPMTLMGLDDGVARNLGLALSLARLAALSLAIVLSALLVNAVGIIGF
FT                   IGLFAPLLAKMLGARRLLARLMLAPLIGALILWLSDQIILWLTRVWMEVSTGSVTALIG
FT                   APLLLWLLPRLKSMSAPDMNASDRVAAERRHVLAFAVAGGVLLLLATWGALSFGRDAHG
FT                   WTWASGTLLEELMPWRWPRILAALIAGVMLAVAGCIIQRLTGNPMASPEVLGISSGAAF
FT                   GVVLMLFLVPGNAFGWLLPAGSLGAAATLLIIMIAAGRGGFSPQRMLLAGMALSTAFTM
FT                   LLMMLQASGDPRMAEVLTWIAGSTYNATGGQVTRTAIVMVILLAIVPLCRRWLTILPLG
FT                   GDAARAVGMALTPSRIALLALAACLTATATMTIGPLSFVGLMAPHIARMLGFRRTMPHM
FT                   VISALAGGVLLVFADWCGRMALFPYQIPAGLLSSFIGAPYFIYLLRKQSR"
FT   gene            238894..239010
FT                   /locus_tag="SeAg_B0231"
FT   CDS_pept        238894..239010
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0231"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0231"
FT                   /db_xref="EnsemblGenomes-Tr:ACH51808"
FT                   /db_xref="UniProtKB/TrEMBL:B5F8Q7"
FT                   /protein_id="ACH51808.1"
FT                   /translation="MFFWLSRLACFVCFLNDKKYLLFNADDPLNKKHLSLGF"
FT   gene            239198..239758
FT                   /locus_tag="SeAg_B0232"
FT   CDS_pept        239198..239758
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0232"
FT                   /product="putative fimbrial subunit"
FT                   /note="identified by match to protein family HMM PF00419"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0232"
FT                   /db_xref="EnsemblGenomes-Tr:ACH49171"
FT                   /db_xref="GOA:B5F8Q8"
FT                   /db_xref="InterPro:IPR000259"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="InterPro:IPR036937"
FT                   /db_xref="UniProtKB/TrEMBL:B5F8Q8"
FT                   /protein_id="ACH49171.1"
FT                   /translation="MNTAVKAAVAAALVMGVSSFANAAGSNTGTVTFTGTIEDSPCSIV
FT                   VGDEHQTVNLGHIGTGSLMGGKESSKVDFHIGLENCAFTTEKEASTVFSAIGNESSANP
FT                   GSVALMRIGGGEMAGSSIVIGNHLGSAIKLGDAYSENLTMNGSVAAAKQTLNFKAWVKG
FT                   DSAATTIDTGEFSSTVNFTISYL"
FT   gene            239844..242501
FT                   /locus_tag="SeAg_B0233"
FT   CDS_pept        239844..242501
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0233"
FT                   /product="fimbrial usher protein"
FT                   /note="identified by match to protein family HMM PF00577"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0233"
FT                   /db_xref="EnsemblGenomes-Tr:ACH48705"
FT                   /db_xref="GOA:B5F8Q9"
FT                   /db_xref="InterPro:IPR000015"
FT                   /db_xref="InterPro:IPR018030"
FT                   /db_xref="InterPro:IPR025885"
FT                   /db_xref="InterPro:IPR025949"
FT                   /db_xref="InterPro:IPR037224"
FT                   /db_xref="InterPro:IPR042186"
FT                   /db_xref="UniProtKB/TrEMBL:B5F8Q9"
FT                   /protein_id="ACH48705.1"
FT                   /translation="MAHYKKFRLSTLAAVVGIVLAVGPENSYAEAPIQFNTRFLDVKDD
FT                   ASLDLSRFSRKGYIMPGSYHLQVLVNQSQIAQDNIITYSVDNNDPDNTYPCLSPELVSL
FT                   LGLKPEIADKMIWINAGQCLQPEQLEGMETQTDLSQSTLTVIIPQAYLEYSDEEWDPPS
FT                   RWDEGIPGVLFDYNVNSQWRHAEHDDGDEYDISGNGTVGANLGAWRLRADWQANYRHEN
FT                   DSEDKDNFGSSSEQNWDWNRYYAWRAIPQLRAQLTLGEGSLESDIFDGFNYVGGSLITD
FT                   DQMLPPNLRGYAPDISGVARTNAKVTVTQRGRVIYESQVPAGPFRIQDINETVSGDLHV
FT                   KIEEQSGQVQEYDVSTASIPFLTRPGQVRYKLAAGRPQDWDHNMEGGFFTSAEASWGIA
FT                   NGWSLYGGAIGEQDYQALALGLGRDLALLGAFSVDVTHSRATLPEGSAYGDGTIQGNSF
FT                   RASYAKDFDDIDSRLTFAGYRFSEENYMTMDEFIDTHNDDNDRQRTGHDKEMYTLTYSQ
FT                   NFSAINVNAYINYTHRTYWNQPNQDSYNLTLSHYFDVGEVRGISLSVNGFRNEYDNERD
FT                   DGVYVSLSIPWGNNRTLSYNGSFSDDNNSNQVGYYERIDDRNNYQINAGRADNGATLDG
FT                   YYRHQASYADIDVSANYQEGDYTSGGLNIQGGATLTAKGGALHRTSVNGGSRLLVDVGD
FT                   EANVPISGYSTPVYTNAFGKAVIVDVNDYYRNQVKIDITQLPEDAEATLSIAQATLTEG
FT                   AIGYRRLEVLSGKKAMASIRLRDGGTPPFGAEVYNSRQQQLGIVGEDGSVYLIGINPGE
FT                   RLQVTWEGKTQCEAALPDPLPGDLFSGLLLPCIGDASSPEATQPAEKPLLQLHTQRLTS
FT                   STQPEALSSRYPTH"
FT   gene            242519..243271
FT                   /locus_tag="SeAg_B0234"
FT   CDS_pept        242519..243271
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0234"
FT                   /product="chaperone protein PapD"
FT                   /note="identified by match to protein family HMM PF00345"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0234"
FT                   /db_xref="EnsemblGenomes-Tr:ACH49734"
FT                   /db_xref="GOA:B5F8R0"
FT                   /db_xref="InterPro:IPR001829"
FT                   /db_xref="InterPro:IPR008962"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR016147"
FT                   /db_xref="InterPro:IPR016148"
FT                   /db_xref="InterPro:IPR018046"
FT                   /db_xref="InterPro:IPR036316"
FT                   /db_xref="UniProtKB/TrEMBL:B5F8R0"
FT                   /protein_id="ACH49734.1"
FT                   /translation="MMPLKRYNLAAVLLLLLGGYGSAQAAIAPDRTRLVFRGEDKSISV
FT                   DLKNANSKLPYLAQSWVEDEKGVKITSPLIVVPPVQRIEPSAIGQVKIQGMPALASLPQ
FT                   DRETLFYYNVREIPPQSDKPNTLQIALQTRIKVFYRPQALSKIDMQHPWQYKITLQRQG
FT                   NGYQVSNPTGYYVVLSNASNRMDGTPARGFSPLVIAPKSNVTLGGDASELGHSPVLTYV
FT                   NDYGARLPLIFNCTDNSCAVDEAKSRKS"
FT   gene            243290..243802
FT                   /locus_tag="SeAg_B0235"
FT   CDS_pept        243290..243802
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0235"
FT                   /product="putative minor fimbrial subunit"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0235"
FT                   /db_xref="EnsemblGenomes-Tr:ACH49186"
FT                   /db_xref="GOA:B5F8R1"
FT                   /db_xref="InterPro:IPR000259"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="InterPro:IPR036937"
FT                   /db_xref="UniProtKB/TrEMBL:B5F8R1"
FT                   /protein_id="ACH49186.1"
FT                   /translation="MRQWRLRLGTVTCAAMLSAVSMPLAAGSKTVNMTLTIVVNAAPPC
FT                   TVTGGEVEFGNVLTTKVDGVNYRQAVGYRLSCNGRVSDYLKLQIQGNAVTINGESVLQT
FT                   DVDGLGIRLQTATDGALISPGNTQWLSFQYSGGSGPAIEAIPVKNNGVTLTGGAFNAGA
FT                   TLVVDYQ"
FT   gene            243799..244275
FT                   /locus_tag="SeAg_B0236"
FT   CDS_pept        243799..244275
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0236"
FT                   /product="fimbrial subunit"
FT                   /note="identified by match to protein family HMM PF00419"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0236"
FT                   /db_xref="EnsemblGenomes-Tr:ACH51009"
FT                   /db_xref="GOA:B5F8R2"
FT                   /db_xref="InterPro:IPR000259"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="InterPro:IPR036937"
FT                   /db_xref="UniProtKB/TrEMBL:B5F8R2"
FT                   /protein_id="ACH51009.1"
FT                   /translation="MKKMALIVLISSSFAAQSAENLKFHGTLISPPNCTINNDQTIDVE
FT                   FGNLLINKIDGTRYAQNVPYEITCDSTVRDETMAMTLTLSGSVSDFNPAAVNTSVAGLG
FT                   IELRQNDQPFTLGSTITVNEQSIPVLKAIPVKKSGASLKEGGFDATATLQVDYQ"
FT   gene            244275..244805
FT                   /locus_tag="SeAg_B0237"
FT   CDS_pept        244275..244805
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0237"
FT                   /product="minor fimbrial subunit StfG"
FT                   /note="identified by match to protein family HMM PF00419"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0237"
FT                   /db_xref="EnsemblGenomes-Tr:ACH50414"
FT                   /db_xref="GOA:B5F8R3"
FT                   /db_xref="InterPro:IPR000259"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="InterPro:IPR036937"
FT                   /db_xref="UniProtKB/TrEMBL:B5F8R3"
FT                   /protein_id="ACH50414.1"
FT                   /translation="MAKRQALLHGAACILCGALILPVSAADNLHFSGSLVASPCTLTMQ
FT                   GTGIAEVDFSSLDSSDFTPDGQSARKPLVFELTDCDSALSNGVQVTFTGTEATGMRGIL
FT                   AIDSHSGASGIGIGIETLSGVPVGMNDEEGAIFTLVTGNNALSLNAWVQRLPGEDLVPG
FT                   TFFASALVTFEYL"
FT   gene            244802..245647
FT                   /locus_tag="SeAg_B0238"
FT   CDS_pept        244802..245647
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0238"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0238"
FT                   /db_xref="EnsemblGenomes-Tr:ACH51657"
FT                   /db_xref="InterPro:IPR021407"
FT                   /db_xref="UniProtKB/TrEMBL:B5F8R4"
FT                   /protein_id="ACH51657.1"
FT                   /translation="MMKIIRTLFLLLIAVYGSSVVAKPMLKATFSSTTLYYGIGPSTFD
FT                   RSILLNVMVDTHDGVYYGTWQLGGVFKNRPVPLQSWSGPEPAPTVVLRDFDNSVARSSC
FT                   QNMPASWHDCGSFTVDITVQSDDYGCPWLATSRVTAADGISGETYSPPDTRSSVCPKVP
FT                   VDTFDISWDANVSKQKTTLMLDATGGTVNRTLHTYLMEGGKLCDGSKFDDRGAYCRFVS
FT                   SGITLNVLGCDQSSVTTSAVDHPITDVELHDINVAVNTRNIGSGQFTSTCSFQYIIDEL
FT                   "
FT   gene            complement(245746..247026)
FT                   /gene="hemL"
FT                   /locus_tag="SeAg_B0239"
FT   CDS_pept        complement(245746..247026)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemL"
FT                   /locus_tag="SeAg_B0239"
FT                   /product="glutamate-1-semialdehyde-2,1-aminomutase"
FT                   /EC_number="5.4.3.8"
FT                   /note="identified by match to protein family HMM PF00202;
FT                   match to protein family HMM TIGR00713"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0239"
FT                   /db_xref="EnsemblGenomes-Tr:ACH51149"
FT                   /db_xref="GOA:B5F8R5"
FT                   /db_xref="InterPro:IPR004639"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5F8R5"
FT                   /protein_id="ACH51149.1"
FT                   /translation="MSKSENLYSAARELIPGGVNSPVRAFTGVGGTPLFIEKADGAYLY
FT                   DVDGKAYIDYVGSWGPMVLGHNHPAIRNAVIEAAERGLSFGAPTEMEVKMAELVTNLVP
FT                   TMDMVRMVNSGTEATMSAIRLARGFTGRDKIIKFEGCYHGHADCLLVKAGSGALTLGQP
FT                   NSPGVPADFAKHTLTCTYNNLASVRAAFEQYPQEIACIIVEPVAGNMNCVPPLPEFLPG
FT                   LRALCDEFGALLIIDEVMTGFRVALAGAQDYYGVVPDLTCLGKIIGGGMPVGAFGGRRD
FT                   VMDALAPTGPVYQAGTLSGNPIAMAAGFACLNEVAQPGIHETLDELTTRLAEGLLEAAE
FT                   EANIPLVVNHVGGMFGIFFTDAESVTCYQDVMACDVERFKRFFHLMLEEGVYLAPSAFE
FT                   AGFMSVAHSMDDINNTIDAARRVFATL"
FT   gene            247053..247196
FT                   /pseudo
FT                   /locus_tag="SeAg_B0240"
FT                   /note="conserved hypothetical protein; this gene contains a
FT                   frame shift which may be the result of sequencing error"
FT   gene            247196..248617
FT                   /locus_tag="SeAg_B0241"
FT   CDS_pept        247196..248617
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0241"
FT                   /product="H(+)/Cl(-) exchange transporter ClcA (ClC-ec1)"
FT                   /note="identified by match to protein family HMM PF00654"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0241"
FT                   /db_xref="EnsemblGenomes-Tr:ACH49772"
FT                   /db_xref="GOA:B5F8R6"
FT                   /db_xref="InterPro:IPR001807"
FT                   /db_xref="InterPro:IPR014743"
FT                   /db_xref="InterPro:IPR023861"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5F8R6"
FT                   /protein_id="ACH49772.1"
FT                   /translation="MKTDTSTFLAQQIVRLRRRDQIRRLMQRDKTPLAILFMAAVVGTL
FT                   TGLVGVAFEKAVSWVQNMRIGALVQVADHAFLLWPLAFILSALLAMVGYFLVRKFAPEA
FT                   GGSGIPEIEGALEELRPVRWWRVLPVKFIGGMGTLGAGMVLGREGPTVQIGGNLGRMVL
FT                   DVFRMRSAEARHTLLATGAAAGLSAAFNAPLAGILFIIEEMRPQFRYNLISIKAVFTGV
FT                   IMSSIVFRIFNGEAPIIEVGKLSDAPVNTLWLYLILGIIFGCVGPVFNSLVLRTQDMFQ
FT                   RFHGGEIKKWVLMGGAIGGLCGILGLIEPEAAGGGFNLIPIAAAGNFSVGLLLFIFIAR
FT                   VVTTLLCFSSGAPGGIFAPMLALGTLLGTAFGMAAAVLFPQYHLEAGTFAIAGMGALMA
FT                   ASVRAPLTGIVLVLEMTDNYQLILPMIITCLGATLLAQFLGGKPLYSTILARTLAKQDA
FT                   EQAAKNQNAPAGENT"
FT   gene            248699..249043
FT                   /gene="yadR"
FT                   /locus_tag="SeAg_B0242"
FT   CDS_pept        248699..249043
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yadR"
FT                   /locus_tag="SeAg_B0242"
FT                   /product="iron-sulfur cluster assembly accessory protein
FT                   YadR"
FT                   /note="identified by match to protein family HMM PF01521;
FT                   match to protein family HMM TIGR00049"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0242"
FT                   /db_xref="EnsemblGenomes-Tr:ACH49119"
FT                   /db_xref="GOA:B5F8R7"
FT                   /db_xref="InterPro:IPR000361"
FT                   /db_xref="InterPro:IPR016092"
FT                   /db_xref="InterPro:IPR017870"
FT                   /db_xref="InterPro:IPR023063"
FT                   /db_xref="InterPro:IPR035903"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5F8R7"
FT                   /protein_id="ACH49119.1"
FT                   /translation="MSDDVALPLQFTDAAANKVKSLIADEDNPNLKLRVYITGGGCSGF
FT                   QYGFTFDDQVNEGDMTIEKQGVGLVVDPMSLQYLVGGSVDYTEGLEGSRFIVTNPNAKS
FT                   TCGCGSSFSI"
FT   gene            249298..250284
FT                   /locus_tag="SeAg_B0243"
FT   CDS_pept        249298..250284
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0243"
FT                   /product="invertase"
FT                   /note="identified by match to protein family HMM PF01548;
FT                   match to protein family HMM PF02371"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0243"
FT                   /db_xref="EnsemblGenomes-Tr:ACH48485"
FT                   /db_xref="GOA:B5F098"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:B5F098"
FT                   /protein_id="ACH48485.1"
FT                   /translation="MCTLGIDVSKNKIDLCLLTAGPGGKKKHKVLTNEPAVARKVVDWL
FT                   NAQKCVPESVTVVLEATGIYHENLAYGLHEAGVSVCMANPCRVREFAHGMDILNKNDAV
FT                   DAFVLACYGELKSPAVWVPPSPEVRKLRALLRQRDALREDVQRTVNRLEKANSTSTPQE
FT                   VIRSLERTKSWLNEELARIEKLITDHTDNDPGLKADLDLLKSIKGVKDQVGREMLALLK
FT                   DGMFKSASQVAAYLGLTPVEKTSGSSVRGRPHMSKTGPSGVRAKLYVAALTASRWNKQA
FT                   KAIYERLVAKGKAKKAALGAVMRKLVHLCFGVLKTRLPWDENYVATA"
FT   gene            complement(250355..250978)
FT                   /locus_tag="SeAg_B0244"
FT   CDS_pept        complement(250355..250978)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0244"
FT                   /product="inner membrane protein YadS"
FT                   /note="identified by match to protein family HMM PF03458"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0244"
FT                   /db_xref="EnsemblGenomes-Tr:ACH50547"
FT                   /db_xref="GOA:B5F8R9"
FT                   /db_xref="InterPro:IPR005115"
FT                   /db_xref="UniProtKB/TrEMBL:B5F8R9"
FT                   /protein_id="ACH50547.1"
FT                   /translation="MLVYWLDIVGTAVFAISGVLLAGKLRMDPFGVLVLGVVTAVGGGT
FT                   IRDMALDNGPVFWVKDPTDLVVAMVTSMLTILLVRQPRRLPKWMLPVLDAVGLAVFVGI
FT                   GVNKAFLAETGPLVAVCMGVITGVGGGIIRDVLAREIPMILRTEIYATACIIGGIVHAT
FT                   AFYTFSVPLESASMMGMVVTLFIRLAAIRWHLKLPTFALDENGR"
FT   gene            complement(251015..251815)
FT                   /locus_tag="SeAg_B0245"
FT   CDS_pept        complement(251015..251815)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0245"
FT                   /product="cobalamin periplasmic binding protein"
FT                   /note="identified by match to protein family HMM PF01497"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0245"
FT                   /db_xref="EnsemblGenomes-Tr:ACH49760"
FT                   /db_xref="GOA:B5F8S0"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="InterPro:IPR023544"
FT                   /db_xref="UniProtKB/TrEMBL:B5F8S0"
FT                   /protein_id="ACH49760.1"
FT                   /translation="MAKQMFRALVALLLTLPVWLYAAPRVITLSPANTELAFAAGITPV
FT                   GVSSYSDYPPEAQKIEQVSTWQGMNLERIVALKPDLVVAWRGGNAERQVNQLTSLGIKV
FT                   MWVDAVSIEQIADTLRQLAAWSPQPEKAQQAAQTLLNEYAALNAEYAGKAKKRVFLQFG
FT                   MNPLFTSGKGSIQHQVLTTCGGENVFADSRVPWPQVSREQVLARHPQAIIVAGKAGEIL
FT                   KIEQYWGNLLKIPVIPLNSDWFERASPRIILAAKQLCNALSQVN"
FT   gene            complement(251808..252506)
FT                   /gene="mtnN"
FT                   /locus_tag="SeAg_B0246"
FT   CDS_pept        complement(251808..252506)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mtnN"
FT                   /locus_tag="SeAg_B0246"
FT                   /product="MTA/SAH nucleosidase"
FT                   /EC_number="3.2.2.16"
FT                   /EC_number="3.2.2.9"
FT                   /note="identified by match to protein family HMM PF01048;
FT                   match to protein family HMM TIGR01704"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0246"
FT                   /db_xref="EnsemblGenomes-Tr:ACH51811"
FT                   /db_xref="GOA:B5F8S1"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR010049"
FT                   /db_xref="InterPro:IPR035994"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5F8S1"
FT                   /protein_id="ACH51811.1"
FT                   /translation="MKIGIIGAMEEEVTLLRDKIDNRQTITLGGCEIYTGQLNGTEVAL
FT                   LKSGIGKVAAALGATLLLEHCKPDVIINTGSAGGLASTLKVGDIVVSDEARYHDADVTA
FT                   FGYEYGQLPGCPAGFKADDKLIAAAESCIRELNLNAVRGLIVSGDAFINGSVGLAKIRH
FT                   NFPDAVAVEMEATAIAHVCYNFNVPFVVVRAISDVADQQSHLSFDEFLAVAAKQSTLMV
FT                   ETLVQKLAHG"
FT   gene            252549..254108
FT                   /gene="dgt"
FT                   /locus_tag="SeAg_B0247"
FT   CDS_pept        252549..254108
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dgt"
FT                   /locus_tag="SeAg_B0247"
FT                   /product="deoxyguanosinetriphosphate triphosphohydrolase"
FT                   /EC_number="3.1.5.1"
FT                   /note="identified by match to protein family HMM PF01966;
FT                   match to protein family HMM TIGR01353"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0247"
FT                   /db_xref="EnsemblGenomes-Tr:ACH51064"
FT                   /db_xref="GOA:B5F8S2"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006261"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR020779"
FT                   /db_xref="InterPro:IPR023293"
FT                   /db_xref="InterPro:IPR026875"
FT                   /db_xref="UniProtKB/TrEMBL:B5F8S2"
FT                   /protein_id="ACH51064.1"
FT                   /translation="MRLWGSAFLRRGEDMASIDFRNKINWHRRYRSPQGVKTEHEILRI
FT                   FESDRGRIINSPAIRRLQQKTQVFPLERNAAVRTRLTHSMEVQQVGRYIAKEILSRLKE
FT                   QNRLEEYGLDTLTGPFESIVEMACLMHDIGNPPFGHFGEAAINDWFRQRLHPEDAESQP
FT                   LTHDRCVVSSLRLQEGEENLNDIRRKVRQDICHFEGNAQGIRLVHTLMRMNLTWAQVGG
FT                   ILKYTRPAWWRGPVPDSHRYLMKKPGYYLSEEKYIARLRKELQLAPYSRFPLTWIMEAA
FT                   DDISYCVADLEDAVEKRIFSVEQLYHHLYHAWGHHEKDSLFELVVGNAWEKSRANTLSR
FT                   STEDQFFMYLRVNTLNKLVPYAAQRFIDNLPQIFAGTFNQALLEDASGFSRLLELYKNV
FT                   AVEHVFSHPDVEQLELQGYRVISGLLDIYQPLLSLSLNDFRELVKKERLKRFPIESRLF
FT                   QKLSTRHRLAYVEVVSKLPTDSAEYPVLEYYYRCRLIQDYISGMTDLYAWDEYRRLMAV
FT                   EQ"
FT   gene            254229..255665
FT                   /gene="degP"
FT                   /locus_tag="SeAg_B0248"
FT   CDS_pept        254229..255665
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="degP"
FT                   /locus_tag="SeAg_B0248"
FT                   /product="protease Do"
FT                   /EC_number="3.4.21.-"
FT                   /note="identified by match to protein family HMM PF00089;
FT                   match to protein family HMM PF00595; match to protein
FT                   family HMM TIGR02037"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0248"
FT                   /db_xref="EnsemblGenomes-Tr:ACH51960"
FT                   /db_xref="GOA:B5F8S3"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR001940"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR011782"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:B5F8S3"
FT                   /protein_id="ACH51960.1"
FT                   /translation="MKHMKKTTLAMSALALSLGLALSPLSATAAETSSSAMTAQQMPSL
FT                   APMLEKVMPSVVSINVEGSTTVNTPRMPRNFQQFFGDDSPFCQDGSPFQNSPFCQGGGN
FT                   GGNGGQQQKFMALGSGVIIDAAKGYVVTNNHVVDNASVIKVQLSDGRKFDAKVVGKDPR
FT                   SDIALIQIQNPKNLTAIKLADSDALRVGDYTVAIGNPFGLGETVTSGIVSALGRSGLNV
FT                   ENYENFIQTDAAINRGNSGGALVNLNGELIGINTAILAPDGGNIGIGFAIPSNMVKNLT
FT                   SQMVEYGQVKRGELGIMGTELNSELAKAMKVDAQRGAFVSQVMPNSSAAKAGIKAGDVI
FT                   TSLNGKPISSFAALRAQVGTMPVGSKISLGLLREGKAITVNLELQQSSQSQVDSSTIFS
FT                   GIEGAEMSNKGQDKGVVVSSVKANSPAAQIGLKKGDVIIGANQQPVKNIAELRKILDSK
FT                   PSVLALNIQRGDSSIYLLMQ"
FT   gene            255818..256975
FT                   /locus_tag="SeAg_B0249"
FT   CDS_pept        255818..256975
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0249"
FT                   /product="carbohydrate diacid regulator"
FT                   /note="identified by match to protein family HMM PF05651"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0249"
FT                   /db_xref="EnsemblGenomes-Tr:ACH52350"
FT                   /db_xref="InterPro:IPR008599"
FT                   /db_xref="InterPro:IPR025736"
FT                   /db_xref="InterPro:IPR041522"
FT                   /db_xref="InterPro:IPR042070"
FT                   /db_xref="UniProtKB/TrEMBL:B5F8S4"
FT                   /protein_id="ACH52350.1"
FT                   /translation="MAGWHLDTKMAQDIVARTMRIIDTNINVMDARGRIIGSGDRERIG
FT                   ELHEGALLVLSQGRVVDIDNAVARHLHGVRQGINLPLRLEGEIVGVIGLTGEPEHLRKY
FT                   GELVCMTAEMMLEQSRLMHLLAQDSRLREELVMNLIQAEENTPALVEWAQRLGIDLNQP
FT                   RVAAVVEVDSGQLGVDSAMAELQQLQNALTTPERNNLIAIVSLTEMVVLKPALNSFGRW
FT                   DAEDHRKRVEQLISRMKENGQLRFRVALGNYFTGPGSIARSYRTARTTMMVGKQRMPES
FT                   RSYFYQDLMLPVLLDSLRGGWQANELARPLVKLKAMDNNGLLRRTLTAWFRHNVQPLAT
FT                   SKALFIHRNTLEYRLNRISELTGLDLGNFDDRLLLYVALQLDEQR"
FT   gene            complement(257064..257450)
FT                   /locus_tag="SeAg_B0250"
FT   CDS_pept        complement(257064..257450)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0250"
FT                   /product="protein YaeH"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0250"
FT                   /db_xref="EnsemblGenomes-Tr:ACH48644"
FT                   /db_xref="InterPro:IPR020911"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5F8S5"
FT                   /protein_id="ACH48644.1"
FT                   /translation="MYDNLKSLGITNPEEIDRYSLRQEANNDILKIYFQKDRGEFFAKS
FT                   VKFKYPRQRKTVVADGIGQGYKEVQEISPNLRYVIDELDQICQRDRSELDLKRKILDDL
FT                   RHLESVVANKISEIEADLDKLTRK"
FT   gene            257697..258998
FT                   /locus_tag="SeAg_B0251"
FT   CDS_pept        257697..258998
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0251"
FT                   /product="shikimate transporter"
FT                   /note="identified by match to protein family HMM PF00083;
FT                   match to protein family HMM PF07690"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0251"
FT                   /db_xref="EnsemblGenomes-Tr:ACH52780"
FT                   /db_xref="GOA:B5F8S6"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B5F8S6"
FT                   /protein_id="ACH52780.1"
FT                   /translation="MSGTYNATIRRVVISAWIGNSIEYYDFLLYGLASALVFGPLFFPG
FT                   ASPLTATLSSFASFGVGFISRPLGALFFGNRGDTLGRKNTLLITLGGMGAVTFLIGCLP
FT                   SYASIGALAPALLVILRFLQGFMVGGEWGGAMLMVVEYAAGKHRGRLSALSQTGGLTGQ
FT                   LLATGVFIVVTQLPKEALLSWGWRIPFLLSALLVLPGLYMRHRLDETPVFRAFKKQQAI
FT                   NHRQQKEERPVVKVVREQWRSILLIIILRFAESVPFFLATVFAVSWATTQLGIASLTIL
FT                   YIVMFTCLLAYPMHVLFGIMSDRRGCRQVYIFGALFVAAMAFPFFWLLESRSLILMTMG
FT                   YVLLINIGHNSLNAVQPSFFAGLFHPPVRYSGSSIGAQLGAVVAGGFTPFIAKALSAVY
FT                   DNSWALVAGYVVLTALASAFAAKIAPETVLPHSP"
FT   gene            complement(259034..259858)
FT                   /gene="dapD"
FT                   /locus_tag="SeAg_B0252"
FT   CDS_pept        complement(259034..259858)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dapD"
FT                   /locus_tag="SeAg_B0252"
FT                   /product="2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
FT                   N-succinyltransferase"
FT                   /EC_number="2.3.1.117"
FT                   /note="identified by match to protein family HMM TIGR00965"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0252"
FT                   /db_xref="EnsemblGenomes-Tr:ACH49348"
FT                   /db_xref="GOA:B5F8S7"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005664"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR023180"
FT                   /db_xref="InterPro:IPR037133"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5F8S7"
FT                   /protein_id="ACH49348.1"
FT                   /translation="MQQLQNVIETAFERRADITPVNVDTVTREAVNQVISLLDSGALRV
FT                   AEKIDGQWVTHQWLKKAVLLSFRINDNQVIDGAESRYFDKVPMKFADYDEARFQKEGFR
FT                   VVPPAAVRQGAFIARNTVLMPSYVNIGAYVDEGTMVDTWATVGSCAQIGKNVHLSGGVG
FT                   IGGVLEPLQANPTIIEDNCFIGARSEVVEGVIVEEGSVISMGVYLGQSTKIYDRETGEV
FT                   HYGRVPAGSVVVSGNLPSKDGKYSLYCAVIVKKVDAKTRGKVGINELLRTID"
FT   gene            complement(259888..262560)
FT                   /gene="glnD"
FT                   /locus_tag="SeAg_B0253"
FT   CDS_pept        complement(259888..262560)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glnD"
FT                   /locus_tag="SeAg_B0253"
FT                   /product="protein-P-II uridylyltransferase"
FT                   /EC_number="2.7.7.59"
FT                   /note="identified by match to protein family HMM PF01842;
FT                   match to protein family HMM PF01909; match to protein
FT                   family HMM PF01966; match to protein family HMM PF08335;
FT                   match to protein family HMM TIGR01693"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0253"
FT                   /db_xref="EnsemblGenomes-Tr:ACH49835"
FT                   /db_xref="GOA:B5F8S8"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR002934"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR010043"
FT                   /db_xref="InterPro:IPR013546"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5F8S8"
FT                   /protein_id="ACH49835.1"
FT                   /translation="MNTLPEQHANTALPTLPDQPQNPGVWPRAELTVAGIKARIDIFQH
FT                   WLGEAFDSGICAEQLIEARTEFIDQLLQRLWIEAGFGQIADLALVAVGGYGRGELHPLS
FT                   DIDLLILSRKKLPDEQAQKVGELLTLLWDVKLDVGHSVRTLEECLLEGLSDLTVATNLI
FT                   ETRLLIGDVALFLALQKHIFSEGFWPSDKFYAAKVEEQNQRHQRYHGTSYNLEPDIKSS
FT                   PGGLRDIHTLQWVARRHFGATSLDEMVGFGFLTPAERAELNECLHILWRIRFALHLVVS
FT                   RYDNRLLFDRQLSVAQRLNYSGEGNDPVERMMKDYFRVTRRVSELNQMLLQLFDEAILA
FT                   LPADEKPRPVDDEFQLRGTLIDLRDDTLFIREPQAILRMFYMMVRNSAITGIYSTTLRH
FT                   LRHARRHLSQPLCYIPEARTLFLSMLRHPGAVSRGLLPMHRHSVLWAYMPQWSHIVGQM
FT                   QFDLFHAYTVDEHTIRVMLKLESFAKEETRQRHPLCVDLWPRLPHPELILIAALFHDIA
FT                   KGRGGDHSVLGAQDVLTFAELHGLNSRETQLVAWLVRQHLLMSVTAQRRDIQDPEVIKQ
FT                   FAEEVQTETRLRFLVCLTVADICATNETLWNSWKQSLLRELYFATEKQLRRGMQNTPDM
FT                   RERVRHHQLQALALLRMDNIDEAALHKIWTRCRANYFVRHSPNQLAWHARHLLQHDLSQ
FT                   PLVLLSPQATRGGTEIFIWSPDRPYLFAAVCAELDRRNLSVHDAQIFTTRDGMAMDTFI
FT                   VLEPDGNPLAADRHDVIRTGLEQTITQRSWQPPQPRRQPAKLRHFTVETEVNFLPTHTD
FT                   RKSFMELIALDQPGLLARVGQIFADLGISLHGARITTIGERVEDLFIIATADRRALNNV
FT                   LQLEVQQRLTAALNPNDKG"
FT   gene            complement(262798..263592)
FT                   /gene="map"
FT                   /locus_tag="SeAg_B0254"
FT   CDS_pept        complement(262798..263592)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="map"
FT                   /locus_tag="SeAg_B0254"
FT                   /product="methionine aminopeptidase, type I"
FT                   /EC_number="3.4.11.18"
FT                   /note="identified by match to protein family HMM PF00557;
FT                   match to protein family HMM TIGR00500"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0254"
FT                   /db_xref="EnsemblGenomes-Tr:ACH50406"
FT                   /db_xref="GOA:B5F8S9"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001714"
FT                   /db_xref="InterPro:IPR002467"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:B5F8S9"
FT                   /protein_id="ACH50406.1"
FT                   /translation="MAISIKTSEDIEKMRVAGRLAAEVLEMIEPYIKPGVTTGELDRIC
FT                   NDYIVNEQHAISACLGYHGYPKSVCISINEVVCHGIPDDAKHLKDGDIVNIDVTVIKDE
FT                   FHGDTSKMFIVGKPTILGERLCRVTQESLYLGIKMVKPGIRLRTIGAAIQKYAEGEGFS
FT                   VVREYCGHGIGRGFHEEPQVLHYDADDGGVVLQPGMTFTIEPMLNAGDYRIRTMKDGWT
FT                   VKTKDRSLSAQYEHTIVVTENGCEILTLRKDDTIPAIITHDE"
FT   gene            263876..264014
FT                   /locus_tag="SeAg_B0255"
FT   ncRNA           263876..264014
FT                   /locus_tag="SeAg_B0255"
FT                   /product="t44 RNA"
FT                   /ncRNA_class="other"
FT   gene            264043..264768
FT                   /gene="rpsB"
FT                   /locus_tag="SeAg_B0256"
FT   CDS_pept        264043..264768
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsB"
FT                   /locus_tag="SeAg_B0256"
FT                   /product="ribosomal protein S2"
FT                   /note="identified by match to protein family HMM PF00318;
FT                   match to protein family HMM TIGR01011"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0256"
FT                   /db_xref="EnsemblGenomes-Tr:ACH50887"
FT                   /db_xref="GOA:B5F8T0"
FT                   /db_xref="InterPro:IPR001865"
FT                   /db_xref="InterPro:IPR005706"
FT                   /db_xref="InterPro:IPR018130"
FT                   /db_xref="InterPro:IPR023591"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5F8T0"
FT                   /protein_id="ACH50887.1"
FT                   /translation="MATVSMRDMLKAGVHFGHQTRYWNPKMKPFIFGARNKVHIINLEK
FT                   TVPMFNEALAELNKISARKGKILFVGTKRAASEAVKEAANSCDQFFVNHRWLGGMLTNW
FT                   KTVRQSIKRLKDLETQSQDGTFEKLTKKEALMRTRELEKLENSLGGIKDMGGLPDALFV
FT                   IDADHEHIAIKEANNLGIPVFAIVDTNSDPDGVDFVIPGNDDAIRAVSLYLGAVAATVR
FT                   EGRSQDLASQAEESFVEAE"
FT   gene            265026..265877
FT                   /gene="tsf"
FT                   /locus_tag="SeAg_B0257"
FT   CDS_pept        265026..265877
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tsf"
FT                   /locus_tag="SeAg_B0257"
FT                   /product="translation elongation factor Ts"
FT                   /note="identified by match to protein family HMM PF00627;
FT                   match to protein family HMM PF00889; match to protein
FT                   family HMM TIGR00116"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0257"
FT                   /db_xref="EnsemblGenomes-Tr:ACH51981"
FT                   /db_xref="GOA:B5F8T1"
FT                   /db_xref="InterPro:IPR001816"
FT                   /db_xref="InterPro:IPR009060"
FT                   /db_xref="InterPro:IPR014039"
FT                   /db_xref="InterPro:IPR018101"
FT                   /db_xref="InterPro:IPR036402"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5F8T1"
FT                   /protein_id="ACH51981.1"
FT                   /translation="MAEITASLVKELRERTGAGMMDCKKALTEANGDIELAIENMRKSG
FT                   AIKAAKKAGNVAADGVIKTKINGNVAFILEVNCQTDFVAKDAGFQAFADKVLDAAVAGK
FT                   ITDVEVLKAQFEEERVALVAKIGENINIRRVASLEGDVLGSYQHGARIGVLVAAKGADE
FT                   ELVKQLAMHVAASKPEFVKPEDVSADVVEKEYQVQLDIAMQSGKPKEIAEKMVEGRMKK
FT                   FTGEVSLTGQPFVMEPSKSVGQLLKEHNADVTGFIRFEVGEGIEKVETDFAAEVAAMSK
FT                   QS"
FT   gene            266022..266747
FT                   /gene="pyrH"
FT                   /locus_tag="SeAg_B0258"
FT   CDS_pept        266022..266747
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyrH"
FT                   /locus_tag="SeAg_B0258"
FT                   /product="UMP kinase"
FT                   /EC_number="2.7.4.22"
FT                   /note="identified by match to protein family HMM PF00696;
FT                   match to protein family HMM TIGR02075"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0258"
FT                   /db_xref="EnsemblGenomes-Tr:ACH52422"
FT                   /db_xref="GOA:B5F8T2"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR011817"
FT                   /db_xref="InterPro:IPR015963"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="UniProtKB/TrEMBL:B5F8T2"
FT                   /protein_id="ACH52422.1"
FT                   /translation="MATNAKPVYKRILLKLSGEALQGTEGFGIDASILDRMAQEIKELV
FT                   ELGIQVGVVIGGGNLFRGAGLAKAGMNRVVGDHMGMLATVMNGLAMRDALHRAYVNARL
FT                   MSAIPLNGVCDNYSWAEAISLLRNNRVVILSAGTGNPFFTTDSAACLRGIEIEADVVLK
FT                   ATKVDGVFTADPAKDPSATMYDQLTYSEVLDKELKVMDLAAFTLARDHKLPIRVFNMNK
FT                   PGALRRVVMGEKEGTLITE"
FT   gene            266894..267451
FT                   /gene="frr"
FT                   /locus_tag="SeAg_B0259"
FT   CDS_pept        266894..267451
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="frr"
FT                   /locus_tag="SeAg_B0259"
FT                   /product="ribosome releasing factor"
FT                   /note="identified by match to protein family HMM PF01765;
FT                   match to protein family HMM TIGR00496"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0259"
FT                   /db_xref="EnsemblGenomes-Tr:ACH52911"
FT                   /db_xref="GOA:B5F8T3"
FT                   /db_xref="InterPro:IPR002661"
FT                   /db_xref="InterPro:IPR023584"
FT                   /db_xref="InterPro:IPR036191"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5F8T3"
FT                   /protein_id="ACH52911.1"
FT                   /translation="MISDIRKDAEVRMEKCVEAFKTQISKVRTGRASPSLLDGIVVEYY
FT                   GTPTPLRQLASVTVEDSRTLKINVFDRSMGPAVEKAIMASDLGLNPSSAGTDIRVPLPP
FT                   LTEERRKDLTKIVRGEAEQARVAVRNVRRDANDKVKALLKDKAISEDDDRRSQEEVQKM
FT                   TDAAIKKVDAALADKEAELMQF"
FT   gene            267506..268789
FT                   /gene="dxr"
FT                   /locus_tag="SeAg_B0260"
FT   CDS_pept        267506..268789
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dxr"
FT                   /locus_tag="SeAg_B0260"
FT                   /product="1-deoxy-D-xylulose 5-phosphate reductoisomerase"
FT                   /EC_number="2.7.4.-"
FT                   /note="identified by match to protein family HMM PF02670;
FT                   match to protein family HMM PF08436; match to protein
FT                   family HMM TIGR00243"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0260"
FT                   /db_xref="EnsemblGenomes-Tr:ACH48819"
FT                   /db_xref="GOA:B5F8T4"
FT                   /db_xref="InterPro:IPR003821"
FT                   /db_xref="InterPro:IPR013512"
FT                   /db_xref="InterPro:IPR013644"
FT                   /db_xref="InterPro:IPR026877"
FT                   /db_xref="InterPro:IPR036169"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B5F8T4"
FT                   /protein_id="ACH48819.1"
FT                   /translation="MYKAPRRRHYQVSCAAFCFLFRFNTSGRFMKQLTILGSTGSIGCS
FT                   TLDVVRHNPDSFRVIALVAGKNVARMAEQCLEFSPRYAVMDDTSSAEQLKIMLQQHGSR
FT                   TEVLSGQQAACEMAALDEVGHVMAAIVGAAGLLPTLAAIRAGKTILLANKESLVTCGRL
FT                   FMDEVKRSNARLLPVDSEHNAIFQSLPQSIQHNLGYADLEQNGVTSILLTGSGGPFRET
FT                   PMCDLAAMTPDQACRHPNWSMGRKISVDSATMMNKGLEYIEARWLFNASARQMEVLIHP
FT                   QSVIHSMVRYQDGSVLAQLGEPDMRTPIAHTMAWPNRVTSGAQPLDFCKLSALTFSAPD
FT                   YQRYPCLKLAMEAFEQGQAATTALNAANEITVAAFLAQQIRFTDIAGLNLAVLERMDLQ
FT                   EPASVEDVLQVDAIAREVARKQVIRLSR"
FT   gene            269102..269860
FT                   /gene="uppS"
FT                   /locus_tag="SeAg_B0261"
FT   CDS_pept        269102..269860
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="uppS"
FT                   /locus_tag="SeAg_B0261"
FT                   /product="di-trans,poly-cis-decaprenylcistransferase"
FT                   /EC_number="2.5.1.31"
FT                   /note="identified by match to protein family HMM PF01255;
FT                   match to protein family HMM TIGR00055"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0261"
FT                   /db_xref="EnsemblGenomes-Tr:ACH50028"
FT                   /db_xref="GOA:B5F8T5"
FT                   /db_xref="InterPro:IPR001441"
FT                   /db_xref="InterPro:IPR018520"
FT                   /db_xref="InterPro:IPR036424"
FT                   /db_xref="UniProtKB/TrEMBL:B5F8T5"
FT                   /protein_id="ACH50028.1"
FT                   /translation="MLSATQPVSENLPAHGCRHVAIIMDGNGRWAKKQGKIRAFGHKAG
FT                   AKSVRRAVSFAANNGIDALTLYAFSSENWNRPAQEVSALMELFVWALDSEVKSLHRHNV
FT                   RLRIIGDISRFNSRLQERIRKSEALTAHNTGLTLNIAANYGGRWDIVQGVRQLAEQVQA
FT                   GVLRPDQIDEERLGQQICMHELAPVDLVIRTGGEHRISNFLLWQIAYAELYFTDVLWPD
FT                   FDEQDFEGALHAFANRERRFGGTEPGDDKA"
FT   gene            269873..270730
FT                   /gene="cdsA1"
FT                   /locus_tag="SeAg_B0262"
FT   CDS_pept        269873..270730
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cdsA1"
FT                   /locus_tag="SeAg_B0262"
FT                   /product="phosphatidate cytidylyltransferase"
FT                   /EC_number="2.7.7.41"
FT                   /note="identified by match to protein family HMM PF01148"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0262"
FT                   /db_xref="EnsemblGenomes-Tr:ACH50150"
FT                   /db_xref="GOA:B5F8T6"
FT                   /db_xref="InterPro:IPR000374"
FT                   /db_xref="UniProtKB/TrEMBL:B5F8T6"
FT                   /protein_id="ACH50150.1"
FT                   /translation="MLKYRLISAFVLIPAVIAALFLLPPVGFAIITLVVCMLAAWEWGQ
FT                   LSGFAARSQRVWLAVLCGLLLALMLFLLPEYHHNIRQPLVEMSLWASLGWWVVALLLVL
FT                   FYPGSAAIWRNSKTLRLIFGLLTIVPFFWGMLALRAWHYDENHYSGAIWLLYVMILVWG
FT                   ADSGAYMFGKLFGKHKLAPKVSPGKTWQGFIGGLATAAVISWGYGMWANLNVAPVILLI
FT                   CSVVAALASVLGDLTESMFKREAGIKDSGHLIPGHGGILDRIDSLTAAVPVFACLLLLV
FT                   FRTL"
FT   gene            270742..272094
FT                   /gene="rseP"
FT                   /locus_tag="SeAg_B0263"
FT   CDS_pept        270742..272094
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rseP"
FT                   /locus_tag="SeAg_B0263"
FT                   /product="RIP metalloprotease RseP"
FT                   /EC_number="3.4.24.-"
FT                   /note="identified by match to protein family HMM PF00595;
FT                   match to protein family HMM PF02163; match to protein
FT                   family HMM TIGR00054"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0263"
FT                   /db_xref="EnsemblGenomes-Tr:ACH50647"
FT                   /db_xref="GOA:B5F8T7"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR004387"
FT                   /db_xref="InterPro:IPR008915"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="InterPro:IPR041489"
FT                   /db_xref="UniProtKB/TrEMBL:B5F8T7"
FT                   /protein_id="ACH50647.1"
FT                   /translation="MLSILWNLAAFIIALGVLITVHEFGHFWVARRCGVRVERFSIGFG
FT                   KALWRRTDRYGTEYVIALIPLGGYVKMLDERAEPVAPELRRHAFNNKTVGQRAAIIAAG
FT                   PVANFIFAIFAYWLVFIIGVPGVRPVIGEITPNSIAAQAQIAPGTELKAVDGIETPDWD
FT                   AVRLQLVSKIGDQQTTVSVAPFGSDQRQDKTLDLRHWAFEPDKQDPVSSLGIRPRGPQI
FT                   EPVLSEVQANSAASKAGLQAGDRIVKVDGQPLTQWMKFVTFVRDNPGKPLALEIERQGS
FT                   ALSLTLTPDTKSVNGKAEGFAGVVPKIIPLPEEYKTIRQYGPFSAILEATDKTWQLMKL
FT                   TVSMLGKLITGDVKLNNLSGPISIAQGAGMSAEFGVIYYLMFLALISVNLGIINLFPLP
FT                   VLDGGHLLFLAIEKLKGGPVSERVQDFSYRIGSILLVLLMGLALFNDFSRL"
FT   gene            272126..274537
FT                   /gene="yaeT"
FT                   /locus_tag="SeAg_B0265"
FT   CDS_pept        272126..274537
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaeT"
FT                   /locus_tag="SeAg_B0265"
FT                   /product="outer membrane protein assembly complex, YaeT
FT                   protein"
FT                   /note="identified by match to protein family HMM PF01103;
FT                   match to protein family HMM PF07244; match to protein
FT                   family HMM TIGR03303"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0265"
FT                   /db_xref="EnsemblGenomes-Tr:ACH50807"
FT                   /db_xref="GOA:B5F8T8"
FT                   /db_xref="InterPro:IPR000184"
FT                   /db_xref="InterPro:IPR010827"
FT                   /db_xref="InterPro:IPR023707"
FT                   /db_xref="InterPro:IPR034746"
FT                   /db_xref="InterPro:IPR039910"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5F8T8"
FT                   /protein_id="ACH50807.1"
FT                   /translation="MAMKKLLIASLLFSSATVYGAEGFVVKDIHFEGLQRVAVGAALLS
FT                   MPVRTGDTVNDEDISNTIRALFATGNFEDVRVLRDGNTLLVQVKERPTIASITFSGNKS
FT                   VKDDMLKQNLEASGVRVGESLDRTTLSDIEKGLEDFYYSVGKYSASVKAVVTPLPRNRV
FT                   DLKLVFQEGVSAKIQQINIVGNHAFSTEELISHFQLRDEVPWWNVVGDRKYQKQKLAGD
FT                   LETLRSYYLDRGYARFNIDSTQVSLTPDKKGIYITVNITEGDQYKLSGVQVSGNLAGHS
FT                   AEIEKLTKIEPGELYNGTKVTKMEDDIKKLLGRYGYAYPRVQSQPEINDADKTVKLRVN
FT                   VDAGNRFYVRKIRFEGNDTSKDSVLRREMRQMEGAWLGSDLVDQGKERLNRLGFFETVD
FT                   TDTQRVPGSPDQVDVVYKVKERNTGSFNFGIGYGTESGVSFQAGVQQDNWLGTGYSVGI
FT                   NGTKNDYQTYSELSVTNPYFTVDGVSLGGRIFYNDFEADDADLSDYTNKSYGTDVTLGF
FT                   PINEYNTLRAGLGYVHNKLSNMQPQIAMDRYLESMGDPDASDFAADDFTFNYGWTYNKL
FT                   DRGYFPTDGSRVNLTGKVTIPGSDNEYYKVSLDTATYVPIDNDHKWVVLGRTRWGYGDG
FT                   LGGKEMPFYENFYAGGSSTVRGFQSNTIGPKAVYKNGARTSGGDNDEYEDCTQESGCKS
FT                   DDAVGGNAMAVASLEFITPTPFISEKYANSVRTSFFWDMGTVWDTNWDPSSAPSDVPDY
FT                   SDPGNIRMSAGIALQWMSPLGPLVFSYAQPFKKYDGDKAEQFQFNIGKTW"
FT   gene            274660..275145
FT                   /gene="skp"
FT                   /locus_tag="SeAg_B0266"
FT   CDS_pept        274660..275145
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="skp"
FT                   /locus_tag="SeAg_B0266"
FT                   /product="chaperone protein Skp"
FT                   /note="identified by match to protein family HMM PF03938"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0266"
FT                   /db_xref="EnsemblGenomes-Tr:ACH51596"
FT                   /db_xref="GOA:B5F8T9"
FT                   /db_xref="InterPro:IPR005632"
FT                   /db_xref="InterPro:IPR024930"
FT                   /db_xref="UniProtKB/TrEMBL:B5F8T9"
FT                   /protein_id="ACH51596.1"
FT                   /translation="MKKWLLAAGLGLAMVTSAQAADKIAIVNMGNLFQQVAQKTGVSNT
FT                   LENEFKGRAAELQKMETDLQSKMQRLQSMKAGSDRTKLEKDVMSQRQTFAQKAQAFEKD
FT                   RARRSNEERNKLVTRIQTAVKKVANDQSIDLVVDANTVAYNSSDVKDITADVLKQVK"
FT   gene            275149..276174
FT                   /gene="lpxD"
FT                   /locus_tag="SeAg_B0267"
FT   CDS_pept        275149..276174
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lpxD"
FT                   /locus_tag="SeAg_B0267"
FT                   /product="UDP-3-O-[3-hydroxymyristoyl] glucosamine
FT                   N-acyltransferase"
FT                   /EC_number="3.1.26.4"
FT                   /note="identified by match to protein family HMM PF00132;
FT                   match to protein family HMM PF04613; match to protein
FT                   family HMM TIGR01853"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0267"
FT                   /db_xref="EnsemblGenomes-Tr:ACH52663"
FT                   /db_xref="GOA:B5F8U0"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR007691"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR020573"
FT                   /db_xref="UniProtKB/TrEMBL:B5F8U0"
FT                   /protein_id="ACH52663.1"
FT                   /translation="MPSIRLADLAEQLDAELHGDGDIVITGVASMQSATTGHITFMVNP
FT                   KYREHLGLCQASAVVMTQDDLPFAKSAALVVKNPYLTYARMAQILDTTPQPAQNIAPSA
FT                   VIDATATLGSNVSVGANAVIESGVQLGDNVVIGAGCFVGKNSKIGAGSRLWANVTIYHD
FT                   IQIGENCLIQSSTVIGADGFGYANDRGNWVKIPQLGRVIIGDRVEIGACTTIDRGALDD
FT                   TVIGNGVIIDNQCQIAHNVVIGDNTAVAGGVIMAGSLKIGRYCMIGGASVINGHMEICD
FT                   KVTVTGMGMVMRPITEPGVYSSGIPLQPNKVWRKTAALVMNIDDMSKRLKAIERKVNQQ
FT                   D"
FT   gene            276280..276735
FT                   /gene="fabZ"
FT                   /locus_tag="SeAg_B0268"
FT   CDS_pept        276280..276735
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fabZ"
FT                   /locus_tag="SeAg_B0268"
FT                   /product="beta-hydroxyacyl-(acyl-carrier-protein)
FT                   dehydratase FabZ"
FT                   /EC_number="4.2.1.-"
FT                   /note="identified by match to protein family HMM PF07977;
FT                   match to protein family HMM TIGR01750"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0268"
FT                   /db_xref="EnsemblGenomes-Tr:ACH49428"
FT                   /db_xref="GOA:B5F8U1"
FT                   /db_xref="InterPro:IPR010084"
FT                   /db_xref="InterPro:IPR013114"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5F8U1"
FT                   /protein_id="ACH49428.1"
FT                   /translation="MTTNTHTLQIEEILELLPHRFPFLLVDRVLDFEEGRFLRAVKNVS
FT                   VNEPFFQGHFPGKPILPGVLILEAMAQATGILAFKSVGKLEPGELYYFAGIDEARFKRP
FT                   VVPGDQMIMEVTFEKTRRGLTRFKGVALVDGKVVCEATMMCARSREA"
FT   gene            276739..277527
FT                   /gene="lpxA"
FT                   /locus_tag="SeAg_B0269"
FT   CDS_pept        276739..277527
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lpxA"
FT                   /locus_tag="SeAg_B0269"
FT                   /product="acyl-[acyl-carrier-protein]-UDP-N-acetylglucosamine
FT                   O-acyltransferase"
FT                   /EC_number="2.3.1.129"
FT                   /note="identified by match to protein family HMM PF00132;
FT                   match to protein family HMM TIGR01852"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0269"
FT                   /db_xref="EnsemblGenomes-Tr:ACH50132"
FT                   /db_xref="GOA:B5F8U2"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR010137"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR029098"
FT                   /db_xref="InterPro:IPR037157"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5F8U2"
FT                   /protein_id="ACH50132.1"
FT                   /translation="MIDKSAFIHPTAIVEDGAVIGANAHIGPFCIVGPQVEIGEGTVLK
FT                   SHVVVNGQTKIGRDNEIYQFASIGEVNQDLKYAGEPTRVEIGDRNRIRESVTIHRGTVQ
FT                   GGGLTKVGSDNLLMINAHVAHDCTVGNRCILANNATLAGHVSVDDFAIIGGMTAVHQFC
FT                   IIGAHVMVGGCSGVAQDVPPYVIAQGNHATPFGVNIEGLKRRGFSREGLVAIRNAYKLL
FT                   YRSGKTLDEAKLEIAELAEKHPEVKAFTEFFERSTRGPIR"
FT   gene            277527..278675
FT                   /gene="lpxB"
FT                   /locus_tag="SeAg_B0270"
FT   CDS_pept        277527..278675
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lpxB"
FT                   /locus_tag="SeAg_B0270"
FT                   /product="lipid-A-disaccharide synthase"
FT                   /EC_number="2.4.1.182"
FT                   /note="identified by match to protein family HMM PF02684;
FT                   match to protein family HMM TIGR00215"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0270"
FT                   /db_xref="EnsemblGenomes-Tr:ACH50660"
FT                   /db_xref="GOA:B5F8U3"
FT                   /db_xref="InterPro:IPR003835"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5F8U3"
FT                   /protein_id="ACH50660.1"
FT                   /translation="MAAQRPLTIALVAGETSGDILGAGLIRALKARVPNARFVGVAGPR
FT                   MQAEGCEAWYEMEELAVMGIVEVLGRLRRLLHIRADLTRRFTELKPDVFVGIDAPDFNI
FT                   TLEGNLKKQGIKTIHYVSPSVWAWRQKRVFKIGRSTHMVLAFLPFEKAFYDKFNVPCRF
FT                   IGHTMADAMPLDPDKNAARDVLGIPHDAHCLALLPGSRGAEVEMLSADFLKTAQLLRQR
FT                   YPDLEVVVPLVNAKRREQFEKIKAEVAPDLAAHLLDGMAREAMIASDAALLASGTAALE
FT                   CMLAKCPMVVGYRMKPFTFWLAKRLVKTEYVSLPNLLAGRELVKELLQEECEPQKLAEA
FT                   LLPLLANGKTSHAMHDTFRELHQQIRCNADEQAADAVLELAQ"
FT   gene            278672..279268
FT                   /gene="rnhB"
FT                   /locus_tag="SeAg_B0271"
FT   CDS_pept        278672..279268
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rnhB"
FT                   /locus_tag="SeAg_B0271"
FT                   /product="ribonuclease HII"
FT                   /EC_number="3.1.26.4"
FT                   /note="identified by match to protein family HMM PF01351"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0271"
FT                   /db_xref="EnsemblGenomes-Tr:ACH50655"
FT                   /db_xref="GOA:B5F8U4"
FT                   /db_xref="InterPro:IPR001352"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR022898"
FT                   /db_xref="InterPro:IPR024567"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5F8U4"
FT                   /protein_id="ACH50655.1"
FT                   /translation="MIEFVYPHTHLVAGVDEVGRGPLVGAVVTAAVILDPARPIVGLND
FT                   SKKLSEKRRLSLYDEIKEKALSWSLGRAEAHEIDELNILHATMLAMQRAVAGLHIAPEY
FT                   VLIDGNRCPALPVPSMAVVKGDSRVAEISAASILAKVTRDAEMAALDIVFPQYGFAQHK
FT                   GYPTAFHLEKLAQYGATAHHRRSFAPVKRALGLVS"
FT   gene            279292..282774
FT                   /gene="dnaE"
FT                   /locus_tag="SeAg_B0272"
FT   CDS_pept        279292..282774
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaE"
FT                   /locus_tag="SeAg_B0272"
FT                   /product="DNA polymerase III, alpha subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="identified by match to protein family HMM PF01336;
FT                   match to protein family HMM PF02811; match to protein
FT                   family HMM PF07733; match to protein family HMM TIGR00594"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0272"
FT                   /db_xref="EnsemblGenomes-Tr:ACH52752"
FT                   /db_xref="GOA:B5F8U5"
FT                   /db_xref="InterPro:IPR003141"
FT                   /db_xref="InterPro:IPR004013"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR004805"
FT                   /db_xref="InterPro:IPR011708"
FT                   /db_xref="InterPro:IPR016195"
FT                   /db_xref="InterPro:IPR029460"
FT                   /db_xref="InterPro:IPR040982"
FT                   /db_xref="InterPro:IPR041931"
FT                   /db_xref="UniProtKB/TrEMBL:B5F8U5"
FT                   /protein_id="ACH52752.1"
FT                   /translation="MSEPRFVHLRVHSDYSMIDGLAKTGPLVKKAASLGMPALAITDFT
FT                   NLCGLVKFYGAGHGAGIKPIVGADFNVHNELLGDELTHLTVLAANNTGYQNLTLLISKA
FT                   YQRGYGAAGPIIERDWLVELKEGLILLSGGRMGDVGRCLLRGNQALVEECVAFYEAHFP
FT                   ERYFLELIRTGRQDEETYLHAAVELAEARGLPVVATNDVRFLESDDFDAHEIRVAIHDG
FT                   FTLDDPKRPRNYSPQQYMRSEEEMCELFSDIPEALENTVEIAKRCNVTVRLGEYFLPQF
FT                   PTGDMTTEDYLVKKAKEGLEERLAFLFPDEEERKKRRPEYDERLDIELQVINQMGFPGY
FT                   FLIVMEFIQWSKDNGVPVGPGRGSGAGSLVAYALKITDLDPLEFDLLFERFLNPERVSM
FT                   PDFDVDFCMEKRDQVIEHVADMYGRDAVSQIITFGTMAAKAVIRDVGRVLGHPYGFVDR
FT                   ISKLVPPDPGMTLAKAFEAEPQLPEIYEADEEVRALIDMARKLEGVTRNAGKHAGGVVI
FT                   APTKITDFAPLYCDEEGKHPVTQFDKSDVEYAGLVKFDFLGLRTLTIINWALEMINKRR
FT                   EKNGEPPLDIAAIPLDDKKSFDMLQRSETTAVFQLESRGMKDLIKRLQPDCFEDMIALV
FT                   ALFRPGPLQSGMVDNFIDRKHGREELSYPDVQWQHESLKPVLEPTYGIILYQEQVMQIA
FT                   QVLSGYTLGGADMLRRAMGKKKPEEMAKQRSVFEEGAKKNGIDGELAMKIFDLVEKFAG
FT                   YGFNKSHSAAYALVSYQTLWLKAHYPAEFMAAVMTADMDNTEKVVGLVDECWRMGLKIL
FT                   PPDINSGLYHFHVNDEGEIVYGIGAIKGVGEGPIEAIIDARNQGGYFRELFDLCARTDT
FT                   KKLNRRVLEKLIMSGAFDRLGPHRAALMNSLGDALKAADQHAKAEAIGQADMFGVLAEE
FT                   PEQIEQSYASCQPWPEQVVLDGERETLGLYLTGHPINQYLKEIERYVGGVRLKDMHPTE
FT                   RGKVTTAAGLVIAARVMVTKRGNRIGICTLDDRSGRLEVMLFTDALDKYQQLLEKDRIL
FT                   IVSGQVSFDDFSGGLKMTAREVMDIDEAREKYARGLAISLTDRQIDDQLLNRLRQSLEP
FT                   HRSGTIPVHLYYQRADARARLRFGATWRVSPSDRLLNDLRGLIGSEQVELEFD"
FT   gene            282787..283746
FT                   /gene="accA"
FT                   /locus_tag="SeAg_B0273"
FT   CDS_pept        282787..283746
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="accA"
FT                   /locus_tag="SeAg_B0273"
FT                   /product="acetyl-CoA carboxylase, carboxyl transferase,
FT                   alpha subunit"
FT                   /EC_number="6.4.1.2"
FT                   /note="identified by match to protein family HMM PF03255;
FT                   match to protein family HMM TIGR00513"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0273"
FT                   /db_xref="EnsemblGenomes-Tr:ACH52567"
FT                   /db_xref="GOA:B5F8U6"
FT                   /db_xref="InterPro:IPR001095"
FT                   /db_xref="InterPro:IPR011763"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5F8U6"
FT                   /protein_id="ACH52567.1"
FT                   /translation="MSLNFLDFEQPIAELEAKIDSLTAVSRQDEKLDINIDEEVHRLRE
FT                   KSVELTRKIFADLGAWQVAQLARHPQRPYTLDYVRLAFDEFDELAGDRAYADDKAIVGG
FT                   IARLEGRPVMIIGHQKGRETKEKIRRNFGMPAPEGYRKALRLMEMAERFNMPIITFIDT
FT                   PGAYPGVGAEERGQSEAIARNLREMSRLNVPVICTVIGEGGSGGALAIGVGDKVNMLQY
FT                   STYSVISPEGCASILWKSADKAPLAAEAMGIIAPRLKELKLIDSIIPEPLGGAHRNPEA
FT                   MAASLKAQLLEDLADLDVLSTDDLKNRRYQRLMSYGYA"
FT   gene            283926..285689
FT                   /locus_tag="SeAg_B0274"
FT   CDS_pept        283926..285689
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0274"
FT                   /product="endochitinase"
FT                   /note="identified by match to protein family HMM PF00182;
FT                   match to protein family HMM PF00801"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0274"
FT                   /db_xref="EnsemblGenomes-Tr:ACH51306"
FT                   /db_xref="GOA:B5F8U7"
FT                   /db_xref="InterPro:IPR000726"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR022409"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR035986"
FT                   /db_xref="UniProtKB/TrEMBL:B5F8U7"
FT                   /protein_id="ACH51306.1"
FT                   /translation="MGLQKTLALSAVAAGIMLSLSGAQAAPLLSSSEPMTINASDLAAK
FT                   EKALTDFPLMEAVKSSIQTLDNSAVEQIEPGRAANPANVKRVESILKEADWDYLFPMRA
FT                   PEYTYSNFLKAIGKFPAVCGTYTDGRDSDAICRKTLATMFAHFAQETGGHESWRDIPEW
FT                   RQALVYLREVGWTEGQKGGYNGECNPDVWQGQTWPCGKDKDGDFLSYFGRGAKQLSYNY
FT                   NYGPFSDAMYGDVRPLLDKPELVADTWMNLASAVFFFVYPQPPKPSMLHVIDGTWQPND
FT                   RDKANGLVSGFGVTIQIINGGVECGGADENAQSLNRIAYYKEFANYLKVPVPADEVLGC
FT                   KKMKQFDEGGAGALPIYWEQDWGWSADTADGKTYSCQLVGYQTPYTAFKEGDYTKCVQH
FT                   YFNVNVVDDNGTTEPDVTPTPAPVTDENVAPVARIAGPVGAVEAGSPVSLSAEGSTDAN
FT                   GDKLTYTWMSQDGKTLSGQDKAVVIFNAPDVTQNTQYVVNLTVSDGTLSSTAVYTLNVK
FT                   AKAAAADDEDKTTSYPAWSSSQKWNPGDIVNSNGALYQCKPFPEGSWCNVAPAYYEPGV
FT                   GIAWADAWNAL"
FT   gene            285765..287906
FT                   /locus_tag="SeAg_B0275"
FT   CDS_pept        285765..287906
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0275"
FT                   /product="lysine decarboxylase, constitutive"
FT                   /EC_number="4.1.1.18"
FT                   /note="identified by match to protein family HMM PF01276;
FT                   match to protein family HMM PF03709; match to protein
FT                   family HMM PF03711"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0275"
FT                   /db_xref="EnsemblGenomes-Tr:ACH49268"
FT                   /db_xref="GOA:B5F8U8"
FT                   /db_xref="InterPro:IPR000310"
FT                   /db_xref="InterPro:IPR005308"
FT                   /db_xref="InterPro:IPR008286"
FT                   /db_xref="InterPro:IPR011193"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036633"
FT                   /db_xref="UniProtKB/TrEMBL:B5F8U8"
FT                   /protein_id="ACH49268.1"
FT                   /translation="MNIIAIMGPHGVYYKDEPIKELERALQSLGFQIIWPQNSVDLLKF
FT                   IEHNPRICGVIFDWDEYSLDLCSEINQLNEYLPLYAFINTNSTLDVSVHDMRMALWFFE
FT                   YALGLAEDIATRIHQYTNEYLDNITPPFTKALFTYAKEGKYTFCTPGHMAGTAYQKSPP
FT                   GCLFYDFFGGNTLKADVSISVTELGSLLDHTGPHLEAEEYIARTFGAEQSYMVTNGTST
FT                   SNKIVGMYAAPAGSTLLIDRNCHKSLAHLLMMSDVVPLWLKPTRNALGILGGIPKREFT
FT                   RDSIARKVAETAQAQWPVHAVITNSTYDGLLYNTNWIKQMLDVPSIHFDSAWVPYTHFH
FT                   PIYQGKSGMSGDRVPGKVIFETQSTHKMLAAFSQASLIHIKGEYDEETFNEAFMMHTST
FT                   SPSYPIVASIETAAAMLRGNPGKRLINRSVERALHFRKEVQRLREESDSWFFDIWQPEE
FT                   VDEAECWPVTPGETWHGFTDADDDHMFLDPVKVTILTPGMDEQGNMSEEGIPAALVAKF
FT                   LDERGVVVEKTGPYNLLFLFSIGIDKTRAMGLLRGLTEFKRAYDLNLRVKNMLPDLYAE
FT                   DPDFYRNMRIQDLAQGIHKLIRQHDLPGLMLRAFEVLPEMIMTPHQAWQRQIKGEVETV
FT                   ALDQLPGRVSANMLLPYPPGVPLLMPGERITQQSRAVLDFLLMLCSIGQHYPGFETDIH
FT                   GAKRNEDGVYQVRVLKHAC"
FT   gene            287962..288351
FT                   /locus_tag="SeAg_B0276"
FT   CDS_pept        287962..288351
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0276"
FT                   /product="glyoxylase family protein"
FT                   /note="identified by match to protein family HMM PF00903"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0276"
FT                   /db_xref="EnsemblGenomes-Tr:ACH52117"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037478"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:B5F8U9"
FT                   /protein_id="ACH52117.1"
FT                   /translation="MLGLKQVHHIAIIATDYAVSKAFYCDILGFDLLSEVWREERDSWK
FT                   GDLALNGQYVIELFSFPFPPARPSRPEACGLRHLAFSVENVENAVAHLEKHQVKCEPIR
FT                   IDPYTGKRFTFFNDPDGLPLELYEQ"
FT   gene            288414..289706
FT                   /locus_tag="SeAg_B0277"
FT   CDS_pept        288414..289706
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0277"
FT                   /product="tRNA(Ile)-lysidine synthase
FT                   (tRNA(Ile)-lysidinesynthetase) (tRNA(Ile)-2-lysyl-cytidine
FT                   synthase)"
FT                   /EC_number="6.3.4.-"
FT                   /note="identified by match to protein family HMM PF01171;
FT                   match to protein family HMM PF09179; match to protein
FT                   family HMM TIGR02432; match to protein family HMM
FT                   TIGR02433"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0277"
FT                   /db_xref="EnsemblGenomes-Tr:ACH50480"
FT                   /db_xref="GOA:B5F8V0"
FT                   /db_xref="InterPro:IPR011063"
FT                   /db_xref="InterPro:IPR012094"
FT                   /db_xref="InterPro:IPR012795"
FT                   /db_xref="InterPro:IPR012796"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015262"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5F8V0"
FT                   /protein_id="ACH50480.1"
FT                   /translation="MTTLTLNTSLLSSRRILAAFSGGLDSTVLLHQLVLWRERHPDVTL
FT                   RAIHIHHGLSPHADSWVRHCETVCERWQVPLVVERVTLADNGLGIEAHAREARYRAFAQ
FT                   TLLPGEVLATAQHLDDQCETFLLALKRGSGPAGLSAMGERSPFAGTLLLRPLLRETRKT
FT                   LEQWAVRHGLCWIEDESNQDDAYDRNFLRLRALPLLQQRWPHFPAAVARSATLCAEQER
FT                   LLDELLASDLTDCITTEGTLRLSPLMSMSDVRRAAILRRWLAMRNAPMPSRDALERIWQ
FT                   EVALARDDASPCLRFGDREIRRYQSQLWWIKSVAGQHETTVAWPVWQTPLALPAGLGTV
FT                   QLVPGGELRRPREEESVSIRFKAPGLLHIVGRHGGRKLKKIWQEQGIPPWRRDTTPLLF
FT                   YGETLIAAAGVFVTREGAAEDKEGVSLVWHA"
FT   gene            complement(289790..289984)
FT                   /gene="rof"
FT                   /locus_tag="SeAg_B0278"
FT   CDS_pept        complement(289790..289984)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rof"
FT                   /locus_tag="SeAg_B0278"
FT                   /product="rof protein"
FT                   /note="identified by match to protein family HMM PF07073"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0278"
FT                   /db_xref="EnsemblGenomes-Tr:ACH49347"
FT                   /db_xref="InterPro:IPR009778"
FT                   /db_xref="InterPro:IPR023534"
FT                   /db_xref="InterPro:IPR038626"
FT                   /db_xref="UniProtKB/TrEMBL:B5F8V1"
FT                   /protein_id="ACH49347.1"
FT                   /translation="MHHLILTLTLKDGEVLQAKANDLILRKNVEYLLAEVSGESCELRL
FT                   DKIASFSHPEIGTVVVSES"
FT   gene            complement(290037..290237)
FT                   /locus_tag="SeAg_B0279"
FT   CDS_pept        complement(290037..290237)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0279"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF06786"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0279"
FT                   /db_xref="EnsemblGenomes-Tr:ACH50065"
FT                   /db_xref="InterPro:IPR009624"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5F8V2"
FT                   /protein_id="ACH50065.1"
FT                   /translation="MEKYCELVRKRYAEIASGDLGYVPDALGCVLKVLNEVAADSALSE
FT                   SVREKAAYAAANLLVSDYVNE"
FT   gene            290435..290980
FT                   /locus_tag="SeAg_B0280"
FT   CDS_pept        290435..290980
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0280"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF07152"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0280"
FT                   /db_xref="EnsemblGenomes-Tr:ACH50712"
FT                   /db_xref="InterPro:IPR009822"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR038590"
FT                   /db_xref="UniProtKB/TrEMBL:B5F8V3"
FT                   /protein_id="ACH50712.1"
FT                   /translation="MALKATIYKAVVNVADLDRNRFLDAALTLARHPSETQERMMLRLL
FT                   AWIKYADERLQFTRGLSAEDEPEAWLRNDHLGIDLWIELGLPDERRIKKACTQASDVAL
FT                   FAYNSRAAQIWWQQHQSKCAQFANLSVWYLDDGQLAQLSEFADRTMTLQATIQDGAIWL
FT                   SDARNNLEIQLTAWQQPS"
FT   gene            290977..291399
FT                   /locus_tag="SeAg_B0281"
FT   CDS_pept        290977..291399
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0281"
FT                   /product="peptidyl-tRNA hydrolase domain protein"
FT                   /note="identified by match to protein family HMM PF00472"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0281"
FT                   /db_xref="EnsemblGenomes-Tr:ACH52325"
FT                   /db_xref="GOA:B5F8V4"
FT                   /db_xref="InterPro:IPR000352"
FT                   /db_xref="UniProtKB/TrEMBL:B5F8V4"
FT                   /protein_id="ACH52325.1"
FT                   /translation="MIAISRTVSIADNELEITAIRAQGAGGQHVNKTSSAIHLRFDIRA
FT                   SGLPEYYKQRLLTASHHLISDDGVIIIKAQEFRSQELNREAAIARLVAVIKELTAEQKS
FT                   RRATRPTRASKERRLSSKAQKSSVKALRGKVRRPLD"
FT   gene            291431..292132
FT                   /locus_tag="SeAg_B0282"
FT   CDS_pept        291431..292132
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0282"
FT                   /product="copper homeostasis protein CutF"
FT                   /note="identified by match to protein family HMM PF04170"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0282"
FT                   /db_xref="EnsemblGenomes-Tr:ACH51868"
FT                   /db_xref="InterPro:IPR007298"
FT                   /db_xref="InterPro:IPR033450"
FT                   /db_xref="InterPro:IPR038139"
FT                   /db_xref="UniProtKB/TrEMBL:B5F8V5"
FT                   /protein_id="ACH51868.1"
FT                   /translation="MVRTAILSVAAACTLFALIGCNNRAEVDALQPAQAAELKPMQQSW
FT                   RGVLPCADCEGIETSLFLEKDGTWVMNERYQGVREEPSSFASYGTWARTADKLVLTDSN
FT                   GEKSYYRAKGNALEMLDREGNPVASQLNYTLVPVTASLPVTPMPLRGMYVYRADAATFT
FT                   DCATGKRLPVASNAQLERGYLTAKGEAEKPVLLTVEGHFVFAANPDTGEPVKMLIADKN
FT                   AKFAPGKDCTH"
FT   gene            complement(292206..293924)
FT                   /gene="proS"
FT                   /locus_tag="SeAg_B0283"
FT   CDS_pept        complement(292206..293924)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="proS"
FT                   /locus_tag="SeAg_B0283"
FT                   /product="prolyl-tRNA synthetase"
FT                   /EC_number="6.1.1.15"
FT                   /note="identified by match to protein family HMM PF00587;
FT                   match to protein family HMM PF03129; match to protein
FT                   family HMM PF04073; match to protein family HMM TIGR00409"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0283"
FT                   /db_xref="EnsemblGenomes-Tr:ACH51642"
FT                   /db_xref="GOA:B5F8V6"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002316"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR004500"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR007214"
FT                   /db_xref="InterPro:IPR023717"
FT                   /db_xref="InterPro:IPR033730"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="InterPro:IPR036754"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5F8V6"
FT                   /protein_id="ACH51642.1"
FT                   /translation="MRTSQYLLSTLKETPADAEVISHQLMLRAGMIRKLASGLYTWLPT
FT                   GLRVLKKVENIVREEMNNAGAIEVSMPVVQPADLWQESGRWEQYGPELLRFVDRGERPF
FT                   VLGPTHEEVITDLVRNELSSYKQLPLNFFQIQTKFRDEVRPRFGVMRSREFLMKDAYSF
FT                   HTSQESLQETYDAMYAAYSRIFSRMGLDFRAVQADTGSIGGNASHEFQVLAQSGEDDIV
FT                   FSDVSDYAANIELAEAIAPQTPRAAATQEMTLVDTPNAKTIAELVEQFNLPIEKTVKTL
FT                   LVKAVKDSKSPLVALLVRGDHELNEVKAEKLPQVASPLTFATEEEIRAVINAGPGSLGP
FT                   VNMPIPVIIDRTVAAMSDFAAGANIDGKHYFGINWDRDVATPVVADIRNVVAGDPSPDG
FT                   QGTLLIKRGIEVGHIFQLGTKYSEALKASVQGEDGRNQILTMGCYGIGVTRVVAAAIEQ
FT                   NFDERGIVWPDAIAPFQVAILPMNMHKSFRVQELAEKLYSELRAQGIEVLMDDRKERPG
FT                   VMFADMELIGIPHTIVIGDRNLDNDDIEYKYRRSGEKSLIKTGDIVDYLVKAIKG"
FT   gene            complement(294035..294742)
FT                   /locus_tag="SeAg_B0284"
FT   CDS_pept        complement(294035..294742)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0284"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF01980;
FT                   match to protein family HMM TIGR00104"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0284"
FT                   /db_xref="EnsemblGenomes-Tr:ACH49990"
FT                   /db_xref="InterPro:IPR023368"
FT                   /db_xref="InterPro:IPR023370"
FT                   /db_xref="InterPro:IPR036413"
FT                   /db_xref="InterPro:IPR036414"
FT                   /db_xref="InterPro:IPR040372"
FT                   /db_xref="InterPro:IPR041369"
FT                   /db_xref="UniProtKB/TrEMBL:B5F8V7"
FT                   /protein_id="ACH49990.1"
FT                   /translation="MSSFQFEQIGVIRSPYKEKFAVPRQPGLVKSACGELHLIAPYNQA
FT                   DAVRGLEAFSHLWVLFVFHQTMDGGWRPTVRPPRLGGNARMGVFATRSTFRPNPIGMSL
FT                   VALKGIECRKESVILKLGSLDLVDGTPVVDIKPYLPFAEALPDAAASYAQQAPIAEMPV
FT                   SFTAEVAQQLTTLERRYPQLRTFICDVLAQDPRPAYRKGEETGKTYAVWLHDFNVRWRV
FT                   VNTGFEVFALEPR"
FT   gene            complement(294739..295143)
FT                   /gene="rcsF"
FT                   /locus_tag="SeAg_B0285"
FT   CDS_pept        complement(294739..295143)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rcsF"
FT                   /locus_tag="SeAg_B0285"
FT                   /product="exopolysaccharide synthesis regulator RcsF"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0285"
FT                   /db_xref="EnsemblGenomes-Tr:ACH52783"
FT                   /db_xref="GOA:B5F8V8"
FT                   /db_xref="InterPro:IPR030852"
FT                   /db_xref="UniProtKB/TrEMBL:B5F8V8"
FT                   /protein_id="ACH52783.1"
FT                   /translation="MRALPICLLALMLGGCSMLSRSPVEPVQSTATPPKAEPEKPKAPR
FT                   AAPVRIYTNAEDLVGKPFRDLGEVSGESCQATNQDSPPNIPTARKRMQINASKMKANAV
FT                   LLHSCEITSGTPGCYRQAVCIGSALNISAK"
FT   gene            complement(295262..296077)
FT                   /gene="metQ"
FT                   /locus_tag="SeAg_B0286"
FT   CDS_pept        complement(295262..296077)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metQ"
FT                   /locus_tag="SeAg_B0286"
FT                   /product="D-methionine ABC transporter, periplasmic
FT                   D-methionine-binding lipoprotein"
FT                   /note="identified by match to protein family HMM PF03180;
FT                   match to protein family HMM TIGR00363"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0286"
FT                   /db_xref="EnsemblGenomes-Tr:ACH51020"
FT                   /db_xref="InterPro:IPR004872"
FT                   /db_xref="UniProtKB/TrEMBL:B5F8V9"
FT                   /protein_id="ACH51020.1"
FT                   /translation="MAFKFKTFAAVGALIGSLALAGCGQDEKDPNHIKVGVIVGAEQQV
FT                   AEVAQKVAKEKYGLDVELVTFNDYVLPNEALSKGDIDANAFQHKPYLDQQIKDRGYKLV
FT                   SVGKTFVYPIAGYSKKIKSLDELKDGSQVAVPNDPTNLGRSLLLLQKVGLIKLKDGVGL
FT                   LPTSLDIVENPKNLKIVELEAPQLPRSLDDAQIALAVINTTYASQIGLTPAKDGIFVED
FT                   KDSPYVNLIVTREDNKDAENVKKFVQAYQSDEVYEAANKVFNGGAVKGW"
FT   gene            complement(296116..296769)
FT                   /gene="metI"
FT                   /locus_tag="SeAg_B0287"
FT   CDS_pept        complement(296116..296769)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metI"
FT                   /locus_tag="SeAg_B0287"
FT                   /product="D-methionine ABC transporter, permease protein"
FT                   /note="identified by match to protein family HMM PF00528"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0287"
FT                   /db_xref="EnsemblGenomes-Tr:ACH49491"
FT                   /db_xref="GOA:B5F8W0"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B5F8W0"
FT                   /protein_id="ACH49491.1"
FT                   /translation="MSEAMMWLLVRGVWETLAMTFVSGFFGFVIGLPVGVLLYVTRPGQ
FT                   IMENARLYRSLSAVVNIFRSIPFIILLVWMIPFTRIIVGTSIGLQAAIVPLTVGAAPFI
FT                   ARMVENALLEIPAGLIEASRAMGATPLQIVRKILLPEALPGLVNAATITLITLVGYSAM
FT                   GGAVGAGGLGQIGYQYGYIGYNATVMNTVLVLLVVLVYLIQLSGDRIVRAVTHK"
FT   gene            complement(296762..297793)
FT                   /gene="metN"
FT                   /locus_tag="SeAg_B0288"
FT   CDS_pept        complement(296762..297793)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metN"
FT                   /locus_tag="SeAg_B0288"
FT                   /product="D-methionine ABC transporter, ATP-binding
FT                   protein"
FT                   /note="identified by match to protein family HMM PF00005;
FT                   match to protein family HMM PF09383; match to protein
FT                   family HMM TIGR02314"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0288"
FT                   /db_xref="EnsemblGenomes-Tr:ACH52281"
FT                   /db_xref="GOA:B5F8W1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR012692"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR017908"
FT                   /db_xref="InterPro:IPR018449"
FT                   /db_xref="InterPro:IPR026253"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041701"
FT                   /db_xref="UniProtKB/TrEMBL:B5F8W1"
FT                   /protein_id="ACH52281.1"
FT                   /translation="MIKLSNITKVFQQGTRTIQALNNVSLHVPAGQIYGVIGASGAGKS
FT                   TLIRCVNLLERPTEGSVQVGGQELTTLSESELTKARRQIGMIFQHFNLLSSRTVFGNVA
FT                   LPLELDNTPKEEIKRRVTELLDLVGLGDKHDSYPANLSGGQKQRVAIARALASNPKVLL
FT                   CDEATSALDPATTRSILELLKDINRRLGLTILLITHEMDVVKRICDCVAVISNGELIEQ
FT                   DTVSEVFSHPKTPLAQKFIQSTLHLDIPEDYQARLKASPETDSVPMLRMEFTGQSVDAP
FT                   LLSETARRFNVNNNIISAQMDYAGGVKFGIMLTEMHGTQEETQAAIAWLQDHHVKVEVL
FT                   GYV"
FT   gene            297983..298549
FT                   /locus_tag="SeAg_B0289"
FT   CDS_pept        297983..298549
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0289"
FT                   /product="D,D-heptose 1,7-bisphosphate phosphatase"
FT                   /note="identified by match to protein family HMM PF08645;
FT                   match to protein family HMM TIGR00213; match to protein
FT                   family HMM TIGR01656; match to protein family HMM
FT                   TIGR01662"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0289"
FT                   /db_xref="EnsemblGenomes-Tr:ACH48542"
FT                   /db_xref="GOA:B5F8W2"
FT                   /db_xref="InterPro:IPR004446"
FT                   /db_xref="InterPro:IPR006543"
FT                   /db_xref="InterPro:IPR006549"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:B5F8W2"
FT                   /protein_id="ACH48542.1"
FT                   /translation="MAKSVPAIFLDRDGTINVDHGYVHEIDAFEFIDGVIDAMRELKKM
FT                   GYALVVVTNQSGIARGKFTEAQFETLTEWMDWSLADRDVDLDGIYYCPHHPQGSIEEFR
FT                   QVCDCRKPHPGMLISARDFLHIDMAASYMVGDKLEDMQAAAAANVGTKVLVRTGKPVTA
FT                   EAENAADWVLNSLADLPSAIKKQQK"
FT   gene            complement(298620..298742)
FT                   /pseudo
FT                   /locus_tag="SeAg_B0290"
FT                   /note="conserved hypothetical protein; this gene contains a
FT                   frame shift which may be the result of sequencing error"
FT   gene            298922..300453
FT                   /gene="rrs"
FT                   /locus_tag="SeAg_B0291"
FT   rRNA            298922..300453
FT                   /gene="rrs"
FT                   /locus_tag="SeAg_B0291"
FT                   /product="16S ribosomal RNA"
FT   gene            300524..300600
FT                   /locus_tag="SeAg_B0292"
FT   tRNA            300524..300600
FT                   /locus_tag="SeAg_B0292"
FT                   /product="tRNA-Ile"
FT   gene            300709..300786
FT                   /locus_tag="SeAg_B0293"
FT   tRNA            300709..300786
FT                   /locus_tag="SeAg_B0293"
FT                   /product="tRNA-Ala"
FT   gene            300794..300910
FT                   /locus_tag="SeAg_B0294"
FT   CDS_pept        300794..300910
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0294"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0294"
FT                   /db_xref="EnsemblGenomes-Tr:ACH50906"
FT                   /db_xref="UniProtKB/TrEMBL:B5F8W3"
FT                   /protein_id="ACH50906.1"
FT                   /translation="MFTKKYFRVYLKGFTAKFCSLKIWIKLKIETLNNESCS"
FT   gene            300968..303956
FT                   /gene="rrl"
FT                   /locus_tag="SeAg_B0295"
FT   rRNA            300968..303956
FT                   /gene="rrl"
FT                   /locus_tag="SeAg_B0295"
FT                   /product="23S ribosomal RNA"
FT   gene            304153..304268
FT                   /gene="rrf"
FT                   /locus_tag="SeAg_B0297"
FT   rRNA            304153..304268
FT                   /gene="rrf"
FT                   /locus_tag="SeAg_B0297"
FT                   /product="5S ribosomal RNA"
FT   gene            304459..304537
FT                   /locus_tag="SeAg_B0298"
FT   tRNA            304459..304537
FT                   /locus_tag="SeAg_B0298"
FT                   /product="tRNA-Asp"
FT   gene            304680..305504
FT                   /gene="dkgB"
FT                   /locus_tag="SeAg_B0299"
FT   CDS_pept        304680..305504
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dkgB"
FT                   /locus_tag="SeAg_B0299"
FT                   /product="2,5-didehydrogluconate reductase B"
FT                   /EC_number="1.1.1.274"
FT                   /note="identified by match to protein family HMM PF00248"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0299"
FT                   /db_xref="EnsemblGenomes-Tr:ACH51048"
FT                   /db_xref="GOA:B5F8W4"
FT                   /db_xref="InterPro:IPR018170"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:B5F8W4"
FT                   /protein_id="ACH51048.1"
FT                   /translation="MIKKRNSMTIPAFGLGTFRLKDDVVIASVKTALELGYRAVDTAQI
FT                   YDNEAAVGQAIAESGVPRNELYITTKIWIENLSKDKLIPSLKESLKKLRTDYVDLTLIH
FT                   WPSPGDAVPVEEFMQALLEAKKQGLTREIGISNFTIPLMEKAIAAVGADHIATNQIELS
FT                   PYLQNRKVVDWAKAHGIHITSYMTLAYGKALKDEVIARIAAKHNATPAQVILAWAMGEG
FT                   YSVIPSSTRRENLASNLLAQDLHLDAEDKNAIAALDCNDRLVSPEGLAPEWD"
FT   gene            complement(305526..306440)
FT                   /locus_tag="SeAg_B0300"
FT   CDS_pept        complement(305526..306440)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0300"
FT                   /product="LysR substrate binding domain protein"
FT                   /note="identified by match to protein family HMM PF00126;
FT                   match to protein family HMM PF03466"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0300"
FT                   /db_xref="EnsemblGenomes-Tr:ACH53011"
FT                   /db_xref="GOA:B5F8W5"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B5F8W5"
FT                   /protein_id="ACH53011.1"
FT                   /translation="MKATSEELAIFVAVVESGSFSRAAEQLGQANSAVSRAVKKLEMKL
FT                   GVSLLNRTTRQLSLTEEGERYFRRVQQILQEMAAAETEIMESRNTPRGLLRIDAATPVM
FT                   LHFLMPLIKPFRERYPEITLSLVSSETFINLIERKVDVAIRAGTLTDSSLRARPLFTSY
FT                   RKIIASPDYIARFGKPETVEELKRHLCLGFSEPVSLNTWPIACSDGQLHEIKCGISSNS
FT                   GETLKQLCLNGNGIACLSDYMIDKEIAWGELVELLADKRLPVEMPFSAVYYSDRAVSTR
FT                   IRAFIDFLSEYIRTAPAGAVKEG"
FT   gene            306545..307720
FT                   /locus_tag="SeAg_B0301"
FT   CDS_pept        306545..307720
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0301"
FT                   /product="inner membrane transport protein YdhP"
FT                   /note="identified by match to protein family HMM PF07690"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0301"
FT                   /db_xref="EnsemblGenomes-Tr:ACH50225"
FT                   /db_xref="GOA:B5F8W6"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B5F8W6"
FT                   /protein_id="ACH50225.1"
FT                   /translation="MPLALFALTISAFAIGTTEFVIVGLVPTIAQQLAISLPSAGMLVS
FT                   IYALGVAIGAPVLTALTGRLPRKQLLVALMVLFTAGNLLAWQAPGYMTLIVARLLTGLA
FT                   HGVFFSIGSTIATSLVPKEKAASAIAIMFGGLTVALVTGVPLGTFIGQHFGWRETFLAV
FT                   SLLGVIALMSSQLLIPANIPGRAAASIRDQVKVLTHPRLLLIYAVTALGYGGVFTAFTF
FT                   LAPMMQDLAGFSPAAVSWILLGYGVSVAIGNIWGGKLADKHGAVPALKFIFAALFVLLM
FT                   VFQVTASTQYAALATILVMGIFAFGNVPGLQVYVVQKAEQFTPNAVDVASGLNIAAFNI
FT                   GIALGSVIGGQTVAHYGLAQTPWIGALIVLVAFLLMGVSGRLDKPVRIALE"
FT   gene            307852..308652
FT                   /locus_tag="SeAg_B0302"
FT   CDS_pept        307852..308652
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0302"
FT                   /product="protein YafD"
FT                   /note="identified by match to protein family HMM PF03372"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0302"
FT                   /db_xref="EnsemblGenomes-Tr:ACH49705"
FT                   /db_xref="GOA:B5F8W7"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR022958"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5F8W7"
FT                   /protein_id="ACH49705.1"
FT                   /translation="MRKNTYAMRYVAGQPAERILPPGSFASIGQALPAGEPLSSEERIR
FT                   ILVWNIFKQQRAEWLSVLKNYGKDAHLVLLQEAQTTPELVQFATANYLAADQVPAFVLP
FT                   QHPSGVMTLSAAHPVYCCPLREREPILRLAKSALVTVYPLPDTRLLMVVNVHAVNFSLG
FT                   VDVYSKQLLPIGDQIAHHSGPVIMAGDFNAWSRPRMNALYRFAREMSLRQVRFTDDQRR
FT                   RAFGRPLDFVFYRGLNVNEASVLVTRASDHNPLLVEFSPGKPEQ"
FT   gene            308730..309500
FT                   /locus_tag="SeAg_B0303"
FT   CDS_pept        308730..309500
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0303"
FT                   /product="methyltransferase, UbiE/COQ5 family"
FT                   /note="identified by match to protein family HMM PF01209;
FT                   match to protein family HMM PF08241; match to protein
FT                   family HMM PF08242"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0303"
FT                   /db_xref="EnsemblGenomes-Tr:ACH50438"
FT                   /db_xref="GOA:B5F8W8"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B5F8W8"
FT                   /protein_id="ACH50438.1"
FT                   /translation="MTTHSHHDNVEKQFGSQANAYLHSAVHAAGRDLARLAQRLSDFSH
FT                   ANVLDMGCGAGHASFVAAQHANSVVAYDLSASMLEVVAGAAEERHLSNITLRQGYAEKL
FT                   PFEDASFEVVISRYSAHHWHDVGQALHEVYRVLKPGGVLIIMDVMSPGHPVRDIWLQTV
FT                   EALRDTSHVRNYSSGEWLAMVNNAMLVTNTVITDRLSLEFRSWVTRMRTPAPLVEAIRL
FT                   YQGSAPAEVKRYFELQDDGSFSSDTIMLEAHKAV"
FT   gene            complement(309556..310923)
FT                   /gene="mltD"
FT                   /locus_tag="SeAg_B0304"
FT   CDS_pept        complement(309556..310923)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mltD"
FT                   /locus_tag="SeAg_B0304"
FT                   /product="membrane-bound lytic murein transglycosylase D"
FT                   /EC_number="2.4.-.-"
FT                   /note="identified by match to protein family HMM PF01464;
FT                   match to protein family HMM PF01476"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0304"
FT                   /db_xref="EnsemblGenomes-Tr:ACH49731"
FT                   /db_xref="GOA:B5F8W9"
FT                   /db_xref="InterPro:IPR000189"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/TrEMBL:B5F8W9"
FT                   /protein_id="ACH49731.1"
FT                   /translation="MKAKAILLASVLLVGCQTSQNTGNVQQHAQSLSAAGQGEAGKFTS
FT                   QARWMDDGTSIAPDQDLWAFIGDELKMGIPENSRIREQKQKYLRNKSYLHDVTLRAEPY
FT                   MYWIAGQVKKRNMPMELVLLPIVESAFDPHATSGANAAGIWQIIPSTGRNYGLKQTRNY
FT                   DARRDVVASTTAALDMMQRLNKMFDGDWLLTVAAYNSGEGRVMRAIKANKARGKPTDFW
FT                   SLSLPRETKLYVPKMLALSEILKNSKRYGVRLPTTDESRALARVRLNSPVEMAQVADMA
FT                   GMSISKLKAFNAGVKGSTLGVSGPQYVMVPKKHAEQLRESLASGEIDAVQSQLIADNTP
FT                   LNSRSYKVRSGDTLSGIASRLGVSTKDLQQWNNLRGSRLKIGQSLTVGAGSSAQRLANN
FT                   SDSITYRVRKGDSLSSIARRHGVNIKDVMRWNHDTDNLQPGDQLTLFVKDNSTPDS"
FT   gene            complement(310995..311750)
FT                   /gene="gloB"
FT                   /locus_tag="SeAg_B0305"
FT   CDS_pept        complement(310995..311750)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gloB"
FT                   /locus_tag="SeAg_B0305"
FT                   /product="hydroxyacylglutathione hydrolase"
FT                   /EC_number="3.1.2.6"
FT                   /note="identified by match to protein family HMM PF00753;
FT                   match to protein family HMM TIGR03413"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0305"
FT                   /db_xref="EnsemblGenomes-Tr:ACH49380"
FT                   /db_xref="GOA:B5F8X0"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR017782"
FT                   /db_xref="InterPro:IPR032282"
FT                   /db_xref="InterPro:IPR035680"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5F8X0"
FT                   /protein_id="ACH49380.1"
FT                   /translation="MNLNSIPAFQDNYIWVLTNDEGRCVIVDPGEAAPVLKAIAEHKWM
FT                   PEAIFLTHHHHDHVGGVKELLQHFPQMTVYGPAETQDKGATHLVGDGDTIRVLGEKFTL
FT                   FATPGHTLGHVCYFSHPYLFCGDTLFSGGCGRLFEGTPSQMYQSLMKINSLPDDTLICC
FT                   AHEYTLANIKFALSILPHDSFINEYYRKVKELRVKKQMTLPVILKNERKINLFLRTEDI
FT                   DLINEINKETILQQPEARFAWLRSKKDTF"
FT   gene            311785..312507
FT                   /locus_tag="SeAg_B0306"
FT   CDS_pept        311785..312507
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0306"
FT                   /product="putative methyltransferase"
FT                   /note="identified by match to protein family HMM PF08241"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0306"
FT                   /db_xref="EnsemblGenomes-Tr:ACH52959"
FT                   /db_xref="GOA:B5F8X1"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR026669"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B5F8X1"
FT                   /protein_id="ACH52959.1"
FT                   /translation="MKPARLSQTVVAPGCWGELPWGNYYREALEQQLNPWFAKMYGFHL
FT                   LKIGNLSAEINSEACAVSHQVNVSSQGSPMQVLADPLHLPFADKSVDVCLLAHTLPWCT
FT                   DPHRLLREADRVLIDDGWLVISGFNPLSLMGLRKLVPVLRKTPPYNSRMFTLMRQLDWL
FT                   SLLNFEVLHYSRFHVLPWKKQGGRLLNTHIPALGCLQLIVARKRTIPLTLNPLRHNKSK
FT                   TPIRQTVGATRQYRKPDG"
FT   gene            complement(312504..312971)
FT                   /gene="rnhA"
FT                   /locus_tag="SeAg_B0307"
FT   CDS_pept        complement(312504..312971)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rnhA"
FT                   /locus_tag="SeAg_B0307"
FT                   /product="ribonuclease HI"
FT                   /EC_number="3.1.26.4"
FT                   /note="identified by match to protein family HMM PF00075"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0307"
FT                   /db_xref="EnsemblGenomes-Tr:ACH48726"
FT                   /db_xref="GOA:B5F8X2"
FT                   /db_xref="InterPro:IPR002156"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR022892"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5F8X2"
FT                   /protein_id="ACH48726.1"
FT                   /translation="MLKQVEIFTDGSCLGNPGPGGYGAILRYRGHEKTFSEGYTLTTNN
FT                   RMELMAAIVALEALKEHCEVTLSTDSQYVRQGITQWIHNWKKRGWKTAEKKPVKNVDLW
FT                   KRLDAALGQHQIKWVWVKGHAGHPENERCDELARAAAMNPTQEDSGYQAEA"
FT   gene            313026..313766
FT                   /gene="dnaQ"
FT                   /locus_tag="SeAg_B0308"
FT   CDS_pept        313026..313766
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaQ"
FT                   /locus_tag="SeAg_B0308"
FT                   /product="DNA polymerase III, epsilon subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="identified by match to protein family HMM PF00929;
FT                   match to protein family HMM TIGR00573; match to protein
FT                   family HMM TIGR01406"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0308"
FT                   /db_xref="EnsemblGenomes-Tr:ACH49893"
FT                   /db_xref="GOA:B5F8X3"
FT                   /db_xref="InterPro:IPR006054"
FT                   /db_xref="InterPro:IPR006309"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:B5F8X3"
FT                   /protein_id="ACH49893.1"
FT                   /translation="MTDMSTAITRQIVLDTETTGMNQIGAHYEGHKIIEIGAVEVINRR
FT                   LTGNNFHVYLKPDRLVDPEAFGVHGIADEFLLDKPVFADVVDEFLDYIRGAELVIHNAS
FT                   FDIGFMDYEFGLLKRDIPKTNTFCKVTDSLALARKMFPGKRNSLDALCSRYEIDNSKRT
FT                   LHGALLDAQILAEVYLAMTGGQTSMTFAMEGETQRQQGEATIQRIVRQASRLRVVFASE
FT                   EELAAHESRLDLVQKKGGSCLWRA"
FT   gene            313899..313977
FT                   /locus_tag="SeAg_B0309"
FT   tRNA            313899..313977
FT                   /locus_tag="SeAg_B0309"
FT                   /product="tRNA-Asp"
FT   gene            314139..314501
FT                   /locus_tag="SeAg_B0310"
FT   CDS_pept        314139..314501
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0310"
FT                   /product="integrase"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0310"
FT                   /db_xref="EnsemblGenomes-Tr:ACH52873"
FT                   /db_xref="InterPro:IPR025166"
FT                   /db_xref="InterPro:IPR038488"
FT                   /db_xref="UniProtKB/TrEMBL:B5F8X4"
FT                   /protein_id="ACH52873.1"
FT                   /translation="MALTDPKIRALKSLDKPYKVIDSGGLYILVKPGGAKHWYLRYRFG
FT                   GKETRIAFGVYPAVTLAAAREKREEVRRMLAENVHPALQRVAEKVAADPSRTLQHIASE
FT                   LHQNILPGHIHCRVII"
FT   gene            complement(314557..314748)
FT                   /locus_tag="SeAg_B0311"
FT   CDS_pept        complement(314557..314748)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0311"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0311"
FT                   /db_xref="EnsemblGenomes-Tr:ACH52206"
FT                   /db_xref="UniProtKB/TrEMBL:B5F8X5"
FT                   /protein_id="ACH52206.1"
FT                   /translation="MLIFCDFIPLQAGADNGFMAYLLTVVTALRSNGNKTTAPRKGKGP
FT                   QGKGSLRVIVPARKGQRA"
FT   gene            complement(314876..315145)
FT                   /locus_tag="SeAg_B0312"
FT   CDS_pept        complement(314876..315145)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0312"
FT                   /product="DNA-binding prophage protein"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0312"
FT                   /db_xref="EnsemblGenomes-Tr:ACH51843"
FT                   /db_xref="GOA:B5F8X6"
FT                   /db_xref="InterPro:IPR024457"
FT                   /db_xref="UniProtKB/TrEMBL:B5F8X6"
FT                   /protein_id="ACH51843.1"
FT                   /translation="MKQAGGAHKTVSDRMALAERFCKRLVTELNVQIRNVRHLNARHIE
FT                   DYIRHRLAQGFGQKEALAMVAMELGHGDGRGRYVAQVYRLRGEG"
FT   gene            315805..316290
FT                   /locus_tag="SeAg_B0313"
FT   CDS_pept        315805..316290
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0313"
FT                   /product="type VI secretion system Vgr family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0313"
FT                   /db_xref="EnsemblGenomes-Tr:ACH51215"
FT                   /db_xref="GOA:B5F8X7"
FT                   /db_xref="InterPro:IPR036444"
FT                   /db_xref="UniProtKB/TrEMBL:B5F8X7"
FT                   /protein_id="ACH51215.1"
FT                   /translation="MSTGLRFTLEVDGLPPDVFAVVSFHLSQSYSSLFTLDISLVSQQL
FT                   HSIEFSQILEKMAYLKIWQGNETEGSDWFVPDGLWGVNFMDACRNHDKCYATKGSDKIT
FT                   CDVNLGNDIALACGVLKSEDPRYNDIYTQCLITSAAYRVAVGTFGKGAYNDAQAGAE"
FT   gene            316978..317262
FT                   /pseudo
FT                   /locus_tag="SeAg_B0314"
FT                   /note="transposase IS66; this gene contains a premature
FT                   stop which may be the result of sequencing error"
FT   gene            317558..317944
FT                   /locus_tag="SeAg_B0315"
FT   CDS_pept        317558..317944
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0315"
FT                   /product="putative cytoplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0315"
FT                   /db_xref="EnsemblGenomes-Tr:ACH51236"
FT                   /db_xref="UniProtKB/TrEMBL:B5F8X8"
FT                   /protein_id="ACH51236.1"
FT                   /translation="MITSENLDESLQETQGWLARLAAQHITPDTMRRGRLTEQVDQLWA
FT                   MWQPGPWWAQWLRGLRRTSQRSRELTGLSDEAPVVELPGVRYLPWPGWPGKTLGQGWFW
FT                   QQNSEGRYVDALLLVDRTNRGHML"
FT   gene            317971..318357
FT                   /locus_tag="SeAg_B0316"
FT   CDS_pept        317971..318357
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0316"
FT                   /product="probable secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0316"
FT                   /db_xref="EnsemblGenomes-Tr:ACH50337"
FT                   /db_xref="InterPro:IPR018696"
FT                   /db_xref="UniProtKB/TrEMBL:B5F8X9"
FT                   /protein_id="ACH50337.1"
FT                   /translation="MSACAGMFLPVFVWGGTDVNIDNPLAECVDIHPVHRQEMDNLTIL
FT                   KTTVTLKKSTGECGCFSALISYTSLLAQDVEGYGRGSAYSLQEGNISLAKMQGRYPFSF
FT                   VLSVDNQSVRDQKLALMIRCTPPL"
FT   gene            318627..318860
FT                   /locus_tag="SeAg_B0317"
FT   CDS_pept        318627..318860
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0317"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0317"
FT                   /db_xref="EnsemblGenomes-Tr:ACH49844"
FT                   /db_xref="UniProtKB/TrEMBL:B5F8Y0"
FT                   /protein_id="ACH49844.1"
FT                   /translation="MHYILKKQVKYTEPDGGKDNIVNLAPKINFPIGHLIEYYLLSKRP
FT                   SDLLEYVKKIRIPGPNKYVKEIEKIFSEIQES"
FT   gene            complement(318927..319184)
FT                   /locus_tag="SeAg_B0318"
FT   CDS_pept        complement(318927..319184)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0318"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF08845"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0318"
FT                   /db_xref="EnsemblGenomes-Tr:ACH49283"
FT                   /db_xref="GOA:B5F8Y1"
FT                   /db_xref="InterPro:IPR014944"
FT                   /db_xref="UniProtKB/TrEMBL:B5F8Y1"
FT                   /protein_id="ACH49283.1"
FT                   /translation="MNASGVSVRHINSETCITTCYSQIPSQHLKGDWQEEAGFETGRSV
FT                   TVKISQGCIVLMADGNEVQKLCEQLYQAERVVKGLKDVLV"
FT   gene            319246..319365
FT                   /locus_tag="SeAg_B0319"
FT   CDS_pept        319246..319365
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0319"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0319"
FT                   /db_xref="EnsemblGenomes-Tr:ACH48778"
FT                   /db_xref="UniProtKB/TrEMBL:B5F8Y2"
FT                   /protein_id="ACH48778.1"
FT                   /translation="MSEYGRDILAPRPPLPGQHRAVMSNRLPGPYFDDETGLH"
FT   gene            319817..319957
FT                   /pseudo
FT                   /locus_tag="SeAg_B0320"
FT                   /note="rhs core protein with extension; this gene contains
FT                   a frame shift which may be the result of sequencing error"
FT   gene            320312..320509
FT                   /locus_tag="SeAg_B0321"
FT   CDS_pept        320312..320509
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0321"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0321"
FT                   /db_xref="EnsemblGenomes-Tr:ACH51382"
FT                   /db_xref="GOA:B5F8Y3"
FT                   /db_xref="UniProtKB/TrEMBL:B5F8Y3"
FT                   /protein_id="ACH51382.1"
FT                   /translation="MRIIHCVIIAVQVLLLVCYSQYQPLMLIYYQEYQSLEGILMGHFL
FT                   REWLIQMLVIKLIVINIQKV"
FT   gene            320628..321095
FT                   /locus_tag="SeAg_B0322"
FT   CDS_pept        320628..321095
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0322"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0322"
FT                   /db_xref="EnsemblGenomes-Tr:ACH49407"
FT                   /db_xref="GOA:B5F8Y4"
FT                   /db_xref="UniProtKB/TrEMBL:B5F8Y4"
FT                   /protein_id="ACH49407.1"
FT                   /translation="MKRNRFFLSLLFMVLIVLFVILFFTWLGRENIKNDSAIREVAKEE
FT                   VDKLFSLYNEGEYAEIYDLSCDSFKNATARKDFLTVMGTKMKILGEFKGRKLQYSNVIN
FT                   SKSVELYYRVDYIDYSLIEEFNYIKNDGQKICLQAMYTDDAGKHGEVIKLH"
FT   gene            321470..321691
FT                   /pseudo
FT                   /locus_tag="SeAg_B0323"
FT                   /note="putative cytoplasmic protein; this gene contains a
FT                   premature stop which may be the result of sequencing error"
FT   gene            321714..321872
FT                   /locus_tag="SeAg_B0324"
FT   CDS_pept        321714..321872
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0324"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0324"
FT                   /db_xref="EnsemblGenomes-Tr:ACH49340"
FT                   /db_xref="GOA:B5F8Y5"
FT                   /db_xref="UniProtKB/TrEMBL:B5F8Y5"
FT                   /protein_id="ACH49340.1"
FT                   /translation="MCKSRRGYLFPAFYYQLLINSCSVLLRLITGISPVLFSAPEMFLT
FT                   TVLHSVY"
FT   gene            complement(321823..321936)
FT                   /pseudo
FT                   /locus_tag="SeAg_B0325"
FT                   /note="putative cytoplasmic protein; this region contains
FT                   one or more premature stops and/or frameshifts"
FT   gene            complement(322136..322276)
FT                   /locus_tag="SeAg_B0326"
FT   CDS_pept        complement(322136..322276)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0326"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0326"
FT                   /db_xref="EnsemblGenomes-Tr:ACH52029"
FT                   /db_xref="UniProtKB/TrEMBL:B5F8Y6"
FT                   /protein_id="ACH52029.1"
FT                   /translation="MFTLTAKIQLEQTVNTVEPFVIPRVSLPPYPDFQLSLVASEIPAS
FT                   R"
FT   gene            322479..322673
FT                   /pseudo
FT                   /locus_tag="SeAg_B0327"
FT                   /note="transposase B; this region contains one or more
FT                   premature stops and/or frameshifts"
FT   gene            323451..323576
FT                   /locus_tag="SeAg_B0328"
FT   CDS_pept        323451..323576
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0328"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0328"
FT                   /db_xref="EnsemblGenomes-Tr:ACH51294"
FT                   /db_xref="GOA:B5F8Y7"
FT                   /db_xref="UniProtKB/TrEMBL:B5F8Y7"
FT                   /protein_id="ACH51294.1"
FT                   /translation="MVWRYVFWMCWIILIWFKKGGYSNEKHKKIDYRKCVEHDGC"
FT   gene            complement(324068..324199)
FT                   /locus_tag="SeAg_B0329"
FT   CDS_pept        complement(324068..324199)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0329"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0329"
FT                   /db_xref="EnsemblGenomes-Tr:ACH49301"
FT                   /db_xref="UniProtKB/TrEMBL:B5F8Y8"
FT                   /protein_id="ACH49301.1"
FT                   /translation="MAEFNCCLAAYTETIELEANKATAIKTKLIVFISKIVKEKRKI"
FT   gene            324234..324839
FT                   /locus_tag="SeAg_B0330"
FT   CDS_pept        324234..324839
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0330"
FT                   /product="gram-negative pili assembly chaperone"
FT                   /note="identified by match to protein family HMM PF00345;
FT                   match to protein family HMM PF02753"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0330"
FT                   /db_xref="EnsemblGenomes-Tr:ACH49925"
FT                   /db_xref="GOA:B5F8Y9"
FT                   /db_xref="InterPro:IPR001829"
FT                   /db_xref="InterPro:IPR008962"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR016147"
FT                   /db_xref="InterPro:IPR016148"
FT                   /db_xref="InterPro:IPR018046"
FT                   /db_xref="InterPro:IPR036316"
FT                   /db_xref="UniProtKB/TrEMBL:B5F8Y9"
FT                   /protein_id="ACH49925.1"
FT                   /translation="MIYHAGTPGATLSVSNPQDYPILVQSSVKAEDKNSPAPFMVMPPL
FT                   FRLEANQQSQLRIIRTGGDMPTDRETLQWVCIKALPPENEPSDTQAKGATLDLNLSIST
FT                   CDKLIFRPDAVKGTPEDVAGNLRWVETGNKLKVENPTPFYMNLASVTVGGKPITGLEYI
FT                   PPFADKTLNMPGGTRGDVEWKIITDLGGESHPFHYVFK"
FT   gene            324863..327373
FT                   /locus_tag="SeAg_B0331"
FT   CDS_pept        324863..327373
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0331"
FT                   /product="outer-membrane fimbrial usher protein"
FT                   /note="identified by match to protein family HMM PF00577"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0331"
FT                   /db_xref="EnsemblGenomes-Tr:ACH49831"
FT                   /db_xref="GOA:B5F8Z0"
FT                   /db_xref="InterPro:IPR000015"
FT                   /db_xref="InterPro:IPR025885"
FT                   /db_xref="InterPro:IPR025949"
FT                   /db_xref="InterPro:IPR037224"
FT                   /db_xref="InterPro:IPR042186"
FT                   /db_xref="UniProtKB/TrEMBL:B5F8Z0"
FT                   /protein_id="ACH49831.1"
FT                   /translation="MKFKQPALLLFIAGVVHCANAHAYTFDASMLGDAAKGVDMSLFNQ
FT                   GVQQPGTYRVDVMVNGKRVDTRDVVFKLEKDGQGTPFLAPCLTVSQLSRYGVKTEDYPQ
FT                   LWKAAKTPDECADLSAIPQAKAVLDINNQQLQLSIPQVALRTKFKGIAPEDLWDDGIPA
FT                   FLMNYSARTTQTDYKMDMERRDNSSWVQLQPGINIGAWRVRNATSWQRSGQQSGKWQAA
FT                   YTYAERGLYSLKSRLTLGQKTSQGEIFDSVPFTGVMLASDDNMVPYSERQFAPVVRGIA
FT                   RTQARVEVKQNGYTIYNTTVAPGPFALRDLSVADSSGDLHVTVWEADGSTQMFVVPYQT
FT                   PAIALHQGYLKYSLLAGRYRSSDSATDKAQIAQATLMYGLPWNLTAYGGIQSATHYQAA
FT                   SLGLGGSLGRWGSLSVDGSDTHSQRQGEAVQQGASWRLRYSNQLTATGTNFFLTRWQYA
FT                   SQGYNTLSDVLDSYRHNGNRLWSWRENLQPSSRTTLMLSQSWGRHLGNLSLTGSRTDWR
FT                   NRPGHDDSYGLSWGTSIGGGSLSLNWNQNRTLWRNGAHRKENITSLWFSMPLSRWTGNN
FT                   VSASWQMTSPSHGGQTQQVGVNGEAFSQQLDWEVRQSYRADAPPGGGNNSALHLAWNGA
FT                   YGLLGGDYSYSRAMRQMGVNIAGGIVIHHHGVTLGQPLQGSVALVEAPGASGVPVGGWP
FT                   GVKTDFRGDTTVGNLNVYQENTVSLDPSRLPDDAEVTQTDVRVVPTEGAVVEAKFHTHI
FT                   GARALMTLKREDGSAIPFGAQVTVNGQDGSAALVDTDSQVYLTGLADKGELTVKWGAQQ
FT                   CRVNYQLPAHKGIAGLYQMSGLCR"
FT   gene            327395..327865
FT                   /locus_tag="SeAg_B0332"
FT   CDS_pept        327395..327865
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0332"
FT                   /product="putative fimbrial structural subunit"
FT                   /note="identified by match to protein family HMM PF05775"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0332"
FT                   /db_xref="EnsemblGenomes-Tr:ACH48922"
FT                   /db_xref="InterPro:IPR008394"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="UniProtKB/TrEMBL:B5F8Z1"
FT                   /protein_id="ACH48922.1"
FT                   /translation="MWMKIQRVKTVIYSVSLLVAASSLMPIANAAEKLQTTLRVGTYFR
FT                   AGHVPDGMVLAQGWVTYHGSHSGFRVWSDEQKAGNTPTVLLLSGQQDPRHHIQVRLEGE
FT                   GWQPDTVSGRGAILRTAADNASFSVVVDGNQEVPADTWTLDFKACALAQEDT"
FT   gene            328273..329094
FT                   /locus_tag="SeAg_B0333"
FT   CDS_pept        328273..329094
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0333"
FT                   /product="polysaccharide deacetylase family protein"
FT                   /note="identified by match to protein family HMM PF01522"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0333"
FT                   /db_xref="EnsemblGenomes-Tr:ACH49394"
FT                   /db_xref="GOA:B5F8Z2"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:B5F8Z2"
FT                   /protein_id="ACH49394.1"
FT                   /translation="MSYARHLPVLMYHHVSDKPGQITLSPRTFRAQMKWLAESGWKTVT
FT                   AAEVEAFYHGARLPRKSVMLTFDGGWLDNWLQVFPVLQEFNLHAHLFLVTSLISDGPVR
FT                   IPAGELVYSHDECQMLVKQGRADEVMLRWSEVREMHLSGLVEFHSHTHTHRRWDQKPVS
FT                   RNPSDLLRVDILLSRKRMREMLGYCSQHLCWPEGWYCSDYIHVAEELGFTYLYTTERRM
FT                   NNPVIGSQRIGRINTKERKNVGWLKRRLFYHTTPGFSSLLARHKGARRIAD"
FT   gene            329577..329708
FT                   /locus_tag="SeAg_B0334"
FT   CDS_pept        329577..329708
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0334"
FT                   /product="TnpA"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0334"
FT                   /db_xref="EnsemblGenomes-Tr:ACH51953"
FT                   /db_xref="UniProtKB/TrEMBL:B5F8Z3"
FT                   /protein_id="ACH51953.1"
FT                   /translation="MNDAINALQTASQKRRMPLQNGRMTMNHFIIGIWFGDNLDDHF"
FT   gene            329911..330858
FT                   /locus_tag="SeAg_B0335"
FT   CDS_pept        329911..330858
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0335"
FT                   /product="LysR-family transcriptional regulator SinR"
FT                   /note="identified by match to protein family HMM PF00126;
FT                   match to protein family HMM PF03466"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0335"
FT                   /db_xref="EnsemblGenomes-Tr:ACH53013"
FT                   /db_xref="GOA:B5F8Z4"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B5F8Z4"
FT                   /protein_id="ACH53013.1"
FT                   /translation="MMELINNRGMRDWMIFIKVAEVGNLSRAARELDISISAVSKSLSR
FT                   LENSIEVTLLRRDSHHLELTGAGQTAYASMKRITSSFQSLLDELRNPDKIIRGSIKFSA
FT                   PAIVCEFLANKWIWEFTASYPDTKIYLDSRERSDFFSKSLEFDELVFKSGIIESEDLVY
FT                   RKISPLKLVLCASPKYIRKYGRISHPGDLENHIIVGLHNHGLSGPLTLFRQDESYTISG
FT                   AVNVHLSSNNLLSVLNLVLEGKGINLMTPAWLATKYLKNNELEIILPEWRVPDLPIYLV
FT                   WRHRQYYSPLFQRFLSFIEDKWNNRPQIDFLNDD"
FT   gene            331018..331200
FT                   /locus_tag="SeAg_B0336"
FT   CDS_pept        331018..331200
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0336"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0336"
FT                   /db_xref="EnsemblGenomes-Tr:ACH50772"
FT                   /db_xref="UniProtKB/TrEMBL:B5F8Z5"
FT                   /protein_id="ACH50772.1"
FT                   /translation="MGLFLGSRKLSPYQKRCSVLKNGARLHLFNDFLKAQEYSLLISSI
FT                   APSGTHRTSYFTDSV"
FT   gene            complement(331356..331425)
FT                   /locus_tag="SeAg_B0338"
FT   ncRNA           complement(331356..331425)
FT                   /locus_tag="SeAg_B0338"
FT                   /product="RNA-OUT"
FT                   /ncRNA_class="antisense_RNA"
FT   gene            331418..332626
FT                   /locus_tag="SeAg_B0337"
FT   CDS_pept        331418..332626
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0337"
FT                   /product="IS10 transposase"
FT                   /note="identified by match to protein family HMM PF01609"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0337"
FT                   /db_xref="EnsemblGenomes-Tr:ACH49228"
FT                   /db_xref="GOA:B5EXM3"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:B5EXM3"
FT                   /protein_id="ACH49228.1"
FT                   /translation="MCELDILHDSLYQFCPELHLKRLNSLTLACHALLDCKTLTLTELG
FT                   RNLPTKARTKHNIKRIDRLLGNRHLHKERLAVYRWHASFICSGNTMPIVLVDWSDIREQ
FT                   KRLMVLRASVALHGRSVTLYEKAFPLSEQCSKKAHDQFLADLASILPSNTTPLIVSDAG
FT                   FKVPWYKSVEKLGWYWLSRVRGKVQYADLGAENWKPISNLHDMSSSHSKTLGYKRLTKS
FT                   NPISCQILLYKSRSKGRKNQRSTRTHCHHPSPKIYSASAKEPWILATNLPVEIRTPKQL
FT                   VNIYSKRMQIEETFRDLKSPAYGLGLRHSRTSSSERFDIMLLIALMLQLTCWLAGVHAQ
FT                   KQGWDKHFQANTVRNRNVLSTVRLGMEVLRHSGYTITREDLLVAATLLAQNLFTHGYAL
FT                   GKL"
FT   gene            complement(332595..333254)
FT                   /locus_tag="SeAg_B0339"
FT   CDS_pept        complement(332595..333254)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0339"
FT                   /product="putative outer membrane adhesin"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0339"
FT                   /db_xref="EnsemblGenomes-Tr:ACH51448"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="InterPro:IPR027385"
FT                   /db_xref="UniProtKB/TrEMBL:B5F8Z7"
FT                   /protein_id="ACH51448.1"
FT                   /translation="MKNFFAVCIIPLVVTWSATASAKEGIYITGKAGTSVVNVYGINST
FT                   FSQDKIVNGHATLPDRTKGVFGGGVAIGYDFYDPFQLPVRLELDTTFRGETDAKGGQDI
FT                   IAFGQPVHINVKNQVRMTTYMVNGYYDFHNSTAFTPYISAGVGLAHVKLSNNTIPVGFG
FT                   INETLSASKNNFAWGAGIGAKYAVTDNIMIDASYKYINAGKVLRDPLIISPKRNHV"
FT   gene            complement(333279..333407)
FT                   /locus_tag="SeAg_B0340"
FT   CDS_pept        complement(333279..333407)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0340"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0340"
FT                   /db_xref="EnsemblGenomes-Tr:ACH52484"
FT                   /db_xref="UniProtKB/TrEMBL:B5F8Z8"
FT                   /protein_id="ACH52484.1"
FT                   /translation="MLFKIFISFFTRLQKTQRYNRPFFGLRLCNRYITPYTVKLVF"
FT   gene            complement(333600..334007)
FT                   /locus_tag="SeAg_B0341"
FT   CDS_pept        complement(333600..334007)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0341"
FT                   /product="periplasmic protein"
FT                   /note="identified by match to protein family HMM PF07813"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0341"
FT                   /db_xref="EnsemblGenomes-Tr:ACH50267"
FT                   /db_xref="GOA:B5EWJ1"
FT                   /db_xref="InterPro:IPR012899"
FT                   /db_xref="UniProtKB/TrEMBL:B5EWJ1"
FT                   /protein_id="ACH50267.1"
FT                   /translation="MKNFVRTTLLAATLAGVSFGAFATAVPNPPLPAQDPIVQHLKLTN
FT                   DQITRIKKLHQQLETDVSQISMKGIKDGALIEVIKSGKWDDAAVKQQLAAFSNIEQQAR
FT                   YYRVKYYFDLSKVLTPEQRQQVQQDLAQALE"
FT   gene            complement(334317..335084)
FT                   /locus_tag="SeAg_B0342"
FT   CDS_pept        complement(334317..335084)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0342"
FT                   /product="hydrolase YafV"
FT                   /EC_number="3.5.-.-"
FT                   /note="identified by match to protein family HMM PF00795"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0342"
FT                   /db_xref="EnsemblGenomes-Tr:ACH51043"
FT                   /db_xref="GOA:B5EWJ2"
FT                   /db_xref="InterPro:IPR001110"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/TrEMBL:B5EWJ2"
FT                   /protein_id="ACH51043.1"
FT                   /translation="MSGLKITLLQQPLVWMDGPANLRHFDRQLELVSGRDVIVLPEMFT
FT                   TGFAMEAANNSLSQDSVITWMQAKARQTDALIAGSAALQTERGAVNRFLLVEPEGKVHL
FT                   YDKRHLFRMADEHQHYAAGDKRIIVQWRGWRILPLICYDLRFPIWSRNRNDYDLALYVA
FT                   NWPAPRSLHWQTLLTARAIENQAYVAGCNRVGTDGNGLHYRGDSRIINPQGDIIATAEP
FT                   HQATRIDADLSLVALQDYREKFPAWRDADPFTL"
FT   gene            complement(335193..337637)
FT                   /pseudo
FT                   /gene="fadE"
FT                   /locus_tag="SeAg_B0343"
FT                   /note="acyl-coenzyme A dehydrogenase; this gene contains a
FT                   frame shift which may be the result of sequencing error;
FT                   identified by match to protein family HMM PF00441; match to
FT                   protein family HMM PF09317"
FT   gene            337877..338455
FT                   /gene="gmhA"
FT                   /locus_tag="SeAg_B0344"
FT   CDS_pept        337877..338455
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gmhA"
FT                   /locus_tag="SeAg_B0344"
FT                   /product="phosphoheptose isomerase"
FT                   /EC_number="5.3.1.-"
FT                   /note="identified by match to protein family HMM TIGR00441"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0344"
FT                   /db_xref="EnsemblGenomes-Tr:ACH50059"
FT                   /db_xref="GOA:B5EWJ3"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR004515"
FT                   /db_xref="InterPro:IPR035461"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5EWJ3"
FT                   /protein_id="ACH50059.1"
FT                   /translation="MYQDLIRNELNEAAETLANFLKDDANIHAIQRAAVLLADSFKAGG
FT                   KVLSCGNGGSHCDAMHFAEELTGRYRENRPGYPAIAISDVSHISCVSNDFGYDYIFSRY
FT                   VEAVGREGDVLLGISTSGNSGNVIKAIAAAREKGMKVITLTGKDGGKMAGTADIEIRVP
FT                   HFGYADRIQEIHIKVIHILIQLIEKEMVK"
FT   gene            338668..339435
FT                   /locus_tag="SeAg_B0345"
FT   CDS_pept        338668..339435
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0345"
FT                   /product="glutamine amidotransferase, class II"
FT                   /note="identified by match to protein family HMM PF00310"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0345"
FT                   /db_xref="EnsemblGenomes-Tr:ACH52792"
FT                   /db_xref="GOA:B5EWJ4"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR026869"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:B5EWJ4"
FT                   /protein_id="ACH52792.1"
FT                   /translation="MCELLGMSANVPTDICFSFTGLVQRGGGTGPHKDGWGITFYEGKG
FT                   CRTFKDPQPSYHSPIAKLVQNYPIKSCSVIAHIRQANRGEVALENTHPFTRELWGRNWT
FT                   YAHNGQLNGYKSLETGNFRPVGETDSEKAFCWLLHKLTQRYPRTPGNMTAVFKYIATLA
FT                   TVLREKGVFNMLLSDGRYVMAFCSTHLHWITRRAPFGVATLVDQDMEIDFSSQTTPNDV
FT                   VTVIATQPLTGNETWQKIMPGEWALFCLGERII"
FT   gene            complement(339406..340146)
FT                   /locus_tag="SeAg_B0346"
FT   CDS_pept        complement(339406..340146)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0346"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF06104"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0346"
FT                   /db_xref="EnsemblGenomes-Tr:ACH52297"
FT                   /db_xref="GOA:B5EWJ5"
FT                   /db_xref="InterPro:IPR005490"
FT                   /db_xref="InterPro:IPR038063"
FT                   /db_xref="UniProtKB/TrEMBL:B5EWJ5"
FT                   /protein_id="ACH52297.1"
FT                   /translation="MRKIAFFLAMLLMPCVSFAGLLSSSSPVTPVSKEYKQQLMGSPVY
FT                   IQIFKEERTLDLYVKMGEQYQLLDSYKICNYSGGLGPKRRQGDFKSPEGFYSVQRNQLK
FT                   PDSRFYKAINIGFPNAYDRAHGYDGKYLMIHGACVSVGCYAMTDSGIDEIFQFVTAALV
FT                   FGQPSVQVSIYPFRMTDANMQRHKYSYYKDFWAQLKPGYDYFEQTHKPPTVSIVDGRYV
FT                   VSKPLSHEVVQPQLASNYTLSEAK"
FT   gene            340396..341451
FT                   /locus_tag="SeAg_B0347"
FT   CDS_pept        340396..341451
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0347"
FT                   /product="DNA polymerase IV"
FT                   /EC_number="2.7.7.7"
FT                   /note="identified by match to protein family HMM PF00817"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0347"
FT                   /db_xref="EnsemblGenomes-Tr:ACH51453"
FT                   /db_xref="GOA:B5EWJ6"
FT                   /db_xref="InterPro:IPR001126"
FT                   /db_xref="InterPro:IPR017961"
FT                   /db_xref="InterPro:IPR022880"
FT                   /db_xref="InterPro:IPR024728"
FT                   /db_xref="InterPro:IPR036775"
FT                   /db_xref="UniProtKB/TrEMBL:B5EWJ6"
FT                   /protein_id="ACH51453.1"
FT                   /translation="MRKIIHVDMDCFFAAVEMRDNPALRDIPIAIGGSRERRGVISTAN
FT                   YPARQFGVRSAMPTAMALKLCPHLTLLPGRFDAYKEASRHVRDIFSRYTSLIEPLSLDE
FT                   AWLDVTDSPHCYGSATLIAREIRQTIFNELQLTASAGVAPVKFLAKIASDLNKPNGQYV
FT                   ITPADVPDFLKTLPLAKIPGVGKVSAAKLENMGLRTCGDIQQCDLAMLLKRFGKFGRVL
FT                   WERSQGIDERDVNSERLRKSVGVERTLAEDIHEWSDCEAIIEHLYPELERRLAIVKPDL
FT                   LIARQGVKLKFNDFQQTTQEHVWPQLNKEDLITTARKTWNERRGERGVRLVGLHVTLLD
FT                   PQLERQLVLGL"
FT   gene            341670..342809
FT                   /locus_tag="SeAg_B0348"
FT   CDS_pept        341670..342809
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0348"
FT                   /product="release factor H-coupled RctB family protein"
FT                   /note="identified by match to protein family HMM PF01139;
FT                   match to protein family HMM TIGR03073"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0348"
FT                   /db_xref="EnsemblGenomes-Tr:ACH51784"
FT                   /db_xref="GOA:B5EWJ7"
FT                   /db_xref="InterPro:IPR001233"
FT                   /db_xref="InterPro:IPR017510"
FT                   /db_xref="InterPro:IPR036025"
FT                   /db_xref="UniProtKB/TrEMBL:B5EWJ7"
FT                   /protein_id="ACH51784.1"
FT                   /translation="MGNYIRPLSDVVFSIASDNLWIEDSAIQQLYTTAKLTGMKRVIGM
FT                   PDLHPGRGYPIGAAFFSRGRFYPALVGNDIGCGMALWQTDILGRKYNADKLEKRLASLP
FT                   DVADAQWLEENVPAAMQHHSWRSALGSIGGGNHFAELQQVDRIVDADSFALSGLQKTQL
FT                   LLLVHSGSRGLGQAILRRHVEAFSHNGLPEDSDDARRYLAEHDDALAFARSNRALIACR
FT                   ILQQLRAEGEPRLDVAHNFVEPCTVAGEAGWLHRKGATPDGQGLVIIPGSRGDYSWLVK
FT                   PVVSEESLFSLAHGAGRKWMRTECKDRLSAKFTPRQLCRTGMGSRVICRDRQLIYEEAP
FT                   QAYKSIDSVVDCLADAGLITPVACLRPVLTLKTSGEKSA"
FT   gene            342806..343420
FT                   /locus_tag="SeAg_B0349"
FT   CDS_pept        342806..343420
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0349"
FT                   /product="putative peptide chain release factor H"
FT                   /note="identified by match to protein family HMM PF00472;
FT                   match to protein family HMM TIGR03072"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0349"
FT                   /db_xref="EnsemblGenomes-Tr:ACH49667"
FT                   /db_xref="GOA:B5EWJ8"
FT                   /db_xref="InterPro:IPR000352"
FT                   /db_xref="InterPro:IPR017509"
FT                   /db_xref="UniProtKB/TrEMBL:B5EWJ8"
FT                   /protein_id="ACH49667.1"
FT                   /translation="MILLQLSSAQGPDECCLAVKKALDCLTKEAAREKVSLTRLETEPG
FT                   RLPDTLRSALVSLDGEKAMAFSERWCGTLLWICTSPYRPHHGRKNWYVGIGRFSADEQM
FT                   QSDEIRFETLRSSGPGGQHVNKTDSAVRATHLASGISVKVQSERSQHANKRLARLLIAW
FT                   RLEQQRQNECAALKSERRLFHHQIERGNPLRIFKGMAFTPQ"
FT   gene            complement(343575..345032)
FT                   /gene="pepD"
FT                   /locus_tag="SeAg_B0350"
FT   CDS_pept        complement(343575..345032)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pepD"
FT                   /locus_tag="SeAg_B0350"
FT                   /product="aminoacyl-histidine dipeptidase"
FT                   /note="identified by match to protein family HMM PF01546;
FT                   match to protein family HMM PF07687; match to protein
FT                   family HMM TIGR01893"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0350"
FT                   /db_xref="EnsemblGenomes-Tr:ACH51198"
FT                   /db_xref="GOA:B5EWJ9"
FT                   /db_xref="InterPro:IPR001160"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="UniProtKB/TrEMBL:B5EWJ9"
FT                   /protein_id="ACH51198.1"
FT                   /translation="MSELSQLSPQPLWDIFAKICSIPHPSYHEEQLAEHIVSWAKEKGL
FT                   YVDRDQVGNILIRKPATAGMENRKPVVLQAHLDMVPQKNSDTVHDFTTDPIQPYIDGEW
FT                   VKARGTTLGADNGIGMASALAVLADDNVVHGPLEVLLTMTEEAGMDGAFGLQSGWLQAD
FT                   ILINTDSEEEGEIYMGCAGGIDFTSNLPLTREAVPAGFACFKLTLKGLKGGHSGGEIHL
FT                   GLGNANKLLARFLAGHAEELDLRLIDFNGGTLRNAIPREAFATLAVAADNVGALKTLVN
FT                   AYQDILKNELAEKEKNLTLQLNEVASDKAALTAPSRDTFVRLLNATPNGVIRNSDVAKG
FT                   VVETSLNVGVVTMSDANVEIHCLIRSLIDSGKDYVVSMLDSLGKLAGAKTEAKGSYPGW
FT                   QPDANSPVMHLVRETYQRLFNKTPNIQIIHAGLECGLFKKPYPDMDMVSIGPTITGPHS
FT                   PDEQVHIESVGHYWTLLTELLKAIPAK"
FT   gene            345281..345739
FT                   /gene="gpt"
FT                   /locus_tag="SeAg_B0351"
FT   CDS_pept        345281..345739
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gpt"
FT                   /locus_tag="SeAg_B0351"
FT                   /product="xanthine phosphoribosyltransferase"
FT                   /EC_number="2.4.2.22"
FT                   /note="identified by match to protein family HMM PF00156"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0351"
FT                   /db_xref="EnsemblGenomes-Tr:ACH50107"
FT                   /db_xref="GOA:B5EWK0"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR023747"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5EWK0"
FT                   /protein_id="ACH50107.1"
FT                   /translation="MSEKYVVTWDMLQIHARKLASRLMPSEQWKGIIAVSRGGLVPGAL
FT                   LARELGIRHVDTVCISSYDHDNQRELKVLKRAEGDGEGFIVIDDLVDTGGTAVAIREMY
FT                   PKAHFVTIFAKPAGRPLVDDYVIDIPQNTWIEQPWDMGVVFVPPISGR"
FT   gene            345828..347072
FT                   /locus_tag="SeAg_B0352"
FT   CDS_pept        345828..347072
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0352"
FT                   /product="esterase FrsA"
FT                   /EC_number="3.1.-.-"
FT                   /note="identified by match to protein family HMM PF06500"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0352"
FT                   /db_xref="EnsemblGenomes-Tr:ACH50525"
FT                   /db_xref="GOA:B5EWK1"
FT                   /db_xref="InterPro:IPR010520"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5EWK1"
FT                   /protein_id="ACH50525.1"
FT                   /translation="MTQANLSETLFKPRFKHTETSTLVRRFNRGSQPPMQSALDGKNVP
FT                   HWYRMINRLMWIWRGVDPREILDVQARIVMSDAERTDDDLYDTVIGYRGGNWIYEWAKQ
FT                   AMDWQQKACQEQDAMRSGRYWLHASTLYNIAAYPHLKGDELAEQAQALANRAYEEAAQR
FT                   LPGSLREMEFAVPGGSPVTAFLHMPKGDGPFPTVLMCGGLDAMQTDYYTLYERYFAPRG
FT                   IAMLTLDMPSVGFSSKWKLTQDSSLLHQHVLKALPNVPWVDHTRVAAFGFRFGANVAVR
FT                   LAYLEAPRLKAVACLGPVVHALLSDPQRQSTVPEMYLDVLASRLGMHDASDEALRVELN
FT                   RYSLKVQGLLGRRCPTPMLSGFWKNDPFSPEEESRLITTSSSDGKLIEIPFNPVYRNFD
FT                   HALQEITDWINHRLC"
FT   gene            347130..347531
FT                   /locus_tag="SeAg_B0353"
FT   CDS_pept        347130..347531
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0353"
FT                   /product="sigma factor-binding protein crl"
FT                   /note="identified by match to protein family HMM PF07417"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0353"
FT                   /db_xref="EnsemblGenomes-Tr:ACH48809"
FT                   /db_xref="GOA:B5EWK2"
FT                   /db_xref="InterPro:IPR009986"
FT                   /db_xref="InterPro:IPR038208"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5EWK2"
FT                   /protein_id="ACH48809.1"
FT                   /translation="MTLPSGHPKSRLIKKFTALGPYIREGQCEDNRFFFDCLAVCVNVK
FT                   PAPEKREFWGWWMELEAQEKRFTYRYQFGLFDKEGNWTAVPINETEVVERLEYTLREFH
FT                   EKLRDLLISMELALEPSDDFNDEPVKLSA"
FT   gene            complement(347582..348634)
FT                   /locus_tag="SeAg_B0354"
FT   CDS_pept        complement(347582..348634)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0354"
FT                   /product="outer membrane pore protein E"
FT                   /note="identified by match to protein family HMM PF00267"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0354"
FT                   /db_xref="EnsemblGenomes-Tr:ACH48605"
FT                   /db_xref="GOA:B5EWK3"
FT                   /db_xref="InterPro:IPR001702"
FT                   /db_xref="InterPro:IPR001897"
FT                   /db_xref="InterPro:IPR013793"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="InterPro:IPR033900"
FT                   /db_xref="UniProtKB/TrEMBL:B5EWK3"
FT                   /protein_id="ACH48605.1"
FT                   /translation="MNKSTLAIVVSIIASASVHAAEVYNKNGNKLDVYGKVKAMHYMSD
FT                   YDSKDGDQSYVRFGFKGETQINDQLTGYGRWEAEFAGNKAESDSSQQKTRLAFAGLKLK
FT                   DIGSFDYGRNLGALYDVEAWTDMFPEFGGDSSAQTDNFMTKRASGLATYRNTDFFGIVD
FT                   GLDLTLQYQGKNEDRDVKKQNGDGFGTSVSYDFGGSDFAVSGAYTLSDRTREQNLQRRG
FT                   TGDKAEAWATGVKYDANDIYIATFYSETRNMTPVSGGFANKTQNFEAVIQYQFDFGLRP
FT                   SLGYVLSKGKDIEGVGSEDLVNYIDVGATYYFNKNMSAFVDYKINQLDSDNTLGINDDD
FT                   IVAIGLTYQF"
FT   gene            complement(348700..348852)
FT                   /locus_tag="SeAg_B0355"
FT   CDS_pept        complement(348700..348852)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0355"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0355"
FT                   /db_xref="EnsemblGenomes-Tr:ACH50952"
FT                   /db_xref="UniProtKB/TrEMBL:B5EWK4"
FT                   /protein_id="ACH50952.1"
FT                   /translation="MPTTCTRSVKFCCAGSASVAAEFDHFITATIKHIFLKKFSLCHKS
FT                   FITER"
FT   gene            348917..350020
FT                   /gene="proB"
FT                   /locus_tag="SeAg_B0356"
FT   CDS_pept        348917..350020
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="proB"
FT                   /locus_tag="SeAg_B0356"
FT                   /product="glutamate 5-kinase"
FT                   /EC_number="2.7.2.11"
FT                   /note="identified by match to protein family HMM PF00696;
FT                   match to protein family HMM PF01472; match to protein
FT                   family HMM TIGR01027"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0356"
FT                   /db_xref="EnsemblGenomes-Tr:ACH52288"
FT                   /db_xref="GOA:B5EWK5"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001057"
FT                   /db_xref="InterPro:IPR002478"
FT                   /db_xref="InterPro:IPR005715"
FT                   /db_xref="InterPro:IPR011529"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR019797"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR036974"
FT                   /db_xref="InterPro:IPR041739"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5EWK5"
FT                   /protein_id="ACH52288.1"
FT                   /translation="MSDSQTLVVKLGTSVLTGGSRRLNRAHIVELVRQCAQLHAAGHRI
FT                   VIVTSGAIAAGREHLGYPELPATIASKQLLAAVGQSRLIQLWEQLFSIYGIHIGQMLLT
FT                   RADMEDRERFLNARDTLRALLDNHIVPVINENDAVATAEIKVGDNDNLSALAAILAGAD
FT                   KLLLLTDQQGLFTADPRSNPQAELIKDVYGVDDALRSIAGDSVSGLGTGGMSTKLQAAD
FT                   VACRAGIDTIIASGSKPGVIGDVMEGISVGTRFHAQASPLENRKRWIFGAPPAGEITVD
FT                   EGATAAMLERGSSLLPKGIKSVTGNFSRGEVIRICNLQGRDIAHGVSRYNSDALRRIAG
FT                   HHSQQIDAILGYEYGPVAVHRDDMITR"
FT   gene            350032..351282
FT                   /gene="proA"
FT                   /locus_tag="SeAg_B0357"
FT   CDS_pept        350032..351282
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="proA"
FT                   /locus_tag="SeAg_B0357"
FT                   /product="glutamate-5-semialdehyde dehydrogenase"
FT                   /EC_number="1.2.1.41"
FT                   /note="identified by match to protein family HMM TIGR00407"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0357"
FT                   /db_xref="EnsemblGenomes-Tr:ACH50539"
FT                   /db_xref="GOA:B5EWK6"
FT                   /db_xref="InterPro:IPR000965"
FT                   /db_xref="InterPro:IPR012134"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR020593"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5EWK6"
FT                   /protein_id="ACH50539.1"
FT                   /translation="MLEQMGIAAKAASYKLALLSSGEKNRVLEKIADELEAQMESILSA
FT                   NVQDVEQARDNGLSEAMLDRLTLTPARLKAIADDVRQVCNLADPVGQVIDGGLLDSGLR
FT                   LERRRVPLGVVGVIYEARPNVTVDVASLCLKTGNAVILRGGKETHRTNAATVRVIQKAL
FT                   KACGLPEAAVQAIDNPDRSLVNEMLRMDKYIDMLIPRGGAGLHKLCREQSTIPVITGGI
FT                   GVCHIFVDSSADIAPALKIIVNAKTQRPSTCNTVETLLVHQDIAERFLPALSKQMAESG
FT                   VTLHGDETVMQVLHGPAKLVPLKPEELDNEFLSLDLNVVVVENMDGAIGHIREHGTQHS
FT                   DAILTCDMHNAARFVNEVDSAAVYVNASTRFTDGGQFGLGAEVAVSTQKLHARGPMGLE
FT                   ALTTYKWIGFGDGTIRA"
FT   gene            351398..351473
FT                   /locus_tag="SeAg_B0358"
FT   tRNA            351398..351473
FT                   /locus_tag="SeAg_B0358"
FT                   /product="tRNA-Thr"
FT   gene            complement(351909..352532)
FT                   /locus_tag="SeAg_B0359"
FT   CDS_pept        complement(351909..352532)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0359"
FT                   /product="ISEc16, orfB"
FT                   /note="identified by match to protein family HMM PF00665"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0359"
FT                   /db_xref="EnsemblGenomes-Tr:ACH51293"
FT                   /db_xref="GOA:B5EWK7"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:B5EWK7"
FT                   /protein_id="ACH51293.1"
FT                   /translation="MKTVAASLRRQGLRAKASRRFRPVSYRKHGLPVSENLLKQDFYAS
FT                   GPNQKWVDDITYLRTGEGWLYLAVVIDLWSRSVIGWSMSSRMTAQLACDALQMALWRRK
FT                   CPENVIVHTDRGGQYCSTDYQSLLKRHNLRGSMSARGCCYDNACAESFFHTLKVECIHG
FT                   EDFVSREIMRTAVFNYIECDYNRWRRHSACGGLSPEQFENQNLA"
FT   gene            352699..353412
FT                   /locus_tag="SeAg_B0360"
FT   CDS_pept        352699..353412
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0360"
FT                   /product="glycerol dehydratase reactivation factor large
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0360"
FT                   /db_xref="EnsemblGenomes-Tr:ACH48987"
FT                   /db_xref="InterPro:IPR009191"
FT                   /db_xref="InterPro:IPR030994"
FT                   /db_xref="UniProtKB/TrEMBL:B5EWK8"
FT                   /protein_id="ACH48987.1"
FT                   /translation="MQAIASELSARLNTPVEVGGVEANMAVAGALTTPGCDAPLAILDL
FT                   GAGSTDAAIINSDGVVKAVHLAGAGNIVSLLIQTELGLSDPFLAEEIKKYPLAKVESLF
FT                   SIRHENGAVEFFREPLSPSVFAKVVYLKEGELIPVDNQTSLEKIRLVRRQAKEKVFVTN
FT                   CLRALRQVSPGGSIRDITFVVLVGGSSLDFEIPQMITDALAHYGVVAGQGNIRGTEGPR
FT                   NAVATGLVLAGEAKK"
FT   gene            353693..353845
FT                   /locus_tag="SeAg_B0361"
FT   CDS_pept        353693..353845
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0361"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0361"
FT                   /db_xref="EnsemblGenomes-Tr:ACH50135"
FT                   /db_xref="InterPro:IPR015079"
FT                   /db_xref="InterPro:IPR037210"
FT                   /db_xref="UniProtKB/TrEMBL:B5EWK9"
FT                   /protein_id="ACH50135.1"
FT                   /translation="MARGEQEGWNPEFTKKVAGWAEKVASGNRILIKNPEYFSTYMQEQ
FT                   LKELV"
FT   gene            354087..355424
FT                   /locus_tag="SeAg_B0362"
FT   CDS_pept        354087..355424
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0362"
FT                   /product="putative permease"
FT                   /note="identified by match to protein family HMM PF07690"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0362"
FT                   /db_xref="EnsemblGenomes-Tr:ACH50945"
FT                   /db_xref="GOA:B5EWL0"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B5EWL0"
FT                   /protein_id="ACH50945.1"
FT                   /translation="MNAVNSANVKDKYCIHGCLLANRQMAIRIFYGTLCMKNNIEETIG
FT                   KYLPILMILPLAGLAELASLYSIQALLPKLSEVYNIPLNQVGMILSAEVGFLALAMLFS
FT                   GTLSDRFGRKPIIFYSLLAGGILTLLCATASSWPMLVVYRALLGIAVSGITAAVTVYIS
FT                   EEVSPALAGIVTGYFIFGNSLGSMSGRVFATLMMEHVSIDTIFFIFGGVLIAMALAVKL
FT                   FLPTSRQFVPTPSLQLGAVLKGGLEHFKNIRVSLCFVIGFILFGSFTSIFNFLAFYLHR
FT                   PPYELSYTWIGLIPVSFSLTFFLAPYAARVALNIGSMNALSMLIICMMVGAFLTLIAPS
FT                   LWVFISGIVLLSVAFFSAHSTVLAWVSSRSPNAKGQATSFYLLCYYSGGAVMGYLNGYL
FT                   FSWQGWNAIAASCLMMLGIGLFICRFIFAKYEKQPQIKKQSVQESF"
FT   gene            355556..356977
FT                   /pseudo
FT                   /gene="leuC"
FT                   /locus_tag="SeAg_B0363"
FT                   /note="3-isopropylmalate dehydratase, large subunit; this
FT                   gene contains a frame shift which may be the result of
FT                   sequencing error; identified by match to protein family HMM
FT                   PF00330; match to protein family HMM TIGR00170"
FT   gene            356979..357605
FT                   /gene="leuD"
FT                   /locus_tag="SeAg_B0364"
FT   CDS_pept        356979..357605
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="leuD"
FT                   /locus_tag="SeAg_B0364"
FT                   /product="3-isopropylmalate dehydratase, small subunit"
FT                   /EC_number="4.2.1.33"
FT                   /note="identified by match to protein family HMM PF00694;
FT                   match to protein family HMM TIGR00171"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0364"
FT                   /db_xref="EnsemblGenomes-Tr:ACH52216"
FT                   /db_xref="GOA:B5EWL1"
FT                   /db_xref="InterPro:IPR000573"
FT                   /db_xref="InterPro:IPR004431"
FT                   /db_xref="InterPro:IPR015928"
FT                   /db_xref="InterPro:IPR033940"
FT                   /db_xref="UniProtKB/TrEMBL:B5EWL1"
FT                   /protein_id="ACH52216.1"
FT                   /translation="MDTFKQISGRIAPMLEPNIDTDVIMPKQFLKGIDRQGLDKGVFFD
FT                   RRFMAGGQPNPDFILNMPGWQSATFLLVGPNFGCGSSREHAVWGLKQLGIRGLIGSTFA
FT                   GIFDDNCQRNGILTVSLDEPALARLAQLAASADTNSITVSLDRCEITTAEETISFVISE
FT                   LKRAMLAAGEDAIAWTLQYLPEIENFEVAHYSRRPWLKRPASPRG"
FT   gene            357620..358498
FT                   /locus_tag="SeAg_B0365"
FT   CDS_pept        357620..358498
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0365"
FT                   /product="5-oxopent-3-ene-1,2,5-tricarboxylate
FT                   decarboxylase"
FT                   /note="identified by match to protein family HMM PF01557"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0365"
FT                   /db_xref="EnsemblGenomes-Tr:ACH52852"
FT                   /db_xref="GOA:B5EWL2"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="UniProtKB/TrEMBL:B5EWL2"
FT                   /protein_id="ACH52852.1"
FT                   /translation="MKLVQYLVNGGKRYGIMQETGIIDLSQRLGDKYPTLKSLLCANAL
FT                   TDAALWCDEPADYYYQEVTFLPVIDDPQKIICVGMNYADKRIEFNETNPAPTLFVRFAD
FT                   SQTGHNGLLLKPENTNEFDYEGELAVVIGRRCSRVSAEDALDYVAGYSCYMDGSVRDWQ
FT                   HSWFTAGKNWPSTGSFGPCLVTTDDIPDPQMLRLLTRLNGREVQNESTANMIHPIASLI
FT                   AYISTFTLLSPGDTILTGSPGGVGKKRVPPLFLHDGDVIEVEIEHIGTLRNVVRDSRYL
FT                   TSSVSWHDGRK"
FT   gene            358498..359412
FT                   /locus_tag="SeAg_B0366"
FT   CDS_pept        358498..359412
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0366"
FT                   /product="haloacetate dehalogenase H-1"
FT                   /EC_number="3.8.1.3"
FT                   /note="identified by match to protein family HMM PF00561"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0366"
FT                   /db_xref="EnsemblGenomes-Tr:ACH48620"
FT                   /db_xref="GOA:B5EWL3"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B5EWL3"
FT                   /protein_id="ACH48620.1"
FT                   /translation="MSTLIECGASPFIPGFALKDVRLENGLTVRVAIGGSGSPLVLLHG
FT                   HPQNHTTWRKVAPTLAQNHTVILPDLRGYGDSDKPTSDPAHRTYSKRTMAQDIVMLMDA
FT                   LGFSRFAFVGHDRGGRVGHRLALDYPDRVTCCTFIDIAPTATMYALTDKSFATRYFWWF
FT                   FLIQPFPLPETMIAHDPAFFLRKHISGQLKIEGATSQEAFNEYLRCYQNPEMIHAICED
FT                   YRAAATIDLDDDAADTSARIRCPLQLLWGGLGTVGQLYDVVGTWKEKALNVQGEALPCG
FT                   HSPQEECPEYFIQKLQSFLHSVL"
FT   gene            359446..360411
FT                   /locus_tag="SeAg_B0367"
FT   CDS_pept        359446..360411
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0367"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="identified by match to protein family HMM PF00126;
FT                   match to protein family HMM PF03466"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0367"
FT                   /db_xref="EnsemblGenomes-Tr:ACH48763"
FT                   /db_xref="GOA:B5EWL4"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B5EWL4"
FT                   /protein_id="ACH48763.1"
FT                   /translation="MKTTPVGKKHRQPLEGWPSVEDLFVFVTVARNGGFARAALELGLS
FT                   PSYISKRIAILEKCLNARLFFRNNRVMRLTPEGENALGGAMQVVSEMDGFVSRLDNQRG
FT                   VLAGNITINCSFGFGHKYVAEALSSFMIAYPDITVKLTLTDREVDLVEEGIDIEIRVGD
FT                   DINELYIARQLATNRRILCASPEYLERHGKPESVSALVQHDCLMIQEKNSAFGNWILTD
FT                   GKQQTHCRLNGFHSSNSGSVVLIWALKGHGITLRSEWDVAQYIERGELVRVLPQWYQEA
FT                   NIWAVYTRRSSSSDRIKICIDFLTEHLAQCLPGGKAPGVL"
FT   gene            361524..361718
FT                   /locus_tag="SeAg_B0368"
FT   CDS_pept        361524..361718
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0368"
FT                   /product="putative outer membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0368"
FT                   /db_xref="EnsemblGenomes-Tr:ACH48906"
FT                   /db_xref="UniProtKB/TrEMBL:B5EWL5"
FT                   /protein_id="ACH48906.1"
FT                   /translation="MTTGIENNFRGYMMRNNNTFYTLIESDNENVWDMSVEEKGTQQNK
FT                   DAVQKVKYQLNTIFDNGTC"
FT   gene            complement(361765..362523)
FT                   /locus_tag="SeAg_B0369"
FT   CDS_pept        complement(361765..362523)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0369"
FT                   /product="fimbrial chaperone protein"
FT                   /note="identified by match to protein family HMM PF00345;
FT                   match to protein family HMM PF02753"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0369"
FT                   /db_xref="EnsemblGenomes-Tr:ACH50632"
FT                   /db_xref="GOA:B5EWL6"
FT                   /db_xref="InterPro:IPR001829"
FT                   /db_xref="InterPro:IPR008962"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR016147"
FT                   /db_xref="InterPro:IPR016148"
FT                   /db_xref="InterPro:IPR018046"
FT                   /db_xref="InterPro:IPR036316"
FT                   /db_xref="UniProtKB/TrEMBL:B5EWL6"
FT                   /protein_id="ACH50632.1"
FT                   /translation="MRNYRQWLVFSKVILTLLGLTGWYGPAQAAVNIDRTRIIFASDDV
FT                   AQSLTLSNDNTTPMLLQVWTDAGNIDASPDNSKTPLVALPPVFKMQPGELRTLRLLLSS
FT                   RQQLATDRESLFWLNIYQIPPVTQDIKNHPRKLVLPLRLRLKILIRPTGLKAPTEAEEK
FT                   KLRFIAKENTIRIVNPTSWYMSLTLTMDNKKSIGDIMVAPKTARDVPLTRSPTPGASIN
FT                   YAVINDSGNWRQYTAILEKYISESDFTPEF"
FT   gene            complement(362489..363814)
FT                   /locus_tag="SeAg_B0370"
FT   CDS_pept        complement(362489..363814)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0370"
FT                   /product="putative fimbrial usher"
FT                   /note="identified by match to protein family HMM PF00419"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0370"
FT                   /db_xref="EnsemblGenomes-Tr:ACH51366"
FT                   /db_xref="GOA:B5EWL7"
FT                   /db_xref="InterPro:IPR000259"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="InterPro:IPR011228"
FT                   /db_xref="InterPro:IPR036937"
FT                   /db_xref="UniProtKB/TrEMBL:B5EWL7"
FT                   /protein_id="ACH51366.1"
FT                   /translation="MLFSFRTLLFITSLFVSAGTWSSCIKVTDKSALSDAAIKAGYTAQ
FT                   NWIGATDTNTGNIGLPTVISVSNSETFQPSGTLLASGIGNFLTAATGTPYSSKQVLYRC
FT                   DTADAGKLYEMYSTNGDSAFAGAFFTPEVEGAYYDVERNVAVRMTNLSTGEYYSRFWKE
FT                   RQLTADSWFQDDKYIYIPASAFSNVLYEMFKIDSRKYFAYQNPMDRDTWTQPRGYIAFK
FT                   GPGLITERIKAGLDHASDYYGWPSYWPGAWSTYNSVTYVRGALCKITDYPAIVKIPPVA
FT                   VGILASGGNSQAPFHVSLECESGAVSSALPSTSAANVAMGFVVNQPTAVAAARRLGLTT
FT                   SAGGLSWLLDTHYGEPGVASGVGIRIYNDAGTPINLLPDRIKTGTGNARGWYGYKDLTT
FT                   RVSSGSVETYSGDFTASLEAIGGQTVTAGSVNAQLQAVVSFQ"
FT   gene            complement(363819..366380)
FT                   /locus_tag="SeAg_B0371"
FT   CDS_pept        complement(363819..366380)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0371"
FT                   /product="outer membrane fimbrial usher protein"
FT                   /note="identified by match to protein family HMM PF00577"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0371"
FT                   /db_xref="EnsemblGenomes-Tr:ACH49825"
FT                   /db_xref="GOA:B5EWL8"
FT                   /db_xref="InterPro:IPR000015"
FT                   /db_xref="InterPro:IPR018030"
FT                   /db_xref="InterPro:IPR025885"
FT                   /db_xref="InterPro:IPR025949"
FT                   /db_xref="InterPro:IPR037224"
FT                   /db_xref="InterPro:IPR042186"
FT                   /db_xref="UniProtKB/TrEMBL:B5EWL8"
FT                   /protein_id="ACH49825.1"
FT                   /translation="MSPTINLNRKSLALLIAIVCSGSAQGEEYYFDPALLQGATYGQNI
FT                   ARFNEQQTPSGDYLADVYVNGTLVTSSTNIRFNAVKEGQQTEPCLPLSVMKAAQIKSLP
FT                   ATDAATECRPLREWVPHAGWQFDSATLRLLLTIPMTELTHKPRGYISPSEWDSGALALF
FT                   LRHNTNWTHTENTDSHYRYQYLWSGLNMGVNLGLWQVRHQSNLRYANSNQSGSAWRYNS
FT                   VRTWVQRPVASINSILSLGDSYTDSSLFGSLSFNGAKLVTDERMRPQGKRGYAPEVRGV
FT                   AASSAHVVVKQLGKVIYETNVPPGPFYIDDLYNTRYQGDLEVEVIEASGKTSRFTVPYS
FT                   SVPDSVRPGNWHYSLAFGRVRQYYDIENRFFEGTFQHGVNNTITLNLGSRIAQRYQAWL
FT                   AGGVWATGMGAFGLNATWSNARAEHNDRQQGWRAELSYSKTFTTGTNLVLAAYRYSTNG
FT                   FRDLQDVLGVRREAKTGIDYYSDTLHQRNRLSATVSQPLGRLGTLNLSASTADYYNNQS
FT                   RITQLQMGYSNQWRNISYGVNIARQRTTWDYDRFYHGVNEPLDVSSRQKYTETTMSFNV
FT                   SIPLDWGENRTSVAMNYNQSSQSRSSTVSMTGSNGENSDLSWSVYGGYERYRNSNSDSS
FT                   APTTFGGNLQQNTRFGALRANYDQGDNYRQEGLGASGTLVLHPGGLTAGPYTSDTFALI
FT                   HADGAQGAIVQNGQGAVVDRFGYAILPSLSPYRVNNVTLDTRKMRSDAELTGGSQQIVP
FT                   YAGAIARVNFATISGKAVLISVKMPDGGIPPMGADVFNGEGTNIGMVGQSGQIYARIAH
FT                   PSGSLLVRWGTGANQRCRVAYQLDLHTKEPFLYLNKICEKE"
FT   gene            complement(366364..367167)
FT                   /locus_tag="SeAg_B0372"
FT   CDS_pept        complement(366364..367167)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0372"
FT                   /product="fimbrial chaperone protein"
FT                   /note="identified by match to protein family HMM PF00345"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0372"
FT                   /db_xref="EnsemblGenomes-Tr:ACH50720"
FT                   /db_xref="GOA:B5EWL9"
FT                   /db_xref="InterPro:IPR001829"
FT                   /db_xref="InterPro:IPR008962"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR016147"
FT                   /db_xref="InterPro:IPR016148"
FT                   /db_xref="InterPro:IPR018046"
FT                   /db_xref="InterPro:IPR036316"
FT                   /db_xref="UniProtKB/TrEMBL:B5EWL9"
FT                   /protein_id="ACH50720.1"
FT                   /translation="MKRQTIFNRQGVVEMKVDTRHSALYYLIVFLLLALPATASWASVT
FT                   ILGSRIIYPSTASSVDVQLKNNDAIPYIVQTWFDDGDMNTSPENSSAMPFIATPPVFRI
FT                   QPKAGQVVRVIYNNTKKLPQDRESVFWFNVLQVPPTNIGSDSGQNKMLVMLRSRIKLFY
FT                   RPDGLGKPDNLAKKLQIKTVNKGSGKSGIVIVNPQPWFASLSNLNVKVNGASYNLDADM
FT                   IAPFSSQTWWLPGKRSLKSFSGTVTVTLVNDLGARISESYDVPHH"
FT   gene            complement(367187..367723)
FT                   /locus_tag="SeAg_B0373"
FT   CDS_pept        complement(367187..367723)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0373"
FT                   /product="fimbrial protein"
FT                   /note="identified by match to protein family HMM PF00419"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0373"
FT                   /db_xref="EnsemblGenomes-Tr:ACH51063"
FT                   /db_xref="GOA:B5EWM0"
FT                   /db_xref="InterPro:IPR000259"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="InterPro:IPR036937"
FT                   /db_xref="UniProtKB/TrEMBL:B5EWM0"
FT                   /protein_id="ACH51063.1"
FT                   /translation="MSMKKYLAMITGSLLVSSSAMAVSDNTITFQGEVSDETCSVVING
FT                   NQAKPVVLLPTVSTKELSEQGKTAGPITFDIGLSGCTGSQDKTTKISTVFVGNQVTSNG
FT                   NLGNTGSAKNVEVQLLDTSGEPINLTGGFTGDGDLQLEPNASEASATYTARYYSTGKAE
FT                   AGTVAATLQYAVSYK"
FT   gene            368387..369121
FT                   /locus_tag="SeAg_B0374"
FT   CDS_pept        368387..369121
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0374"
FT                   /product="putative transmembrane regulator"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0374"
FT                   /db_xref="EnsemblGenomes-Tr:ACH50826"
FT                   /db_xref="GOA:B5EWM1"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:B5EWM1"
FT                   /protein_id="ACH50826.1"
FT                   /translation="MNESIFLLDKRVVFDSTKMTLSHGNEIIRISEAETHLLLAFWHGL
FT                   YKKEDIIHFVWENRGGCVSESSYYKLINQMRNDFSSIGLQPSDIVTRPRVGVSLSVAIE
FT                   PIKKITSLKVSDENVKGTPTRENVFYKIKRHSVFVVLTGAILLALLYGVFTIYKAPVRN
FT                   SPDSFFTYLGEYNDYAIYKTKEDKVTLSEVVFAFNSLKIKIYRQNGRHLYYIREPNMNI
FT                   FLQCLNPVEMAVPKCITVKERY"
FT   gene            369094..369594
FT                   /pseudo
FT                   /locus_tag="SeAg_B0375"
FT                   /note="conserved hypothetical protein; this gene contains a
FT                   frame shift which may be the result of sequencing error"
FT   gene            369929..371479
FT                   /locus_tag="SeAg_B0376"
FT   CDS_pept        369929..371479
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0376"
FT                   /product="cyclic diguanylate phosphodiesterase (EAL) domain
FT                   protein"
FT                   /note="identified by match to protein family HMM PF00563"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0376"
FT                   /db_xref="EnsemblGenomes-Tr:ACH52080"
FT                   /db_xref="GOA:B5EWM2"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR024744"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:B5EWM2"
FT                   /protein_id="ACH52080.1"
FT                   /translation="MLFIAVPLIVMILVGLLAGIFQLKRDIAVSANTLLRFSADISAAS
FT                   WQVAGKAARLAESSCTDTLKELSRTRAFTPYVRDIGFLENGDITCSFVTGTERYHFSRL
FT                   AGLSLPASYPERWLRSIGSMAEGPDRLVVVYVKKVAANKAAFVIVDSQYVQELMEILAA
FT                   ERASAFSLTFGAGEAITSAATLRGKAFLTQRFTSTDHTIQLMVRTPFSTLSAYWLQNLF
FT                   IFVPLSLCLSVGMILFYRRWYLKRLSLAREIARGITHNEFTVHYQPVFNVKHGSCGGVE
FT                   ALMRWPQPDGRFITPDIFITAAENEGMIIPLSRHLFELIAHDVINWTVPDDFYISVNIS
FT                   PAHLMDDGFIQDIEALRTRLGTITLMLELTERSLIVEPSQVAEKLSTLREKGVLIAIDD
FT                   FGTGYCSLSYLQQLPVDSLKIDRTFIDTIDTSSNDVPVLDTIITLSQRLGLNVVAEGVS
FT                   TQHQLRYILSHGVGFVQGFLYARPMGANDFMSWLGKSAQRQNGLLKGENESASGLVAE"
FT   gene            371579..372322
FT                   /locus_tag="SeAg_B0377"
FT   CDS_pept        371579..372322
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0377"
FT                   /product="putative response regulator"
FT                   /note="identified by match to protein family HMM PF00486"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0377"
FT                   /db_xref="EnsemblGenomes-Tr:ACH52688"
FT                   /db_xref="GOA:B5EWM3"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:B5EWM3"
FT                   /protein_id="ACH52688.1"
FT                   /translation="MSQNNYLIDKRVILDCERMTLSCAGESITISESERSLLIAFHEGL
FT                   FKKDDLINYVWGRKGVVVSDASYYKLINQLRGSFDKIGLKGASVVTRPRVGVLLSVSIE
FT                   PLSDEAQNTPLPAVAETELSTVEVRRDDTIIPPIPGAVNKKDWLYFCLAALLMFFMMYK
FT                   VKGENIDYFTLQGSYDGYTFYSVGHDKTHLTDIVEAYSEMSNEIHKQNGKIIYYIRVPN
FT                   TNIFVQCLNQLDIAEPKCISIKERY"
FT   gene            372295..372783
FT                   /locus_tag="SeAg_B0378"
FT   CDS_pept        372295..372783
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0378"
FT                   /product="putative inner membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0378"
FT                   /db_xref="EnsemblGenomes-Tr:ACH48972"
FT                   /db_xref="GOA:B5EWM4"
FT                   /db_xref="UniProtKB/TrEMBL:B5EWM4"
FT                   /protein_id="ACH48972.1"
FT                   /translation="MHFYKRTLLSVATLGMLAVSVVLMVVWVRNSSHSSINTNEFLCTT
FT                   RTVTTIQPKDIHADGSLVLDFKMKRITLQYEIKTKDNGVKILYRDVYMKNLHRTAPGVY
FT                   TFEVSQVKVFATDTAGDLLSYLRVLHPEAANEIRISKVGEKTFFYSLNRQLYNVCTAQ"
FT   gene            373185..373709
FT                   /locus_tag="SeAg_B0379"
FT   CDS_pept        373185..373709
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0379"
FT                   /product="attachment invasion locus protein"
FT                   /note="identified by match to protein family HMM PF06316;
FT                   match to protein family HMM TIGR03304"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0379"
FT                   /db_xref="EnsemblGenomes-Tr:ACH49493"
FT                   /db_xref="GOA:B5EWM5"
FT                   /db_xref="InterPro:IPR000758"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="InterPro:IPR027385"
FT                   /db_xref="UniProtKB/TrEMBL:B5EWM5"
FT                   /protein_id="ACH49493.1"
FT                   /translation="MKRRSSFLVFLGLLLASPLALANDQHTVSFGYAQTHLSSLKNSDS
FT                   KDLRGFNFKYRYEFNETWGMLGSFTATRNEMENYTWKEGKLHKNGSDSVDYGSLMFGPT
FT                   YRFNDYVSLYGNAGIATMKFNKHSKEDSFAYGAGVIFNPVKSISIDASWEASRFFAVDT
FT                   NTFGVSVGYRF"
FT   gene            373853..374494
FT                   /locus_tag="SeAg_B0380"
FT   CDS_pept        373853..374494
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0380"
FT                   /product="putative response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0380"
FT                   /db_xref="EnsemblGenomes-Tr:ACH49172"
FT                   /db_xref="GOA:B5EWM6"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:B5EWM6"
FT                   /protein_id="ACH49172.1"
FT                   /translation="MINSLSEQLPLKTIGIVLTDDYYTYLGIASLFEDGKCFMFPLNGE
FT                   YNSCQISASEDIIIIIDGRVLIQGVWKGFKALMQHYPHARRIWLTRRDIGKLYPHGCDR
FT                   DPDIDPDLAKPVFIEHFIKYACANEVAVGELAPLTKKEEELLWHFLYKKSMSQIASSYG
FT                   MSRKTLYIHRLRICRKYGFKRFFHLLFIYQRSRHIFASKICRVDKNADQA"
FT   gene            374550..374729
FT                   /locus_tag="SeAg_B0381"
FT   CDS_pept        374550..374729
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0381"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0381"
FT                   /db_xref="EnsemblGenomes-Tr:ACH49967"
FT                   /db_xref="UniProtKB/TrEMBL:B5EWM7"
FT                   /protein_id="ACH49967.1"
FT                   /translation="MLLAIKILISALDEKTKIRLREHIEKTEQEIASSIHDSIMTETFL
FT                   QQMKDIRYILNIVP"
FT   gene            374763..375146
FT                   /locus_tag="SeAg_B0382"
FT   CDS_pept        374763..375146
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0382"
FT                   /product="cytochrome c type biogenesis protein CycH"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0382"
FT                   /db_xref="EnsemblGenomes-Tr:ACH49284"
FT                   /db_xref="InterPro:IPR025294"
FT                   /db_xref="UniProtKB/TrEMBL:B5EWM8"
FT                   /protein_id="ACH49284.1"
FT                   /translation="MINRPGISMKKILVCFVGLALTACSANSLNYGAEQVRVMTSEPGK
FT                   ECSYLGDITGSQGNFFTGGWTSNSNLETGARNDLKNKAYKMGGNTVVLLTQRAGQTGSS
FT                   WHGSGSSKQTNVTLSGNVYRCPR"
FT   gene            complement(375216..376673)
FT                   /locus_tag="SeAg_B0383"
FT   CDS_pept        complement(375216..376673)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0383"
FT                   /product="outer membrane protein OprM"
FT                   /note="identified by match to protein family HMM PF02321;
FT                   match to protein family HMM TIGR01845"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0383"
FT                   /db_xref="EnsemblGenomes-Tr:ACH50951"
FT                   /db_xref="GOA:B5EWM9"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="InterPro:IPR010131"
FT                   /db_xref="UniProtKB/TrEMBL:B5EWM9"
FT                   /protein_id="ACH50951.1"
FT                   /translation="MKITFTGYRQTATLATLAFVTTLAGCTMAPKHERPASPTAMVYPY
FT                   ATSTVSGAPDAADIGWRDFFHDPLLQELIAIALRNNRDLRKAGLNVEAARALYRIQRAE
FT                   MLPTLGIATAMDAGRTPADLSVTDEPEINRRYEMAGATTAWELDLWGRVRSLSDQALAA
FT                   YMALDETYIAARMSLVSEVASAWLTLRADRELLRLTEDTLAAQKSSYTLTTQLARTGNA
FT                   TQLDLRMAEIALRSAEINRAAYTRQLARDRNALELLLGQPLTPELSRRLNEAVTLTEGA
FT                   IPTTLPGGLPSDLLVRRPDIRAAEYRLRGANARIGAARAAFFPTISLTGTAGTASASLS
FT                   GLFEPGSGSWRFLPQITLPLFHGGALRADLDRAHVQKQIEIASYENVIQQAFRDVADGL
FT                   AGQRTLNDQVQSEQRAVEASQIAYELAGLRFQEGVDDYLTLLDTHRMLYGAQQRLVRTR
FT                   LMQQLNIINLYKALGGGWREYSEKKQG"
FT   gene            complement(376690..379857)
FT                   /locus_tag="SeAg_B0384"
FT   CDS_pept        complement(376690..379857)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0384"
FT                   /product="OqxB"
FT                   /note="identified by match to protein family HMM PF00873;
FT                   match to protein family HMM TIGR00915"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0384"
FT                   /db_xref="EnsemblGenomes-Tr:ACH50306"
FT                   /db_xref="GOA:B5EWN0"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR004764"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:B5EWN0"
FT                   /protein_id="ACH50306.1"
FT                   /translation="MKFTHFFIARPIFAIVLSLLMLLAGAIAFLKLPLSEYPAVTPPTV
FT                   QVSASYPGANPQVIADTVAAPLEQVINGVDGMLYMNTQMAIDGRMVISIAFEQGTDPDM
FT                   AQIQVQNRVSRALPRLPEEVQRIGIVTEKTSPDMLMVVHLVSPQKRYDSLYLSNFAIRQ
FT                   VRDELARLPGVGDVLVWGAGEYAMRVWLDPAKIANRGLTASDIVTALREQNVQVAAGSV
FT                   GQQPEASAAFQMTVNTLGRLTSEEQFGEIVVKIGADGEVTRLRDVARVTLGADAYTLRS
FT                   LLNGEAAPALQIIQSPGANAIDVSNAIRGKMDELQQNFPQDIEYRIAYDPTVFVRASLQ
FT                   SVAITLLEALVLVVLVVVLFLQTWRASIIPLVAVPVSLVGTFALMHLFGFSLNTLSLFG
FT                   LVLSIGIVVDDAIVVVENVERHISQGKSPGEAAKKAMDEVTGPILSITSVLTAVFIPSA
FT                   FLAGLQGEFYRQFALTIAISTILSAINSLTLSPALAAILLRPHHDTAKADWLTRLMGTV
FT                   TGGFFHRFNRFFDSASNRYVSAVRRAVRGSVIVMVLYAGFVGLTWLGFHQVPNGFVPAQ
FT                   DKYYLVGIAQLPSGASLDRTEAVVKQMSAIALAEPGVESVVVFPGLSVNGPVNVPNSAL
FT                   MFAMLKPFDEREDPSLSANAIAGKLMHKFSHIPDGFIGIFPPPPVPGLGATGGFKLQIE
FT                   DRAELGFEAMTKVQSEIMSKAMQTPELANMLASFQTNAPQLQVDIDRVKAKSMGVSLTD
FT                   IFETLQINLGSLYVNDFNRFGRTWRVMAQADAPFRMQQEDIGLLKVRNAKGEMIPLSAF
FT                   VTIMRQSGPDRIIHYNGFPSVDISGGPAPGFSSGQATDAIEKIVRETLPEGMVFEWTDL
FT                   VYQEKQAGNSALAIFALAVLLAFLILAAQYNSWSLPFAVLLIAPMSLLSAIVGVWVSGG
FT                   DNNIFTQIGFVVLVGLAAKNAILIVEFARAKEHDGADPLTAVLEASRLRLRPILMTSFA
FT                   FIAGVVPLVLATGAGAEMRHAMGIAVFAGMLGVTLFGLLLTPVFYVVVRRMALKRENRV
FT                   DSHDQQA"
FT   gene            complement(379854..381080)
FT                   /locus_tag="SeAg_B0385"
FT   CDS_pept        complement(379854..381080)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0385"
FT                   /product="putative auxiliary transport protein, membrane
FT                   fusion protein (MFP) family"
FT                   /note="identified by match to protein family HMM PF00529;
FT                   match to protein family HMM TIGR01730"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0385"
FT                   /db_xref="EnsemblGenomes-Tr:ACH48902"
FT                   /db_xref="GOA:B5EWN1"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:B5EWN1"
FT                   /protein_id="ACH48902.1"
FT                   /translation="MRRTFKIMLIAGVIAAIGGVIYMAGEALWDKDNAVGPPASAPPPP
FT                   SVPVAKALSRTLAPTAEFTGFLAAPETVELRSRVGGTLDAVSVPEGRLVSRGQLLFQID
FT                   PRPFEVALDTAVAQLRQAEVLARQAQADFDRIQRLVASGAVSRKNADDVTATRNARQAQ
FT                   MQSAKAAVAAARLELSWTRITAPIAGRVDRILVTRGNLVSGGVAGNATLLTTIVSHNPM
FT                   YVYFDIDEATWLKALRHTRSDKNPPVVNMGLTTDNGLPYQGVLDFMGNQMNRSTGTIRA
FT                   RAVIPDPDGMLSPGLFARISLPIGEPRETVLIDDLAVSADQGKNYVLIVGKENQVEYRP
FT                   VELGQMVDGLRVVTQGVLPGEKIILKGLVRPGMTVAPRLVPMRQNVTDKQTATLTKADG
FT                   DSAPKAVRQ"
FT   gene            381224..381337
FT                   /locus_tag="SeAg_B0386"
FT   CDS_pept        381224..381337
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0386"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0386"
FT                   /db_xref="EnsemblGenomes-Tr:ACH49585"
FT                   /db_xref="UniProtKB/TrEMBL:B5EWN2"
FT                   /protein_id="ACH49585.1"
FT                   /translation="MSRIILFYEPSHILAEPCSLNTLDLPTMASFRLSDTE"
FT   gene            381357..383645
FT                   /locus_tag="SeAg_B0387"
FT   CDS_pept        381357..383645
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0387"
FT                   /product="copper-translocating P-type ATPase"
FT                   /EC_number="3.6.3.4"
FT                   /note="identified by match to protein family HMM PF00122;
FT                   match to protein family HMM PF00403; match to protein
FT                   family HMM PF00702; match to protein family HMM TIGR01494;
FT                   match to protein family HMM TIGR01511; match to protein
FT                   family HMM TIGR01525"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0387"
FT                   /db_xref="EnsemblGenomes-Tr:ACH48963"
FT                   /db_xref="GOA:B5EWN3"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR017969"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:B5EWN3"
FT                   /protein_id="ACH48963.1"
FT                   /translation="MSQSENRHDTISLLIEGMTCASCVARVEKGIKAVPGVTDATVNLA
FT                   TERATVRGTASAEAVIAAIEKTGYEARPIETAGQGEDDSEEKKEAERVRLKRDLILASV
FT                   LALPVFVLEMGSHLIPGMHEWVIKTIGLQQSWYWQFALTLLVLTIPGRRFYLKGFPALA
FT                   RLAPDMNSLVAVGTAAAFGYSLVATFTPDLLPEGTVNVYYEAAAVIVALILLGRFLEAR
FT                   AKGRTSEAIKRLVGLQARVAHVLREGRIVDIPVDEVVLGDCVEVRPGERIPVDGEVTEG
FT                   RSFVDESMITGEPIPVEKSAGSAVVGGTVNQKGALTLRATAVGGQTMLAQIIRLVEQAQ
FT                   GSKLPIQAVVDKVTLWFVPMVMLIAALTFVVWLAFGPSPALTFALINGVAVLIIACPCA
FT                   MGLATPTSIMVGTGRGAEMGVLFRKGEALQLLKDAKVVAVDKTGTLTEGRPVLTDLDVA
FT                   SGFERREVLAKVAAVESRSEHPIARAIVVSAEEEGIALPGMNGFESVTGMGVYATVAGT
FT                   RVDVGADRYMREIGVDISGFATTAERLGQEGKSPLYAAIDGQLAAIIAVADPIKPSTPA
FT                   AINALHQLGIKVAMITGDNARTAQAIARQLGIDDVVAEVLPEGKVEAIRRLKAAYGQVA
FT                   FVGDGINDAPALAESDVGLAIGTGTDVAVESADVVLMSGNLQGVPNAIALSKATIRNIH
FT                   QNLFWAFAYNTALIPVAAGALFPVWGILLSPVFAAGAMAMSSVFVLGNALRLRRFRAPM
FT                   ATPSDTSTT"
FT   gene            383657..384121
FT                   /gene="cueR"
FT                   /locus_tag="SeAg_B0388"
FT   CDS_pept        383657..384121
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cueR"
FT                   /locus_tag="SeAg_B0388"
FT                   /product="Cu(I)-responsive transcriptional regulator"
FT                   /note="identified by match to protein family HMM PF00376;
FT                   match to protein family HMM PF09278; match to protein
FT                   family HMM TIGR02044"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0388"
FT                   /db_xref="EnsemblGenomes-Tr:ACH48572"
FT                   /db_xref="GOA:B5EWN4"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR011789"
FT                   /db_xref="InterPro:IPR015358"
FT                   /db_xref="UniProtKB/TrEMBL:B5EWN4"
FT                   /protein_id="ACH48572.1"
FT                   /translation="MNIGKAAKASKVSAKMIRYYEQIGLIPAASRTDSGYRAYTQADVN
FT                   QLHFIRRARDLGFSVAEISDLLNLWNNQSRQSADVKRLAQTHIDELDRRIQNMQHMAQT
FT                   LKALIHCCAGDALPDCPILHTLGQPDDSEPEARTGAVLRRPRRHGLAKRL"
FT   gene            384199..384393
FT                   /locus_tag="SeAg_B0389"
FT   CDS_pept        384199..384393
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0389"
FT                   /product="conserved domain protein"
FT                   /note="identified by match to protein family HMM PF00403"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0389"
FT                   /db_xref="EnsemblGenomes-Tr:ACH50641"
FT                   /db_xref="GOA:B5EWN5"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="UniProtKB/TrEMBL:B5EWN5"
FT                   /protein_id="ACH50641.1"
FT                   /translation="MQFHIDDMTCGGCASTVKKTILTLDANATVRTDPATRLVDVETSL
FT                   SAEQIAAALQKAGFPPRER"
FT   gene            complement(384437..384550)
FT                   /locus_tag="SeAg_B0390"
FT   CDS_pept        complement(384437..384550)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0390"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0390"
FT                   /db_xref="EnsemblGenomes-Tr:ACH50023"
FT                   /db_xref="UniProtKB/TrEMBL:B5EWN6"
FT                   /protein_id="ACH50023.1"
FT                   /translation="MLAKIDKSLHIINKAYWHMICHIFYGDYLTQRKAKRG"
FT   gene            384685..385938
FT                   /locus_tag="SeAg_B0391"
FT   CDS_pept        384685..385938
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0391"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="identified by match to protein family HMM PF00083;
FT                   match to protein family HMM PF07690"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0391"
FT                   /db_xref="EnsemblGenomes-Tr:ACH51058"
FT                   /db_xref="GOA:B5EWN7"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B5EWN7"
FT                   /protein_id="ACH51058.1"
FT                   /translation="MYTPLNWTTTQRHVAFASFTSWMLDAFDFFILVFVLSDLAEWFHA
FT                   SVSDVSIAIMLTLAVRPIGALLFGRMAEKYGRRPILMLNILFFTVFELLSAWSPTFMAF
FT                   LIFRVMYGVAMGGIWGVASSLAMETIPDRSRGLMSGIFQAGYPCGYLFASVIFGLFYSM
FT                   VGWRGMFLIGALPVVLLPYIWFKVPESPVWLAARARKENTALLPVLRKQWKLCLYLVLV
FT                   MAFFNFFSHGTQDLYPTFLKMQHGFDPHLISIIAIFYNIAAMLGGIFYGTLSERIGRKK
FT                   AIMIAAFLALPVLPLWAFSSGSFTIGLGAFLMQFMVQGAWGVVPTWLNELVPANARAVL
FT                   PGFVYQLGNLLASVNATLQARIAETHGGNYGLAMAIVAGAVAILICVFVAFGRETRGVV
FT                   ISGTDSDALPESAISHRT"
FT   gene            386127..388085
FT                   /locus_tag="SeAg_B0392"
FT   CDS_pept        386127..388085
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0392"
FT                   /product="type III restriction-modification system StyLTI
FT                   enzyme mod"
FT                   /EC_number="2.1.1.72"
FT                   /note="identified by match to protein family HMM PF01555"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0392"
FT                   /db_xref="EnsemblGenomes-Tr:ACH51680"
FT                   /db_xref="GOA:B5EWN8"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR002295"
FT                   /db_xref="InterPro:IPR002941"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041405"
FT                   /db_xref="UniProtKB/TrEMBL:B5EWN8"
FT                   /protein_id="ACH51680.1"
FT                   /translation="MLKDNQKHNESVAPNSAFLSELQRALPEFFIADRYNEQGELIAKG
FT                   GFDLAKFERALKARNIDELTSGYQIDFIGKDYAKKQAGEKSVTVIVPDVEHNTLAENKN
FT                   SHNLFLTGDNLDVLRHLQNNYADTVDMIYIDPPYNTGSDGFVYPDHFEYSDRALQDMFG
FT                   LNDTELARLKSIQGKSTHSAWLSFMYPRLFLARKLLKDTGFIFISIDDNEYANLKLMMD
FT                   EIFGEGGFVTNVMWKRKKEISNDSDNVSIQGEYILVYAKTGQGALRLEPLSKEYIQKSY
FT                   KEPTEQFPEGKWRPVPLTVSKGLSGGGYTYKITTPNGTVHERLWAYPEASYQKLVADNL
FT                   VYFGKDNGGIPQRVMYAHHSKGQPTTNYWDNVASNKEGKKEILDLFGDNVFDTPKPTAL
FT                   LKKIIKLAIDKDGVVLDFFAGSGTTAHAVMALNEEDGGQRTFILCTIDQALSNNTIAKK
FT                   AGYNTIDEISRERITRVAAKIRANNPATNSDLGFKHYRFATPTQQTLDDLDSFDIATGH
FT                   FINTSGQLAAFTESGFTDMINPFSARGLGVPGGASGEETLLTTWLVADGYKMDIDVQTV
FT                   DFSGYCARYVDNTRLYLIDERWGTEQTRDLLNHIGTHQLPVQTIVIYGYSFDLESIREL
FT                   EIGLKQLDQKVNLVKRY"
FT   gene            388098..391067
FT                   /locus_tag="SeAg_B0393"
FT   CDS_pept        388098..391067
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0393"
FT                   /product="type III restriction-modification system StyLTI
FT                   enzyme res"
FT                   /EC_number="3.1.21.5"
FT                   /note="identified by match to protein family HMM PF04851;
FT                   match to protein family HMM PF08774"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0393"
FT                   /db_xref="EnsemblGenomes-Tr:ACH49144"
FT                   /db_xref="GOA:B5EWN9"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR014883"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B5EWN9"
FT                   /protein_id="ACH49144.1"
FT                   /translation="MNILLEELPHQEQALAAILASFTGIDHAQADHNHYANPLIKERYD
FT                   DKANIDVKMETGTGKTYVYTRLMYELHQNYGLFKFVLVVPTPAIKEGARNFITSDYARQ
FT                   HFSQFYENTRMELCTINAGDFKVKSGRKNFPAQLLSFTDASRRDSHTIQVLLINAQMLN
FT                   SASMTRDDYDQTLLGGLTSPVKGLQMTRPVVIIDEPHRFARDNKFYRAIQAIQPQMIVR
FT                   FGATFPDIVEGKGKNKCVRKDYYRRQPQFDLNAVDSFNDGLVKGIDIYYPNLPEEQANN
FT                   RYIVDSVTAKKLILRRGSKIAEVGVGENLADVDAGFEGSIEYAGSKMLSNDLELEAGMA
FT                   LVPGTFGASYQELIIQDAIDKHFDTEQANFLRSNEPENNAPRIKTLSLFFIDSIKSYRD
FT                   DEGWLKVTFERLLKKKLTQLIDDYQRKTLPREVEYLSFLQATLASLHSDNQNVHAGYFG
FT                   EDRGSGDEAIQAEVDDILKNKEKLLSFSDHHGNWETRRFLFSKWTLREGWDNPNVFVIA
FT                   KLRSSGSESSKIQEVGRGLRLPVDENGHRVHQEEWPSRLSFLIGYDEKAFASMLVDEIN
FT                   RDSKVQLNEQKLDEAMITLIVTERQKVDPAFTELRLLEDLDDKKLINRSNEFKPSVTLN
FT                   GETKSGFAWLLEFYPELTQARVRADRIRDNKPASRLRVRLRKENWEQLSSIWEQFSRRY
FT                   MLQFERSGASLEQIAAEVLRDPALYIRQKPSQVQQRLVSNEDNGRFEVAQREGELAASE
FT                   FMAGMKYGHFLKQLALRTSLPVNVLHPVLMAMLRDVLHGDSRYLSEISLDNMTRALQTR
FT                   INAHFAQRHDYLPLDFQASTSVFDSTARQFREEISAEIVGKNVDENAIDDPRSLYQIPP
FT                   LRYDSVDPELPLLKYDYPQQVSVFGKLPKRAIQIPKYTGGSTTPDFVYRIERQDADSVY
FT                   LLVETKAENMRVGDQVILDAQRKFFDMLRRQNINVEFADATSAPAVFSTINGLIEGKAN
FT                   "
FT   gene            391562..392965
FT                   /gene="cioA"
FT                   /locus_tag="SeAg_B0394"
FT   CDS_pept        391562..392965
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cioA"
FT                   /locus_tag="SeAg_B0394"
FT                   /product="cyanide-insensitive oxidase CioA"
FT                   /note="identified by match to protein family HMM PF01654"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0394"
FT                   /db_xref="EnsemblGenomes-Tr:ACH49798"
FT                   /db_xref="GOA:B5EWP0"
FT                   /db_xref="InterPro:IPR002585"
FT                   /db_xref="UniProtKB/TrEMBL:B5EWP0"
FT                   /protein_id="ACH49798.1"
FT                   /translation="MEFDAFFLARLQFAFTVSFHIIFPAITIGLASYLVVLEGLWLKTR
FT                   NPVWRSLYQFWLKIFAVNFGMGVVSGLVMAYQFGTNWSGFSQFAGSITGPLLTYEVLTA
FT                   FFLEAGFLGVMLFGWNKVGPGLHFLSTCMVALGTLMSTFWILASNSWMHTPQGFEIHNG
FT                   QVVPVDWFAVIFNPSFPYRLLHMSVAAFLSSAMFVGASAAWHLLKGNDTLAIRRMFSMA
FT                   LWMAVVVAPVQALIGDMHGLNTLKHQPVKIAAIEGHWENTPGEPTPLTLVGWPDMEAER
FT                   TRYALEIPALGSLILTHSLDKQVPALKDYPKEDRPNSTVVFWSFRLMVGMGVLMIFLGL
FT                   ASLWLRYRRRLYHSRPFMHFALWMGPSGLIAILAGWVTTEVGRQPWVVYGLLRTRDAVS
FT                   AHSTLQMSISLLAFFVVYSLVFGVGYIYMIRLIQKGPQPAETPTAETDGRPARPISAVG
FT                   ESLEQEKRE"
FT   gene            392962..393972
FT                   /gene="cydB"
FT                   /locus_tag="SeAg_B0395"
FT   CDS_pept        392962..393972
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cydB"
FT                   /locus_tag="SeAg_B0395"
FT                   /product="cytochrome D ubiquinol oxidase, subunit II"
FT                   /EC_number="1.10.3.-"
FT                   /note="identified by match to protein family HMM PF02322;
FT                   match to protein family HMM TIGR00203"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0395"
FT                   /db_xref="EnsemblGenomes-Tr:ACH52958"
FT                   /db_xref="GOA:B5EWP1"
FT                   /db_xref="InterPro:IPR003317"
FT                   /db_xref="UniProtKB/TrEMBL:B5EWP1"
FT                   /protein_id="ACH52958.1"
FT                   /translation="MTIDLPVIWFAIIVFATLMYIVMDGFDLGVGILFPFIRDKHDRDV
FT                   MVNSVAPVWDGNETWLVLGGAGLFGAFPLAYAVITDALTIPLVVMLLGLIFRGVAFEFR
FT                   FKATESHRAFWDKSFIVGSILATFAQGVVVGAVVSGFQVEGRTFSGSQLDWLTPFNLFC
FT                   GVGLVVTYALLGATWLIMKSEDPLHSRMCALSRPLLIVLLLVMGGVSVWTPLTHDDIAE
FT                   RWFTLPNLYYFLPVPVLVLAFSVWLWRSVKKPESHARPFILTLGLIFLGFSGLGISIWP
FT                   NIIPPDISLYAAAAPPQSQSFMLVGALIIIPIILAYTFWSYYVFRGKVRHGEGYH"
FT   gene            393972..394103
FT                   /locus_tag="SeAg_B0396"
FT   CDS_pept        393972..394103
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0396"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0396"
FT                   /db_xref="EnsemblGenomes-Tr:ACH48459"
FT                   /db_xref="GOA:B5EWP2"
FT                   /db_xref="InterPro:IPR018895"
FT                   /db_xref="UniProtKB/TrEMBL:B5EWP2"
FT                   /protein_id="ACH48459.1"
FT                   /translation="MVKVKKWSRRVVWMVAIWCASVLLLAGVGMLFRLLMTSAGFRS"
FT   gene            394310..395314
FT                   /locus_tag="SeAg_B0397"
FT   CDS_pept        394310..395314
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0397"
FT                   /product="AraC-family transcriptional regulator"
FT                   /note="identified by match to protein family HMM PF00165"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0397"
FT                   /db_xref="EnsemblGenomes-Tr:ACH51838"
FT                   /db_xref="GOA:B5EWP3"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="UniProtKB/TrEMBL:B5EWP3"
FT                   /protein_id="ACH51838.1"
FT                   /translation="MSPISCHSSAAPAMKKIFSVSDFIAFGERYGIDYRFPALPQYTQS
FT                   SPVLHGDIEEIALPGGICITRSDVHVLQPYETTSRHSSPLYMLVVLEGNVALAVNEQTF
FT                   LLSAGMAFCSQLSEQQTIRAHHGADSKLRTLSLGMYPDGGWRERLPVSLADEWEHRAAS
FT                   ARVWQVPEFLLSGLRYAQQPGPHAASRQLMLEGIMLQLLGYALNLCQPATQKRGLPVTG
FT                   EYQRLELIRRLLEQTPEKAYTLNELARRAAMSPSSLRCKFRHAYGCTVFDYLRDCRLAR
FT                   ARRYLMEGYSVQQAAWMSGYQHATNFATAFRRRYGCSPGELRDASLTASRHCA"
FT   gene            395472..397568
FT                   /locus_tag="SeAg_B0398"
FT   CDS_pept        395472..397568
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0398"
FT                   /product="ferrichrome-iron receptor"
FT                   /note="identified by match to protein family HMM PF00593;
FT                   match to protein family HMM PF07715; match to protein
FT                   family HMM TIGR01783"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0398"
FT                   /db_xref="EnsemblGenomes-Tr:ACH52293"
FT                   /db_xref="GOA:B5EWP4"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010105"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039423"
FT                   /db_xref="UniProtKB/TrEMBL:B5EWP4"
FT                   /protein_id="ACH52293.1"
FT                   /translation="MFMFATTRMALLIGGAIGGATFPLFAQETTKNDTVIVTSPVQSGA
FT                   TKLATPDIETPQSVSIITRQQFEEQGATSVRQAVSYTPGVYSNQIGASNRFDYIVLRGF
FT                   SDGSLDNVYLDGLKMMGDTNSHSSLVVDPWFLEDIEVVRGPASVLYGRSSPGGIVALTS
FT                   RKPAFDAGGEVKLFAGNNNQRGAAFDVTGPLDDNERVAARLSGMTRYADSQFTPLKEER
FT                   YALMPSLTWRITDRTRLDLMAYLHRDPQGGSHSGLPYQGTVVPYNGRKISNTFFEGEDD
FT                   YDKYDRRENMVGYNIEHLFDNGWSVRQKLRYLHTKVTLNQVYAAGWLNETALNRGYSGS
FT                   GEKMSAIALDNQLDGSVDTGAINHRLLVGIDYQDRSNHTTGYYGAFPPIDAFNPVYGAQ
FT                   PDYITLYSREKHKLRQTGYYLQDQMSWDRWRFTLGGRYDRVSVSNIDKLHDSRSDLDKN
FT                   NVSTRAALLYLFDNGVAPYLSYSTAFTPTSFADENGNVLEPMKGKQWEAGVKYEPLGGN
FT                   SQFSAAVYRINQTNIATKEEPTDPYRSIGEIESKGVELEAISHLSDSVRLQAAYTYTDI
FT                   RYKKSSPQEQGKRAVYAPRNQASAWLSYDVKSGLLEGLTLGSGIRYVNGVTSDRLNTHT
FT                   LPSYTLVDMVVGYDLSSIGLNGLSAQLNVNNLTDKRYVAACNSLSYCYFGAERSIVGSV
FT                   SWAF"
FT   gene            complement(397609..398241)
FT                   /locus_tag="SeAg_B0399"
FT   CDS_pept        complement(397609..398241)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0399"
FT                   /product="putative transport protein"
FT                   /note="identified by match to protein family HMM PF01810;
FT                   match to protein family HMM TIGR00949"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0399"
FT                   /db_xref="EnsemblGenomes-Tr:ACH50447"
FT                   /db_xref="GOA:B5EWP5"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="InterPro:IPR004778"
FT                   /db_xref="UniProtKB/TrEMBL:B5EWP5"
FT                   /protein_id="ACH50447.1"
FT                   /translation="MEPFHAVVLTVSLFVLTFFNPGANLFVVVQTSLASGRRAGVITGL
FT                   GVATGDAFYSGLGLFGLATLITQCEAVFSLIKIVGGAYLLWFAWNSIRHQATPQMSTLQ
FT                   TPIAAPWTIFFRRGLMTDLSNPQTVLFFISIFSVTLSAETPTWARLMAWAGIVLSSVIW
FT                   RIFLSQAFSLPAVRRAYGRIQRIASRVIGAIIGMFALRLLYEGVTYR"
FT   gene            398473..398748
FT                   /locus_tag="SeAg_B0400"
FT   CDS_pept        398473..398748
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0400"
FT                   /product="protein YahO"
FT                   /note="identified by match to protein family HMM PF07338"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0400"
FT                   /db_xref="EnsemblGenomes-Tr:ACH50532"
FT                   /db_xref="InterPro:IPR010854"
FT                   /db_xref="InterPro:IPR025543"
FT                   /db_xref="InterPro:IPR036275"
FT                   /db_xref="UniProtKB/TrEMBL:B5EWP6"
FT                   /protein_id="ACH50532.1"
FT                   /translation="MKTGYKVMLGALAFVVTNVYAAEIMKKTDFDKVASEYTKIGTIST
FT                   TGEMSPLDAREDLIKKADEKGADVVVLTSGQTENKIHGTADIYKKK"
FT   gene            complement(398884..400509)
FT                   /gene="prpR"
FT                   /locus_tag="SeAg_B0401"
FT   CDS_pept        complement(398884..400509)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prpR"
FT                   /locus_tag="SeAg_B0401"
FT                   /product="propionate catabolism operon regulatory protein
FT                   PrpR"
FT                   /note="identified by match to protein family HMM PF00158;
FT                   match to protein family HMM PF02954; match to protein
FT                   family HMM PF06506; match to protein family HMM TIGR02329"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0401"
FT                   /db_xref="EnsemblGenomes-Tr:ACH52744"
FT                   /db_xref="GOA:B5EWP7"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR010524"
FT                   /db_xref="InterPro:IPR012704"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B5EWP7"
FT                   /protein_id="ACH52744.1"
FT                   /translation="MTTAHSAPRDNSDKPVIWTVSVTRLFELFRDISLEFDHLATITPI
FT                   QLGFEKAVTYIRKKLATERCDAIIAAGSNGAYLKSRLSIPVILIKPSGFDVLQALAKAG
FT                   KLTSSIGIVTYQETIPALLAFQKTFHLCLEQRSYVTEEDARGQINELKANGIEAVVGAG
FT                   LITDLAEEAGMTAIFIYSAATVRQAFHDALDMTRLTRRQRVDYPSGKGLQTRYELGDIR
FT                   GQSPQMEQLRQTITLYARSRAAVLIQGETGTGKELAAQAIHQTFFHRQPHRQNKPSPPF
FT                   VAVNCGAITESLLEAELFGYEEGAFTGSRRGGRAGLFEIAHGGTLFLDEIGEMPLPLQT
FT                   RLLRVLEEKAVTRVGGHQPIPVEVRVISATHCDLDREIMQGRFRPDLFYRLSILRLTLP
FT                   PLRERQADILPLAESFLKQSLAAMEIPFTESIRHGLTQCQPLLLAWRWPGNIRELRNMM
FT                   ERLALFLSVDPAPTLDRQFMRQLLPELMVNTAELTPSTVDAHTLQDVLARFKGDKSATA
FT                   RYLGISRTTLWRRLKAGAKDQSGN"
FT   gene            400775..401662
FT                   /gene="prpB"
FT                   /locus_tag="SeAg_B0402"
FT   CDS_pept        400775..401662
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prpB"
FT                   /locus_tag="SeAg_B0402"
FT                   /product="methylisocitrate lyase"
FT                   /EC_number="4.1.3.30"
FT                   /note="identified by match to protein family HMM TIGR02317"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0402"
FT                   /db_xref="EnsemblGenomes-Tr:ACH51952"
FT                   /db_xref="GOA:B5EWP8"
FT                   /db_xref="InterPro:IPR012695"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018523"
FT                   /db_xref="InterPro:IPR039556"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:B5EWP8"
FT                   /protein_id="ACH51952.1"
FT                   /translation="MSLHSPGQAFRAALAKENPLQIVGAINANHALLAQRAGYQAIYLS
FT                   GGGVAAGSLGLPDLGISTLDDVLTDIRRITDVCPLPLLVDADIGFGSSAFNVARTVKSI
FT                   AKAGAAALHIEDQVGAKRCGHRPNKAIVSKEEMVDRIRAAVDARTDPNFVIMARTDALA
FT                   VEGLEAALDRAQAYVDAGADMLFPEAITELSMYRQFADVAQVPILANITEFGATPLFTT
FT                   DELRSAHVAMALYPLSAFRAMNRAAEKVYTVLRQEGTQKNVIDIMQTRNELYESINYYQ
FT                   FEEKLDALYRNKKS"
FT   gene            401785..402954
FT                   /gene="prpC"
FT                   /locus_tag="SeAg_B0403"
FT   CDS_pept        401785..402954
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prpC"
FT                   /locus_tag="SeAg_B0403"
FT                   /product="2-methylcitrate synthase"
FT                   /EC_number="2.3.3.5"
FT                   /note="identified by match to protein family HMM PF00285;
FT                   match to protein family HMM TIGR01800"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0403"
FT                   /db_xref="EnsemblGenomes-Tr:ACH51390"
FT                   /db_xref="GOA:B5EWP9"
FT                   /db_xref="InterPro:IPR002020"
FT                   /db_xref="InterPro:IPR011278"
FT                   /db_xref="InterPro:IPR016142"
FT                   /db_xref="InterPro:IPR016143"
FT                   /db_xref="InterPro:IPR019810"
FT                   /db_xref="InterPro:IPR024176"
FT                   /db_xref="InterPro:IPR036969"
FT                   /db_xref="UniProtKB/TrEMBL:B5EWP9"
FT                   /protein_id="ACH51390.1"
FT                   /translation="MTDTTILQNNTHVIKPKKSVALSGVPAGNTALCTVGKSGNDLHYR
FT                   GYDILDLAEHCEFEEVAHLLIHGKLPTRDELNAYKSKLKALRGLPANVRTVLEALPAAS
FT                   HPMDVMRTGVSALGCTLPEKEGHTVSGARDIADKLLASLSSILLYWYHYSHNGERIQPE
FT                   TDDDSIGGHFLHLLHGEKPTQSWEKAMHISLVLYAEHEFNASTFTSRVIAGTGSDVYSA
FT                   IIGAIGALRGPKHGGANEVSLEIQQRYETPDEAEADIRKRVENKEVVIGFGHPVYTIAD
FT                   PRHQVIKRVAKQLSEEGGSLKMYHIADRLETVMWETKKMFPNLDWFSAVSYNMMGVPTE
FT                   MFTPLFVIARVTGWAAHIIEQRQDNKIIRPSANYTGPEDRPFVSIDDRC"
FT   gene            402994..404445
FT                   /gene="prpD"
FT                   /locus_tag="SeAg_B0404"
FT   CDS_pept        402994..404445
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prpD"
FT                   /locus_tag="SeAg_B0404"
FT                   /product="2-methylcitrate dehydratase"
FT                   /EC_number="4.2.1.79"
FT                   /note="identified by match to protein family HMM PF03972;
FT                   match to protein family HMM TIGR02330"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0404"
FT                   /db_xref="EnsemblGenomes-Tr:ACH51781"
FT                   /db_xref="GOA:B5EWQ0"
FT                   /db_xref="InterPro:IPR005656"
FT                   /db_xref="InterPro:IPR012705"
FT                   /db_xref="InterPro:IPR036148"
FT                   /db_xref="InterPro:IPR042183"
FT                   /db_xref="InterPro:IPR042188"
FT                   /db_xref="UniProtKB/TrEMBL:B5EWQ0"
FT                   /protein_id="ACH51781.1"
FT                   /translation="MSTQELNIRPEFDREIVDIVDYVMNYDITSKVAYDTAHYCLLDTL
FT                   GCGLEALEYPACKKLLGPIVPGTVVPNGARVPGTQFQLDPVQAAFNIGAMIRWLDFNDT
FT                   WLAAEWGHPSDNLGGILATADWLSRNAVAAGKAPLTMKQVLSGMIKAHEIQGCIALENA
FT                   FNRVGLDHVLLVKVASTAVVAEMLGLTRDEILNAVSLAWVDGQSLRTYRHAPNTGTRKS
FT                   WAAGDATSRAVRLALMAKTGEMGYPSALTAKTWGFYDVSFKGETFRFQRPYGSYVMENV
FT                   LFKISFPAEFHSQTAVEAAMTLYEQMQAAGKTAADIEKVTIRTHEACLRIIDKKGPLNN
FT                   PADRDHCIQYMVAVPLLFGRLTAADYEDEVAQDKRIDALREKIVCYEDPAFTADYHDPE
FT                   KRAIGNAITVEFTDGSRFGEVVVEYPIGHARRRADGIPKLIEKFKINLARQFPTRQQQR
FT                   ILDVSLDRARLEQMPVNEYLDLYVI"
FT   gene            404486..406372
FT                   /gene="prpE"
FT                   /locus_tag="SeAg_B0405"
FT   CDS_pept        404486..406372
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prpE"
FT                   /locus_tag="SeAg_B0405"
FT                   /product="propionate--CoA ligase"
FT                   /EC_number="6.2.1.17"
FT                   /note="identified by match to protein family HMM PF00501;
FT                   match to protein family HMM TIGR02316"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0405"
FT                   /db_xref="EnsemblGenomes-Tr:ACH50736"
FT                   /db_xref="GOA:B5EWQ1"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR012694"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR032387"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:B5EWQ1"
FT                   /protein_id="ACH50736.1"
FT                   /translation="MSFSEFYQRSINEPEAFWAEQARRIDWRQPFTQTLDHSRPPFARW
FT                   FCGGTTNLCHNAVDRWLDKQPEALALIAVSSETDEERTFTFSQLHDEVNIVAAMLLSLG
FT                   VQRGDRVLVYMPMIAEAQITLLACARIGAIHSVVFGGFASHSVAARIDDARPALIVSAD
FT                   AGARGGKILPYKKLLDDAIAQAQHQPKHVLLVDRGLAKMAWVDGRDLDFATLRQQHLGA
FT                   SVPVAWLESNETSCILYTSGTTGKPKGVQRDVGGYAVALATSMDTIFGGKAGGVFFCAS
FT                   DIGWVVGHSYIVYAPLLAGMATIVYEGLPTYPDCGVWWKIVEKYQVNRMFSAPTAIRVL
FT                   KKFPTAQIRNHDLSSLEALYLAGEPLDEPTASWVTETLGVPVIDNYWQTESGWPIMALA
FT                   RALDDRPSRLGSPGVPMYGYNVQLLNEVTGEPCGINEKGMLVIEGPLPPGCIQSIWGDD
FT                   ARFVKTYWSLFNRQVYATFDWGIRDAEGYYFILGRTDDVINIAGHRLGTREIEESISSY
FT                   PNVAEVAVVGIKDALKGQVAVAFVIPKQSDTLADREAARDEENAIMALVDNQIGHFGRP
FT                   AHVWFVSQLPKTRSGKMLRRTIQAICEGRDPGDLTTIDDPASLQQIRQAIEE"
FT   gene            complement(406476..407450)
FT                   /gene="hemB"
FT                   /locus_tag="SeAg_B0406"
FT   CDS_pept        complement(406476..407450)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemB"
FT                   /locus_tag="SeAg_B0406"
FT                   /product="delta-aminolevulinic acid dehydratase"
FT                   /EC_number="4.2.1.24"
FT                   /note="identified by match to protein family HMM PF00490"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0406"
FT                   /db_xref="EnsemblGenomes-Tr:ACH49966"
FT                   /db_xref="GOA:B5EWQ2"
FT                   /db_xref="InterPro:IPR001731"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR030656"
FT                   /db_xref="UniProtKB/TrEMBL:B5EWQ2"
FT                   /protein_id="ACH49966.1"
FT                   /translation="MTDLIHRPRRLRKSAALRAMFEETTLSLNDLVLPIFVEEELDDYK
FT                   AIDAMPGVMRIPEKQLAREIERIANAGIRSVMTFGISHHTDDTGSDTWKEDGLVARMSR
FT                   ICKQTVPEMIVMSDTCFCEYTSHGHCGVLCEHGVDNDATLANLGKQAVIAAAAGADFIA
FT                   PSAAMDGQVQAIRQALDAAGFTDTAIMSYSTKFASSFYGPFREAAGTALKGDRKTYQMN
FT                   PMNRREAIRESLLDEAQGADCLMVKPAGAYLDVLREIRERTELPLGAYQVSGEYAMIKF
FT                   AAMAGAIDEEKVVLESLGSIKRAGADLIFSYFALDLAEKNILR"
FT   gene            407670..407789
FT                   /locus_tag="SeAg_B0407"
FT   CDS_pept        407670..407789
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0407"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0407"
FT                   /db_xref="EnsemblGenomes-Tr:ACH48617"
FT                   /db_xref="GOA:B5EWQ3"
FT                   /db_xref="UniProtKB/TrEMBL:B5EWQ3"
FT                   /protein_id="ACH48617.1"
FT                   /translation="MWVLTLFIFILFFFNPYLSYMYFVFLFSCKVMKKNAFQL"
FT   gene            complement(407780..407896)
FT                   /locus_tag="SeAg_B0408"
FT   CDS_pept        complement(407780..407896)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0408"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0408"
FT                   /db_xref="EnsemblGenomes-Tr:ACH49251"
FT                   /db_xref="UniProtKB/TrEMBL:B5EWQ4"
FT                   /protein_id="ACH49251.1"
FT                   /translation="MFSKKDYAASLLKGSIILYPQSGFGHELKRRNKSKLYN"
FT   gene            408893..410935
FT                   /locus_tag="SeAg_B0409"
FT   CDS_pept        408893..410935
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0409"
FT                   /product="putative autotransporter/pertactin"
FT                   /note="identified by match to protein family HMM PF03212;
FT                   match to protein family HMM PF03797; match to protein
FT                   family HMM TIGR01414"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0409"
FT                   /db_xref="EnsemblGenomes-Tr:ACH50931"
FT                   /db_xref="GOA:B5EWQ5"
FT                   /db_xref="InterPro:IPR003991"
FT                   /db_xref="InterPro:IPR004899"
FT                   /db_xref="InterPro:IPR005546"
FT                   /db_xref="InterPro:IPR006315"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR036709"
FT                   /db_xref="UniProtKB/TrEMBL:B5EWQ5"
FT                   /protein_id="ACH50931.1"
FT                   /translation="MKNNVYFDHSTLLGDVEFSSHWNNDGEFFYSTGYDSNGDGVKDTN
FT                   GGWIDDSQNVDELNITLDNGSKWIGSANITADAIAPANMYDVAYNSLTPGATIEANDWD
FT                   RVIDNKVFQSGVFNVALNNGSEWDTVNSSIIDTLAVNNGSQVNVTDSTLVSDTIGLTNG
FT                   SSMNIGEDGQVATDHLTIDSYSTVALNDDVTHYGDYSLYANTITVTNGGMLDVNVDQFD
FT                   NGVFSTDKLELTSGNTADHNGNVVSGVFNIHSSDYVLNADLVNDRTWDTTQANYGYGTI
FT                   AMNSDGHLTINGNGDINNGDELDNSSVDNVVAATGNYKVRIDNATGAGSVADYKGNELI
FT                   YVNDVNTDATFSAANKADLGAYTYQAKQEGNTVVLEQMELTDYANMALSIPSANTNIWN
FT                   LEQDTVGTRLTNARHGLADNGGAWVSYFGGNFNGDNGTINYDQDVNGIMVGVDTKVDGN
FT                   NAKWIVGAAAGFAKGDLSDRTGQVDQDSQSAYIYSSARFANNIFVDGNLSYSHFNNDLS
FT                   ANMSDGTYVDGNTSSDAWGFGLKLGYDLKLGDAGYVTPYGSVSGLFQSGDDYQLSNDMK
FT                   VDGQSYDSMRYELGVDAGYTFTYSEDQALTPYFKLAYVYDDSNNDADVNGDSIDNGVEG
FT                   SAVRVGLGTQFSFTKNFSAYTDANYLGGGDVDQDWSANVGVKYTW"
FT   gene            411021..411644
FT                   /pseudo
FT                   /locus_tag="SeAg_B0410"
FT                   /note="putative inner membrane protein; this gene contains
FT                   a frame shift which may be the result of sequencing error;
FT                   identified by match to protein family HMM PF00027"
FT   gene            complement(411688..412845)
FT                   /locus_tag="SeAg_B0411"
FT   CDS_pept        complement(411688..412845)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0411"
FT                   /product="beta-lactamase"
FT                   /note="identified by match to protein family HMM PF00144"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0411"
FT                   /db_xref="EnsemblGenomes-Tr:ACH52639"
FT                   /db_xref="InterPro:IPR001466"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:B5EWQ6"
FT                   /protein_id="ACH52639.1"
FT                   /translation="MKRSLLFTAMLFAASLTSVQAAQPIADPVFASDIVDRYAEHIFYG
FT                   SGATGMALVVIDGNQRVFRSFGDTRPGNNVRPQLDSVIRIASLTKLMTSEMLVKLLDQG
FT                   TVKLNDPLSKYAPPGAHVPTYQGTPITLVNLATHTSALPREQPGGAAHRPVFVWPTREQ
FT                   RWNWLSTATLKVAPGSQAAYSNLAFDLLADALATASGKPYTQLFEEKITRPLGMKDTTF
FT                   TPSPDQCKRLMVAEKGASPCNNTLAAIGSGGVYSTPGDMMRWMQQYLSSDFYHRSQQAD
FT                   RMQTLIYQRTQLKKIIGMDVPGKADALGLGWVYMAPKDGRPGIIQKTGGGGGFITYMAM
FT                   IPQYNIGAFVVVTRSPLTRFTNMSDGINDLVTELSGNKPIAIPAS"
FT   gene            413192..414412
FT                   /gene="smbA"
FT                   /locus_tag="SeAg_B0412"
FT   CDS_pept        413192..414412
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="smbA"
FT                   /locus_tag="SeAg_B0412"
FT                   /product="protein SbmA"
FT                   /note="identified by match to protein family HMM PF05992;
FT                   match to protein family HMM PF06472"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0412"
FT                   /db_xref="EnsemblGenomes-Tr:ACH52008"
FT                   /db_xref="GOA:B5EWQ7"
FT                   /db_xref="InterPro:IPR009248"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="UniProtKB/TrEMBL:B5EWQ7"
FT                   /protein_id="ACH52008.1"
FT                   /translation="MFKSFFPKPGPFFMSAFVWALIAVIFWQAGGGDWVARLVGASDEV
FT                   PISAARFWSLDYLIFYAYYLICVGLFATFWFIYSPHRWQYWSILGTSLIIFVTWFLVEV
FT                   GVAVNAWYAPFYDLIQTALSSPHKVTLGQFYHEVGVFLGIALIAVVIGVLNNFFVSHYV
FT                   FRWRTAMNEHYMAHWQYLRHIEGAAQRVQEDTMRFASTLENMGVSFINAIMTLIAFLPV
FT                   LVTLSAHVPNLPIVGHIPYGLVIAAIVWSLMGTGLLAVVGIKLPGLEFKNQRVEAAYRK
FT                   ELVYGEDDASRATPPTVRELFSAVRHNYFRLYFHYMYFNIARILYLQVDNVFGLFLLFP
FT                   SIVAGTITLGLMTQITNVFGQVRGSFQYLINSWTTLVELMSIYKRLRSFERQLDGQPVQ
FT                   EVTHSFS"
FT   gene            414427..415521
FT                   /locus_tag="SeAg_B0413"
FT   CDS_pept        414427..415521
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0413"
FT                   /product="putative outer membrane lipoprotein"
FT                   /note="identified by match to protein family HMM PF07759"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0413"
FT                   /db_xref="EnsemblGenomes-Tr:ACH49559"
FT                   /db_xref="InterPro:IPR011673"
FT                   /db_xref="UniProtKB/TrEMBL:B5EWQ8"
FT                   /protein_id="ACH49559.1"
FT                   /translation="MSAASRLYPLPFLAVAILAGCSSQSGQPVSKGEKPVDVASVVRQK
FT                   MPASVKDREAWAKDIATTFKSQGLAPTVENICSVLAVAQQESGYQADPVVPGLSKIAWQ
FT                   EIDRRAERLHIPLFLVHTALKINSPNGKSYSERLDTVKTEKQLSAIFDDFINMVPMGQT
FT                   LFGSYNPVHTGGPMQVSIAFAEQHAKGYPWKMTGTVRQEVFTRRGGLWFGTYHLLNYPA
FT                   NYSAPVFRFADFNAGWYASRNAAFQNAVSKASGVKLALDGDLIRYNSKEPGKTELAVRK
FT                   LAGQLGMSEREIRSQLEKGDSLAFEKTALYKKVYKLAEAKTGKTLAREMLPGIQLESPK
FT                   ITRKLTTAWFAKRVDERRARCMGR"
FT   gene            complement(415559..415867)
FT                   /locus_tag="SeAg_B0414"
FT   CDS_pept        complement(415559..415867)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0414"
FT                   /product="inner membrane protein YaiY"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0414"
FT                   /db_xref="EnsemblGenomes-Tr:ACH48901"
FT                   /db_xref="GOA:B5EWQ9"
FT                   /db_xref="InterPro:IPR020513"
FT                   /db_xref="UniProtKB/TrEMBL:B5EWQ9"
FT                   /protein_id="ACH48901.1"
FT                   /translation="MADFTLSKSLFSGKHRETSSTPGNIAYAIFVLFCFWAGAQLLNLL
FT                   VHAPGIYEHLMQVQDTGRPRVEIGLGVGTIFGLVPFLTGCLIFAVIAAFLRWRHRHQ"
FT   gene            416135..416350
FT                   /locus_tag="SeAg_B0415"
FT   CDS_pept        416135..416350
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0415"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0415"
FT                   /db_xref="EnsemblGenomes-Tr:ACH51230"
FT                   /db_xref="GOA:B5EWR0"
FT                   /db_xref="InterPro:IPR020490"
FT                   /db_xref="UniProtKB/TrEMBL:B5EWR0"
FT                   /protein_id="ACH51230.1"
FT                   /translation="MRLPVKIRRDWHYYAFSIGLIFILNGVVGLLGFEAKGWQTYGVGL
FT                   VTWIISFWLAGFIIRRREDGEVKDAR"
FT   gene            complement(416376..417470)
FT                   /locus_tag="SeAg_B0416"
FT   CDS_pept        complement(416376..417470)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0416"
FT                   /product="D-alanine--D-alanine ligase"
FT                   /EC_number="6.3.2.4"
FT                   /note="identified by match to protein family HMM PF01820;
FT                   match to protein family HMM PF02222; match to protein
FT                   family HMM PF07478; match to protein family HMM PF08443;
FT                   match to protein family HMM TIGR01205"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0416"
FT                   /db_xref="EnsemblGenomes-Tr:ACH50613"
FT                   /db_xref="GOA:B5EWR1"
FT                   /db_xref="InterPro:IPR000291"
FT                   /db_xref="InterPro:IPR005905"
FT                   /db_xref="InterPro:IPR011095"
FT                   /db_xref="InterPro:IPR011127"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:B5EWR1"
FT                   /protein_id="ACH50613.1"
FT                   /translation="MAKLRVGIVFGGKSAEHEVSLQSAKNIVDAIDKTRFDVVLLGIDK
FT                   AGQWHVNDAENYLQNADDPAHIALRPSAISLAQVPGKHQHQLINAQNGQPLPTVDVIFP
FT                   IVHGTLGEDGSLQGMLRVANLPFVGSDVLSSAACMDKDVAKRLLRDAGLNIAPFITLTR
FT                   TNRHAFSFAEVESRLGLPLFVKPANQGSSVGVSKVANEAQYQQAVALAFEFDHKVVVEQ
FT                   GIKGREIECAVLGNDNPQASTCGEIVLNSEFYAYDTKYIDDNGAQVVVPAQIPSEVNDK
FT                   IRAIAIQAYQTLGCAGMARVDVFLTADNEVVINEINTLPGFTNISMYPKLWQASGLGYT
FT                   DLISRLIELALERHTANNALKTTM"
FT   gene            417578..418261
FT                   /locus_tag="SeAg_B0417"
FT   CDS_pept        417578..418261
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0417"
FT                   /product="extensin family protein"
FT                   /note="identified by match to protein family HMM PF06904"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0417"
FT                   /db_xref="EnsemblGenomes-Tr:ACH52228"
FT                   /db_xref="InterPro:IPR009683"
FT                   /db_xref="UniProtKB/TrEMBL:B5EWR2"
FT                   /protein_id="ACH52228.1"
FT                   /translation="MRGKGFLIIVLLGGIGGLGYRYLPSYYNPFAPLQLADPPGWITTF
FT                   KLQRLTPSQCRELLTAANQQGLISSQPVADSAGECPLSHVVRVRDFGQVKLSSSFLASC
FT                   PLALRSALFVEQQAKPLTETWMKRRLTRIEHLGSYACRNIYHRPDARRSEHASAEALDV
FT                   SGFQLSDGRKITVLRGWGREETGPWLRAMLNASCHYYGNGLGPDYNAAHANHFHLGMRG
FT                   YGVCR"
FT   gene            418430..419641
FT                   /locus_tag="SeAg_B0418"
FT   CDS_pept        418430..419641
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0418"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="identified by match to protein family HMM PF07690"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0418"
FT                   /db_xref="EnsemblGenomes-Tr:ACH51026"
FT                   /db_xref="GOA:B5EWR3"
FT                   /db_xref="InterPro:IPR001958"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B5EWR3"
FT                   /protein_id="ACH51026.1"
FT                   /translation="MESWKVNLISVWFGCFFTGLAISQILPFLPLYISQLGVSSHEALS
FT                   MWSGLTFSITFLISAIVSPMWGSLADRKGRKLMLLRASLGMAIAILLQAFATHVWQLFL
FT                   LRGIMGLTSGYIPNAMALVASQVPRERSGWALSTLSTAQISGVIGGPLMGGFVADHIGL
FT                   RAVFLITAILLVVSFLVTLFLIKEGVRPVIKKSERLSGKAVFASLPYPALVISLFFTTM
FT                   VIQLCNGSISPILALFIKSMMPDSNNIAFLSGLIASVPGISALISAPRLGKLGDRIGTE
FT                   RILMATLICAVLLFFAMSWVTTPFQLGLLRFLLGFADGAMLPAVQTLLVKYSSDQITGR
FT                   IFGYNQSFMYLGNVVGPLMGATVSAMAGFRWVFIATAAIVLINIGQLTLALRRRRNAQK
FT                   AKGQ"
FT   gene            419938..420198
FT                   /locus_tag="SeAg_B0419"
FT   CDS_pept        419938..420198
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0419"
FT                   /product="putative cytoplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0419"
FT                   /db_xref="EnsemblGenomes-Tr:ACH48579"
FT                   /db_xref="GOA:B5EWR4"
FT                   /db_xref="InterPro:IPR019732"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5EWR4"
FT                   /protein_id="ACH48579.1"
FT                   /translation="MKNLIAELLLKLAQKEEESKELVAQVEALEIIVTAMLRNMAQNEQ
FT                   EMLIRQVEGALEGVKPDASVPDHDTELLRQYVKKLLRHPRH"
FT   gene            420548..420868
FT                   /locus_tag="SeAg_B0420"
FT   CDS_pept        420548..420868
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0420"
FT                   /product="psiF repeat domain protein"
FT                   /note="identified by match to protein family HMM PF07769"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0420"
FT                   /db_xref="EnsemblGenomes-Tr:ACH52619"
FT                   /db_xref="InterPro:IPR011690"
FT                   /db_xref="UniProtKB/TrEMBL:B5EWR5"
FT                   /protein_id="ACH52619.1"
FT                   /translation="MKITLLVTLLFGLVFLTAVGATEKPLTPQQQRMTTCNQQATAQAL
FT                   KGDARKTYLSDCLKNSQSAPGEKSLTPQQQKMRECNVQATEQSLKGDDRSKFMSACLKK
FT                   AA"
FT   gene            420960..422072
FT                   /locus_tag="SeAg_B0421"
FT   CDS_pept        420960..422072
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0421"
FT                   /product="AdrA protein"
FT                   /note="identified by match to protein family HMM PF00990;
FT                   match to protein family HMM PF05230; match to protein
FT                   family HMM TIGR00254"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0421"
FT                   /db_xref="EnsemblGenomes-Tr:ACH52111"
FT                   /db_xref="GOA:B5EWR6"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR007894"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:B5EWR6"
FT                   /protein_id="ACH52111.1"
FT                   /translation="MFPKIMNDENFYRKAVEQAVAPPDPSDDRQRSGLRFARRIRLPRA
FT                   VGLGGMFLPVAAVLVSQPVFGGWWLLLVGWSFVWPHLAWQWAAKALDPLRQEIYNLKVD
FT                   AILSGMWIALMGVNMLPAAALFMMMSMNLMGAGGRRLFTVGMGLLLASCLVTLQLTGLP
FT                   VAMRSSSLEVTLSLPVIMLYPLLFAWVSYQTAIKLAEHKRRLQAMSSRDGMTGVYNRRH
FT                   WEILLRNEFDHSRRHHREATLLIIDIDHFKSINDTWGHDVGDEAIIALTRQLQITLRGS
FT                   DIIGRFGGDEFAVIMCGTPADSAITAMSRVHERLNTLRLPGAPQVMLRISVGVAPLTPQ
FT                   IGHYREWLKSADMALYKAKNAGRNRTEVAA"
FT   gene            complement(422087..422896)
FT                   /gene="proC"
FT                   /locus_tag="SeAg_B0422"
FT   CDS_pept        complement(422087..422896)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="proC"
FT                   /locus_tag="SeAg_B0422"
FT                   /product="pyrroline-5-carboxylate reductase"
FT                   /EC_number="1.5.1.2"
FT                   /note="identified by match to protein family HMM PF03446;
FT                   match to protein family HMM PF03807; match to protein
FT                   family HMM TIGR00112"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0422"
FT                   /db_xref="EnsemblGenomes-Tr:ACH49393"
FT                   /db_xref="GOA:B5EWR7"
FT                   /db_xref="InterPro:IPR000304"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR028939"
FT                   /db_xref="InterPro:IPR029036"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B5EWR7"
FT                   /protein_id="ACH49393.1"
FT                   /translation="MEKKIGFIGCGNMGKAILGGLIASGQVLPGQIWVYTPSPDKVAAL
FT                   HDQYGINAAQSAQEVAQVADIVFGAVKPGIMVKVLSEISSSLNKDSLVVSIAAGVTLDQ
FT                   LARALGHDRKIIRAMPNTPSLVNAGMTSVTPNALVTPEDTADVLNIFRCFGEAEVIAEP
FT                   MIHPVVGVSGSSPAYVFMFIEAMADAAVLGGMPRAQAYKFAAQAVMGSAKMVLETGKHP
FT                   GELKDMVCSPGGTTIEAVRVLEERGFRAAVIEAMTKCMEKSEALSKS"
FT   gene            422930..423079
FT                   /locus_tag="SeAg_B0423"
FT   CDS_pept        422930..423079
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0423"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0423"
FT                   /db_xref="EnsemblGenomes-Tr:ACH50833"
FT                   /db_xref="UniProtKB/TrEMBL:B5EWR8"
FT                   /protein_id="ACH50833.1"
FT                   /translation="MVSLTRIENGQKEKQHFDERQKRETIKDCISYGRHYDHLGGCGCV
FT                   SECH"
FT   gene            423036..423491
FT                   /locus_tag="SeAg_B0424"
FT   CDS_pept        423036..423491
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0424"
FT                   /product="protein YaiI"
FT                   /note="identified by match to protein family HMM PF02639"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0424"
FT                   /db_xref="EnsemblGenomes-Tr:ACH52735"
FT                   /db_xref="InterPro:IPR003791"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5EWR9"
FT                   /protein_id="ACH52735.1"
FT                   /translation="MTIWVDADACPNVIKEILYRAAERMQLPLILVANQALRVPPSRFI
FT                   RTLRVAAGFDVADNEIVRQCEAGDLVITADIPLAAEVLEKGAAALNPRGERYSDATIRE
FT                   RLTMRDFMDTLRASGVQTGGPNTLSPRDRQHFAAELDKWWLESQRKK"
FT   gene            423676..424221
FT                   /gene="aroK"
FT                   /locus_tag="SeAg_B0425"
FT   CDS_pept        423676..424221
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroK"
FT                   /locus_tag="SeAg_B0425"
FT                   /product="shikimate kinase"
FT                   /EC_number="2.7.1.71"
FT                   /note="identified by match to protein family HMM PF01202"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0425"
FT                   /db_xref="EnsemblGenomes-Tr:ACH50672"
FT                   /db_xref="GOA:B5EWS0"
FT                   /db_xref="InterPro:IPR000623"
FT                   /db_xref="InterPro:IPR023000"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR027544"
FT                   /db_xref="InterPro:IPR031322"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5EWS0"
FT                   /protein_id="ACH50672.1"
FT                   /translation="MMQPLYLVGPRGCGKTTIGMALAQATGFRFADTDRWLQSHVQMSV
FT                   ADIVEKEGWGGFRARETAALEAVSAPSTVVATGGGIILTEYNRRYMHRVGVVIYLCAPV
FT                   STLVNRLEAEPEADLRPTLTGKPLSEEVREVLEQRDALYRETAHYIIDATKAPAQVVSE
FT                   IIAALPPSTQRLQGDVYT"
FT   gene            424248..424439
FT                   /locus_tag="SeAg_B0426"
FT   CDS_pept        424248..424439
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0426"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0426"
FT                   /db_xref="EnsemblGenomes-Tr:ACH51443"
FT                   /db_xref="InterPro:IPR032303"
FT                   /db_xref="InterPro:IPR038462"
FT                   /db_xref="UniProtKB/TrEMBL:B5EWS1"
FT                   /protein_id="ACH51443.1"
FT                   /translation="MPTRPPYPREAYIVTIEKGTPGQTVTWYQLRADHPKPDSLISEHP
FT                   TAEEAMDAKKRYEDPDKS"
FT   gene            424690..425367
FT                   /locus_tag="SeAg_B0427"
FT   CDS_pept        424690..425367
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0427"
FT                   /product="aro operon protein"
FT                   /note="identified by match to protein family HMM PF07302"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0427"
FT                   /db_xref="EnsemblGenomes-Tr:ACH49344"
FT                   /db_xref="InterPro:IPR010843"
FT                   /db_xref="UniProtKB/TrEMBL:B5EWS2"
FT                   /protein_id="ACH49344.1"
FT                   /translation="MSASLAILTIGVVPMSEVLPLLTEYIDEQHITHHSLLGKMSREDV
FT                   MADYAVEPGDDPLLTLLNDNQIAHVSRQKVERDLQSVVEVLDNQGYDVIILMSTAAIKS
FT                   MAARNSILLEPLRIIPPLVASIVDGHQVGVIVPVAELLAAQEKKWQVLQMPPVYSLANP
FT                   VHGSEQQLIDAGQALLDQGADVIMLDCLGFHQRHRDILQQALDVPVLLSNVLIARLASE
FT                   LLV"
FT   gene            425438..425722
FT                   /locus_tag="SeAg_B0428"
FT   CDS_pept        425438..425722
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0428"
FT                   /product="protein YaiE"
FT                   /note="identified by match to protein family HMM PF06865"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0428"
FT                   /db_xref="EnsemblGenomes-Tr:ACH48989"
FT                   /db_xref="GOA:B5EWS3"
FT                   /db_xref="InterPro:IPR009664"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5EWS3"
FT                   /protein_id="ACH48989.1"
FT                   /translation="MLQSNEYFSGKVKSIGFTSSSTGRASVGVMAEGEYTFGTAEPEEM
FT                   TVVSGALKVLLPGTVEWKVYTAGEVFNVPGHSEFHLQVAEPTSYLCRYL"
FT   gene            complement(425765..426676)
FT                   /gene="rdgC"
FT                   /locus_tag="SeAg_B0429"
FT   CDS_pept        complement(425765..426676)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rdgC"
FT                   /locus_tag="SeAg_B0429"
FT                   /product="recombination-associated exonuclease RdgC"
FT                   /note="identified by match to protein family HMM PF04381"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0429"
FT                   /db_xref="EnsemblGenomes-Tr:ACH49069"
FT                   /db_xref="GOA:B5EWS4"
FT                   /db_xref="InterPro:IPR007476"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5EWS4"
FT                   /protein_id="ACH49069.1"
FT                   /translation="MLWFKNLMVYRLSRDITLRAEEMEKQLASMTFTPCGSQDMAKMGW
FT                   VPPMGSHSDALTHTANGQIIICARKEEKILPSPVIKQALEAKIQKLEADQGRKLKKTEK
FT                   DSLKDEVLHSLLPRAFSRFSQTMMWIDTVNGLIMVDCASAKKAEDTLALLRKSLGSLPV
FT                   VPLALENPIELTLTEWVRSGTVAQGFQLLDEAELKAMLEDGGVIRAKKQDLVSDEIAVH
FT                   IEAGKVVTKLALDWQQRIQFVMCDDGSIKRLKFCDELRDQNEDIDREDFAQRFDADFIL
FT                   MTGELAALIQSLVEGLGGEAQR"
FT   gene            426802..427710
FT                   /locus_tag="SeAg_B0430"
FT   CDS_pept        426802..427710
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0430"
FT                   /product="N-acetyl-D-glucosamine kinase"
FT                   /EC_number="2.7.1.59"
FT                   /note="identified by match to protein family HMM PF00480"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0430"
FT                   /db_xref="EnsemblGenomes-Tr:ACH48712"
FT                   /db_xref="GOA:B5EWS5"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="UniProtKB/TrEMBL:B5EWS5"
FT                   /protein_id="ACH48712.1"
FT                   /translation="MRIGIDLGGTKTEVIALDDAGEQRFRHRLPTPREDYQQTIETIAT
FT                   LVDMAEQATGQTGSVGIGIPGSLSPYTGVVKNANSTWLNGQPFDSDVSRRLKREVRLAN
FT                   DANCLAVSEAVDGAAAGAQTVFAVIIGTGCGAGVALNGRVHIGGNGTAGEWGHNPLPWM
FT                   DDDELRYCEEIPCYCGKQGCIETFISGTGFATDYQRLSGNALKGDEIIRLVDAQDAVAE
FT                   LALSRYELRLAKALSHVVNILDPDVIVLGGGMSNVERLYKTVPSLMKSFVFGGECETPV
FT                   RKARHGDSSGVRGAAWLWPLA"
FT   gene            complement(427730..428902)
FT                   /locus_tag="SeAg_B0431"
FT   CDS_pept        complement(427730..428902)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0431"
FT                   /product="protein AraJ"
FT                   /note="identified by match to protein family HMM PF07690"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0431"
FT                   /db_xref="EnsemblGenomes-Tr:ACH49202"
FT                   /db_xref="GOA:B5EWS6"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B5EWS6"
FT                   /protein_id="ACH49202.1"
FT                   /translation="MKKVIFSLALGTFGLGMAEFGIMGVLTELARDVGITIPAAGHMIS
FT                   FYAFGVVLGAPVMALFSSRFSLKHILLFLVTLCVMGNAIFTFSSSYLMLAVGRLVSGFP
FT                   HGAFFGVGAIVLSKIIRPGKVTAAVAGMVSGMTVANLVGIPVGTYLSQEFSWRYTFLLI
FT                   AVFNIAVLTAIFFWVPDIRDKAQGSLREQFHFLRSPAPWLIFAATMFGNAGVFAWFSYI
FT                   KPFMMYISGFSETSMTFIMMLVGLGMVLGNLLSGKLSGRYTPLRIAVVTDLVIVLSLMA
FT                   LFFFSGYKTASLTFAFICCAGLFALSAPLQILLLQNAKGGELLGAAGGQIAFNLGSAIG
FT                   AWCGGLMLTLGFAYHYVALPAALLSFSAMSSLLVYGRLKHKQPSVTPVAG"
FT   gene            complement(429075..432215)
FT                   /locus_tag="SeAg_B0432"
FT   CDS_pept        complement(429075..432215)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0432"
FT                   /product="exonuclease SbcC"
FT                   /note="identified by match to protein family HMM PF02463;
FT                   match to protein family HMM TIGR00618"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0432"
FT                   /db_xref="EnsemblGenomes-Tr:ACH48729"
FT                   /db_xref="GOA:B5EWS7"
FT                   /db_xref="InterPro:IPR004592"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B5EWS7"
FT                   /protein_id="ACH48729.1"
FT                   /translation="MKILSLRLKNLNSLKGEWKVDFTAEPFASNGLFAITGPTGAGKTT
FT                   LLDAICLALYHETPRLNTVSQSQNDLMTRDTAECLAEVEFEVKGEAWRAFWSQNRARNQ
FT                   PDGNLQAPRVELARCSDGKIFADKVKDKLEMIATLTGLDYERFTRSMLLSQGQFAAFLN
FT                   AKAKERAELLEELTGTEIYGQISAQVFEKHKSARLELEKLQAQASGVALLADEQLQQLE
FT                   ASLQALTDEEKRLLADQQGQQQHLHWLTRKNELHTELHARQQALYAAQEAREKAQPQLA
FT                   ALTLAQPARQLRPHWERIQEQTRAVERVRQHSDEVNARLQSAYRLRQRIRACAHRQFTQ
FT                   LNATGQRLKTWLAEHDGIRVWRSELAGWRALLTQQSHDRAQLSQWQQQLLSDTRQRDAL
FT                   PPLTLDLTPQALAEARALHTRQRPLRHRLAALQGQIIPKQKRQAQLQAAIARHHQEQMQ
FT                   YTQRLADKRLSYKTKAQELADVRTICEQEARIKDLESQRAHLQSGQPCPLCGSTTHPAI
FT                   AAYQALELSANQTRRDALEKEVKTLAEEGAALRGQLDALTQQLQRDESEAQSLLQEEQA
FT                   LTEEWQTLCATLGVQLQPQEDLAGWLTAAEEHEQQLDQLSQRHALQTQIAAHTEQVARF
FT                   TAQIAQRQASLTADLAQYTLSLPAPEDEASWLNERADEAKIWQQRQTEFADLQTQIDRL
FT                   APLLETLPQTDTADSDDDVPLDNWRQAHDECVSLQSQLQTLQEQTTQEQQRAAEAIAHF
FT                   DAALKNSPFDSQATFLAALLDEETVTRLEKQQQTLESQLQQAKALSAQSTQALADHQQQ
FT                   PPAGLDPTCTAEQLAQRLAQLAQQLRENTTRQGEIRQQIKQDADNRQRQRALMAEMKQA
FT                   SQQVEDWGYLNALIGSKEGDKFRKFAQGLTLDNLVWLANHQLTRLHGRYLLQRKASDAL
FT                   ELEVVDTWQADAVRDTRTLSGGESFLVSLALALALSDLVSHKTRIDSLFLDEGFGTLDS
FT                   ETLDAALDALDALNASGKTIGVISHVEAMKERIPVQIKVKKINGLGYSKLDKAFAVE"
FT   gene            complement(432212..433414)
FT                   /locus_tag="SeAg_B0433"
FT   CDS_pept        complement(432212..433414)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0433"
FT                   /product="ATP-dependent dsDNA exonuclease"
FT                   /note="identified by match to protein family HMM PF00149;
FT                   match to protein family HMM TIGR00619"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0433"
FT                   /db_xref="EnsemblGenomes-Tr:ACH50409"
FT                   /db_xref="GOA:B5EWS8"
FT                   /db_xref="InterPro:IPR004593"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR026843"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="InterPro:IPR041796"
FT                   /db_xref="UniProtKB/TrEMBL:B5EWS8"
FT                   /protein_id="ACH50409.1"
FT                   /translation="MRILHTSDWHLGQNFYSKSRAAEHQAFLDWLLETAQAHQVDAIIV
FT                   AGDIFDTGSPPSYARELYNRFVVNLQQTGCHLVVLAGNHDSVATLNESRDILAFLNTTV
FT                   IASAGYAPRLLHRRDGSPGAVLCPIPFLRPRDIITSQAGLSGSEKQQQLLHAIADYYQQ
FT                   QYQEACLLRGERKLPVIATGHLTTVGASKSDAVRDIYIGTLDAFPAQHFPPADYIALGH
FT                   IHRAQCVGGTEHIRYCGSPIALSFDECGKSKCVHLVTFDQGKWQSTESLAVPVTQPLAV
FT                   LKGDLASITEQLEQWRGVEQSPPVWLDIEITTDDYLHNIQRRIQTLTESLPVEVLLVRR
FT                   SREQRERSLANERRETLSELSVEEVFARRLALEALDPPQRERLNQLFSSTLYALNEEHE
FT                   A"
FT   gene            complement(433457..433588)
FT                   /locus_tag="SeAg_B0434"
FT   CDS_pept        complement(433457..433588)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0434"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0434"
FT                   /db_xref="EnsemblGenomes-Tr:ACH49626"
FT                   /db_xref="UniProtKB/TrEMBL:B5EWS9"
FT                   /protein_id="ACH49626.1"
FT                   /translation="MRQIYDRFMKKKGGIDSMLMIYDTGETVHYRVPAVNCAQKWRG"
FT   gene            433630..434319
FT                   /gene="phoB"
FT                   /locus_tag="SeAg_B0435"
FT   CDS_pept        433630..434319
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phoB"
FT                   /locus_tag="SeAg_B0435"
FT                   /product="phosphate regulon transcriptional regulatory
FT                   protein PhoB"
FT                   /note="identified by match to protein family HMM PF00072;
FT                   match to protein family HMM PF00486; match to protein
FT                   family HMM TIGR02154"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0435"
FT                   /db_xref="EnsemblGenomes-Tr:ACH51908"
FT                   /db_xref="GOA:B5EWT0"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR011879"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:B5EWT0"
FT                   /protein_id="ACH51908.1"
FT                   /translation="MARRILVVEDEAPIREMVCFVLEQNGFQPVEAEDYDSAVNKLNEP
FT                   WPDLILLDWMLPGGSGLQFIKHLKREALTRDIPVVMLTARGEEEDRVRGLETGADDYIT
FT                   KPFSPKELVARIKAVMRRISPMAVEEVIEMQGLSLDPGSHRVMTGGSPLDMGPTEFKLL
FT                   HFFMTHPERVYSREQLLNHVWGTNVYVEDRTVDVHIRRLRKALEHSGHDRMVQTVRGTG
FT                   YRFSTRF"
FT   gene            434389..435684
FT                   /gene="phoR"
FT                   /locus_tag="SeAg_B0436"
FT   CDS_pept        434389..435684
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phoR"
FT                   /locus_tag="SeAg_B0436"
FT                   /product="phosphate regulon sensor protein PhoR"
FT                   /EC_number="2.7.3.-"
FT                   /note="identified by match to protein family HMM PF00512;
FT                   match to protein family HMM PF00989; match to protein
FT                   family HMM PF02518; match to protein family HMM TIGR02966"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0436"
FT                   /db_xref="EnsemblGenomes-Tr:ACH51286"
FT                   /db_xref="GOA:B5EWT1"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR014310"
FT                   /db_xref="InterPro:IPR021766"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B5EWT1"
FT                   /protein_id="ACH51286.1"
FT                   /translation="MLERLSWKRLVLELVLCCIPALILSAFFGYLPWFLLAAVTGLLVW
FT                   HFWNLLRLSWWLWVDRSMTPPPGRGSWEPLLYGLHQMQLRNKKRRRELGNLIKRFRSGA
FT                   ESLPDAVVLTTEEGGIFWCNGLAQQILGLRWPDDNGQNILNLLRYPEFTQYLKTRDFTR
FT                   PLHLVLNTGRHLEIRVMPYTDKQLLMVARDVTQMHQLEGARRNFFANVSHELRTPLTVL
FT                   QGYLEMMQEQALEGATREKALHTMREQTYRMEGLVKQLLTLSKIEAAPALLLNEKVDVP
FT                   MMLRVVEREAQTLSQQKHTFTFEVDDSLSVLGNEEQLRSAISNLVYNAVNHTPAGTHIT
FT                   VSWRRAAHGAEFCIQDNGPGIAAEHIPRLTERFYRVDKARSRQTGGSGLGLAIVKHALN
FT                   HHESRLEIDSSPGKGTRFSFVLPERLIAKNSD"
FT   gene            complement(435897..436046)
FT                   /locus_tag="SeAg_B0437"
FT   CDS_pept        complement(435897..436046)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0437"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0437"
FT                   /db_xref="EnsemblGenomes-Tr:ACH52980"
FT                   /db_xref="UniProtKB/TrEMBL:B5EWT2"
FT                   /protein_id="ACH52980.1"
FT                   /translation="MPFPEDYKAAFFINFSGKSSRTDAAKNCFSIYRANAVVMTAPEAQ
FT                   FKRL"
FT   gene            436093..437412
FT                   /gene="brnQ"
FT                   /locus_tag="SeAg_B0438"
FT   CDS_pept        436093..437412
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="brnQ"
FT                   /locus_tag="SeAg_B0438"
FT                   /product="branched-chain amino acid transport system II
FT                   carrier protein"
FT                   /note="identified by match to protein family HMM PF05525;
FT                   match to protein family HMM TIGR00796"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0438"
FT                   /db_xref="EnsemblGenomes-Tr:ACH52191"
FT                   /db_xref="GOA:B5EWT3"
FT                   /db_xref="InterPro:IPR004685"
FT                   /db_xref="UniProtKB/TrEMBL:B5EWT3"
FT                   /protein_id="ACH52191.1"
FT                   /translation="MTHQLKSRDIIALGFMTFALFVGAGNIIFPPMVGLQAGEHVWTAA
FT                   IGFLITAVGLPVLTVVALAKVGGGVDSLSTPIGKVAGLLLATVCYLAVGPLFATPRTAT
FT                   VSFEVGIAPLTGDSAMPLLIYSVVYFAIVILVSLYPGKLLDTVGNFLAPLKIIALVILS
FT                   VAAIIWPAGPISNALDAYQNAAFSNGFVNGYLTMDTLGAMVFGIVIVNAARSRGVTEAR
FT                   LLTRYTVWAGLMAGVGLTLLYLALFRLGSDSATLVDQSANGAAILHAYVQHTFGGAGSF
FT                   LLAALIFIACLVTAVGLTCACAEFFAQYIPLSYRTLVFILGGFSMVVSNLGLSHLIQIS
FT                   IPVLTAIYPPCIALVVLSFTRSWWHNSTRIIAPAMFISLLFGILDGIKASAFGDMLPAW
FT                   SQRLPLAEQGLAWLMPTVVMVILAIIWDRAAGRQVTSSAH"
FT   gene            437427..438857
FT                   /locus_tag="SeAg_B0439"
FT   CDS_pept        437427..438857
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0439"
FT                   /product="proline-specific permease ProY"
FT                   /note="identified by match to protein family HMM PF00324"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0439"
FT                   /db_xref="EnsemblGenomes-Tr:ACH50129"
FT                   /db_xref="GOA:B5EWT4"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004840"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniProtKB/TrEMBL:B5EWT4"
FT                   /protein_id="ACH50129.1"
FT                   /translation="MYTTGLNAPWFFIVLIGQKLMESNNKLKRGLSTRHIRFMALGSAI
FT                   GTGLFYGSADAIKMAGPSVLLAYIIGGVAAYIIMRALGEMSVHNPAASSFSRYAQENLG
FT                   PLAGYITGWTYCFEILIVAIADVTAFGIYMGVWFPAVPHWIWVLSVVLIICAINLMSVK
FT                   VFGELEFWFSFFKVATIIIMIVAGIGIIVWGIGNGGQPTGIHNLWSNGGFFSNGWLGMI
FT                   MSLQMVMFAYGGIEIIGITAGEAKDPEKSIPRAINSVPMRILVFYVGTLFVIMSIYPWN
FT                   QVGTNGSPFVLTFQHMGITFAASILNFVVLTASLSAINSDVFGVGRMLHGMAEQGSAPK
FT                   VFAKTSRRGIPWVTVLVMTIALLFAVYLNYIMPENVFLVIASLATFATVWVWIMILLSQ
FT                   IAFRRRLPPEEVKALKFKVPGGVVTTIAGLIFLVFIIALIGYHPDTRISLYVGFAWIVL
FT                   LLIGWIFKRRRDRQLAQA"
FT   gene            439019..440836
FT                   /locus_tag="SeAg_B0440"
FT   CDS_pept        439019..440836
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0440"
FT                   /product="maltodextrin glucosidase"
FT                   /EC_number="3.2.1.20"
FT                   /note="identified by match to protein family HMM PF00128"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0440"
FT                   /db_xref="EnsemblGenomes-Tr:ACH50611"
FT                   /db_xref="GOA:B5EWT5"
FT                   /db_xref="InterPro:IPR004185"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR017069"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:B5EWT5"
FT                   /protein_id="ACH50611.1"
FT                   /translation="MLNAWHLPVAPFVKQHNDKLTITLWLSGENPPSRVTLRSEFDNEE
FT                   ISLAMRKQRRQPQPGVTAWRATLNIALGQPRRRYSFKLLWHDRQLWFTPQGFNRFPPAR
FT                   LEQFAVDVPDSGPQWVADQIFYQIFPDRFARSATREADQDRVYYHHAAGQEIVLRDWDD
FT                   PLTPLAGGSTFYGGCLNGICEKLPYLKKLGVTALYLNPVFTAPSVHKYDTEDYRHVDPQ
FT                   FGGDRALLRLRRETQAQGMRLVLDGVFNHSGDSHAWFDRHNRSTGGACHHPDSPWRDWY
FT                   SFSPQGVALDWLGYPSLPKLDYQSETLVDEIYRGEDSIVRHWLKAPWNMDGWRLDVVHM
FT                   LGEAGGARHNLQHVAGITRAAKEAQPEAYIVGEHFGDARQWLQADAEDAAMNYRGFTFP
FT                   LWGFLANTDIAYEPQHIDARTCIAWMDNYRAGLSHQQQLRMFNQLDSHDTARFKTLLGK
FT                   DAARLPLAVVWLFTWPGVPCIYYGDEVGVDGANDPMCRKPFPWDERKQDGNLLALYQRM
FT                   AKLRQRSLALRRGGCQALYAEGDVVVFVRVYQQQRALVAINRGEACEVALEALPLLNVA
FT                   GWQCKTGSGDIREGRLSLPAISATVWMNR"
FT   gene            complement(440908..441510)
FT                   /locus_tag="SeAg_B0441"
FT   CDS_pept        complement(440908..441510)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0441"
FT                   /product="peroxiredoxin-2"
FT                   /EC_number="1.11.1.15"
FT                   /note="identified by match to protein family HMM PF00578;
FT                   match to protein family HMM PF08534"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0441"
FT                   /db_xref="EnsemblGenomes-Tr:ACH49697"
FT                   /db_xref="GOA:B5EWT6"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR019479"
FT                   /db_xref="InterPro:IPR024706"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B5EWT6"
FT                   /protein_id="ACH49697.1"
FT                   /translation="MVLVTRQAPDFTAAAVLGSGEIVDKFNFKQHTNGKTTVLFFWPMD
FT                   FTFVCPSELIAFDKRYEEFQKRGVEVVGVSFDSEFVHNAWRNTPVDKGGIGPVKYAMVA
FT                   DVKREIQKAYGIEHPDEGVALRGSFLIDANGIVRHQVVNDLPLGRNIDEMLRMVDALQF
FT                   HEEHGDVCPAQWEKGKEGMNASPDGVAKYLAENISSL"
FT   gene            complement(441720..442301)
FT                   /gene="acpH"
FT                   /locus_tag="SeAg_B0442"
FT   CDS_pept        complement(441720..442301)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="acpH"
FT                   /locus_tag="SeAg_B0442"
FT                   /product="[acyl-carrier-protein] phosphodiesterase"
FT                   /EC_number="3.1.4.14"
FT                   /note="identified by match to protein family HMM PF04336"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0442"
FT                   /db_xref="EnsemblGenomes-Tr:ACH50211"
FT                   /db_xref="GOA:B5EWT7"
FT                   /db_xref="InterPro:IPR007431"
FT                   /db_xref="InterPro:IPR023491"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5EWT7"
FT                   /protein_id="ACH50211.1"
FT                   /translation="MNFLAHLHLAHLADSSLSGNLLADFVRGNPATHYPPDVVEGIYMH
FT                   RRIDVMTDNLPEVREAREWFRHETRRVASITLDVMWDHFLSRHWTQISPDFPLQAFVGY
FT                   AHAQVATILPDSPPRFVNLNDYLWSEKWLERYRDMDFIQNVLNGMANRRPRLDALRDSW
FT                   YDLDAHYDALEERFWHFYPRMMAQAARKAL"
FT   gene            442395..443459
FT                   /gene="queA"
FT                   /locus_tag="SeAg_B0443"
FT   CDS_pept        442395..443459
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="queA"
FT                   /locus_tag="SeAg_B0443"
FT                   /product="S-adenosylmethionine:tRNA
FT                   ribosyltransferase-isomerase"
FT                   /EC_number="5.-.-.-"
FT                   /note="identified by match to protein family HMM PF02547;
FT                   match to protein family HMM TIGR00113"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0443"
FT                   /db_xref="EnsemblGenomes-Tr:ACH49541"
FT                   /db_xref="GOA:B5EWT8"
FT                   /db_xref="InterPro:IPR003699"
FT                   /db_xref="InterPro:IPR036100"
FT                   /db_xref="InterPro:IPR042118"
FT                   /db_xref="InterPro:IPR042119"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5EWT8"
FT                   /protein_id="ACH49541.1"
FT                   /translation="MRVTDFSFELPESLIAHYPQPERSRCRLLSLEGPTGALTHGTFTD
FT                   LLDKLNPGDLLVFNNTRVIPARLFGRKASGGKIEVLVERMLDDKRILAHIRASKAPKPG
FT                   TELLLGDDESIHATMTARHGALFEVEFNDPRPVLDILNAIGHMPLPPYIDRPDEDADRE
FT                   LYQTVYSEKPGAVAAPTAGLHFDEPLLAALREKGVEMAFVTLHVGAGTFQPVRVDTIED
FT                   HIMHSEYAEVPQEVVDAVLAAKARGNRVIAVGTTSVRSLESAAQAAKRDLIEPFFGDTQ
FT                   IFIYPGYQYKVIDALITNFHLPESTLIMLVSAFAGYQHTMNAYKTAVEQKYRFFSYGDA
FT                   MFITYNPQAISERP"
FT   gene            443656..444783
FT                   /gene="tgt"
FT                   /locus_tag="SeAg_B0444"
FT   CDS_pept        443656..444783
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tgt"
FT                   /locus_tag="SeAg_B0444"
FT                   /product="queuine tRNA-ribosyltransferase"
FT                   /EC_number="2.4.2.29"
FT                   /note="identified by match to protein family HMM PF01702;
FT                   match to protein family HMM TIGR00430; match to protein
FT                   family HMM TIGR00449"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0444"
FT                   /db_xref="EnsemblGenomes-Tr:ACH49943"
FT                   /db_xref="GOA:B5EWT9"
FT                   /db_xref="InterPro:IPR002616"
FT                   /db_xref="InterPro:IPR004803"
FT                   /db_xref="InterPro:IPR036511"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5EWT9"
FT                   /protein_id="ACH49943.1"
FT                   /translation="MKFELDTTDGRARRGRLVFDRGVVETPAFMPVGTYGTVKGMTPEE
FT                   VEATGAQIILGNTFHLWLRPGQEIMKLHGDLHDFMQWKGPILTDSGGFQVFSLGDIRKI
FT                   TEQGVHFRNPINGDPIFLDPEKSMEIQYDLGSDIVMIFDECTPYPADWDYAKRSMEMSL
FT                   RWAKRSRDRFDSLGNKNALFGIIQGSVYEDLRDISVKGLVEIGFDGYAVGGLAVGEPKA
FT                   DMHRILEHVCPQIPADKPRYLMGVGKPEDLVEGVRRGIDMFDCVMPTRNARNGHLFVTD
FT                   GVVKIRNAKHKSDTSPLDAECDCYTCRNYSRAYLHHLDRCNEILGARLNTIHNLRYYQR
FT                   LMAGLRKAIEEGKLESFVTEFYQRQGRPVPPLNVD"
FT   gene            444806..445138
FT                   /gene="yajC"
FT                   /locus_tag="SeAg_B0445"
FT   CDS_pept        444806..445138
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yajC"
FT                   /locus_tag="SeAg_B0445"
FT                   /product="preprotein translocase, YajC subunit"
FT                   /note="identified by match to protein family HMM PF02699;
FT                   match to protein family HMM TIGR00739"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0445"
FT                   /db_xref="EnsemblGenomes-Tr:ACH52843"
FT                   /db_xref="GOA:B5EWU0"
FT                   /db_xref="InterPro:IPR003849"
FT                   /db_xref="UniProtKB/TrEMBL:B5EWU0"
FT                   /protein_id="ACH52843.1"
FT                   /translation="MSFFISDAVAATGAPAQGSPMSLILMLVVFGLIFYFMILRPQQKR
FT                   TKEHKKLMDSIAKGDEVLTNGGLVGRVTKVAEAGYIAIALNDTTEVVIKRDFVAAVLPK
FT                   GTMKAL"
FT   gene            445166..447013
FT                   /gene="secD"
FT                   /locus_tag="SeAg_B0446"
FT   CDS_pept        445166..447013
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secD"
FT                   /locus_tag="SeAg_B0446"
FT                   /product="protein-export membrane protein SecD"
FT                   /note="identified by match to protein family HMM PF02355;
FT                   match to protein family HMM PF07549; match to protein
FT                   family HMM TIGR00916; match to protein family HMM
FT                   TIGR01129"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0446"
FT                   /db_xref="EnsemblGenomes-Tr:ACH48640"
FT                   /db_xref="GOA:B5EWU1"
FT                   /db_xref="InterPro:IPR005791"
FT                   /db_xref="InterPro:IPR022645"
FT                   /db_xref="InterPro:IPR022646"
FT                   /db_xref="InterPro:IPR022813"
FT                   /db_xref="InterPro:IPR027398"
FT                   /db_xref="UniProtKB/TrEMBL:B5EWU1"
FT                   /protein_id="ACH48640.1"
FT                   /translation="MLNRYPLWKYIMLVVVIIVGLLYALPNLYGEDPAVQITGVRGVAA
FT                   SEQTLIQVQKTLQEEKIPAKSVALEEGAILARFDTTDTQLRAREALMSVLGDKYVVALN
FT                   LAPATPRWLAAIHADPMKLGLDLRGGVHFLMEVDMDTALGKLQEQNIDSLRSDLREKGI
FT                   PYTTVRKENNYGLSITFRDSKARDEAIAYLTPRHRDLVISSQGGNQLRAVMTDARLSEA
FT                   REYAVQQNINILRNRVNQLGVAEPVVQRQGADRIVVELPGIQDTARAKEILGATATLEF
FT                   RLVNTNVDQAAAAAGRVPGDSEVKQTREGQPVVLYKRVILTGDHITDSTSSQDEYNQPQ
FT                   VNISLDSAGGNIMSNFTKDNIGKPMATLFVEYKDSGKKDANGRAVLVKQEEVINIANIQ
FT                   SRLGNSFRITGISNPNEARQLSLLLRAGALIAPIQIVEERTIGPTLGMQNIKQGLEACL
FT                   AGLVVSILFMIFFYKKFGLIATSALVANLVLIVGIMSLLPGATLSMPGIAGIVLTLAVA
FT                   VDANVLINERIKEELSNGRTVQQAINEGYAGAFSSIFDANITTLIKVIILYAVGTGAIK
FT                   GFAITTGIGVATSMFTAIIGTRAIVNLLYGGKRVTKLSI"
FT   gene            447024..447995
FT                   /gene="secF"
FT                   /locus_tag="SeAg_B0447"
FT   CDS_pept        447024..447995
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secF"
FT                   /locus_tag="SeAg_B0447"
FT                   /product="protein-export membrane protein SecF"
FT                   /note="identified by match to protein family HMM PF02355;
FT                   match to protein family HMM PF07549; match to protein
FT                   family HMM TIGR00916; match to protein family HMM
FT                   TIGR00966"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0447"
FT                   /db_xref="EnsemblGenomes-Tr:ACH51931"
FT                   /db_xref="GOA:B5EWU2"
FT                   /db_xref="InterPro:IPR005665"
FT                   /db_xref="InterPro:IPR022645"
FT                   /db_xref="InterPro:IPR022646"
FT                   /db_xref="InterPro:IPR022813"
FT                   /db_xref="UniProtKB/TrEMBL:B5EWU2"
FT                   /protein_id="ACH51931.1"
FT                   /translation="MAQEYTVEQLNHGRKVYDFMRWDFWAFGISGLLLIAAIVIMGVRG
FT                   FNWGLDFTGGTVIEITLEKPAEMDVMREALQKAGYEEPQLQNFGSSHDIMVRMPPTEGE
FT                   TGGQVLGSKVVTIINEATNQNAAVKRIEFVGPSVGADLAQTGAMALLVALISILVYVGF
FT                   RFEWRLAAGVVIALAHDVIITLGILSLFHIEIDLTIVASLMSVIGYSLNDSIVVSDRIR
FT                   ENFRKIRRGTPYEIFNVSLTQTLHRTLITSGTTLVVILMLYLFGGPVLEGFSLTMLIGV
FT                   SIGTASSIYVASALALKLGMKREHMLQQKVEKEGADQPSILP"
FT   gene            complement(447974..448090)
FT                   /locus_tag="SeAg_B0449"
FT   CDS_pept        complement(447974..448090)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0449"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0449"
FT                   /db_xref="EnsemblGenomes-Tr:ACH51566"
FT                   /db_xref="UniProtKB/TrEMBL:B5EWU3"
FT                   /protein_id="ACH51566.1"
FT                   /translation="MIVPHAIEFILDNKKPQHPAMLRLFSVMLTPAYGRMDG"
FT   gene            448089..448436
FT                   /locus_tag="SeAg_B0448"
FT   CDS_pept        448089..448436
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0448"
FT                   /product="HNH endonuclease"
FT                   /note="identified by match to protein family HMM PF01844"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0448"
FT                   /db_xref="EnsemblGenomes-Tr:ACH51340"
FT                   /db_xref="GOA:B5EWU4"
FT                   /db_xref="InterPro:IPR002711"
FT                   /db_xref="InterPro:IPR003615"
FT                   /db_xref="UniProtKB/TrEMBL:B5EWU4"
FT                   /protein_id="ACH51340.1"
FT                   /translation="MAIIPKNYARLESGYREKALKLFPWVCGRCSREFVYSNLRELTVH
FT                   HIDHDHTNNPEDGSNWELLCLYCHDHEHSKYTEADQYGSTVIAGEDAQKDVGEATYNPF
FT                   ADLKAMMNKKK"
FT   gene            448830..448982
FT                   /pseudo
FT                   /locus_tag="SeAg_B0450"
FT                   /note="conserved hypothetical protein; this gene contains a
FT                   frame shift which may be the result of sequencing error"
FT   gene            complement(449066..449929)
FT                   /locus_tag="SeAg_B0451"
FT   CDS_pept        complement(449066..449929)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0451"
FT                   /product="nucleoside-specific channel-forming protein tsx"
FT                   /note="identified by match to protein family HMM PF03502"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0451"
FT                   /db_xref="EnsemblGenomes-Tr:ACH51507"
FT                   /db_xref="GOA:B5EXF3"
FT                   /db_xref="InterPro:IPR003055"
FT                   /db_xref="InterPro:IPR018013"
FT                   /db_xref="InterPro:IPR036777"
FT                   /db_xref="UniProtKB/TrEMBL:B5EXF3"
FT                   /protein_id="ACH51507.1"
FT                   /translation="MKKTLLAVSAALALTSSFTANAAENDQPQYLSDWWHQSVNVVGSY
FT                   HTRFSPKLNNDVYLEYEAFAKKDWFDFYGYIDIPKTFDWGNGNDKGIWSDGSPLFMEIE
FT                   PRFSIDKLTGADLSFGPFKEWYFANNYIYDMGDNKASRQSTWYMGLGTDIDTGLPMGLS
FT                   LNVYAKYQWQNYGASNENEWDGYRFKVKYFVPITDLWGGKLSYIGFTNFDWGSDLGDDP
FT                   NRTSNSIASSHILALNYDHWHYSVVARYFHNGGQWQNGAKLNWGDGDFSAKSTGWGGYL
FT                   VVGYNF"
FT   gene            complement(450229..450726)
FT                   /locus_tag="SeAg_B0452"
FT   CDS_pept        complement(450229..450726)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0452"
FT                   /product="lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0452"
FT                   /db_xref="EnsemblGenomes-Tr:ACH51018"
FT                   /db_xref="InterPro:IPR021658"
FT                   /db_xref="InterPro:IPR037125"
FT                   /db_xref="UniProtKB/TrEMBL:B5EXF4"
FT                   /protein_id="ACH51018.1"
FT                   /translation="MSLTACAPQSEVRQMHQSISTLNKEMTQLNQETVKITQQNKLNAE
FT                   STRGVYLLPGANTPARLESQIGTLRMTLLEITPVADGAHATLRIQGESRDPLPAFSATV
FT                   EYGQLQGTTENYQEVNAQSLLVNAPASLLAPSDVNISLPLKGITPAQLGFIRIHDIQPV
FT                   NQ"
FT   gene            450801..450947
FT                   /locus_tag="SeAg_B0453"
FT   CDS_pept        450801..450947
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0453"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0453"
FT                   /db_xref="EnsemblGenomes-Tr:ACH52542"
FT                   /db_xref="UniProtKB/TrEMBL:B5EXF5"
FT                   /protein_id="ACH52542.1"
FT                   /translation="MVVRYTHKGTDPLSQKRSAFVVAPVQGKIVFSKSSGQDAVCIAHF
FT                   VSP"
FT   gene            450920..451369
FT                   /gene="nrdR"
FT                   /locus_tag="SeAg_B0454"
FT   CDS_pept        450920..451369
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nrdR"
FT                   /locus_tag="SeAg_B0454"
FT                   /product="transcriptional regulator, NrdR family"
FT                   /note="identified by match to protein family HMM PF03477;
FT                   match to protein family HMM TIGR00244"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0454"
FT                   /db_xref="EnsemblGenomes-Tr:ACH52016"
FT                   /db_xref="GOA:B5EXF6"
FT                   /db_xref="InterPro:IPR003796"
FT                   /db_xref="InterPro:IPR005144"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5EXF6"
FT                   /protein_id="ACH52016.1"
FT                   /translation="MHCPFCFAVDTKVIDSRLVGEGSSVRRRRQCLVCNERFTTFEVAE
FT                   LVMPRVIKSNDVREPFNEDKLRSGMLRALEKRPVSADDVEMALNHIKSQLRATGEREVP
FT                   SKMIGNLVMEQLKKLDKVAYIRFASVYRSFEDIKDFGEEIARLQD"
FT   gene            451373..452476
FT                   /gene="ribD"
FT                   /locus_tag="SeAg_B0455"
FT   CDS_pept        451373..452476
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ribD"
FT                   /locus_tag="SeAg_B0455"
FT                   /product="riboflavin biosynthesis protein RibD"
FT                   /EC_number="3.5.4.26"
FT                   /EC_number="1.1.1.193"
FT                   /note="identified by match to protein family HMM PF00383;
FT                   match to protein family HMM PF01872; match to protein
FT                   family HMM TIGR00227; match to protein family HMM
FT                   TIGR00326"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0455"
FT                   /db_xref="EnsemblGenomes-Tr:ACH49945"
FT                   /db_xref="GOA:B5EXF7"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR002734"
FT                   /db_xref="InterPro:IPR004794"
FT                   /db_xref="InterPro:IPR011549"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR024072"
FT                   /db_xref="UniProtKB/TrEMBL:B5EXF7"
FT                   /protein_id="ACH49945.1"
FT                   /translation="MQDEFYMARALKLAQRGRFTTHPNPNVGCVIVNNGDIVGEGYHQR
FT                   AGDPHAEVHALRMAGAKAKGATAYVTLEPCSHHGRTPPCCDALIAAGVARVVAAMQDPN
FT                   PQVAGRGLYRLQQAGIAVSHGLMMSEAEALNKGFLKRMRTGFPYLQLKLGTSVDGRTAM
FT                   ASGESQWITSPQARRDVQRLRAQSHAILTSSATVLADDPALTVRWAELDASTQASYPQE
FT                   NLRQPVRIVIDSQNRVTPAHRIVQQPGETWIARTQEDSRAWPDAVRTISVPAHNGHLDL
FT                   VVLMMQLGRQQINSIWVEAGPGLAGALLQAGLVDELIVYVAPKLLGTQARGLCELPGLE
FT                   KLADAPQFTFSEIRHVGPDVCLHMVSA"
FT   gene            452565..453035
FT                   /gene="ribH"
FT                   /locus_tag="SeAg_B0456"
FT   CDS_pept        452565..453035
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ribH"
FT                   /locus_tag="SeAg_B0456"
FT                   /product="6,7-dimethyl-8-ribityllumazine synthase"
FT                   /EC_number="6.3.3.-"
FT                   /note="identified by match to protein family HMM PF00885;
FT                   match to protein family HMM TIGR00114"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0456"
FT                   /db_xref="EnsemblGenomes-Tr:ACH49604"
FT                   /db_xref="GOA:B5EXF8"
FT                   /db_xref="InterPro:IPR002180"
FT                   /db_xref="InterPro:IPR034964"
FT                   /db_xref="InterPro:IPR036467"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5EXF8"
FT                   /protein_id="ACH49604.1"
FT                   /translation="MNIIKANVAAPDARVAITIARFNQFINDSLLDGAVDALTRIGQVK
FT                   DDNITVVWVPGAYELPLATEALAKSGKYDAVVALGTVIRGGTAHFEYVAGGASNGLASV
FT                   AQDSGVPVAFGVLTTESIEQAIERAGTKAGNKGAEAALTALEMINVLKAIKA"
FT   gene            453056..453475
FT                   /gene="nusB"
FT                   /locus_tag="SeAg_B0457"
FT   CDS_pept        453056..453475
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nusB"
FT                   /locus_tag="SeAg_B0457"
FT                   /product="transcription termination/antitermination factor
FT                   NusB"
FT                   /note="identified by match to protein family HMM PF01029;
FT                   match to protein family HMM TIGR01951"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0457"
FT                   /db_xref="EnsemblGenomes-Tr:ACH50916"
FT                   /db_xref="GOA:B5EXF9"
FT                   /db_xref="InterPro:IPR006027"
FT                   /db_xref="InterPro:IPR011605"
FT                   /db_xref="InterPro:IPR035926"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5EXF9"
FT                   /protein_id="ACH50916.1"
FT                   /translation="MKPAARRRARECAVQALYSWQLSQNDIADVEYQFLAEQDVKDVDV
FT                   LYFRELLSGVATNSAYLDGLMKPYLSRLLEELGQVEKAVLRIALFELSKRSDVPYKVAI
FT                   NEAIELAKTFGAEDSHKFVNGVLDKAAPVIRPNKK"
FT   gene            453557..454537
FT                   /gene="thiL"
FT                   /locus_tag="SeAg_B0458"
FT   CDS_pept        453557..454537
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiL"
FT                   /locus_tag="SeAg_B0458"
FT                   /product="thiamine-monophosphate kinase"
FT                   /EC_number="2.7.4.16"
FT                   /note="identified by match to protein family HMM PF02769;
FT                   match to protein family HMM TIGR01379"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0458"
FT                   /db_xref="EnsemblGenomes-Tr:ACH50617"
FT                   /db_xref="GOA:B5EXG0"
FT                   /db_xref="InterPro:IPR006283"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="UniProtKB/TrEMBL:B5EXG0"
FT                   /protein_id="ACH50617.1"
FT                   /translation="MACGEFSLIARYFDRVRSSRLDVETGIGDDCALLNIPEKQTLAIS
FT                   TDTLVAGIHFLPDIDPADLAYKALAVNLSDLAAMGADPAWLTLALTLPDVDEAWLAAFS
FT                   DSLFEQLDYYDMQLIGGDTTRGPLSMTLGIHGLVPVGRALKRSGAKPGDWIYVTGTLGD
FT                   SAAGLAILRGDFRVGSWGDADYLVKRHLRPTPRILQGQALRDLASSAIDLSDGLISDLG
FT                   HILQASNCGARIDLEALPDSEELWGHANDPEQKLRWMLSGGEDYELCFTVPELNRGALD
FT                   VALGHLGVPFTCIGQMTADIEGIAFVRDGEPVTFDWKGYDHFATP"
FT   gene            454524..455030
FT                   /gene="pgpA"
FT                   /locus_tag="SeAg_B0459"
FT   CDS_pept        454524..455030
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pgpA"
FT                   /locus_tag="SeAg_B0459"
FT                   /product="phosphatidylglycerophosphatase A"
FT                   /EC_number="3.1.3.27"
FT                   /note="identified by match to protein family HMM PF04608"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0459"
FT                   /db_xref="EnsemblGenomes-Tr:ACH51010"
FT                   /db_xref="GOA:B5EXG1"
FT                   /db_xref="InterPro:IPR007686"
FT                   /db_xref="InterPro:IPR026037"
FT                   /db_xref="InterPro:IPR036681"
FT                   /db_xref="UniProtKB/TrEMBL:B5EXG1"
FT                   /protein_id="ACH51010.1"
FT                   /translation="MPRHKDVAKSRLNLRNPWHLLATGFGSGLSPVVPGTMGSLAAIPF
FT                   WYLMTFLPWQLYSLVVMFGICIGVYLCHQTAKDMGVHDHGSIVWDEFIGMWITLMALPT
FT                   TDWQWVAAGFVIFRILDMWKPWPIRWFDRNVHGGMGIMIDDIVAGVISAGILYFIGHHW
FT                   PLGII"
FT   gene            complement(455134..456108)
FT                   /locus_tag="SeAg_B0460"
FT   CDS_pept        complement(455134..456108)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0460"
FT                   /product="oxidoreductase, aldo/keto reductase family"
FT                   /note="identified by match to protein family HMM PF00248"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0460"
FT                   /db_xref="EnsemblGenomes-Tr:ACH50567"
FT                   /db_xref="GOA:B5EXG2"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:B5EXG2"
FT                   /protein_id="ACH50567.1"
FT                   /translation="MQYNTLGNTDLRVSRLCLGCMTFGEPSRGNHAWTLPEESSRPIIK
FT                   RALEGGINFFDTANSYSDGSSEEIVGRALRDFARRDEVVVATKVFHRVGDLPEGLSRAQ
FT                   ILRSIDDSLNRLGMEYVDILQIHRWDYTTPIEETLEALNDVVKAGKARYIGASSMHASQ
FT                   FAQALALQKQHGWAPFVTMQDHYNLIYREEEREMLPLCWQEGVAVIPWSPLARGRLTRP
FT                   WGETTARLVSDDVGKNLYAESDKNDAQIAERLAGVSEALGATRAQVALAWLLSKRGVAA
FT                   PIIGASREEQLDELLNAVDLTLKPEQIAELETPYKQHPVVGFK"
FT   gene            complement(456165..458027)
FT                   /gene="dxs"
FT                   /locus_tag="SeAg_B0461"
FT   CDS_pept        complement(456165..458027)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dxs"
FT                   /locus_tag="SeAg_B0461"
FT                   /product="1-deoxy-D-xylulose-5-phosphate synthase"
FT                   /EC_number="2.2.1.7"
FT                   /note="identified by match to protein family HMM PF02779;
FT                   match to protein family HMM PF02780; match to protein
FT                   family HMM TIGR00204"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0461"
FT                   /db_xref="EnsemblGenomes-Tr:ACH50721"
FT                   /db_xref="GOA:B5EXG3"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR005477"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR020826"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5EXG3"
FT                   /protein_id="ACH50721.1"
FT                   /translation="MSFDIAKYPTLALVDSTQELRLLPKESLPKLCDELRRYLLDSVSR
FT                   SSGHFASGLGTVELTVALHYVYNTPFDQLIWDVGHQAYPHKILTGRRDKIGTIRQKGGL
FT                   HPFPWRGESEYDVLSVGHSSTSISAGIGIAVAAEKEGKDRRTVCVIGDGAITAGMAFEA
FT                   MNHAGDIRPDMLVILNDNEMSISENVGALNNHLAQLLSGKLYSSLREGGKKVFSGVPPI
FT                   KELLKRTEEHIKGMVVPGTLFEELGFNYIGPVDGHDVMGLISTLKNMRDLKGPQFLHIM
FT                   TKKGRGYEPAEKDPITFHAVPKFDPSSGCLPKSSGGLPGYSKIFGDWLCETAAKDSKLM
FT                   AITPAMREGSGMVEFSRKFPDRYFDVAIAEQHAVTFAAGLAIGGYKPVVAIYSTFLQRA
FT                   YDQVIHDVAIQKLPVMFAIDRAGIVGADGQTHQGAFDLSYLRCIPDMVIMTPSDENECR
FT                   QMLFTGYHYNDGPTAVRYPRGNAQGVALTPLEKLPIGKGLVKRHGEKLAILNFGTLMPE
FT                   AAKVAEALNATLVDMRFVKPLDDTLILEMAAQHDALVTLEENAIMGGAGSGVNEVLMAH
FT                   RKPVPVLNIGLPDFFIPQGTQEEARAELGLDAAGIEAKIKAWQA"
FT   gene            complement(458051..458950)
FT                   /gene="ispA"
FT                   /locus_tag="SeAg_B0462"
FT   CDS_pept        complement(458051..458950)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ispA"
FT                   /locus_tag="SeAg_B0462"
FT                   /product="geranyltranstransferase"
FT                   /EC_number="2.5.1.10"
FT                   /note="identified by match to protein family HMM PF00348"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0462"
FT                   /db_xref="EnsemblGenomes-Tr:ACH49855"
FT                   /db_xref="GOA:B5EXG4"
FT                   /db_xref="InterPro:IPR000092"
FT                   /db_xref="InterPro:IPR008949"
FT                   /db_xref="InterPro:IPR033749"
FT                   /db_xref="UniProtKB/TrEMBL:B5EXG4"
FT                   /protein_id="ACH49855.1"
FT                   /translation="MDFTQQLQACVTQANQALSRFIAPLPFQNTPVVEAMQYGALLGGK
FT                   RLRPFLVYATGQMFGVSTATLDAPAAAVECIHAYSLIHDDLPAMDDDDLRRGLPTCHIK
FT                   FGEANAILAGDALQTLAFAIISDAPMPEVADRDRIAMIAELANASGIAGMCGGQALDLA
FT                   AEGQRITLDALERIHRHKTGALIRAAVRLGALSAGDKGRNTLPILDRYAESIGLAFQVQ
FT                   DDILDVVGDTATLGKRQGADQQLGKSTYPALLGLEQARNKARDLIEDARQSLHQLAAQS
FT                   LDTSALEALANYIIQRDK"
FT   gene            complement(458951..459193)
FT                   /gene="xseB"
FT                   /locus_tag="SeAg_B0463"
FT   CDS_pept        complement(458951..459193)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="xseB"
FT                   /locus_tag="SeAg_B0463"
FT                   /product="exodeoxyribonuclease VII, small subunit"
FT                   /EC_number="3.1.11.6"
FT                   /note="identified by match to protein family HMM PF02609;
FT                   match to protein family HMM TIGR01280"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0463"
FT                   /db_xref="EnsemblGenomes-Tr:ACH51353"
FT                   /db_xref="GOA:B5EXG5"
FT                   /db_xref="InterPro:IPR003761"
FT                   /db_xref="InterPro:IPR037004"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5EXG5"
FT                   /protein_id="ACH51353.1"
FT                   /translation="MPKKNEAPASFETALSELEHIVTRLESGDLPLEDALNEFERGVQL
FT                   ARQGQAKLQQAEQRVQILLSDNEEASPEPFIADNE"
FT   gene            459403..460851
FT                   /gene="thiI"
FT                   /locus_tag="SeAg_B0464"
FT   CDS_pept        459403..460851
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiI"
FT                   /locus_tag="SeAg_B0464"
FT                   /product="thiamine biosynthesis/tRNA modification protein
FT                   ThiI"
FT                   /note="identified by match to protein family HMM PF02568;
FT                   match to protein family HMM PF02926; match to protein
FT                   family HMM TIGR00342"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0464"
FT                   /db_xref="EnsemblGenomes-Tr:ACH51661"
FT                   /db_xref="GOA:B5EXG6"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR003720"
FT                   /db_xref="InterPro:IPR004114"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020536"
FT                   /db_xref="InterPro:IPR026340"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5EXG6"
FT                   /protein_id="ACH51661.1"
FT                   /translation="MKFIIKLFPEITIKSQSVRLRFIKILTGNIRNVLKHYDETLAVVR
FT                   HWDNIEVRAKDENQRLAIRDALTRIPGIHHILEVEDVPFTDMHDIFEKALAQYREQLEG
FT                   KTFCVRVKRRGKHEFSSIEVERYVGGGLNQHIESARVKLTNPDVTVHLEVEDDRLLLIK
FT                   GRYEGIGGFPIGTQEDVLSLISGGFDSGVSSYMLMRRGCRVHYCFFNLGGAAHEIGVRQ
FT                   VAHYLWNRFGSSHRVRFVAINFEPVVGEILEKVDDGQMGVVLKRMMVRAASKVAERYGV
FT                   QALVTGEALGQVSSQTLTNLRLIDNVSDTLILRPLISYDKEHIINLARQIGTEDFARTM
FT                   PEYCGVISKSPTVKAIKAKIEAEEENFDFSILDKVVEEANNVDIREIAQQTQQEVVEVE
FT                   TVSGFGANDVILDIRSVDEQDDKPLKVEGVDVVSLPFYKLSTKFGDLDQSKTWLLWCER
FT                   GVMSRLQALYLREQGFANVKVYRP"
FT   gene            complement(460895..461692)
FT                   /gene="phnV"
FT                   /locus_tag="SeAg_B0465"
FT   CDS_pept        complement(460895..461692)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phnV"
FT                   /locus_tag="SeAg_B0465"
FT                   /product="2-aminoethylphosphonate ABC transport system,
FT                   membrane component PhnV"
FT                   /note="identified by match to protein family HMM PF00528;
FT                   match to protein family HMM TIGR03255"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0465"
FT                   /db_xref="EnsemblGenomes-Tr:ACH51170"
FT                   /db_xref="GOA:B5EXG7"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR017661"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B5EXG7"
FT                   /protein_id="ACH51170.1"
FT                   /translation="MLIWSPKGRAAAGVVASVLFIVFFFLPLAVILMSSLSQQWNGILP
FT                   SGFTLNHFVNALHGAAWDALLASLTIGFCASLFALLCGVWAALALRQYGVKTQKWLSMV
FT                   FYLPSAIPSVSVGLGILVAFSQGPLQMNGTLWIVLTAHFVLISAFTFSNVSTGLARISA
FT                   DIENVASSLGASPWYRLRHVTLPLLMPWMVSALALSLSLSMGELGATMMIYPPGWTTLP
FT                   VAIFSLTDRGNIADGAALTIVLVAITLLLMMKLERIAKRLGQK"
FT   gene            complement(461695..462555)
FT                   /pseudo
FT                   /gene="phnU"
FT                   /locus_tag="SeAg_B0466"
FT                   /note="2-aminoethylphosphonate ABC transporter, permease
FT                   protein; this gene contains a premature stop which may be
FT                   the result of sequencing error; identified by match to
FT                   protein family HMM PF00528; match to protein family HMM
FT                   TIGR03226"
FT   gene            complement(462558..463667)
FT                   /gene="phnT"
FT                   /locus_tag="SeAg_B0467"
FT   CDS_pept        complement(462558..463667)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phnT"
FT                   /locus_tag="SeAg_B0467"
FT                   /product="2-aminoethylphosphonate ABC transport system,
FT                   ATP-binding component PhnT"
FT                   /note="identified by match to protein family HMM PF00005;
FT                   match to protein family HMM PF08402; match to protein
FT                   family HMM TIGR03258"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0467"
FT                   /db_xref="EnsemblGenomes-Tr:ACH52414"
FT                   /db_xref="GOA:B5EXG8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="InterPro:IPR017662"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B5EXG8"
FT                   /protein_id="ACH52414.1"
FT                   /translation="MLMKTTAVHAPASQGTSGIVLDSLRVAYHGNVVLKPLSLTIEPGE
FT                   VLALIGPSGSGKTTVLRAVAGFVQPAGGRILIGDTDVTHLPPYKRGLAMVVQNYALFPH
FT                   LKVEDNVAFGLRAQKQPKALINERVTQALKTVGMSDYAARYPHQLSGGQQQRVAIARAI
FT                   AVRPRVLLLDEPLSALDAQIRHNMVEEIARLHRELPELTILYVTHDQTEALTLADKIGI
FT                   MKDGSLIAHGETRALYQHPPNRFAAEFLGRANILSAIALGITEAPGLVDVSCGGAVIRA
FT                   FSRGSHHGYNKLLCIRPQHLSLTPRSDYSNRFNATLQSVHWQGDLTHLLCDVAGETVRM
FT                   VLTHVNPLPRVGDKLALWFEPDDAVLIEV"
FT   gene            complement(463673..464686)
FT                   /gene="phnS"
FT                   /locus_tag="SeAg_B0468"
FT   CDS_pept        complement(463673..464686)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phnS"
FT                   /locus_tag="SeAg_B0468"
FT                   /product="2-aminoethylphosphonate ABC transporter,
FT                   2-aminoethylphosphonate binding protein"
FT                   /note="identified by match to protein family HMM PF01547;
FT                   match to protein family HMM TIGR03227"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0468"
FT                   /db_xref="EnsemblGenomes-Tr:ACH49082"
FT                   /db_xref="InterPro:IPR017637"
FT                   /db_xref="UniProtKB/TrEMBL:B5EXG9"
FT                   /protein_id="ACH49082.1"
FT                   /translation="MKLSRLALLSVFALASAPSWAESVVTVYSIDGLHDGDNSWYQVQF
FT                   DAFTKATGITVRYVEGGGGVVVERLAKERTNPQADVLVTAPPFIQRAAAEKLLANFNTD
FT                   AASAIPDANNLYSPLVKNYLSFIYNSKLLKTAPASWQDLLDGKFKNKLQYSTPGQAADG
FT                   TAVMLQAFHSFGSKDAGFAYLGKLQANNVGPSASTGKLTALVNKGEIYVANGDLQMNLA
FT                   QMERNPNVKIFWPANDKGERSALAIPYVIGLVQGAPQSENGKKLINFLLSKEAQTRVSE
FT                   LSWGMPVRSDVTPSDEHYKAATAALEGVQSWQPNWDDVAVSLSADISRWHKVTESE"
FT   gene            complement(464884..465603)
FT                   /locus_tag="SeAg_B0469"
FT   CDS_pept        complement(464884..465603)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0469"
FT                   /product="transcriptional regulator protein"
FT                   /note="identified by match to protein family HMM PF00392;
FT                   match to protein family HMM PF07702; match to protein
FT                   family HMM TIGR03337"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0469"
FT                   /db_xref="EnsemblGenomes-Tr:ACH48590"
FT                   /db_xref="GOA:B5EXH0"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR011663"
FT                   /db_xref="InterPro:IPR017722"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B5EXH0"
FT                   /protein_id="ACH48590.1"
FT                   /translation="MKSIPGDIPQYLLIKAQLQARIQSGALKSGDKLPSERELCAIFNT
FT                   TRITIRESLAQLESSGLIWRADRRGWFVTPERLWLDPTQNTNFHKLCREQGREPKTALL
FT                   SGVLTTVPVEVMEPLQLQPFDQIYLLTRLRYADGRAVCYCENHCLPARVPELLQYDLNG
FT                   SLTEVYESHYNLVYTSMHLSFYPTAMPAQAAQALGVMEGRPALLLRRLNYDQHGRVLDL
FT                   DIEYWRHDSLRIEVDTH"
FT   gene            465743..466846
FT                   /gene="phnW"
FT                   /locus_tag="SeAg_B0470"
FT   CDS_pept        465743..466846
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phnW"
FT                   /locus_tag="SeAg_B0470"
FT                   /product="2-aminoethylphosphonate--pyruvate transaminase"
FT                   /EC_number="2.6.1.37"
FT                   /note="identified by match to protein family HMM PF00266;
FT                   match to protein family HMM TIGR02326; match to protein
FT                   family HMM TIGR03301"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0470"
FT                   /db_xref="EnsemblGenomes-Tr:ACH49462"
FT                   /db_xref="GOA:B5EXH1"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR012703"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR024169"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5EXH1"
FT                   /protein_id="ACH49462.1"
FT                   /translation="MTSRNYLLLTPGPLTTSRTVKEAMLFDSCTWDDDYNIGVVEQIRQ
FT                   QLTALATASEGYTSVLLQGSGSYAVEAVLGSALGPQDKVLIVSNGAYGARMVEMSGLMG
FT                   IAHHAYDCGEVARPDVQAIDAILNADPTISHIAMVHSETTTGMLNPIDEVGALAHRYGK
FT                   TYIVDAMSSFGGIPMDIATLHIDYLISSANKCIQGVPGFAFVIAREQKLAACKGRSRSL
FT                   SLDLYAQWRCMEDNHGKWRFTSPTHTVLAFAQALKELAKEGGVAARHQRYQQNQRSLVA
FT                   GMRALGFNTLLDDELHSPIITAFYSPEDPQYRFSEFYRRLKEQGFVIYPGKVSQSDCFR
FT                   IGNIGEVYAADITALLTAIRTAMYWMK"
FT   gene            466856..467665
FT                   /gene="phnX"
FT                   /locus_tag="SeAg_B0471"
FT   CDS_pept        466856..467665
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phnX"
FT                   /locus_tag="SeAg_B0471"
FT                   /product="phosphonoacetaldehyde hydrolase"
FT                   /EC_number="3.11.1.1"
FT                   /note="identified by match to protein family HMM PF00702;
FT                   match to protein family HMM TIGR01422; match to protein
FT                   family HMM TIGR01509"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0471"
FT                   /db_xref="EnsemblGenomes-Tr:ACH52519"
FT                   /db_xref="GOA:B5EXH2"
FT                   /db_xref="InterPro:IPR006323"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5EXH2"
FT                   /protein_id="ACH52519.1"
FT                   /translation="MNRIHAVILDWAGTTVDFGSFAPTQIFVEAFRQAFDVEITLAEAR
FT                   VPMGLGKWQHIEALGKLPAVDARWQAKFGRSMSAADIDAIYAAFMPLQIAKVIDFSSPI
FT                   AGVIDTIAALRAEGIKIGSCSGYPRAVMERLVPAAAEHGYRPDHWVATDDLVAGGRPGP
FT                   WMALQNVIALGIDAVAHCVKVDDAAPGISEGLNAGMWTVGLAVSGNEFGATWDAYQTMS
FT                   KEDVAVRREHAASKLYAAGAHYVVDSLADLPEVIAHINARLAQGERP"
FT   gene            complement(467762..468352)
FT                   /locus_tag="SeAg_B0472"
FT   CDS_pept        complement(467762..468352)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0472"
FT                   /product="protein ThiJ"
FT                   /note="identified by match to protein family HMM PF01965;
FT                   match to protein family HMM TIGR01383"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0472"
FT                   /db_xref="EnsemblGenomes-Tr:ACH51455"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR006287"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:B5EXH3"
FT                   /protein_id="ACH51455.1"
FT                   /translation="MSAQALVCLAPGSEETEAVTTIDLLVRGGIHVTTASVASDGNLTI
FT                   VCSRGVKLLADAPLVEVADGDYDIIVLPGGIKGAECFRDSPLLVETVKQFHRSGRIVAA
FT                   ICAAAATVLVPHDIFPIGNMTGFPALKDKIPAEQWLDKRVVWDARVKLLTSQGPGTAID
FT                   FGLKIIDLLAGREKAHEVASQLVMAAGIYNYYE"
FT   gene            complement(468315..469226)
FT                   /gene="panE"
FT                   /locus_tag="SeAg_B0473"
FT   CDS_pept        complement(468315..469226)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="panE"
FT                   /locus_tag="SeAg_B0473"
FT                   /product="2-dehydropantoate 2-reductase"
FT                   /EC_number="1.1.1.169"
FT                   /note="identified by match to protein family HMM PF02558;
FT                   match to protein family HMM PF08546; match to protein
FT                   family HMM TIGR00745"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0473"
FT                   /db_xref="EnsemblGenomes-Tr:ACH49669"
FT                   /db_xref="GOA:B5EXH4"
FT                   /db_xref="InterPro:IPR003710"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR013332"
FT                   /db_xref="InterPro:IPR013752"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B5EXH4"
FT                   /protein_id="ACH49669.1"
FT                   /translation="MKITVLGCGALGQLWLSALCKHGHDVQGWLRVPQPYCSVNLIDTD
FT                   GSFFNESLTANDPDFLAKSELLLVTLKAWQVSDAVRTLASTLPVTSPILLIHNGMGTIE
FT                   ELQNIQQPMLMGTITHAARRDGNIIIHVANGTTHIGPAREQDGDYSYLADILQGVLPDV
FT                   AWHNNIRAEMWRKLAVNCVINPLTALWNCPNGELRHHPDEINAICEEVAAVIEREGYHT
FT                   SADDLRYYVEQVIDSTAENISSMLQDVRAMRHTEIDYITGYLLKRARVHGLAVPENSRL
FT                   FEMVKRKESEYERSGTGMPRPW"
FT   gene            469352..469843
FT                   /locus_tag="SeAg_B0474"
FT   CDS_pept        469352..469843
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0474"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF04461"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0474"
FT                   /db_xref="EnsemblGenomes-Tr:ACH50528"
FT                   /db_xref="InterPro:IPR007551"
FT                   /db_xref="InterPro:IPR035570"
FT                   /db_xref="InterPro:IPR035571"
FT                   /db_xref="InterPro:IPR036183"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5EXH5"
FT                   /protein_id="ACH50528.1"
FT                   /translation="MPSFDIVSEVDLQEARNGVDNAVREVESRFDFRGVEATIELNDAN
FT                   KTIKVLSESDFQVNQLLDILRAKLLKRGIEGASLDVPDEFVHSGKTWYVEAKLKQGIES
FT                   AVQKKIVKLIKDSKLKVQAQIQGEEIRVTGKSRDDLQSVMALVRGGDLGQPFQFKNFRD
FT                   "
FT   gene            complement(469890..471254)
FT                   /locus_tag="SeAg_B0475"
FT   CDS_pept        complement(469890..471254)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0475"
FT                   /product="inner membrane transport protein YajR"
FT                   /note="identified by match to protein family HMM PF07690"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0475"
FT                   /db_xref="EnsemblGenomes-Tr:ACH48636"
FT                   /db_xref="GOA:B5EXH6"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B5EXH6"
FT                   /protein_id="ACH48636.1"
FT                   /translation="MNDYKMTPGELRATWGLGTVFSLRMLGMFMVLPVLTTYGMALQGA
FT                   SEALIGIAIGIYGLAQAIFQIPFGLLSDRIGRKPLIVGGLAVFVAGSVIAALSHSIWGI
FT                   ILGRALQGSGAIAAAVMALLSDLTREQNRTKAMAFIGVSFGITFAIAMVLGPIVTHSLG
FT                   LNALFWMIAALATLGILLTIWVVPNSTNHVLNRESGMVKGSFSKVLAEPRLLKLNFGIM
FT                   CLHILLMSTFVALPGQLADAGFPAAEHWKVYLATMVIAFAAVVPFIIYAEVKRRMKQVF
FT                   LFCVGLIIVAEIVLWGAGQHFWELVIGVQLFFLAFNLMEALLPSLISKESPAGYKGTAM
FT                   GVYSTSQFLGVALGGSLGGWIDGTFDGQTVFLAGAVLAMVWLAVASTMKEPPYVSSLRV
FT                   EIPADIVADDRLKQRLLAMKGVSEALIVAEEHSAYVKIDSKVTNRFEVEQLISKG"
FT   gene            471800..473311
FT                   /locus_tag="SeAg_B0476"
FT   CDS_pept        471800..473311
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0476"
FT                   /product="putative periplasmic protein"
FT                   /note="identified by match to protein family HMM PF08238"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0476"
FT                   /db_xref="EnsemblGenomes-Tr:ACH52272"
FT                   /db_xref="InterPro:IPR006597"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:B5EXH7"
FT                   /protein_id="ACH52272.1"
FT                   /translation="MEIKYLSLCILAGILFVSQVNASENNGKDDVKYAALTQKDLDALP
FT                   VEKRASVLDELGFIHEYGIGVPMNRERALQYYKQACELGGNYGCYNVKYAYQYGDGVAK
FT                   DSAQANMYAKKMNLDNLLIEQEYIDKFSQEIYAAKALADTDKSQRPEFINALFNLLNNR
FT                   PESDALFFSRIGFNQEKTFRLATLWGQDGDPQMDYQLGLLALNDFSGHYVDEPYKARPA
FT                   SLKWFRAAAEKGVVEAQSLLGGIYSGGEGDEWGIKPDIQEAQKWYGQAAEQGDSDAQIA
FT                   LGKIYYSGATGRTDYAKALALFTQVENDGTNSRSTMPLSWMYYNGLGTAPDCDKAWSYY
FT                   KKASRYVGKKVEEKIFLSKCAADIQSRKNNADALPKVTLKKESIFSRGITAKPKECALI
FT                   FQIGTDKIRNMANLHITLELKNDDGVATEETLMIPPFGLNTLGIDMQNHAVDPLVTSYD
FT                   LPLYTQDFCHGIGDIHFTLKSATATINDKNVDLLKADSVRFLDKE"
FT   gene            473323..474813
FT                   /locus_tag="SeAg_B0477"
FT   CDS_pept        473323..474813
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0477"
FT                   /product="tetratricopeptide repeat protein"
FT                   /note="identified by match to protein family HMM PF08238"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0477"
FT                   /db_xref="EnsemblGenomes-Tr:ACH52804"
FT                   /db_xref="InterPro:IPR006597"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:B5EXH8"
FT                   /protein_id="ACH52804.1"
FT                   /translation="MIKQKWNLLLLLGLSFASVCQAGDDIDALYSRIAQKDIQALNELK
FT                   ALAKDNNAQALAELGFIYEYGVSVSVDIPQAIKYYEQACDLDGDYGCFNAAYFYEYGIG
FT                   TQKDITQAKILAKQLREKTNLSNINLDKKVSERIIGSVYSNKLEAYRDLSFRPHFIQGL
FT                   SFYFYAPQSDERKLLSRIGFDSSHLARIAILWAREGDPEVAYQTAKLVSTLYFNNETKT
FT                   IDIAEALKWLRISAEKGDADSQTLLGFLYEHAGLGLQPDGEKARKWYEMAAQQGNGEAL
FT                   YTLGRMYYSGVMVNVDYDKALYFFKKAYEKELQAAADYLAQMYFNGQSVDVDCQQSWHY
FT                   YDNSYIKKMTQRDYLDYCEKDRKRRNDFSQQLPELTLEKYAGLFGRIDNIPLCQIGFVV
FT                   NTNKLIHVANLRVELILKNDVGVSDERMVAFPPLGLNTLGAEQGMGDSFKSMGYILMKN
FT                   GDLCDYHKLTFTVKSATATINGKKVDLLKTDNLHIIQN"
FT   gene            complement(474898..475785)
FT                   /gene="cyoE"
FT                   /locus_tag="SeAg_B0478"
FT   CDS_pept        complement(474898..475785)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cyoE"
FT                   /locus_tag="SeAg_B0478"
FT                   /product="protoheme IX farnesyltransferase"
FT                   /EC_number="2.5.1.-"
FT                   /note="identified by match to protein family HMM PF01040;
FT                   match to protein family HMM TIGR01473"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0478"
FT                   /db_xref="EnsemblGenomes-Tr:ACH51292"
FT                   /db_xref="GOA:B5EXH9"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR006369"
FT                   /db_xref="InterPro:IPR030470"
FT                   /db_xref="UniProtKB/TrEMBL:B5EXH9"
FT                   /protein_id="ACH51292.1"
FT                   /translation="MFKQYLQVTKPGIIFGNLISVIGGFLLASKGSIDYPLFIYTLVGV
FT                   SLVVASGCVFNNYIDRDIDRKMERTKNRVLVKGLISPGVSLVYATLLGIAGFMLLWFGA
FT                   NPLACWLGVMGFVVYVGVYSLYMKRHSVYGTLIGSLSGAAPPVIGYCAVTGDFDSGAAI
FT                   LLAIFSLWQMPHSYAIAIFRFKDYQAANIPVLPVVKGISVAKNHITLYIIAFAVATLML
FT                   TLGGYAGYKYLVVAAAVSVWWLGMALRGYKVEDDKVWARKLFGFSIIAITALSIMMSVD
FT                   FMVPNSQNLLTYVW"
FT   gene            complement(475800..476129)
FT                   /gene="cyoD"
FT                   /locus_tag="SeAg_B0479"
FT   CDS_pept        complement(475800..476129)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cyoD"
FT                   /locus_tag="SeAg_B0479"
FT                   /product="cytochrome o ubiquinol oxidase, subunit IV"
FT                   /EC_number="1.10.3.-"
FT                   /note="identified by match to protein family HMM PF03626;
FT                   match to protein family HMM TIGR02847"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0479"
FT                   /db_xref="EnsemblGenomes-Tr:ACH51826"
FT                   /db_xref="GOA:B5EXI0"
FT                   /db_xref="InterPro:IPR005171"
FT                   /db_xref="InterPro:IPR014210"
FT                   /db_xref="UniProtKB/TrEMBL:B5EXI0"
FT                   /protein_id="ACH51826.1"
FT                   /translation="MSHSTESGGASHGSVKTYMTGFILSVILTVIPFWMVMTGAASPAV
FT                   ILGSILAMAVVQILVHLVCFLHMNTKSDEGWNMTAFIFTVLIIAILVVGSIWIMWNLNY
FT                   NMMMH"
FT   gene            complement(476129..476743)
FT                   /gene="cyoC"
FT                   /locus_tag="SeAg_B0480"
FT   CDS_pept        complement(476129..476743)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cyoC"
FT                   /locus_tag="SeAg_B0480"
FT                   /product="cytochrome o ubiquinol oxidase, subunit III"
FT                   /EC_number="1.10.3.-"
FT                   /note="identified by match to protein family HMM PF00510;
FT                   match to protein family HMM TIGR02842"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0480"
FT                   /db_xref="EnsemblGenomes-Tr:ACH52291"
FT                   /db_xref="GOA:B5EXI1"
FT                   /db_xref="InterPro:IPR000298"
FT                   /db_xref="InterPro:IPR013833"
FT                   /db_xref="InterPro:IPR014206"
FT                   /db_xref="InterPro:IPR024791"
FT                   /db_xref="InterPro:IPR033946"
FT                   /db_xref="InterPro:IPR035973"
FT                   /db_xref="UniProtKB/TrEMBL:B5EXI1"
FT                   /protein_id="ACH52291.1"
FT                   /translation="MATDTLTHATAHAHEHGHHDAGQNKIFGFWVYLMSDCILFSILFA
FT                   TYAVLVNGTAGGPTGKDIFELPFVLVETFLLLFSSITYGMAAIAMHKNNKSQVISWLAL
FT                   TFLFGAGFIGMELYEFHHLIVNGMGPDRSGFLSAFFALVGTHGLHVTSGLIWMAVLMVQ
FT                   VARRGLTSTNRTRIMCLSLFWHFLDVIWICVFTVVYLMGAM"
FT   gene            complement(476733..478724)
FT                   /gene="cyoB"
FT                   /locus_tag="SeAg_B0481"
FT   CDS_pept        complement(476733..478724)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cyoB"
FT                   /locus_tag="SeAg_B0481"
FT                   /product="cytochrome o ubiquinol oxidase, subunit I"
FT                   /EC_number="1.10.3.-"
FT                   /note="identified by match to protein family HMM PF00115;
FT                   match to protein family HMM TIGR02843"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0481"
FT                   /db_xref="EnsemblGenomes-Tr:ACH51237"
FT                   /db_xref="GOA:B5EXI2"
FT                   /db_xref="InterPro:IPR000883"
FT                   /db_xref="InterPro:IPR014207"
FT                   /db_xref="InterPro:IPR023615"
FT                   /db_xref="InterPro:IPR023616"
FT                   /db_xref="InterPro:IPR036927"
FT                   /db_xref="UniProtKB/TrEMBL:B5EXI2"
FT                   /protein_id="ACH51237.1"
FT                   /translation="MFGKLSLDAVPFHEPIVMVTIAAIIVGGLAILAAITYFGKWTYLW
FT                   KEWLTSVDHKRLGIMYIIVAIVMLLRGFADAIMMRSQQALASAGEAGFLPPHHYDQIFT
FT                   AHGVIMIFFVAMPFVIGLMNLVVPLQIGARDVAFPFLNNLSFWFTVVGVILVNLSLGVG
FT                   EFAQTGWLAYPPLSGIEYSPSVGVDYWIWALQLSGIGTTLTGINFFVTILKMRAPGMTM
FT                   FKMPVFTWASLCANVLIIASFPILTVTVALLTLDRYLGTHFFTNDMGGNMMMYINLIWA
FT                   WGHPEVYILILPVFGVFSEIAATFSRKRLFGYTSLVWATVCITVLSFIVWLHHFFTMGA
FT                   GANVNAFFGITTMIIAIPTGVKIFNWLFTMYQGRIVFHSAMMWTIGFIVTFSVGGMTGV
FT                   LLAVPGADFVLHNSLFLIAHFHNVIIGGVVFGCFAGMTYWWPKAFGFKLNETWGKRAFW
FT                   FWIIGFFVAFMPLYVLGFMGMTRRLSQQIDPQFHTMLMVAAAGAALIALGILCQLIQIF
FT                   VSIRDRDQNRDLTGDPWGGRTLEWSTSSPPPFYNFAVVPHVHERDAFWEMKEKGEAYQQ
FT                   PGQYEEIHMPKNSGAGIVIAAFATVFGFAMIWHIWWLAIVGFAGMIISWIVKSFDEDVD
FT                   YYVPVPEVEKLENQHFDEITKAGLKNGN"
FT   gene            complement(478735..479664)
FT                   /gene="cyoA"
FT                   /locus_tag="SeAg_B0482"
FT   CDS_pept        complement(478735..479664)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cyoA"
FT                   /locus_tag="SeAg_B0482"
FT                   /product="ubiquinol oxidase, subunit II"
FT                   /EC_number="1.10.3.-"
FT                   /note="identified by match to protein family HMM PF00116;
FT                   match to protein family HMM PF06481; match to protein
FT                   family HMM TIGR01433"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0482"
FT                   /db_xref="EnsemblGenomes-Tr:ACH51869"
FT                   /db_xref="GOA:B5EXI3"
FT                   /db_xref="InterPro:IPR002429"
FT                   /db_xref="InterPro:IPR006333"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR010514"
FT                   /db_xref="InterPro:IPR011759"
FT                   /db_xref="InterPro:IPR034227"
FT                   /db_xref="InterPro:IPR036257"
FT                   /db_xref="UniProtKB/TrEMBL:B5EXI3"
FT                   /protein_id="ACH51869.1"
FT                   /translation="MGWLSLIAGTALLSGCNSALLDPKGQIGLEQRSLILTAFGLMLIV
FT                   VIPAILMAVGFAWKYRASNKDAKYSPNWSHSNKVEAVVWTVPILIIIFLAVLTWKTTHA
FT                   LEPSKPLAHDEKPITIEVVSMDWKWFFIYPEQGIATVNEIAFPANTPVYFKVTSNSVMN
FT                   SFFIPRLGSQIYAMAGMQTRLHLIANEPGTYDGISASYSGPGFSGMKFKAIATKDRAEF
FT                   DQWVAKAKQSPNTMNDMAAFEKVAMPSEYNKVEYFSSVKPDLFKDVINKFMGHGKSMDM
FT                   TQPEGEHSSHEGMEGMDMSHAESANSKG"
FT   gene            complement(479938..480060)
FT                   /locus_tag="SeAg_B0483"
FT   CDS_pept        complement(479938..480060)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0483"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0483"
FT                   /db_xref="EnsemblGenomes-Tr:ACH52219"
FT                   /db_xref="GOA:B5EXI4"
FT                   /db_xref="UniProtKB/TrEMBL:B5EXI4"
FT                   /protein_id="ACH52219.1"
FT                   /translation="MRNRILEIIGNFYATYFLYTIQPIKFKFLPLIVLLLIINC"
FT   gene            complement(480144..481625)
FT                   /locus_tag="SeAg_B0484"
FT   CDS_pept        complement(480144..481625)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0484"
FT                   /product="MFS family, muropeptide transporter"
FT                   /note="identified by match to protein family HMM PF07690;
FT                   match to protein family HMM TIGR00901"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0484"
FT                   /db_xref="EnsemblGenomes-Tr:ACH52880"
FT                   /db_xref="GOA:B5EXI5"
FT                   /db_xref="InterPro:IPR004752"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B5EXI5"
FT                   /protein_id="ACH52880.1"
FT                   /translation="MPMSSQYLRIFQQPRSAILLILGFASGLPLALTSGTLQAWMTVEN
FT                   IDLKTIGFFSLVGQAYVFKFLWSPLMDRYTPPFLGRRRGWLLATQLLLLAAIAAMGFLE
FT                   PGTQLRWMAALAVVIAFCSASQDIVFDAWKTDVLPAEERGAGAAISVLGYRLGMLVSGG
FT                   LALWLADRWLGWQGMYWLMAALLIPCIIATLLAPEPTDTIPSPKSLEQAVVAPLRDFFG
FT                   RNNAWLILLLIVLYKLGDAFAMSLTTTFLIRGVGFDAGEVGVVNKTLGLLATIVGALYG
FT                   GILMQRLSLFRALLIFGILQGASNAGYWLLSITDKNMFSMGAAVFFENLCGGMGTAAFV
FT                   ALLMTLCNKSFSATQFALLSALSAVGRVYVGPVAGWFVEAHGWPTFYLFSVVAAVPGLL
FT                   LLLVCRQTLEYSWQNERFIPRTQYRGAYNFALSILLAGVALLAVWVLLLTMNALDYTNF
FT                   SFLSGLLETAVAIAVCGIVFGGLLDYLALRKTRLL"
FT   gene            complement(481663..482295)
FT                   /pseudo
FT                   /locus_tag="SeAg_B0485"
FT                   /note="putative lipoprotein; this gene contains a frame
FT                   shift which may be the result of sequencing error;
FT                   identified by match to protein family HMM PF03923"
FT   gene            482545..482862
FT                   /locus_tag="SeAg_B0486"
FT   CDS_pept        482545..482862
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0486"
FT                   /product="protein BolA"
FT                   /note="identified by match to protein family HMM PF01722"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0486"
FT                   /db_xref="EnsemblGenomes-Tr:ACH49868"
FT                   /db_xref="InterPro:IPR002634"
FT                   /db_xref="InterPro:IPR036065"
FT                   /db_xref="UniProtKB/TrEMBL:B5EXI6"
FT                   /protein_id="ACH49868.1"
FT                   /translation="MMIREQIEEKLRTAFDPVFLEVVDESYRHNVPAGSESHFKVVLVS
FT                   DRFTGERFLNRHRMIYGTLTAELSTTVHALALHTYTLKEWEGLQDTIFASPPCRGAGSI
FT                   A"
FT   gene            483209..484507
FT                   /gene="tig"
FT                   /locus_tag="SeAg_B0487"
FT   CDS_pept        483209..484507
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tig"
FT                   /locus_tag="SeAg_B0487"
FT                   /product="trigger factor"
FT                   /EC_number="5.2.1.8"
FT                   /note="identified by match to protein family HMM PF00254;
FT                   match to protein family HMM PF05697; match to protein
FT                   family HMM PF05698; match to protein family HMM TIGR00115"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0487"
FT                   /db_xref="EnsemblGenomes-Tr:ACH50314"
FT                   /db_xref="GOA:B5EXI7"
FT                   /db_xref="InterPro:IPR001179"
FT                   /db_xref="InterPro:IPR005215"
FT                   /db_xref="InterPro:IPR008880"
FT                   /db_xref="InterPro:IPR008881"
FT                   /db_xref="InterPro:IPR027304"
FT                   /db_xref="InterPro:IPR036611"
FT                   /db_xref="InterPro:IPR037041"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5EXI7"
FT                   /protein_id="ACH50314.1"
FT                   /translation="MQVSVETTQGLGRRVTITIAADSIETAVKSELVNVAKKVRIDGFR
FT                   KGKVPMNIVAQRYGASVRQDVLGDLMSRNFVDAIIKEKINPAGAPNYVPGEYKVGEDFT
FT                   YSVEFEVYPEVELTGLESIEVEKPVVEVTDADVDVMLDTLRKQQATWKEKDGAADAEDR
FT                   VTIDFTGSVDGEEFEGGKATDFVLAMGQGRMIPGFEDGVKGHKAGEEFTIDVTFPEEYH
FT                   AENLKGKAAKFVINLKKVEERELPELTEEFIKRFGVEDGSVAGLRAEVRKNMERELKGA
FT                   VRNRVKSQAIEGLVKANDIDVPAALIDSEIDVLRRQAAQRFGGNEKQALELPRELFEEQ
FT                   AKRRVVVGLLLGEVIRTNELKADEERVKGLIEEMASAYEDPKEVIEFYSKNKELMDNMR
FT                   NVALEEQAVEAVLAKAKVSEKATSFNELMNQQA"
FT   gene            484646..485377
FT                   /gene="clpP"
FT                   /locus_tag="SeAg_B0488"
FT   CDS_pept        484646..485377
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="clpP"
FT                   /locus_tag="SeAg_B0488"
FT                   /product="ATP-dependent Clp protease, proteolytic subunit
FT                   ClpP"
FT                   /EC_number="3.4.21.92"
FT                   /note="identified by match to protein family HMM PF00574;
FT                   match to protein family HMM TIGR00493"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0488"
FT                   /db_xref="EnsemblGenomes-Tr:ACH50858"
FT                   /db_xref="GOA:B5EXI8"
FT                   /db_xref="InterPro:IPR001907"
FT                   /db_xref="InterPro:IPR018215"
FT                   /db_xref="InterPro:IPR023562"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR033135"
FT                   /db_xref="UniProtKB/TrEMBL:B5EXI8"
FT                   /protein_id="ACH50858.1"
FT                   /translation="MNYGDAVPITEGLADNPSIRLQSVQQIFSIFIQETEMSYSGERDN
FT                   LAPHMALVPMVIEQTSRGERSFDIYSRLLKERVIFLTGQVEDHMANLIVAQMLFLEAEN
FT                   PEKDIYLYINSPGGVITAGMSIYDTMQFIKPDVSTICMGQAASMGAFLLTAGAKGKRFC
FT                   LPNSRVMIHQPLGGYQGQATDIEIHAREILKVKGRMNELMAHHTGQSLEQIERDTERDR
FT                   FLSAPEAVEYGLVDSILTHRN"
FT   gene            485629..486900
FT                   /gene="clpX"
FT                   /locus_tag="SeAg_B0489"
FT   CDS_pept        485629..486900
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="clpX"
FT                   /locus_tag="SeAg_B0489"
FT                   /product="ATP-dependent Clp protease, ATP-binding subunit
FT                   ClpX"
FT                   /note="identified by match to protein family HMM PF00004;
FT                   match to protein family HMM PF06689; match to protein
FT                   family HMM PF07724; match to protein family HMM TIGR00382"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0489"
FT                   /db_xref="EnsemblGenomes-Tr:ACH51872"
FT                   /db_xref="GOA:B5EXI9"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004487"
FT                   /db_xref="InterPro:IPR010603"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038366"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5EXI9"
FT                   /protein_id="ACH51872.1"
FT                   /translation="MTDKRKDGSGKLLYCSFCGKSQHEVRKLIAGPSVYICDECVDLCN
FT                   DIIREEIKEVAPHRERSALPTPHEIRTHLDDYVIGQEQAKKVLAVAVYNHYKRLRNGDT
FT                   SNGVELGKSNILLIGPTGSGKTLLAETLARLLDVPFTMADATTLTEAGYVGEDVENIIQ
FT                   KLLQKCDYDVQKAQRGIVYIDEIDKISRKSDNPSITRDVSGEGVQQALLKLIEGTVAAV
FT                   PPQGGRKHPQQEFLQVDTSKILFICGGAFAGLDKVIANRVETGSGIGFGATVKAKSDKA
FT                   SEGELLSQVEPEDLIKFGLIPEFIGRLPVVATLNELSEEALIQILKEPKNALTKQYQAL
FT                   FNLEGVDLEFRDEALDAIARKAMARKTGARGLRSIVEAALLDTMYDLPSMEDVEKVVID
FT                   ESVIAGQSKPLLIYGKPEAQASGE"
FT   gene            487086..489440
FT                   /gene="lon"
FT                   /locus_tag="SeAg_B0490"
FT   CDS_pept        487086..489440
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lon"
FT                   /locus_tag="SeAg_B0490"
FT                   /product="ATP-dependent protease La"
FT                   /EC_number="3.4.21.53"
FT                   /note="identified by match to protein family HMM PF00004;
FT                   match to protein family HMM PF02190; match to protein
FT                   family HMM PF05362; match to protein family HMM PF07728;
FT                   match to protein family HMM TIGR00763"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0490"
FT                   /db_xref="EnsemblGenomes-Tr:ACH49660"
FT                   /db_xref="GOA:B5EXJ0"
FT                   /db_xref="InterPro:IPR003111"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004815"
FT                   /db_xref="InterPro:IPR008268"
FT                   /db_xref="InterPro:IPR008269"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027065"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR027543"
FT                   /db_xref="UniProtKB/TrEMBL:B5EXJ0"
FT                   /protein_id="ACH49660.1"
FT                   /translation="MNPERSERIEIPVLPLRDVVVYPHMVIPLFVGREKSIRCLEAAMD
FT                   HDKKIMLVAQKEASTDEPGVNDLFTVGTVASILQMLKLPDGTVKVLVEGLQRARISALS
FT                   DNGEHFSAKAEYLDSPAIDEREQEVLVRTAISQFEGYIKLNKKIPPEVLTSLNSIDDPA
FT                   RLADTIAAHMPLKLADKQSVLEMSDVNERLEYLMAMMESEIDLLQVEKRIRNRVKKQME
FT                   KSQREYYLNEQMKAIQKELGEMDDAPDENEALKRKIDAAKMPKEAKEKAEAELQKLKMM
FT                   SPMSAEATVVRGYIDWMVQVPWNARSKVKKDLRQAQEILDTDHYGLERVKDRILEYLAV
FT                   QSRVNKIKGPILCLVGPPGVGKTSLGQSIAKATGRKYIRMALGGVRDEAEIRGHRRTYI
FT                   GSMPGKLIQKMAKVGVKNPLFLLDEIDKMSSDMRGDPASALLEVLDPEQNVAFSDHYLE
FT                   VDYDLSDVMFVATSNSMNIPAPLLDRMEVIRLSGYTEDEKLNIAKRHLLPKQIERNALK
FT                   KGELTVDDSAIIGIIRYYTREAGVRSLEREISKLCRKAVKQLLLDKSLKHIEINGDNLH
FT                   DYLGVQRFDYGRADSENRVGQVTGLAWTEVGGDLLTIETACVPGKGKLTYTGSLGEVMQ
FT                   ESIQAALTVVRARAEKLGINPDFYEKRDIHVHVPEGATPKDGPSAGIAMCTALVSCLTG
FT                   NPVRADVAMTGEITLRGQVLPIGGLKEKLLAAHRGGIKTVLIPFENKRDLEEIPDNVIA
FT                   DLDIHPVKRIEEVLTLALQNEPSGMQVVTAK"
FT   gene            489649..489921
FT                   /gene="hupB"
FT                   /locus_tag="SeAg_B0491"
FT   CDS_pept        489649..489921
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hupB"
FT                   /locus_tag="SeAg_B0491"
FT                   /product="DNA-binding protein HU-beta"
FT                   /note="identified by match to protein family HMM PF00216"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0491"
FT                   /db_xref="EnsemblGenomes-Tr:ACH50393"
FT                   /db_xref="GOA:B5EXJ1"
FT                   /db_xref="InterPro:IPR000119"
FT                   /db_xref="InterPro:IPR010992"
FT                   /db_xref="InterPro:IPR020816"
FT                   /db_xref="UniProtKB/TrEMBL:B5EXJ1"
FT                   /protein_id="ACH50393.1"
FT                   /translation="MNKSQLIEKIAAGADISKAAAGRALDAIIASVTESLKEGDDVALV
FT                   GFGTFAVKERAARTGRNPQTGKEITIAAAKVPSFRAGKALKDAVN"
FT   gene            490212..492083
FT                   /gene="ppiD"
FT                   /locus_tag="SeAg_B0492"
FT   CDS_pept        490212..492083
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ppiD"
FT                   /locus_tag="SeAg_B0492"
FT                   /product="peptidylprolyl isomerase"
FT                   /EC_number="5.2.1.8"
FT                   /note="identified by match to protein family HMM PF00639"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0492"
FT                   /db_xref="EnsemblGenomes-Tr:ACH49645"
FT                   /db_xref="GOA:B5EXJ2"
FT                   /db_xref="InterPro:IPR000297"
FT                   /db_xref="InterPro:IPR023058"
FT                   /db_xref="InterPro:IPR027304"
FT                   /db_xref="UniProtKB/TrEMBL:B5EXJ2"
FT                   /protein_id="ACH49645.1"
FT                   /translation="MMDSLRTAANSLVLKIIFVIIIVSFILTGVSGYLIGGSNNYAAKV
FT                   NGQEISRAQFENAFNNERNRMQQQLGDRYSELAANEGYMKSLRQQVLNRLIDEALLDQY
FT                   SRELKLGISDEQVKQAIFATPAFQVDGKFDNNRYNAIVNQMGMTADQYAQALRNQLTTQ
FT                   QLINGVAGTDFMLKGETDELAALVSQQRVVREAVIDVNALAAKQQVTDQEVSSYYDQNK
FT                   VRFMTPEQFRVSYIKLDAATMQAPVSDADIQAYYDQHVDQFTQPERIRYSIIQTKTEDD
FT                   AKAVLDALNKGEDFATLAKEKSTDIISARNGGDMGWLEESATVPELKNAGLKEKGQISG
FT                   VIKSSVGFLVARLDDIQPAKVKPLSEVRDDIAAKVKQEKALDAYYALQQKVSDAASNDN
FT                   ESLAGAEQVAGVKAVETGWFSHDTLPEELNFKPVADAIFNGGLVGENGTPGPNSDIITV
FT                   DGDRAFVVRVSEHKPEAVKPLAEVKEQVTALVKHNKAEQQAKLDAEKLLVELKAGKGAE
FT                   AMKAAGLSFGEPKTLSRTSQDPVSQAAFALSLPTKDKPVYGVANDMQGNVVLLAFDEVK
FT                   AGAMPEAQKKAMVQGITQNNAQIVFEALMSNLRKEAKIKIGDALEQQ"
FT   gene            492233..492607
FT                   /locus_tag="SeAg_B0493"
FT   CDS_pept        492233..492607
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0493"
FT                   /product="competence protein ComEA"
FT                   /note="identified by match to protein family HMM TIGR00426"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0493"
FT                   /db_xref="EnsemblGenomes-Tr:ACH50133"
FT                   /db_xref="InterPro:IPR004509"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="UniProtKB/TrEMBL:B5EXJ3"
FT                   /protein_id="ACH50133.1"
FT                   /translation="MKHGIKALLITLSLTCAGMAHSALAATPVAKNAAVETKADTPSSS
FT                   SAKAALPAKASDDEGTRVSINTASAEDLARVMNGVGLKKAQAIVSYREEYGPFKTVDDL
FT                   KQVPGMGSALVERNLAVLTL"
FT   gene            492711..493109
FT                   /locus_tag="SeAg_B0494"
FT   CDS_pept        492711..493109
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0494"
FT                   /product="thioesterase superfamily protein"
FT                   /note="identified by match to protein family HMM PF03061;
FT                   match to protein family HMM TIGR00051"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0494"
FT                   /db_xref="EnsemblGenomes-Tr:ACH49460"
FT                   /db_xref="GOA:B5EXJ4"
FT                   /db_xref="InterPro:IPR006684"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:B5EXJ4"
FT                   /protein_id="ACH49460.1"
FT                   /translation="MQTQIKVRGYHLDVYQHVNNARYLEFLEEARWDGLENSDSFKWMT
FT                   ARNIAFVVVNININYRRPAVLSDLLTVTSQVQQLNGKSGVLSQTITLEPEGQVVADALI
FT                   TFVCIDLKTQKALPLEGELREKLEQMVQ"
FT   gene            complement(493215..493910)
FT                   /locus_tag="SeAg_B0495"
FT   CDS_pept        complement(493215..493910)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0495"
FT                   /product="ExsB protein"
FT                   /note="identified by match to protein family HMM PF06508;
FT                   match to protein family HMM TIGR00364"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0495"
FT                   /db_xref="EnsemblGenomes-Tr:ACH48760"
FT                   /db_xref="GOA:B5EXJ5"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR018317"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5EXJ5"
FT                   /protein_id="ACH48760.1"
FT                   /translation="MKRAVVVFSGGQDSTTCLAQARHQYDEVHCVTFDYGQRHRAEIDV
FT                   ARALALKLGARAHKVLDVTLLNELAVSSLTRDSIPVPDYEPNADGIPNTFVPGRNILFL
FT                   TLAAIYAYQVKAEAVITGVCETDFSGYPDCRDEFVKALNHAVNLGMAKDIRFETPLMWI
FT                   DKAETWALADYWGQLDLVREETLTCYNGIKGDGCGHCAACNLRANGLNHYLSNKAAVMA
FT                   AMKQKTGLR"
FT   gene            complement(493975..495675)
FT                   /locus_tag="SeAg_B0496"
FT   CDS_pept        complement(493975..495675)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0496"
FT                   /product="extracellular solute-binding protein, family 5"
FT                   /note="identified by match to protein family HMM PF00496"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0496"
FT                   /db_xref="EnsemblGenomes-Tr:ACH52680"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR025370"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:B5EXJ6"
FT                   /protein_id="ACH52680.1"
FT                   /translation="MRLLNRLNQYQRLWQPSAGETQHVTVSELAERCFCSERHLRTLLR
FT                   QAQQAGWLRWEAQSGRGKRGQLQFLVTPESLRTAMMEQALEKGQQLNVLELAQLAPGEL
FT                   RAMLQPFMGGQWQNDTPTLRIPYYRPLDPLQPGFLPGRAEQHLAGQVFSGLTRFDRDSQ
FT                   YPCGDLAHHWEVSADGLRWDFYIRSTLHWHNGDAVDTAQLHKRLERLLTLPALSKLFIS
FT                   VARIEVTHPQCLTFLLHRPDYWLAHRLASYCSGLAHPDLPLIGTGPFRLALFTPELVRL
FT                   ESHDHYHLSHPLLKAIEFWITPQLFAQDLGTSCRHPVQIAIGKPEELATLSQVSSGISL
FT                   GFCYLTLKKGSRLNVQQARRLIHIIHHTSLLKTLPVDENLIMPSQGLLPGWTIPQWQDV
FT                   DETPLPKKLTLAYHLPVELHTMAEQLRHYLATLGCELTLIFHNAKNWDNCPALTQADLM
FT                   MGDRLIGEAPEYTLEQWLRCDQIWPHVLDAPAFSHLQATLDALQIQPNEKDRRAALQQV
FT                   FANLMDDATLTPLFNYHYRISAPPGVNGVRLTPRGWFEFSEAWLPPPSP"
FT   gene            495776..496594
FT                   /locus_tag="SeAg_B0497"
FT   CDS_pept        495776..496594
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0497"
FT                   /product="protein cof"
FT                   /note="identified by match to protein family HMM PF00702;
FT                   match to protein family HMM PF05116; match to protein
FT                   family HMM PF08282; match to protein family HMM TIGR00099;
FT                   match to protein family HMM TIGR01484"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0497"
FT                   /db_xref="EnsemblGenomes-Tr:ACH52102"
FT                   /db_xref="GOA:B5EXJ7"
FT                   /db_xref="InterPro:IPR000150"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023938"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5EXJ7"
FT                   /protein_id="ACH52102.1"
FT                   /translation="MARLAAFDMDGTLLMPEHHLGRETIATLARLRERDITLTFATGRH
FT                   VLEMRHILGTLSLDAYLITGNGTRIHSLEGDVLHRQDLDPQVADTVMHHAWDTRASMHV
FT                   FNDNGWFTGQEIPALLQAHVYSGFRYQVIDIKSIPAHQVTKICFCGDHDDLIRLRIQLN
FT                   EALEERAHLCFSAVDCLEVLPLGCNKGSALAVLSNHLGLSLADCMAFGDAMNDREMLGS
FT                   VGRGLIMGNAMPQLIAALPHLSVIGHCGNQAVSHFLTHWLDNPHLPYSPE"
FT   gene            complement(496643..497698)
FT                   /locus_tag="SeAg_B0498"
FT   CDS_pept        complement(496643..497698)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0498"
FT                   /product="pyridoxal-5'-phosphate-dependent enzyme, beta
FT                   subunit"
FT                   /note="identified by match to protein family HMM PF00291"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0498"
FT                   /db_xref="EnsemblGenomes-Tr:ACH51454"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:B5EXJ8"
FT                   /protein_id="ACH51454.1"
FT                   /translation="MMSSNWVKNAINEINADHQRSADTHLIRLPLSAFPGIQLYLKDES
FT                   THPTGSLKHRLARSLFLYGLCNGWIKEGTPIIEASSGSTAISEAWFARLLGLPFIAVMP
FT                   ACTAKRKIEQIQFYGGHCHFVESACEIYAASERLAHELNGHYMDQFTYAERATDWRGNN
FT                   NIADSIFRQMRNEPHPVPRFIVMSAGTGGTSATIGRYIRCQGYDTQLMVVDPENSVFLP
FT                   YWQDRDASLRSPVGSKIEGIGRPRVEPSFIPDVVDEMLRVPDAASVATAHWLETQLGRK
FT                   VGASTGTNMWGALQLAARMREAGETGAIVTLLCDSGDRYLDTYYHPSWVSDHIGDLTPW
FT                   SAAIAKLLTGD"
FT   gene            497811..498269
FT                   /locus_tag="SeAg_B0499"
FT   CDS_pept        497811..498269
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0499"
FT                   /product="glutamate uptake regulatory protein"
FT                   /note="identified by match to protein family HMM PF01037"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0499"
FT                   /db_xref="EnsemblGenomes-Tr:ACH50789"
FT                   /db_xref="GOA:B5EXJ9"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR019885"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B5EXJ9"
FT                   /protein_id="ACH50789.1"
FT                   /translation="MLDKIDRKLLCLLQQDCTLSLQALADAVNLTTTPCWKRLKRLEDD
FT                   GILLGRVALLDPEKLGLGLTAFVLIKTQHHSSEWYCRFVTVVSEMPEVLGFWRMAGEYD
FT                   YLMRVQVADMKRYDDFYKRLVNSVPGLSDVTSSFAMEQIKYTTSLPIE"
FT   gene            498310..500082
FT                   /locus_tag="SeAg_B0500"
FT   CDS_pept        498310..500082
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0500"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005;
FT                   match to protein family HMM PF00664"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0500"
FT                   /db_xref="EnsemblGenomes-Tr:ACH52222"
FT                   /db_xref="GOA:B5EXK0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:B5EXK0"
FT                   /protein_id="ACH52222.1"
FT                   /translation="MRLFAQLSWYFRREWRRYLGAVALLMLIAMLQLIPPKVVGIVVDG
FT                   VTAQHFTPGRIAMWIGTIALIAVVVYLLRYVWRVLLFGASYQLAVELREDYYRQLSRQH
FT                   PEFYQRHRTGDLIARATNDVDRVVFAAGEGVLTLVDSLVMGCAVLIVMSTQISWQLTLL
FT                   ALLPMPIMALMIKRYGDRLHDYFKLAQAAFSSLNDRTQESLTSIRMIKAFGLEDRQSSL
FT                   FAADAEDTGKKNMRVARIDARFDPTIYIAIGMANLLAISGGSWMVVNGSLTLGELTSFM
FT                   MYLGLMIWPMLALAWMFNIVERGSAAYSRIRAMLAEAPVVKDGEEPVPAGRGELTAAIR
FT                   EFCYPQTTHPALENVNFRLKPGQMLGICGPTGAGKSTILSLIQRHFDVTQGEIRFHDVP
FT                   LTHLQLDSWRSRLAVVSQTPFLFSDSIANNIALGRPEATQEEIEQVARLASVHEDILRL
FT                   PQGYDTQVGERGVMLSGGQKQRISIARALLLNAEILLLDDALSAVDGRTEHRILHNLRQ
FT                   WGEGRTVIISAHRLSALTDANEIIVMQHGHVVQRGDHDQLAQQIGWYRDMYRYQQLEAA
FT                   LDDAPERGEEAANA"
FT   gene            500075..501856
FT                   /locus_tag="SeAg_B0501"
FT   CDS_pept        500075..501856
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0501"
FT                   /product="ABC-type multidrug transporter, ATP-binding
FT                   protein"
FT                   /note="identified by match to protein family HMM PF00005;
FT                   match to protein family HMM PF00664"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0501"
FT                   /db_xref="EnsemblGenomes-Tr:ACH48680"
FT                   /db_xref="GOA:B5EXK1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:B5EXK1"
FT                   /protein_id="ACH48680.1"
FT                   /translation="MRSFGQLWPTLKRLLAYGSPWRKPLSVAVIMLWIAAAAEVSGPLL
FT                   ISYFIDNMVARHHLPLGKVAGLAAAYVGLQFLAAGLHYAQSLLFNRAAVGVVQSLRTDV
FT                   MDAALRQPLSAFDTQPVGQLISRVTNDTEVIRDLYVTVVATVLRSAALIGAMLVAMFSL
FT                   DWRMALVAILIFPAVLTVMIIYQRYSTPIVRRVRAYLADINDGFNEIINGMSVIQQFRQ
FT                   QARFGERMGEASRSHYMARMQTLRLDGFLLRPLLSLFSALILCGLLMLFSFTSAGTIEV
FT                   GVLYAFISYLSRLNEPLIELTTQQSMLQQAVVAGERVFELMDRPRQRYGSDDRPLQSGA
FT                   IDIDHLSFAYRDDNLVLQDITLSVPSRSFVALVGHTGSGKSTLASLLMGYYPLTQGEIR
FT                   LDGREISSLNHRVLRQGVAMVQQDPVVMADTFLANVTLGRDVSEAQVWQALETVQLADL
FT                   ARGLSDGLHTHLGEQGNTLSVGQKQLLALARVLVDAPQILILDEATASIDSGTEQAIQQ
FT                   ALAAIRERTTLVVIAHRLSTIVEADTILVLHRGQAVERGTHQQLLAAQGRYWQMYQLQL
FT                   VGEELAASVHEEPGPAA"
FT   gene            501890..502018
FT                   /locus_tag="SeAg_B0502"
FT   CDS_pept        501890..502018
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0502"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0502"
FT                   /db_xref="EnsemblGenomes-Tr:ACH50224"
FT                   /db_xref="UniProtKB/TrEMBL:B5EXK2"
FT                   /protein_id="ACH50224.1"
FT                   /translation="MHRRGAFFFPCFDFGARQYKDAPLTALFLARQLLAHPLQYPF"
FT   gene            502069..502407
FT                   /locus_tag="SeAg_B0503"
FT   CDS_pept        502069..502407
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0503"
FT                   /product="nitrogen regulatory protein P-II"
FT                   /note="identified by match to protein family HMM PF00543"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0503"
FT                   /db_xref="EnsemblGenomes-Tr:ACH49714"
FT                   /db_xref="GOA:B5EXK3"
FT                   /db_xref="InterPro:IPR002187"
FT                   /db_xref="InterPro:IPR002332"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="InterPro:IPR017918"
FT                   /db_xref="UniProtKB/TrEMBL:B5EXK3"
FT                   /protein_id="ACH49714.1"
FT                   /translation="MKLVTVIIKPFKLEDVREALSSIGIQGLTVTEVKGFGRQKGHAEL
FT                   YRGAEYSVNFLPKVKIDVAIADDQLEEVIDIISKAAYTGKIGDGKIFVAELMRVIRIRT
FT                   GEADEAAL"
FT   gene            502439..503725
FT                   /locus_tag="SeAg_B0504"
FT   CDS_pept        502439..503725
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0504"
FT                   /product="ammonium transporter NrgA"
FT                   /note="identified by match to protein family HMM PF00909;
FT                   match to protein family HMM TIGR00836"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0504"
FT                   /db_xref="EnsemblGenomes-Tr:ACH49165"
FT                   /db_xref="GOA:B5EXK4"
FT                   /db_xref="InterPro:IPR001905"
FT                   /db_xref="InterPro:IPR002229"
FT                   /db_xref="InterPro:IPR018047"
FT                   /db_xref="InterPro:IPR024041"
FT                   /db_xref="InterPro:IPR029020"
FT                   /db_xref="UniProtKB/TrEMBL:B5EXK4"
FT                   /protein_id="ACH49165.1"
FT                   /translation="MKIAMIKTTLASLALLPGLTIAAPAVADKADSAFMMICTALVLFM
FT                   TIPGIALFYGGLIRAKNVLSMLTQVTVTFALVCILWVVYGYSLAFGEGNHFFGNVDGAM
FT                   LKNIALTAVTGTIYQYIHVAFQGSFACITVGLIVGALAERIRFSAVLIFVVVWFTLSYI
FT                   PIAHMVWGGGLLAAHGALDFAGGTVVHINAAIAGLVGAYLIGKRVGFGKEAFKPHNLPM
FT                   VFTGTAILYIGWFGFNAGSAGSANEIAALAFVNTVVATAAAILGWIIGEWTLRGKPSLL
FT                   GACSGAIAGLVGVTPACGYVGVGGALVIGVIAGLAGLWGVTMLKRLLRVDDPCDVFGVH
FT                   GVCGIIGCILTGVFAASSLGGVGFVDGVTMGHQVMVQLESIAITVVWSGVVAFVGYKLA
FT                   DILVGLRVPEEQEREGLDVNSHGENAYNA"
FT   gene            complement(503825..504685)
FT                   /gene="tesB"
FT                   /locus_tag="SeAg_B0505"
FT   CDS_pept        complement(503825..504685)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tesB"
FT                   /locus_tag="SeAg_B0505"
FT                   /product="acyl-CoA thioesterase II"
FT                   /EC_number="3.1.2.-"
FT                   /note="identified by match to protein family HMM PF02551;
FT                   match to protein family HMM TIGR00189"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0505"
FT                   /db_xref="EnsemblGenomes-Tr:ACH48671"
FT                   /db_xref="GOA:B5EXK5"
FT                   /db_xref="InterPro:IPR003703"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:B5EXK5"
FT                   /protein_id="ACH48671.1"
FT                   /translation="MSQTLNNLLTLLNLEKIEEGLFRGQSEDLGLRQVFGGQVVGQALY
FT                   AAKETVPEARLVHSFHSYFLRPGDSQKPIIYDVEVLRDGNSFSARRVAAIQNGKPIFYM
FT                   TASFQAPEPGFEHQKTMPTAVGPEGLPSETEIAQSLAHLLPPILKEKFLCDRPLEIRPV
FT                   EFHNPLKGHVAAPVRQVWIRANGTVPDDIRVHQYLLGYASDLNFLPVALQPHGIGFLEK
FT                   GIQIATIDHSMWFHRPFNFNEWLLYSVESTSASSARGFVRGEFYTQDGALVASTVQEGV
FT                   MRNHN"
FT   gene            504900..505469
FT                   /locus_tag="SeAg_B0506"
FT   CDS_pept        504900..505469
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0506"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0506"
FT                   /db_xref="EnsemblGenomes-Tr:ACH52239"
FT                   /db_xref="InterPro:IPR039366"
FT                   /db_xref="UniProtKB/TrEMBL:B5EXK6"
FT                   /protein_id="ACH52239.1"
FT                   /translation="MKLVHIVSGLAVAISLAACADKSADIQTPAPNPNMSITANQSTIQ
FT                   QPNVSGTVWIRQKVALPPDAVLTVTLSDASLADAPSKVLSQKAVRTEGKQAPFSFVLPF
FT                   NPSDIQPNARILLSAAITVDNKLVFITDSVKPVINNGGTKADLTLVPVQQTAVPVQASG
FT                   GATTTVPSTSPTQVNPSSAVPAPTQY"
FT   gene            complement(505502..505891)
FT                   /locus_tag="SeAg_B0507"
FT   CDS_pept        complement(505502..505891)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0507"
FT                   /product="methylated-DNA-[protein]-cysteine
FT                   S-methyltransferase"
FT                   /EC_number="2.1.1.63"
FT                   /note="identified by match to protein family HMM PF01035;
FT                   match to protein family HMM TIGR00589"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0507"
FT                   /db_xref="EnsemblGenomes-Tr:ACH51845"
FT                   /db_xref="GOA:B5EXK7"
FT                   /db_xref="InterPro:IPR014048"
FT                   /db_xref="InterPro:IPR036217"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:B5EXK7"
FT                   /protein_id="ACH51845.1"
FT                   /translation="MLVSCASGLSSPLIPDYPEALTQDSIMDIQDTFPQRVWQIVASIP
FT                   EGFVTTYGDVARLAGSPRAARQVGGVLKRLPEGSTLPWHRVVNRHGAISLTGPDLQRQR
FT                   QALLTEGVVVSGSGQIDLQRYRWVY"
FT   gene            505976..506073
FT                   /gene="srpB"
FT                   /locus_tag="SeAg_B0508"
FT   ncRNA           505976..506073
FT                   /gene="srpB"
FT                   /locus_tag="SeAg_B0508"
FT                   /product="Bacterial signal recognition particle RNA"
FT                   /ncRNA_class="SRP_RNA"
FT   gene            complement(506122..507672)
FT                   /locus_tag="SeAg_B0509"
FT   CDS_pept        complement(506122..507672)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0509"
FT                   /product="cyclic diguanylate phosphodiesterase (EAL) domain
FT                   protein"
FT                   /note="identified by match to protein family HMM PF00563"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0509"
FT                   /db_xref="EnsemblGenomes-Tr:ACH51213"
FT                   /db_xref="GOA:B5EXK8"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR024744"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:B5EXK8"
FT                   /protein_id="ACH51213.1"
FT                   /translation="MTTRHLVSLVTGVLILSVLFPIGLSLWLAHRQVEKRFNEELDIFS
FT                   SRVALRTERVSDQAKAALTHIASFKGEPCSSAHLLAMRRVSYSFRYVQEVLYLKNSIPV
FT                   CSSLEKESHIPAFPPPMKITRDGYRAWFTAQNDLGIKRYMAALGSDSYIVMIDPASFID
FT                   VIPFGAWPINVAIIGRERNTVVASSGNLDPAILPLIHHETPLRLENRGIQYAIHPFPEM
FT                   GITIVSWAPTAPLERSWYRQAFIWLPAGIVTGLLAAAFILRILRRLQSPRHRLQDAIDN
FT                   REINVHYQPIVSLSSGKIVGAEALARWQQADGTFLSPEIFIALAEQTGLTEPLTRLIIE
FT                   TVFEDMGSWLKSHPEQHISINLEASDLASETLPTLLSTLLNRSQISPSQIALELTEREF
FT                   ADPKTSAPIVARYRNAGHSIYIDDFGTGYSSLSYLQNLDVDVLKIDKSFVDALEYKNVT
FT                   PHIIEMAKTLKLKMVAEGIETTRQEQWLRQHGVHYGQGWLYSKPLPATAFILWAEQRL"
FT   gene            507897..508157
FT                   /gene="rpmE"
FT                   /locus_tag="SeAg_B0510"
FT   CDS_pept        507897..508157
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmE"
FT                   /locus_tag="SeAg_B0510"
FT                   /product="ribosomal protein L31"
FT                   /note="identified by match to protein family HMM PF01197;
FT                   match to protein family HMM TIGR00105"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0510"
FT                   /db_xref="EnsemblGenomes-Tr:ACH50294"
FT                   /db_xref="GOA:B5EXK9"
FT                   /db_xref="InterPro:IPR002150"
FT                   /db_xref="InterPro:IPR027493"
FT                   /db_xref="InterPro:IPR034704"
FT                   /db_xref="InterPro:IPR042105"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5EXK9"
FT                   /protein_id="ACH50294.1"
FT                   /translation="MKPDIHPVYRTVVFHDTSANEYVKVGSTIKTEREIELDGVTYPYV
FT                   TIDVSSKSHPFYTGRQKTFDSESSAARFQKRFGHFIGAKRG"
FT   gene            508163..508303
FT                   /gene="rpmJ"
FT                   /locus_tag="SeAg_B0511"
FT   CDS_pept        508163..508303
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmJ"
FT                   /locus_tag="SeAg_B0511"
FT                   /product="ribosomal protein L36"
FT                   /note="identified by match to protein family HMM PF00444;
FT                   match to protein family HMM TIGR01022"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0511"
FT                   /db_xref="EnsemblGenomes-Tr:ACH49620"
FT                   /db_xref="GOA:B5EXL0"
FT                   /db_xref="InterPro:IPR000473"
FT                   /db_xref="InterPro:IPR035977"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5EXL0"
FT                   /protein_id="ACH49620.1"
FT                   /translation="MQVLNSLRNAKQRHPDCQIVKRKGRLYVICKTNPRFKAVQGRKKR
FT                   R"
FT   gene            complement(508359..508829)
FT                   /locus_tag="SeAg_B0512"
FT   CDS_pept        complement(508359..508829)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0512"
FT                   /product="inner membrane protein YlaC"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0512"
FT                   /db_xref="EnsemblGenomes-Tr:ACH51890"
FT                   /db_xref="GOA:B5EXL1"
FT                   /db_xref="InterPro:IPR019713"
FT                   /db_xref="UniProtKB/TrEMBL:B5EXL1"
FT                   /protein_id="ACH51890.1"
FT                   /translation="MTEIQRLLSETIDDLNVREKRDNRPRFSISFIRKHPGLFIAMYAA
FT                   WFATLAVMLQSETLVGSVWLLVVLFIAFNGFFFFDIAPRYHYNDIDVLDLRVCYNGEWY
FT                   NTRFVPPTLIETILQSPQVDNEHKVQLQKMVARKGELSFYDIFTLARAEASR"
FT   gene            complement(508947..509498)
FT                   /locus_tag="SeAg_B0513"
FT   CDS_pept        complement(508947..509498)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0513"
FT                   /product="maltose O-acetyltransferase"
FT                   /EC_number="2.3.1.79"
FT                   /note="identified by match to protein family HMM PF00132"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0513"
FT                   /db_xref="EnsemblGenomes-Tr:ACH51365"
FT                   /db_xref="GOA:B5EXL2"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR024688"
FT                   /db_xref="UniProtKB/TrEMBL:B5EXL2"
FT                   /protein_id="ACH51365.1"
FT                   /translation="MSDEKQKMIAGALYCPTDETLCQDRLRARQLIHQYNYTTPDEINK
FT                   RQAILRDLLGRCEDAYIEPSFRCDYGYNIFLGHSFYANFDCVMLDVCPIHIGDNCMLAP
FT                   GVHIYTATHPLDAVERNSGRELGKPVTIGNNVWIGGRAVVNPGVTIGDNVVVASGAVVT
FT                   KNVPPDVVVGGNPARIIKKL"
FT   gene            complement(509677..509895)
FT                   /locus_tag="SeAg_B0514"
FT   CDS_pept        complement(509677..509895)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0514"
FT                   /product="haemolysin expression modulating protein"
FT                   /note="identified by match to protein family HMM PF05321"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0514"
FT                   /db_xref="EnsemblGenomes-Tr:ACH49694"
FT                   /db_xref="InterPro:IPR007985"
FT                   /db_xref="InterPro:IPR036666"
FT                   /db_xref="UniProtKB/TrEMBL:B5EXL3"
FT                   /protein_id="ACH49694.1"
FT                   /translation="MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYS
FT                   AADHRLAELTMNKLYDKIPSSVWKFIR"
FT   gene            complement(509923..510297)
FT                   /locus_tag="SeAg_B0515"
FT   CDS_pept        complement(509923..510297)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0515"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0515"
FT                   /db_xref="EnsemblGenomes-Tr:ACH50086"
FT                   /db_xref="InterPro:IPR019693"
FT                   /db_xref="UniProtKB/TrEMBL:B5EXL4"
FT                   /protein_id="ACH50086.1"
FT                   /translation="MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVN
FT                   LQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYLDDTFMLFSSYGINTQDLQKWRKSG
FT                   NRLFRCFVNATRANPVSLSC"
FT   gene            complement(510793..513942)
FT                   /gene="acrB"
FT                   /locus_tag="SeAg_B0516"
FT   CDS_pept        complement(510793..513942)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="acrB"
FT                   /locus_tag="SeAg_B0516"
FT                   /product="acriflavine resistance protein B"
FT                   /note="identified by match to protein family HMM PF00873;
FT                   match to protein family HMM TIGR00915"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0516"
FT                   /db_xref="EnsemblGenomes-Tr:ACH50704"
FT                   /db_xref="GOA:B5EXL5"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR004764"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:B5EXL5"
FT                   /protein_id="ACH50704.1"
FT                   /translation="MPNFFIDRPIFAWVIAIIIMLAGGLAILKLPVAQYPTIAPPAVTI
FT                   SATYPGADAKTVQDTVTQVIEQNMNGIDNLMYMSSNSDSTGTVQITLTFESGTDADIAQ
FT                   VQVQNKLQLAMPLLPQEVQQQGVSVEKSSSSFLMVVGVINTDGTMTQEDISDYVAANMK
FT                   DPISRTSGVGDVQLFGSQYAMRIWMNPTELTKYQLTPVDVINAIKAQNAQVAAGQLGGT
FT                   PPVKGQQLNASIIAQTRLTSTDEFGKILLKVNQDGSQVRLRDVAKIELGGENYDVIAKF
FT                   NGQPASGLGIKLATGANALDTATAIRAELKKMEPFFPPGMKIVYPYDTTPFVKISIHEV
FT                   VKTLVEAIILVFLVMYLFLQNFRATLIPTIAVPVVLLGTFAVLAAFGFSINTLTMFGMV
FT                   LAIGLLVDDAIVVVENVERVMTEEGLPPKEATRKSMGQIQGALVGIAMVLSAVFIPMAF
FT                   FGGSTGAIYRQFSITIVSAMALSVLVALILTPALCATMLKPVAKGDHGEGKKGFFGWFN
FT                   RLFDKSTHHYTDSVGNILRSTGRYLLLYLIIVVGMAYLFVRLPSSFLPDEDQGVFLTMV
FT                   QLPAGATQERTQKVLDEVTDYYLNKEKANVESVFAVNGFGFAGRGQNTGIAFVSLKDWA
FT                   DRPGEKNKVEAITQRATAAFSQIKDAMVFAFNLPAIVELGTATGFDFELIDQAGLGHEK
FT                   LTQARNQLFGEVAKYPDLLVGVRPNGLEDTPQFKIDIDQEKAQALGVSISDINTTLGAA
FT                   WGGSYVNDFIDRGRVKKVYVMSEAKYRMLPDDINDWYVRGSDGQMVPFSAFSSSRWEYG
FT                   SPRLERYNGLPSMEILGQAAPGKSTGEAMAMMEELASKLPSGIGYDWTGMSYQERLSGN
FT                   QAPALYAISLIVVFLCLAALYESWSIPFSVMLVVPLGVIGALLAATFRGLTNDVYFQVG
FT                   LLTTIGLSAKNAILIVEFAKDLMDKEGKGLVEATLEAVRMRLRPILMTSLAFMLGVMPL
FT                   VISSGAGSGAQNAVGTGVLGGMVTATVLAIFFVPVFFVVVRRRFSRKSEDIEHSHSTEH
FT                   R"
FT   gene            complement(513965..515158)
FT                   /gene="acrA"
FT                   /locus_tag="SeAg_B0517"
FT   CDS_pept        complement(513965..515158)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="acrA"
FT                   /locus_tag="SeAg_B0517"
FT                   /product="acriflavine resistance protein A"
FT                   /note="identified by match to protein family HMM PF00529;
FT                   match to protein family HMM TIGR01730"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0517"
FT                   /db_xref="EnsemblGenomes-Tr:ACH49410"
FT                   /db_xref="GOA:B5EXL6"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:B5EXL6"
FT                   /protein_id="ACH49410.1"
FT                   /translation="MNKNRGLTPLAVVLMLSGSLALTGCDDKQDQQGGQQMPEVGVVTL
FT                   KTEPLQITTELPGRTVAYRIAEVRPQVSGIILKRNFVEGSDIEAGVSLYQIDPATYQAT
FT                   YDSAKGDLAKAQAAANIAELTVKRYQKLLGTQYISKQEYDQALADAQQATAAVVAAKAA
FT                   VETARINLAYTKVTSPISGRIGKSSVTEGALVQNGQASALATVQQLDPIYVDVTQSSND
FT                   FLRLKQELANGSLKQENGKAKVDLVTSDGIKFPQSGTLEFSDVTVDQTTGSITLRAIFP
FT                   NPDHTLLPGMFVRARLQEGTKPTALLVPQQGVTRTPRGDATVLVVGADNKVETRQIVAS
FT                   QAIGDKWLVTDGLKAGDRVVVSGLQKVRPGAQVKVQEITADNKQQAASGDQPAQPRS"
FT   gene            515300..515953
FT                   /gene="acrR"
FT                   /locus_tag="SeAg_B0518"
FT   CDS_pept        515300..515953
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="acrR"
FT                   /locus_tag="SeAg_B0518"
FT                   /product="transcriptional regulator AcrR"
FT                   /note="identified by match to protein family HMM PF00440;
FT                   match to protein family HMM PF08361"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0518"
FT                   /db_xref="EnsemblGenomes-Tr:ACH52182"
FT                   /db_xref="GOA:B5EXL7"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR013572"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:B5EXL7"
FT                   /protein_id="ACH52182.1"
FT                   /translation="MARKTKQQALETRQHILDVALRLFSQQGVSATSLAEIANAAGVTR
FT                   GAIYWHFKNKSDLFSEIWELSESNIGELEIEYQAKFPDDPLSVLREILVHILEATVTEE
FT                   RRRLLMEIIFHKCEFVGEMVVVQQAQRSLCLESYDRIEQTLKHCINAKMLPENLLTRRA
FT                   AILMRSFISGLMENWLFAPQSFDLKKEARAYVTILLEMYQLCPTLRASTVNGSP"
FT   gene            516072..519434
FT                   /locus_tag="SeAg_B0519"
FT   CDS_pept        516072..519434
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0519"
FT                   /product="potassium efflux system KefA"
FT                   /note="identified by match to protein family HMM PF00924"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0519"
FT                   /db_xref="EnsemblGenomes-Tr:ACH52902"
FT                   /db_xref="GOA:B5EXL8"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="InterPro:IPR006686"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR011014"
FT                   /db_xref="InterPro:IPR011066"
FT                   /db_xref="InterPro:IPR023408"
FT                   /db_xref="InterPro:IPR024393"
FT                   /db_xref="InterPro:IPR025692"
FT                   /db_xref="UniProtKB/TrEMBL:B5EXL8"
FT                   /protein_id="ACH52902.1"
FT                   /translation="MTMLQLYKRSQHFVFITISVLIILLSCQSLAFARGQTNGDLPSKA
FT                   DVQNQLDTLNKQKDLSAQDKLVQQDLIDTLATLDKIERVKEETVQLRQKVAQAPEKMRQ
FT                   ATAALNALSDVDNDDEMRKTLSALSLRQLELRVAQVLDDLQNSQNDLAAYNSQLVSLQT
FT                   QPERVQNAMYTASQQIQQIRNRLDGNNVGEAALRPSQQVLLQAQQALLNAQIDQQRKSL
FT                   EGNTVLQDTLQKQRDYVTANSNRLEHQLQLLQEAVNSKRLTLTEKTAQEAISPDETARI
FT                   QANPLVKQELDINHQLSQRLIVATENGNMLMQQNIKVKNWLDRALQSERNIKEQIAVLK
FT                   GSLLLSRILYQQQQTLPSADELEDMTNRIADLRLEQFEINQQRDALFQSDAFVDKLEEG
FT                   HTSEVNDEVHDALLQVVEMRRELLDQLNKQLGNQLMMAINLQVNQQQLMSVSKNLKAIL
FT                   TQQIFWVNSNRPMDWDWLKAFPQTLKEQFSAMKITVNWQKAWPAVFIAFLAGLPLLLIA
FT                   GLIRWRLKWLKAYQQKLAAAVGSLRNDSQLNTPKAILIDLIRALPVCLIILALGLILLT
FT                   MQLNISDLLWAFSKKLAMFWLVFGLCWKVLEKEGVAIRHFGMPAQLTSHWRRQIVRISL
FT                   ALLPLHFWSVVAELSPLNLMDDVLGQAVIFLNLLVITLLVWPLCRESWRDKESHGIRLV
FT                   TVTILSIIPVALMVLTATGYFYTTLRLAGRWIETVYLVIIWNLLYQTVLRGLSVAARRI
FT                   AWRRALARRQNLVKEGAEGAEPQEEPTIALEQINQQTLRITMLLMLALFGVMFWAIWSD
FT                   LITVFSYLDSITLWHYNGSEAGAAVVKSVTMGSLLFAIIAAMVAWALIRNLPGLLEVLV
FT                   LSRLNMRQGASYAITTILNYVIIAVGAMTVFGSLGVSWDKLQWLAAALSVGLGFGLQEI
FT                   FGNFVSGLIILFERPVRIGDTVTIGTYSGTVSKIRIRATTITDFDRKEVIIPNKAFVTE
FT                   RLINWSLSDTTTRLVIRLGVAYGSDLEKVKRVLLQAAMEHPKVMHDPEPAVFFTTFGAS
FT                   TLDHELRLYVRELRDRSHTVDELNRAIDRLCRENDINIAFNQLEVHLHNAKGDEVTEVK
FT                   RDLNGGDLAPTAS"
FT   gene            complement(519476..520399)
FT                   /locus_tag="SeAg_B0520"
FT   CDS_pept        complement(519476..520399)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0520"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF04754;
FT                   match to protein family HMM TIGR01784"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0520"
FT                   /db_xref="EnsemblGenomes-Tr:ACH51139"
FT                   /db_xref="InterPro:IPR006842"
FT                   /db_xref="InterPro:IPR010106"
FT                   /db_xref="UniProtKB/TrEMBL:B5EXL9"
FT                   /protein_id="ACH51139.1"
FT                   /translation="MERLPTTPHDAVFRQMLMQKEVARDFLALHMPEDFLAICDLDSLK
FT                   LESGSFVEDNLRSRYSDILYSLHTQHGPGYVYALIEHQSKSDRLMAFRLMRYAIAAMQR
FT                   HLDAGHDTLPLVVPILFYHGPESPWPYSLNWHNMFVKPDMAKALYSHEFALVDLTTMPD
FT                   NQLLQHRRIAMLELLQKHIRQRDLSELLDPLITLLTQDYLTDAQLSVLINYMLKAGNAA
FT                   EPGALIRQLAQGAPQYKEQLMTIAEWLEEKGRTEGLQKGLEQGLAQGREAEARAIARKM
FT                   LANGLEPGLIASVTGITPEELSTLSH"
FT   gene            complement(520469..520636)
FT                   /locus_tag="SeAg_B0521"
FT   CDS_pept        complement(520469..520636)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0521"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0521"
FT                   /db_xref="EnsemblGenomes-Tr:ACH49736"
FT                   /db_xref="InterPro:IPR019630"
FT                   /db_xref="UniProtKB/TrEMBL:B5EXM0"
FT                   /protein_id="ACH49736.1"
FT                   /translation="MSLENAPDEVKLAVDLIVLLEENRLPARTVLRALEIVMRDYENKL
FT                   KSTEDDSQTE"
FT   gene            complement(520650..521165)
FT                   /locus_tag="SeAg_B0522"
FT   CDS_pept        complement(520650..521165)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0522"
FT                   /product="primosomal replication protein N''"
FT                   /note="identified by match to protein family HMM PF07445"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0522"
FT                   /db_xref="EnsemblGenomes-Tr:ACH52802"
FT                   /db_xref="InterPro:IPR010890"
FT                   /db_xref="InterPro:IPR038338"
FT                   /db_xref="UniProtKB/TrEMBL:B5EXM1"
FT                   /protein_id="ACH52802.1"
FT                   /translation="MLLQTLEERLATLRQRCAPLAQHATLSARFDRHLFRTRSTLLQGY
FT                   LEEADANLAALRQAVKHEQLPQVAWLAEHLASQLEAISRETAAWSLRQWDTAAPGLGRW
FT                   QRRRIQHQEFERRLLAMTQERKIRLAQATGLVEQQTLQKEVEIYEGRLARCRHALEKIE
FT                   NVLARLTR"
FT   gene            521228..521344
FT                   /locus_tag="SeAg_B0523"
FT   CDS_pept        521228..521344
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0523"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0523"
FT                   /db_xref="EnsemblGenomes-Tr:ACH52536"
FT                   /db_xref="UniProtKB/TrEMBL:B5EXM2"
FT                   /protein_id="ACH52536.1"
FT                   /translation="MITIRIMQRTILIIIGWLAVVLGTLGADESPNDFGKNH"
FT   gene            complement(521352..521421)
FT                   /locus_tag="SeAg_B0525"
FT   ncRNA           complement(521352..521421)
FT                   /locus_tag="SeAg_B0525"
FT                   /product="RNA-OUT"
FT                   /ncRNA_class="antisense_RNA"
FT   gene            521414..522622
FT                   /locus_tag="SeAg_B0524"
FT   CDS_pept        521414..522622
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0524"
FT                   /product="IS10 transposase"
FT                   /note="identified by match to protein family HMM PF01609"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0524"
FT                   /db_xref="EnsemblGenomes-Tr:ACH52050"
FT                   /db_xref="GOA:B5EXM3"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:B5EXM3"
FT                   /protein_id="ACH52050.1"
FT                   /translation="MCELDILHDSLYQFCPELHLKRLNSLTLACHALLDCKTLTLTELG
FT                   RNLPTKARTKHNIKRIDRLLGNRHLHKERLAVYRWHASFICSGNTMPIVLVDWSDIREQ
FT                   KRLMVLRASVALHGRSVTLYEKAFPLSEQCSKKAHDQFLADLASILPSNTTPLIVSDAG
FT                   FKVPWYKSVEKLGWYWLSRVRGKVQYADLGAENWKPISNLHDMSSSHSKTLGYKRLTKS
FT                   NPISCQILLYKSRSKGRKNQRSTRTHCHHPSPKIYSASAKEPWILATNLPVEIRTPKQL
FT                   VNIYSKRMQIEETFRDLKSPAYGLGLRHSRTSSSERFDIMLLIALMLQLTCWLAGVHAQ
FT                   KQGWDKHFQANTVRNRNVLSTVRLGMEVLRHSGYTITREDLLVAATLLAQNLFTHGYAL
FT                   GKL"
FT   gene            522638..522961
FT                   /locus_tag="SeAg_B0526"
FT   CDS_pept        522638..522961
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0526"
FT                   /product="inner membrane protein YbaN"
FT                   /note="identified by match to protein family HMM PF04304"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0526"
FT                   /db_xref="EnsemblGenomes-Tr:ACH51495"
FT                   /db_xref="GOA:B5EXM4"
FT                   /db_xref="InterPro:IPR007401"
FT                   /db_xref="UniProtKB/TrEMBL:B5EXM4"
FT                   /protein_id="ACH51495.1"
FT                   /translation="MGVVLPLLPTTPFILLAAWCFARSSPRFHAWLLYRSWFGGYLRHW
FT                   QRYRAMPPGAKPRAIALILLTFGISLWLVNMMWVRVLLLVILACLLIFMWRIPVIDEKQ
FT                   QKR"
FT   gene            523114..523665
FT                   /gene="apt"
FT                   /locus_tag="SeAg_B0527"
FT   CDS_pept        523114..523665
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="apt"
FT                   /locus_tag="SeAg_B0527"
FT                   /product="adenine phosphoribosyltransferase"
FT                   /EC_number="2.4.2.7"
FT                   /note="identified by match to protein family HMM PF00156;
FT                   match to protein family HMM TIGR01090"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0527"
FT                   /db_xref="EnsemblGenomes-Tr:ACH50995"
FT                   /db_xref="GOA:B5EXM5"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005764"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5EXM5"
FT                   /protein_id="ACH50995.1"
FT                   /translation="MTATAQQLEFLKNSIKSIQDYPKPGILFRDVTSLLEDPKAYALSI
FT                   ELLVERYKNAGITKVVGTEARGFLFGAPVALGLGVGFVPVRKPRKLPRETIAETYELEY
FT                   GTDQLEIHVDAIKPGDNVLVVDDLLATGGTIEATVKLIRRLGGKVTDAAFIINLFDLGG
FT                   EQRLEKQGITCYSLVPFPGH"
FT   gene            523779..525707
FT                   /gene="dnaX"
FT                   /locus_tag="SeAg_B0528"
FT   CDS_pept        523779..525707
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaX"
FT                   /locus_tag="SeAg_B0528"
FT                   /product="DNA polymerase III, tau subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="identified by match to protein family HMM PF00004;
FT                   match to protein family HMM TIGR02397"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0528"
FT                   /db_xref="EnsemblGenomes-Tr:ACH48688"
FT                   /db_xref="GOA:B5EXM6"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR012763"
FT                   /db_xref="InterPro:IPR021029"
FT                   /db_xref="InterPro:IPR022001"
FT                   /db_xref="InterPro:IPR022754"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038249"
FT                   /db_xref="UniProtKB/TrEMBL:B5EXM6"
FT                   /protein_id="ACH48688.1"
FT                   /translation="MSYQVLARKWRPQTFADVVGQEHVLTALANGLSLGRIHHAYLFSG
FT                   TRGVGKTSIARLLAKGLNCETGITATPCGVCDNCREIEQGRFVDLIEIDAASRTKVEDT
FT                   RDLLDNVQYAPARGRFKVYLIDEVHMLSRHSFNALLKTLEEPPAHVKFLLATTDPQKLP
FT                   VTILSRCLQFHLKALDVEQIRHQLEHILNEEHIAHEPRALQLLSRAADGSLRDALSLTD
FT                   QAIASGDGQVSTQAVSAMLGTLDDDQALSLVEAVVDANGERVMSLINEAAARGIEWEAL
FT                   LVEMLSLLHRIAMVQLSPAALGSDMAAIEQRMRELARTVPPGDLQLYYQTLLIGRKELP
FT                   WAPDRRMGVEMTLLRALAFHPRMPLPEPETPRQSFAPVAPTAVMTPPQVQQQSAPAPQT
FT                   SPAPLPASTSQVLAARNQLQRSQGVTKTKKSEPAAASRARPVNNSALERLASVSERVQA
FT                   RPAPSALETAPVKKEAYRWKATTPVVQTKEVVATPKALKKALEHEKTPELAAKLAAEAI
FT                   ERDPWAAQVSQLSLPKLVEQVALNAWKEQNGNAVCLHLRSTQRHLNSSGAQQKLAQALS
FT                   DLTGTTVELTIVEDDNPAVRTPLEWRQAIYEEKLAQARESIIADNNIQTLRRFFDAELD
FT                   EESIRPI"
FT   misc_feature    525040..525104
FT                   /gene="dnaX"
FT                   /locus_tag="SeAg_B0528"
FT                   /note="DnaX ribosomal frameshifting element"
FT   gene            525753..526082
FT                   /locus_tag="SeAg_B0530"
FT   CDS_pept        525753..526082
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0530"
FT                   /product="conserved hypothetical protein TIGR00103"
FT                   /note="identified by match to protein family HMM PF02575;
FT                   match to protein family HMM TIGR00103"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0530"
FT                   /db_xref="EnsemblGenomes-Tr:ACH49940"
FT                   /db_xref="GOA:B5EXM7"
FT                   /db_xref="InterPro:IPR004401"
FT                   /db_xref="InterPro:IPR036894"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5EXM7"
FT                   /protein_id="ACH49940.1"
FT                   /translation="MFGKGGLGNLMKQAQQMQEKMQKMQEEIAQLEVTGESGAGLVKVT
FT                   INGAHNCRRVEIDPSLLEDDKEMLEDLVAAAFNDAARRIEETQKEKMASVSSGMQLPPG
FT                   FKMPF"
FT   gene            526082..526687
FT                   /gene="recR"
FT                   /locus_tag="SeAg_B0531"
FT   CDS_pept        526082..526687
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recR"
FT                   /locus_tag="SeAg_B0531"
FT                   /product="recombination protein RecR"
FT                   /note="identified by match to protein family HMM PF01751;
FT                   match to protein family HMM PF02132; match to protein
FT                   family HMM TIGR00615"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0531"
FT                   /db_xref="EnsemblGenomes-Tr:ACH49447"
FT                   /db_xref="GOA:B5EXM8"
FT                   /db_xref="InterPro:IPR000093"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR015967"
FT                   /db_xref="InterPro:IPR023627"
FT                   /db_xref="InterPro:IPR023628"
FT                   /db_xref="InterPro:IPR034137"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5EXM8"
FT                   /protein_id="ACH49447.1"
FT                   /translation="MQTSPLLTQLMEALRCLPGVGPKSAQRMAFTLLQRDRSGGMRLAQ
FT                   ALTRAMSEIGHCADCRTFTEQDVCNICSNPRRQENGQICVVESPADIYAIEQTGQFSGR
FT                   YFVLMGHLSPLDGIGPDDIGLDRLEQRLASEKISELILATNPTVEGEATANYIAELCAE
FT                   AGVEASRIAHGVPVGGELEMVDGTTLSHSLAGRHKIIF"
FT   gene            526798..528672
FT                   /gene="htpG"
FT                   /locus_tag="SeAg_B0532"
FT   CDS_pept        526798..528672
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="htpG"
FT                   /locus_tag="SeAg_B0532"
FT                   /product="chaperone protein HtpG"
FT                   /note="identified by match to protein family HMM PF00183;
FT                   match to protein family HMM PF02518"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0532"
FT                   /db_xref="EnsemblGenomes-Tr:ACH48866"
FT                   /db_xref="GOA:B5EXM9"
FT                   /db_xref="InterPro:IPR001404"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR019805"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020575"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR037196"
FT                   /db_xref="UniProtKB/TrEMBL:B5EXM9"
FT                   /protein_id="ACH48866.1"
FT                   /translation="MKGQETRGFQSEVKQLLHLMIHSLYSNKEIFLRELISNASDAADK
FT                   LRFRALSNPDLYEGDGELRVRVSFDKDKRTLTIADNGVGMNRDEVIDHLGTIAKSGTKS
FT                   FLESMGSDQAKDSQLIGQFGVGFYSAFIVADKVTVRTRAAGDKPENGVFWESAGEGEYT
FT                   VADITKNDRGTEITLHLREGEDEFLDDWRVRSIISKYSDHIALPVEIEKREEKDGETVI
FT                   SWEKINKAQALWTRNKSEIKDDEYNEFYKHIAHDFTDPLTWSHNRVEGKQEYTSLLYIP
FT                   SQAPWDLWNRDHKHGLKLYVQRVFIMDDAEQFMPNYLRFVRGLIDSNDLPLNVSREILQ
FT                   DSTVTRNLRSALTKRVLQMLEKLAKDDAEKYQTFWKQFGLVLKEGPAEDHANQEAIAKL
FT                   LRFASTHTDSSAQTVSLEDYVSRMKEGQEKIYYITADSYAAAKNSPHLELLRKKGIEVL
FT                   LLSDRIDEWMMNYLTEFDGKAFQSVAKADESIEKLADEVDENAKEAEKALEPFVERVKT
FT                   LLGDRVKEVRLTHRLTDTPAIVTTDADEMSTQMAKLFAAAGQSVPEVKYIFELNPDHVL
FT                   VKRTADTEDEAQFKEWVELLLDQALFAERGTLEDPNQFIRRMNQLLVS"
FT   gene            528914..529558
FT                   /gene="adk"
FT                   /locus_tag="SeAg_B0533"
FT   CDS_pept        528914..529558
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="adk"
FT                   /locus_tag="SeAg_B0533"
FT                   /product="adenylate kinase"
FT                   /EC_number="2.7.4.3"
FT                   /note="identified by match to protein family HMM PF00406;
FT                   match to protein family HMM PF05191; match to protein
FT                   family HMM TIGR01351"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0533"
FT                   /db_xref="EnsemblGenomes-Tr:ACH51310"
FT                   /db_xref="GOA:B5EXN0"
FT                   /db_xref="InterPro:IPR000850"
FT                   /db_xref="InterPro:IPR006259"
FT                   /db_xref="InterPro:IPR007862"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033690"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5EXN0"
FT                   /protein_id="ACH51310.1"
FT                   /translation="MRIILLGAPGAGKGTQAQFIMEKYGIPQISTGDMLRAAVKSGSEL
FT                   GKQAKDIMDAGKLVTDELVIALVKERIAQEDCRNGFLLDGFPRTIPQADAMKEAGIVVD
FT                   YVLEFDVPDELIVDRIVGRRVHAASGRVYHVKFNPPKVEGKDDVTGEDLTTRKDDQEET
FT                   VRKRLVEYHQMTAPLIGYYQKEAEAGNTKYAKVDGTQAVADVRAALEKILG"
FT   gene            529637..529777
FT                   /locus_tag="SeAg_B0534"
FT   CDS_pept        529637..529777
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0534"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0534"
FT                   /db_xref="EnsemblGenomes-Tr:ACH51684"
FT                   /db_xref="UniProtKB/TrEMBL:B5EXN1"
FT                   /protein_id="ACH51684.1"
FT                   /translation="MPDGGLNALSGLLASLAPFGKFSSYLSQQLVLLYRFSATIINNLN
FT                   R"
FT   gene            529787..530749
FT                   /gene="hemH"
FT                   /locus_tag="SeAg_B0535"
FT   CDS_pept        529787..530749
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemH"
FT                   /locus_tag="SeAg_B0535"
FT                   /product="ferrochelatase"
FT                   /EC_number="4.99.1.1"
FT                   /note="identified by match to protein family HMM PF00762;
FT                   match to protein family HMM TIGR00109"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0535"
FT                   /db_xref="EnsemblGenomes-Tr:ACH49986"
FT                   /db_xref="GOA:B5EXN2"
FT                   /db_xref="InterPro:IPR001015"
FT                   /db_xref="InterPro:IPR019772"
FT                   /db_xref="InterPro:IPR033644"
FT                   /db_xref="InterPro:IPR033659"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5EXN2"
FT                   /protein_id="ACH49986.1"
FT                   /translation="MRQTKTGILLANLGTPDAPTPEAVKRYLKQFLSDRRVVDTPRLLW
FT                   WPLLRGVILPLRSPRVAKLYQSIWMDGGSPLMVYSREQQQALAARLPDTPVALGMSYGS
FT                   PSLESAVDELLASDVDHIVVLPLYPQYSCSTVGAVWDELGRILARKRRIPGISFIRDYA
FT                   DDGAYIDALAKSARESFARHGEPDVLLLSYHGIPQRYADEGDDYPQRCRDTTRELVSAL
FT                   GLPPEKVMMTFQSRFGREPWLTPYTDETLKMLGEKGTGHIQVMCPGFAADCLETLEEIA
FT                   EQNREIFLEAGGKKYAYIPALNATPEHIDMMLKLTAPYR"
FT   gene            complement(530746..531717)
FT                   /locus_tag="SeAg_B0536"
FT   CDS_pept        complement(530746..531717)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0536"
FT                   /product="acetyl esterase"
FT                   /EC_number="3.1.1.-"
FT                   /note="identified by match to protein family HMM PF07859"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0536"
FT                   /db_xref="EnsemblGenomes-Tr:ACH49761"
FT                   /db_xref="GOA:B5EXN3"
FT                   /db_xref="InterPro:IPR013094"
FT                   /db_xref="InterPro:IPR023508"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR033140"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5EXN3"
FT                   /protein_id="ACH49761.1"
FT                   /translation="MKPENKIPVLTRLSDEMKAVVNFQQPGLPPWPADGDIETQRQYYL
FT                   LERRFWNADAPSMTTRTCAVPTPYGDVTTRLYSPQPTSQATLYYLHGGGFILGNLDTHD
FT                   RIMRLLARYTGCTVIGIDYSLSPQARYPQAIEETVAVCSYFSQHADEYSLNVEKIGFAG
FT                   DSAGAMLALASALWLRDKHIRCGNVIAILLWYGLYGLQDSVSRRLFGGAWDGLTREDLD
FT                   MYEKAYLRNEDDRESPWYCLFNNDLTRDVPPCFIASAEFDPLIDDSRLLHQTLQAHQQP
FT                   CEYKMYPGTLHAFLHYSRMMTIADDALQDGARFFMARMKTPR"
FT   gene            531870..533174
FT                   /gene="gsk"
FT                   /locus_tag="SeAg_B0537"
FT   CDS_pept        531870..533174
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gsk"
FT                   /locus_tag="SeAg_B0537"
FT                   /product="inosine kinase"
FT                   /EC_number="2.7.1.73"
FT                   /note="identified by match to protein family HMM PF00294"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0537"
FT                   /db_xref="EnsemblGenomes-Tr:ACH52869"
FT                   /db_xref="GOA:B5EXN4"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:B5EXN4"
FT                   /protein_id="ACH52869.1"
FT                   /translation="MKFPGKRKSKHYFPVNARDPLLQQIQPEQETNASWVVGIDQTLVD
FT                   IEAKVDDDFITRYGLSAGHSLVIEDEVAEKLYQELTRENLITHQFAGGTIGNTMHNYSV
FT                   LADDRSVLLGVMCSNIEIGSYAYRYLCNTSSRTDLNYLQAVDGPIGRCFTLIGESGERT
FT                   FAISPGHMNQLRAESIPEAVIAGASALVLTSYLVRCKPGEPMPDATMKAIEYAKKHNVP
FT                   VVMTLGTKFVIADNPQWWQAFLKENVSILAMNEEEAEALTGENDPLLAADKALDWVDLV
FT                   LCTAGPIGLYMAGFTEEEAKRKTQHPLLPGAIAEFNQYEFSRAMRHKDCINPLRVYSHI
FT                   APYMGGPEKIMNTNGAGDGALAALLHDITANSYHRSNVPNSSKHKFTWLTYSSLAQVCK
FT                   YANRVSYQVLNQHSPRLTRGLPEREDSLEESYWDR"
FT   gene            complement(533223..534899)
FT                   /locus_tag="SeAg_B0538"
FT   CDS_pept        complement(533223..534899)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0538"
FT                   /product="inner membrane protein YbaL"
FT                   /note="identified by match to protein family HMM PF00999;
FT                   match to protein family HMM PF02254; match to protein
FT                   family HMM TIGR00932"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0538"
FT                   /db_xref="EnsemblGenomes-Tr:ACH51244"
FT                   /db_xref="GOA:B5EXN5"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR004771"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:B5EXN5"
FT                   /protein_id="ACH51244.1"
FT                   /translation="MHHATPLITTIVGGLVLAFILGMIANKLRISPLVGYLLAGVLAGP
FT                   FTPGFVADTKLAPELAELGVILLMFGVGLHFSLKDLMAVKSIAIPGAVAQIAVATLLGM
FT                   ALSAVLGWSLMTGIVFGLCLSTASTVVLLRALEERQLLDSQRGQIAIGWLIVEDLVMVL
FT                   TLVLLPAVAGMVEKGDVGIASLTVDMGITIGKVVAFIAIMMLVGRRLVPWIMARSAATG
FT                   SRELFTLSVLALALGIAFGAVELFDVSFALGAFFAGMVLNESELSHRAAHDTLPLRDAF
FT                   AVLFFVSVGMLFDPLVLIQQPLAVLATLAIIVFGKSIAAFFLVRMFGHSPRTALTIAAS
FT                   LAQIGEFAFILAGLGMALNLLPQAGQNLVLAGAILSIMLNPVLFTLLEKYLAKTETLEE
FT                   QTLEEAIEEEKQIPVDICNHALLVGFGRVGSLLGEKLLAAGIPLVVIETSRTRVDELRE
FT                   RGIRAVLGNAANEEIMNLAHLDCARWLLLTIPNGYEAGEIVASAREKSPDIEIIARAHY
FT                   DDEVKYITERGANQVVMGEREIARAMLELLETPPAGEVVAS"
FT   gene            complement(535114..536334)
FT                   /gene="fsr"
FT                   /locus_tag="SeAg_B0539"
FT   CDS_pept        complement(535114..536334)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fsr"
FT                   /locus_tag="SeAg_B0539"
FT                   /product="fosmidomycin resistance protein"
FT                   /note="identified by match to protein family HMM PF07690"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0539"
FT                   /db_xref="EnsemblGenomes-Tr:ACH52381"
FT                   /db_xref="GOA:B5EXN6"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B5EXN6"
FT                   /protein_id="ACH52381.1"
FT                   /translation="MAMSEPTQPLAGAPAAAAKARTSFGILGAISLSHLLNDMIQSLIL
FT                   AIYPLLQAEFSLTFVQIGLITLTFQLASSLLQPVVGYWTDKYPMPWSLPVGMCFTLSGL
FT                   VLLAMAGSFGGVLLAAALVGTGSSVFHPESSRVARMASGGRHGLAQSIFQVGGNFGSSL
FT                   GPLLAAVIIAPYGKGNVAWFVLAALLAIVVLAQISRWYAAQHRIAKGKPKAIIANPLPR
FT                   NKVVLAVSVLLLLIFSKYFYMASISSYYTFYLMQKFGLSIQNAQLHLFAFLFAVAAGTV
FT                   IGGPVGDKIGRKYVIWGSILGVAPFTLVLPYATLYWTGILTVIIGFILASAFSAILVYA
FT                   QELLPGRIGMVSGLFFGFAFGMGGLGAAVLGLIADHTSIYLVYKICAFLPLLGILTIFL
FT                   PDNRHKA"
FT   gene            536507..538159
FT                   /locus_tag="SeAg_B0540"
FT   CDS_pept        536507..538159
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0540"
FT                   /product="protein UshA"
FT                   /EC_number="3.6.1.45"
FT                   /EC_number="3.1.3.5"
FT                   /note="identified by match to protein family HMM PF00149;
FT                   match to protein family HMM PF02872"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0540"
FT                   /db_xref="EnsemblGenomes-Tr:ACH52993"
FT                   /db_xref="GOA:B5EXN7"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR006146"
FT                   /db_xref="InterPro:IPR006179"
FT                   /db_xref="InterPro:IPR008334"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="InterPro:IPR036907"
FT                   /db_xref="UniProtKB/TrEMBL:B5EXN7"
FT                   /protein_id="ACH52993.1"
FT                   /translation="MKLLKRGVALALLAAFALTTQPAQAYEKDKTYKITILHTNDHHGH
FT                   FWRSEYGEYGLAAQKTLVDSIRKEVAQEGGSVLLLSGGDINTGVPESDLQDAEPDFRGM
FT                   NLIGYDAMAVGNHEFDNPLTVLRQQEKWAKFPFLSANIYQKSTGERLFKPWAIFTRQDI
FT                   KIAVIGLTTDDTAKIGNPEYFTDIEFRKPAEEAKVVIQELNMNEKPDVIIATTHMGHYD
FT                   NGDHGSNAPGDVEMARSLPAGSLAMIVGGHSQDPVCMASENKKQVNYVPGTPCAPDKQN
FT                   GIWIVQAHEWGKYVGRADFEFRNGEMKMVNYQLIPVNLKKKVTWDNGKSERVLYTPEIA
FT                   ENPQMLSLLTPFQNKGKAQLEVKIGSVNGLLEGDRSKVRFVQTNMGRVILAAQIARTGA
FT                   DFGVMSGGGIRDSIEAGDITYKSVLKVQPFGNIVVYADMSGKEVVDYLTAVAQMKPDSG
FT                   AYPQFANVSFVAKEGKLTDLKIKGEPVDPAKTYRMATLSFNATGGDGYPRIDNKPGYVN
FT                   TGFIDAEVLKEFIQQNSPLDAAAFTPKGEVSWL"
FT   gene            complement(538276..538755)
FT                   /gene="ybaK"
FT                   /locus_tag="SeAg_B0541"
FT   CDS_pept        complement(538276..538755)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybaK"
FT                   /locus_tag="SeAg_B0541"
FT                   /product="YbaK/ebsC protein"
FT                   /note="identified by match to protein family HMM PF04073;
FT                   match to protein family HMM TIGR00011"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0541"
FT                   /db_xref="EnsemblGenomes-Tr:ACH48548"
FT                   /db_xref="GOA:B5EXN8"
FT                   /db_xref="InterPro:IPR004369"
FT                   /db_xref="InterPro:IPR007214"
FT                   /db_xref="InterPro:IPR036754"
FT                   /db_xref="UniProtKB/TrEMBL:B5EXN8"
FT                   /protein_id="ACH48548.1"
FT                   /translation="MTPAVKLLEKNKIPFNIHTYDHDPNETNFGDEVVRKLGLNADQVY
FT                   KTLLVAVNGDMKQLAVAVTPVAGQLDLKKVAKALGAKKVDMADPMVAQRTTGYLVGGIS
FT                   PLGQKKRLPTLIDAPARTFATIYVSGGKRGLDIELAADDLAAILGAKFADIARRD"
FT   gene            538879..538958
FT                   /gene="sroB"
FT                   /locus_tag="SeAg_B0542"
FT   ncRNA           538879..538958
FT                   /gene="sroB"
FT                   /locus_tag="SeAg_B0542"
FT                   /product="sroB RNA"
FT                   /ncRNA_class="other"
FT   gene            complement(538957..539751)
FT                   /locus_tag="SeAg_B0543"
FT   CDS_pept        complement(538957..539751)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0543"
FT                   /product="GumN family protein"
FT                   /note="identified by match to protein family HMM PF07446"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0543"
FT                   /db_xref="EnsemblGenomes-Tr:ACH49191"
FT                   /db_xref="InterPro:IPR002816"
FT                   /db_xref="UniProtKB/TrEMBL:B5EXN9"
FT                   /protein_id="ACH49191.1"
FT                   /translation="MELLNQLKRLWRALRGTPNSWPAIDLSLPGGRHLHLVGSIHMGTR
FT                   DMAPLPAKLVKKLRQADALVVEADISGNETPFSNLPKCPPLVERLSAGQLSALEKRVSE
FT                   LGMPLIHFDNQPLWQIAMVLQATQAQRLGLRPDYGIDYQLLQAAREMSLPVQELEGAKH
FT                   QLELLCDLPDGGMALLDDTLTHWHTNARLLQVMIGWWLEQPPTSVGASLPRTFSQPLYD
FT                   VLMVKRNEAWRDALLALPPGRYVVAVGALHLYGEGNLPQILK"
FT   gene            complement(539837..540664)
FT                   /locus_tag="SeAg_B0544"
FT   CDS_pept        complement(539837..540664)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0544"
FT                   /product="putative periplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0544"
FT                   /db_xref="EnsemblGenomes-Tr:ACH51498"
FT                   /db_xref="InterPro:IPR009739"
FT                   /db_xref="UniProtKB/TrEMBL:B5EXP0"
FT                   /protein_id="ACH51498.1"
FT                   /translation="MFRKAVTLLFLLSPAVSYAGLFDSTPELKCGNDNAVTAAKEWIYN
FT                   EALGRLQQDYIKEPSTLFFDIPQTQYEQQLRAIPVQFSDVITQNPQAENANLRTCSATV
FT                   AMGIPQPLFKLMKDLPNTLFYISQGDGQVINNTVTWKQVNYNIQLADNNKDIVVTPVQK
FT                   TDKLARSIYVMARMTVSGDSIIKKKNNSLIEIAAKKFESRDRELNQVWKSLPASARTAL
FT                   KQEQRVWVTKKEQQCGKLSDAKSEAIPAEKRISIYKCQLEMTIARTAYLDGSE"
FT   gene            complement(540818..543319)
FT                   /locus_tag="SeAg_B0545"
FT   CDS_pept        complement(540818..543319)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0545"
FT                   /product="copper-translocating P-type ATPase"
FT                   /EC_number="3.6.3.4"
FT                   /note="identified by match to protein family HMM PF00122;
FT                   match to protein family HMM PF00403; match to protein
FT                   family HMM PF00702; match to protein family HMM TIGR01494;
FT                   match to protein family HMM TIGR01511; match to protein
FT                   family HMM TIGR01525"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0545"
FT                   /db_xref="EnsemblGenomes-Tr:ACH51074"
FT                   /db_xref="GOA:B5EXP1"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR017969"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:B5EXP1"
FT                   /protein_id="ACH51074.1"
FT                   /translation="MSQTIDLTLDGLSCGHCVKRVKESLEQRPDVELADVTVTEAHVTG
FT                   TASADALIETIKQAGYGATLSHPKAKPLTESSIPSEALAAVPHELPVATADEESQQLLL
FT                   SGMSCASCVTRVQHALQSVPGVTQARVNLAERTALVMGSASAADLVQAVEKAGYGAEAI
FT                   EDDIKRRERQQETAIATMKRFRWQAIVALAVGIPVMVWGMIGDNMMVTGDNRSLWLAIG
FT                   LITLAVMVFAGGHFYRNAWKSLLNGTATMDTLVALGTGVAWLYSMSVNLWPQWFPMEAR
FT                   HLYYEASAMIIGLINLGHMLEARARQRSSKALEKLLDLTPPTARVVTEDGEKSVPLADV
FT                   QPGMLLRLTTGDRVPVDGEITQGEAWLDEAMLTGEPIPQQKGEGDSVHAGTVVQDGSVL
FT                   FRASAVGSHTTLSRIIRMVRQAQSSKPEIGQLADKISAVFVPVVVAIALFSAAIWYFFG
FT                   PAPQIVYTLVIATTVLIIACPCALGLATPMSIISGVGRAAEFGVLVRDADALQRASTLD
FT                   TLVFDKTGTLTEGKPQVVAVKTFNGVDEAQALRLAAALEQGSSHPLAHAILEKAGDDKL
FT                   PQVNGFRTLRGLGVSGEAEGHQLLLGNQALLNKQHVATDDMTAEITAQASQGSTPVLLA
FT                   IDGKAAALLAVRDPLRSDSIAALERLHNAGYRLVMLTGDNPTTANAIAKEAGIDEVIAG
FT                   VLPDGKADAIKRLQSQGRQVAMVGDGINDAPALAQADVGIAMGGGSDVAIETAAITLMR
FT                   HSLMGVADALAISRATLRNMKQNLLGAFIYNSIGIPVAAGILWPFTGTLLNPVVAGAAM
FT                   ALSSITVVSNANRLLRFKPKA"
FT   gene            543429..543845
FT                   /gene="cueR"
FT                   /locus_tag="SeAg_B0546"
FT   CDS_pept        543429..543845
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cueR"
FT                   /locus_tag="SeAg_B0546"
FT                   /product="Cu(I)-responsive transcriptional regulator"
FT                   /note="identified by match to protein family HMM PF00376;
FT                   match to protein family HMM PF09278; match to protein
FT                   family HMM TIGR02044"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0546"
FT                   /db_xref="EnsemblGenomes-Tr:ACH49031"
FT                   /db_xref="GOA:B5EXP2"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR011789"
FT                   /db_xref="UniProtKB/TrEMBL:B5EXP2"
FT                   /protein_id="ACH49031.1"
FT                   /translation="MNISDVAKKTGLTSKAIRFYEEKGLVTPPLRSENGYRTYTQKHLN
FT                   ELTLLRQARQVGFNLEECGELVNLFNDPRRHSADVKKRTLEKVAEIERHISELQSMRDQ
FT                   LLALAESCPGDDSADCPIIDNLSGCCHHKAQKPR"
FT   gene            complement(543846..544298)
FT                   /locus_tag="SeAg_B0547"
FT   CDS_pept        complement(543846..544298)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0547"
FT                   /product="inner membrane protein YbbJ"
FT                   /note="identified by match to protein family HMM PF01957"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0547"
FT                   /db_xref="EnsemblGenomes-Tr:ACH48578"
FT                   /db_xref="GOA:B5EXP3"
FT                   /db_xref="InterPro:IPR002810"
FT                   /db_xref="UniProtKB/TrEMBL:B5EXP3"
FT                   /protein_id="ACH48578.1"
FT                   /translation="MIAMILVHPHIFWLSLGGLLLAAEMLGGNGYLLWSGVAAVITGLT
FT                   VWLLPLGWEWQGVLFAALTLLAAWLWWRWLARRVREQKPTDSRLNQRGQQLVGRRFMLD
FT                   AALVNGRGHMRVGDSSWPVCADEDLRAGTHVEVIAVEGITLRIRAV"
FT   gene            complement(544295..545212)
FT                   /locus_tag="SeAg_B0548"
FT   CDS_pept        complement(544295..545212)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0548"
FT                   /product="band 7 protein"
FT                   /note="identified by match to protein family HMM PF01145"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0548"
FT                   /db_xref="EnsemblGenomes-Tr:ACH52916"
FT                   /db_xref="GOA:B5EXP4"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR001972"
FT                   /db_xref="InterPro:IPR018080"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:B5EXP4"
FT                   /protein_id="ACH52916.1"
FT                   /translation="MLILIPILIFVALVIVGAGVKIVPQGYQWTVERFGRYTKTLQPGL
FT                   SLVVPFMDRIGRKINMMEQVLDIPSQEVISKDNANVTIDAVCFIQVIDAPRAAYEVSNL
FT                   ELAIINLTMTNIRTVLGSMELDEMLSQRDSINTRLLHIVDEATNPWGIKVTRIEIRDVR
FT                   PPAELISSMNAQMKAERTKRAYILEAEGVRQAEILKAEGEKQSQILKAEGERQSAFLQA
FT                   EARERSAEAEARATQMVSEAIAAGDIQAINYFVAQKYTEALQQIGSANNSKVVMMPLDA
FT                   SSLMGAIAGISELVKDSASERKKA"
FT   gene            545359..546036
FT                   /locus_tag="SeAg_B0549"
FT   CDS_pept        545359..546036
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0549"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0549"
FT                   /db_xref="EnsemblGenomes-Tr:ACH52441"
FT                   /db_xref="GOA:B5EXP5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B5EXP5"
FT                   /protein_id="ACH52441.1"
FT                   /translation="MTERSMLLELKQVGYRTATTKIVNNISFTLQRGEFKLITGPSGCG
FT                   KSTLLKMVASLISPDIGVILFEGQDITTLSPEAYRQQVSYCAQTPALFGDTVYDNLIFP
FT                   WQIRHQRPQPTAFADDLARFELPETILQKPIAALSGGEKQRIALIRNLQFLPKILLLDE
FT                   ITSALDEHNKRNVNDIIHRYVRDKQVAVLWVTHDKDEIQHADKVITLTPSAGEMQEARY
FT                   ERA"
FT   gene            546023..546802
FT                   /locus_tag="SeAg_B0550"
FT   CDS_pept        546023..546802
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0550"
FT                   /product="putative membrane protein"
FT                   /note="identified by match to protein family HMM PF03649;
FT                   match to protein family HMM TIGR00245"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0550"
FT                   /db_xref="EnsemblGenomes-Tr:ACH51315"
FT                   /db_xref="GOA:B5EXP6"
FT                   /db_xref="InterPro:IPR005226"
FT                   /db_xref="UniProtKB/TrEMBL:B5EXP6"
FT                   /protein_id="ACH51315.1"
FT                   /translation="MNEHNITNTSLALSMLLVVVAMLISHKEKLALEKDILWSVCRAVI
FT                   QLIIVGYVLKYIFGVNHAALTLLMVLFICFNAAWNAQKRSKYIDKAFLSSFIAITVGAG
FT                   LTLTVLVLTGSIEFAPMQVIPIAGMVAGNAMVAVGLCYNQLGLRFHSEQQQIQEKLSLG
FT                   ATPKMASAGLIRDSIRASLIPTIDSAKTVGLVSLPGMMSGLIFAGIDPVKAIKYQIMVT
FT                   FMLLSTASLSTIIACYLTYRKFYNSRHQLVVMPLKKS"
FT   gene            complement(546888..547769)
FT                   /locus_tag="SeAg_B0551"
FT   CDS_pept        complement(546888..547769)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0551"
FT                   /product="thioredoxin domain protein"
FT                   /note="identified by match to protein family HMM PF00085"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0551"
FT                   /db_xref="EnsemblGenomes-Tr:ACH52784"
FT                   /db_xref="GOA:B5EXP7"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B5EXP7"
FT                   /protein_id="ACH52784.1"
FT                   /translation="MTQTKESDAMSVQNIVNINESNLQQTLEQSMTTPVLFYFWSERSQ
FT                   HCLQLTPVLESLAAQYHGQFILAKLDCDAEQMIAAQFGLRAIPTVYLFQNGQPVDGFQG
FT                   PQPEEAIRALLDKVLPREEELKAQQAMQLMQEGNYIDALPLLKDAWQLSSQNGEIGLLL
FT                   AEAQIALNRSEEAEAVLKTIPLQDQDTRYQGLVAQIELLKQAADTPEIQQLQQQVAENP
FT                   QDAALATQLALQLHQVGRNEEALELLFSHLRKDLTAAEGQTRKTFQEILAALGTGDALA
FT                   SKYRRQLYALLY"
FT   gene            complement(547802..548572)
FT                   /locus_tag="SeAg_B0552"
FT   CDS_pept        complement(547802..548572)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0552"
FT                   /product="oxidoreductase, short chain
FT                   dehydrogenase/reductase family"
FT                   /note="identified by match to protein family HMM PF00106;
FT                   match to protein family HMM PF08659"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0552"
FT                   /db_xref="EnsemblGenomes-Tr:ACH50376"
FT                   /db_xref="GOA:B5EXP8"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B5EXP8"
FT                   /protein_id="ACH50376.1"
FT                   /translation="MQKSVLITGCSSGIGLDSALELKRQGFQILAGCRKPDDVARMNSM
FT                   GFTGVLIDLDSPESVDRAADEVIALTDNRLYGIFNNAGYGVYGPLSTISREQMEQQFSS
FT                   NFFGAHQLTMRLLPAMLPHGEGRIVMTSSVMGLISTPGRGAYAASKYALEAWSDALRME
FT                   LRHTGIKVSLIEPGPIRTRFTDNVNQTQRDKPVENPGIAARFTRDPDAVVAKVRHAFAS
FT                   DKPRLRYPVTLVTWAVMALKRLLPGRMLDKILQS"
FT   gene            complement(548727..549341)
FT                   /locus_tag="SeAg_B0554"
FT   CDS_pept        complement(548727..549341)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0554"
FT                   /product="acyl-CoA thioesterase I"
FT                   /EC_number="3.1.2.-"
FT                   /EC_number="3.1.1.5"
FT                   /note="identified by match to protein family HMM PF00657"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0554"
FT                   /db_xref="EnsemblGenomes-Tr:ACH49851"
FT                   /db_xref="GOA:B5EXP9"
FT                   /db_xref="InterPro:IPR008265"
FT                   /db_xref="InterPro:IPR013830"
FT                   /db_xref="InterPro:IPR036514"
FT                   /db_xref="UniProtKB/TrEMBL:B5EXP9"
FT                   /protein_id="ACH49851.1"
FT                   /translation="MNFNTVFRWHLPFLFLILLTFRAAAADTLLILGDSLSAGYRMAAS
FT                   AAWPSLLNDKWQNKTSVVNASISGDTSQQGLARLPALLQQHHPRWVVVELGGNDGLRGF
FT                   APAQTEQTLRKIIQTVKAADAQPLLMQIHLPANYGRRYNESFSAIYPKLAKEFDIPLLP
FT                   FFMEEVYLKPQWMQDDGIHPNRDAQPFIADWMAKQLTPFLS"
FT   gene            549312..549998
FT                   /locus_tag="SeAg_B0553"
FT   CDS_pept        549312..549998
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0553"
FT                   /product="lipoprotein-releasing system ATP-binding protein
FT                   LolD"
FT                   /EC_number="3.6.3.-"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0553"
FT                   /db_xref="EnsemblGenomes-Tr:ACH51797"
FT                   /db_xref="GOA:B5EXQ0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B5EXQ0"
FT                   /protein_id="ACH51797.1"
FT                   /translation="MPAENSVEVHRLRKSVGQGEHELSILTGVELVVKRGETIALIGES
FT                   GSGKSTLLAILAGLDDGSSGEVSLVGKPLHQMDEEARAQLRAQHVGFVFQSFMLIPTLN
FT                   ALENVELPALLRGENSGQSKAGAKALLEQLGLGKRLDHLPAQLSGGEQQRVALARAFNG
FT                   RPDVLFADEPTGNLDRQTGDKIADLLFSLNREHGTTLILVTHDPALAARCDRRLRLVNG
FT                   QLQEEA"
FT   gene            549995..552409
FT                   /locus_tag="SeAg_B0555"
FT   CDS_pept        549995..552409
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0555"
FT                   /product="efflux ABC transporter, permease protein"
FT                   /note="identified by match to protein family HMM PF02687"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0555"
FT                   /db_xref="EnsemblGenomes-Tr:ACH50935"
FT                   /db_xref="GOA:B5EXQ1"
FT                   /db_xref="InterPro:IPR038766"
FT                   /db_xref="UniProtKB/TrEMBL:B5EXQ1"
FT                   /protein_id="ACH50935.1"
FT                   /translation="MIARWFWREWRSPSLIIVWLALSLAVACVLALGSISDRMEKGLSQ
FT                   QSREFMAGDRTLQSSREVPKAWLEEARKRGLNVGEQLTFATMTFAGDTPQLASVKAVDS
FT                   VYPMYGELQTRPGGVKPQPGSVLLAPRLMALLNLKTGDTIDVGDVTLRIAGEVVQEPDS
FT                   GFNPFQMAPRLMMNMADVAKTGAIQPGSRVMWRYKFGGTPQQLAGYESWLLPQLKPEHR
FT                   WYGLEQDDGALGKSLERSQQFLLLSALLTLLLAVAAVAVAMSHYCRSRYDLVAILKTLG
FT                   AGRAQLRKLIIGQWLMVLGLSAVTGGAIGLLFENILLVLLKPVLPADLPPASLWPWLWA
FT                   LGAMTVISLLVGLRPYRLLLATQPLRVLRRDVVARVWPLKIYLPVACAVVVALLAGLMG
FT                   GSMLLWAVLAGAVILALLCGLVGWMLLNVLRGMTLTSLPLRLAVSRLLRQPWSTLSQLS
FT                   AFSLSFMLLALLLVLRGDLLDRWQQQLPPESPNYFLINIASEQVAPLKAFLAEHQVIPQ
FT                   TFYPIVRARLTRINGNPTEGQQDESLNRELNLTWQDTRPAHNPLVAGHWPPKSGEVSME
FT                   EGLAKRLNVKLGDSVTFMGDTQAFSAKVTSLRQVDWESLRPNFFFIFPSGALDGQPQSW
FT                   LTSFRWENGNGMLTQLNREFPTVSLLDIGAILKQVGQVLEQVSRALEVMVVLVTLCGML
FT                   LLLAQVQVGMRQRHQELVVWRTLGAGKKLLRTTLWCEFAMLGLVAGLVAAIGAETALAI
FT                   LQINVFDFPWEPDWRLWGALPFCGALLLSVCGGWLGVRLLKGKALFRQFNG"
FT   gene            552595..553728
FT                   /locus_tag="SeAg_B0556"
FT   CDS_pept        552595..553728
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0556"
FT                   /product="outer membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0556"
FT                   /db_xref="EnsemblGenomes-Tr:ACH49076"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="UniProtKB/TrEMBL:B5EXQ2"
FT                   /protein_id="ACH49076.1"
FT                   /translation="MTIKITALAASIGAAVAFMPFATQAEITVLKQDPQAGNPLSRLNF
FT                   TVGGSIRPQFQNMTGNDGANGYKRNGFDGGTRFRFAADYYLFDDISWISYYELGVNIPA
FT                   VFDWDNHYAKGATDTTRRMLYTGFKSAKWGTLTFGQQNSIYYDVVGVKTDIWDYDMIGQ
FT                   APGNGINGDYDGSYRTRKSLKYKKSIGNVDLYASYLFSDDYNANNGLNYKRKGGGSLGA
FT                   DYHLTDDLTWGTAWNYTRAEMRGNGNKTYDQNIVGTALSWTPENWTIAAGGGWYQNFMT
FT                   TKKVSVNDYFAGDAWGLEYFVGYAFPIGQYAVKAIQPYFMGDRIEYVNGRDYLRTDNGV
FT                   GITFQLDYGFRVDYEHVFTSSTDNLGDMNLVRLRYDF"
FT   gene            553985..554815
FT                   /locus_tag="SeAg_B0557"
FT   CDS_pept        553985..554815
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0557"
FT                   /product="lipoprotein"
FT                   /note="identified by match to protein family HMM PF03180"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0557"
FT                   /db_xref="EnsemblGenomes-Tr:ACH48546"
FT                   /db_xref="InterPro:IPR004872"
FT                   /db_xref="UniProtKB/TrEMBL:B5EXQ3"
FT                   /protein_id="ACH48546.1"
FT                   /translation="MGLRQSLRIAASTLLLACGLQFAHADSSPQTIVFGVAPGPYGDMV
FT                   KQAIAPTLKEKGYKVVVREFSDYVQPNMALANGSIDANLFQHTLYFDKFTADKGLKLSK
FT                   LIVVPTAGMGFYSRKINSLDALKKGDIITLSNDPTNLARGLRFLQSLGLITIKDNIDPT
FT                   KASERDIASNPKGLVFKPLEAAQLPRTLDGVTGALVNGNFAVAAGLDLSSAIKQEHLDE
FT                   NLKNIIAVRSEDADKPFAKDIVEAVKSPAYRAVIDDPKNIYSAFQKPEWMTATP"
FT   gene            554852..555868
FT                   /locus_tag="SeAg_B0558"
FT   CDS_pept        554852..555868
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0558"
FT                   /product="methionine import ATP-binding protein MetN 2"
FT                   /EC_number="3.6.3.-"
FT                   /note="identified by match to protein family HMM PF00005;
FT                   match to protein family HMM PF09383"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0558"
FT                   /db_xref="EnsemblGenomes-Tr:ACH50420"
FT                   /db_xref="GOA:B5EXQ4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR017908"
FT                   /db_xref="InterPro:IPR018449"
FT                   /db_xref="InterPro:IPR026253"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041701"
FT                   /db_xref="UniProtKB/TrEMBL:B5EXQ4"
FT                   /protein_id="ACH50420.1"
FT                   /translation="MIEIEKVCVDFTAGRGTPTRAVDDVSLHIAAGEIFGIVGTSGAGK
FT                   STLLRTLNALTRPSQGRVNVNGVEISALDGKALRQARQRIGMIFQHFNLMHTRTVAQNV
FT                   AFSLKAAGWERSKIAPRVAEILTLVGLADKANRFPVQLSGGQKQRVGIARAIANHPDVL
FT                   LCDEPTSALDLETSATILALLRQINAQLGITIVLITHEMNVIKSICDRVAVMSGGKVVE
FT                   SGEVFDVFAHPQHAFTQQLVSHTLNLTLPERLREHLPGQLLKILFIGDSAEQPVLSEVA
FT                   IKFGVAVNILHGKIEYIGERALGILVVQLTAPHNPTAVAAAVEHIRQRTAQVEVIRG"
FT   gene            555861..556520
FT                   /locus_tag="SeAg_B0559"
FT   CDS_pept        555861..556520
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0559"
FT                   /product="ABC transporter integral membrane protein"
FT                   /note="identified by match to protein family HMM PF00528"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0559"
FT                   /db_xref="EnsemblGenomes-Tr:ACH49904"
FT                   /db_xref="GOA:B5EXQ5"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B5EXQ5"
FT                   /protein_id="ACH49904.1"
FT                   /translation="MDDLLPDLTLAFNETFQMLSISTVLAILGGLPLGFLIFVTDRHLF
FT                   WQNRFIYLVASVLVNIIRSVPFVILLVLLLPLTQLLLGNTIGPIAASVPLSVAAIAFYA
FT                   RLVDSALREVDKGIIEAALAFGASPMRIICTVLLPEASAGLLRGLTITLVSLIGYSAMA
FT                   GIVGGGGVGDLAIRYGYYRYETEVMVVTVVALIVLVQVVQMLGDWLAKRADKRDRH"
FT   gene            complement(556549..557643)
FT                   /gene="ybbB"
FT                   /locus_tag="SeAg_B0560"
FT   CDS_pept        complement(556549..557643)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybbB"
FT                   /locus_tag="SeAg_B0560"
FT                   /product="tRNA 2-selenouridine synthase"
FT                   /EC_number="2.9.1.-"
FT                   /note="identified by match to protein family HMM TIGR03167"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0560"
FT                   /db_xref="EnsemblGenomes-Tr:ACH51639"
FT                   /db_xref="GOA:B5EYB4"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR017582"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5EYB4"
FT                   /protein_id="ACH51639.1"
FT                   /translation="MQDRQKAQDYRALLLADTPLIDVRAPIEFEQGAMPGAINLPLMMD
FT                   NERAAVGTCYKRQGADAALALGHRLVCGDIRQQRLEAWKAAYQRFPNGYLCCARGGQRS
FT                   HIVQRWLQETGIDCPLIEGGYKALRQTAIQATWQLAQKPILLIGGCTGSGKTQLVRQQP
FT                   NGVDLEGLARHRGSSFGRTLNPQLSQASFENKLAVELLKINAHQTLKRWVLEDEGRTIG
FT                   ANHLPECLRERMAQAPIAVVEDPFALRLERLREEYFIRMHHDFTHAYGDEAGWQAYSEY
FT                   LHHGLFAIRRRLGLQRFAELTDTLDRALAEQLSNGSTDGHMAWLVPLLNEYYDPMYRYQ
FT                   LEKKAANIVFRGPWQDVANWLKAQ"
FT   gene            complement(557713..558639)
FT                   /locus_tag="SeAg_B0561"
FT   CDS_pept        complement(557713..558639)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0561"
FT                   /product="HTH-type transcriptional activator AllS"
FT                   /note="identified by match to protein family HMM PF00126;
FT                   match to protein family HMM PF03466"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0561"
FT                   /db_xref="EnsemblGenomes-Tr:ACH50419"
FT                   /db_xref="GOA:B5EYB5"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B5EYB5"
FT                   /protein_id="ACH50419.1"
FT                   /translation="MFDPETLRTFISVAETGSFSKAAERLCKTTATISYRIKLLEENTG
FT                   VGLFFRTTRSVSLTAAGSHLLSQAKDWLAWLDSMPDELRQVNDGVERQVNIVVNNLLYS
FT                   PQAVASLLSWLNVRYPFTQFHFSRQIYMGVWDSLLYEGFSLAIGVTGTEPLANTFMLDP
FT                   LGSVQWRFVMSADHPLAHVSGPLTEAQLRRFPAINIEDSARTLTKRVAWRLPGQKEIIV
FT                   PDMETKIAAHLAGVGIGFVPQPLCQTLIDKNELVSCTIPTMRPPSPLSLAWHKFGGGKA
FT                   VEDIVKLFTQRQPEIAGFLSIFNTVRC"
FT   gene            558866..559348
FT                   /gene="allA"
FT                   /locus_tag="SeAg_B0562"
FT   CDS_pept        558866..559348
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="allA"
FT                   /locus_tag="SeAg_B0562"
FT                   /product="ureidoglycolate hydrolase"
FT                   /EC_number="3.5.3.19"
FT                   /note="identified by match to protein family HMM PF04115"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0562"
FT                   /db_xref="EnsemblGenomes-Tr:ACH52907"
FT                   /db_xref="GOA:B5EYB6"
FT                   /db_xref="InterPro:IPR007247"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR023525"
FT                   /db_xref="InterPro:IPR024060"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5EYB6"
FT                   /protein_id="ACH52907.1"
FT                   /translation="MKLEVLPLDQKTFSAYGDVIETQERDFFHINNGLVERYHDLAKVE
FT                   VLEQDRTLISINRAQPAAMPIVVHELERHPLGTQAFVPMNGEAFVVIVALGDDKPDLST
FT                   LRAFISNGRQGVNYHRNVWHHPLFAWQTVTDFLTVDRGGSDNCDVESIPTHELCFA"
FT   gene            559427..560245
FT                   /gene="allR"
FT                   /locus_tag="SeAg_B0563"
FT   CDS_pept        559427..560245
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="allR"
FT                   /locus_tag="SeAg_B0563"
FT                   /product="transcriptional regulator AllR"
FT                   /note="identified by match to protein family HMM PF01614;
FT                   match to protein family HMM PF09339"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0563"
FT                   /db_xref="EnsemblGenomes-Tr:ACH52406"
FT                   /db_xref="GOA:B5EYB7"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B5EYB7"
FT                   /protein_id="ACH52406.1"
FT                   /translation="MTEVRRRGRPGQAEPTAQKGAQALERGIAILQYLERSGGSSSVSD
FT                   ISGSLDLPLSTTFRLLKVLQAADFVYQDSQLGWWHIGLGVFNVGSAYIHNRDVLSVAGP
FT                   FMHRLMLLSGETVNVAIRNGNEAVLIGQKECKSMVRMCAPLGSRLPLHASGAGKALLYP
FT                   LTEEELVGIVVNTGLRRFTPTTLVDLPILLKNLEQAREQGYTVDQEEHVVGLNCIASAI
FT                   YDDAGSVVAAISISGPASRLTEDRFISQGELVRDTAKDISTALGLKPPVA"
FT   gene            560330..562111
FT                   /gene="gcl"
FT                   /locus_tag="SeAg_B0564"
FT   CDS_pept        560330..562111
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gcl"
FT                   /locus_tag="SeAg_B0564"
FT                   /product="glyoxylate carboligase"
FT                   /EC_number="4.1.1.47"
FT                   /note="identified by match to protein family HMM PF00205;
FT                   match to protein family HMM PF02775; match to protein
FT                   family HMM PF02776; match to protein family HMM TIGR01504"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0564"
FT                   /db_xref="EnsemblGenomes-Tr:ACH52334"
FT                   /db_xref="GOA:B5EYB8"
FT                   /db_xref="InterPro:IPR006397"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:B5EYB8"
FT                   /protein_id="ACH52334.1"
FT                   /translation="MAKMRAVDAAMYVLEKEGITTAFGVPGAAINPFYSAMRKHGGIRH
FT                   ILARHVEGASHMAEGYTRAAAGNIGVCLGTSGPAGTDMITALYSASADSIPILCITGQA
FT                   PRARLHKEDFQAVDIEAIAKPVSKMAVTVREAALVPRVLQQAFHLMRSGRPGPVLVDLP
FT                   FDVQVAEIEFDPDMYEPLPVYKPAASRVQIEKALEMLIQSERPVIVAGGGVINADAAPL
FT                   LQQFAELTSVPVIPTLMGWGCIPDDHPLMAGMVGLQTAHRYGNATLLASDMVFGIGNRF
FT                   ANRHTGSVEKYTQGRKIIHIDIEPTQIGRVLCPDLGIVSDAKAALTLLIDVAQEMQKAG
FT                   RLPCRKTWVDECQQRKRTLLRKTHFDNVPVKPQRVYEEMNKAFGRDVCYVTTIGLSQIA
FT                   AAQMLHVFKDRHWINCGQAGPLGWTIPAALGVCAADPQRNVVAISGDFDFQFLIEELAV
FT                   GAQFNIPYIHVLVNNAYLGLIRQSQRAFDMDYCVQLAFENINSSEVNGYGVDHVKVAEG
FT                   LGCKAIRVFKPEDIAPAFEQAKALMAQYRVPVVVEVILERVTNISMGSELDNVTEFEEV
FT                   ADSAKDAPTETCFMKYE"
FT   gene            562124..562900
FT                   /gene="hyi"
FT                   /locus_tag="SeAg_B0565"
FT   CDS_pept        562124..562900
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hyi"
FT                   /locus_tag="SeAg_B0565"
FT                   /product="hydroxypyruvate isomerase"
FT                   /EC_number="5.3.1.22"
FT                   /note="identified by match to protein family HMM PF01261;
FT                   match to protein family HMM TIGR03234"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0565"
FT                   /db_xref="EnsemblGenomes-Tr:ACH49646"
FT                   /db_xref="GOA:B5EYB9"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR017643"
FT                   /db_xref="InterPro:IPR026040"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:B5EYB9"
FT                   /protein_id="ACH49646.1"
FT                   /translation="MLRFSANLSMLFTEYDFLERFDKAALSGFRGVEFMFPYDNDIEVL
FT                   KRKLRDNNLEHTLHNLPAGDWAAGERGIACIPGREEEFRDGVAAAIRYARVLGNKKINC
FT                   LVGKTPSGFSATEIHDTLVENLRYAANMLAKEDILLLIEPINHFDMPGFHLTGTQQALA
FT                   LIKDIGSDNIKIQYDIYHMQRMEGELTQTMTAWADKIGHLQIADNPRRGEPGTGEINYD
FT                   FIFNVIKQSGYDGWVGCEYKPLTTTEAGLSWINQYR"
FT   gene            563001..563879
FT                   /locus_tag="SeAg_B0566"
FT   CDS_pept        563001..563879
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0566"
FT                   /product="2-hydroxy-3-oxopropionate reductase"
FT                   /EC_number="1.1.1.60"
FT                   /note="identified by match to protein family HMM PF03446;
FT                   match to protein family HMM PF03807; match to protein
FT                   family HMM TIGR01505"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0566"
FT                   /db_xref="EnsemblGenomes-Tr:ACH51807"
FT                   /db_xref="GOA:B5EYC0"
FT                   /db_xref="InterPro:IPR002204"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="InterPro:IPR006398"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR015815"
FT                   /db_xref="InterPro:IPR029154"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B5EYC0"
FT                   /protein_id="ACH51807.1"
FT                   /translation="MKLGFIGLGIMGSPMAINLARAGHQLHVTTIGPVADELLSLGAVN
FT                   VETARQVTEFADIIFIMVPDTPQVEEVLFGEHGCAKTSLQGKTIVDMSSISPIETKRFA
FT                   QRVNEMGADYLDAPVSGGEIGAREGTLSIMVGGEQKVFDRVKPLFDILGKNITLVGGNG
FT                   DGQTCKVANQIIVALNIEAVSEALVFASKAGADPVRVRQALMGGFASSRILEVHGERMI
FT                   NRTFEPGFKIALHQKDLNLALQSAKALALNLPNTATCQELFNTCAANGGSQLDHSAMVQ
FT                   ALELMANHKLS"
FT   gene            563945..565192
FT                   /locus_tag="SeAg_B0567"
FT   CDS_pept        563945..565192
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0567"
FT                   /product="major facilitator family transporter"
FT                   /note="identified by match to protein family HMM PF07690"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0567"
FT                   /db_xref="EnsemblGenomes-Tr:ACH49358"
FT                   /db_xref="GOA:B5EYC1"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B5EYC1"
FT                   /protein_id="ACH49358.1"
FT                   /translation="MSETKKSGIDYWKQIVVVMSLGWVAIWIYRTVLTPIYPEIQASLD
FT                   NVSNAEIGAIASFYFFAYCSMQIPCGILVDKFGQKIMLMAGFTLFIIGTLCIAKANGLA
FT                   MIYTGSLMAGGGCASFFSSAYSLSSANVPQARRALANAIINSGSAIGMGIGLIGSSVLV
FT                   KNMSMAWQNVLYIVAAILVIMLCVFTLVIRGKAKSDSAQAEKQTQTVTEDEKRAPLFSG
FT                   LLCSVYFLYFCTCYGYYLIVTWLPSYLQTERGFDGGAIGLASALVAVVGVPGALFFSHL
FT                   SDKFRNSKVKVILGLEIVAAAMLAFTVLSPNTTMLMVSLTLYGLLGKMAVDPILISFVS
FT                   EQASAKSLGRAFSLFNFFGMSSAVVAPTLTGFISDVTGSKEISFVISACLVVTGTLIFA
FT                   VVTLYKKKATQRIASA"
FT   gene            565288..566742
FT                   /gene="ncs1"
FT                   /locus_tag="SeAg_B0568"
FT   CDS_pept        565288..566742
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ncs1"
FT                   /locus_tag="SeAg_B0568"
FT                   /product="NCS1 nucleoside transporter family protein"
FT                   /note="identified by match to protein family HMM PF02133;
FT                   match to protein family HMM TIGR00800"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0568"
FT                   /db_xref="EnsemblGenomes-Tr:ACH49273"
FT                   /db_xref="GOA:B5EYC2"
FT                   /db_xref="InterPro:IPR001248"
FT                   /db_xref="InterPro:IPR012681"
FT                   /db_xref="InterPro:IPR038271"
FT                   /db_xref="UniProtKB/TrEMBL:B5EYC2"
FT                   /protein_id="ACH49273.1"
FT                   /translation="MEHQRELYQQRGYSEDLLPKTETQRNWKAFNYFTLWMGSVHNVPN
FT                   YVMVGGFFILGLSTFNIMLAIIISALFIAAAMVMNGAAGSKYGVPFAMILRGSYGVRGA
FT                   LFPGLLRGGIAAIMWFGLQCYAGSLAFLILIGKIWPGFLTLGGDFKLLGLSLPGLITFL
FT                   IFWIINVGIGFGGGKVLNKFTAILNPCIYIVFGGMAIWAISLVGIGPILDYLPSGVQKA
FT                   EHSGFLFLVVINAVVAVWAAPAVSASDFTQNAHSFRAQALGQTLGLIVAYILFAVASVC
FT                   IIAGASIHYGMDTWNVLDIVQRWDSLFASFFAVLVILMTTISTNATGNIIPAGYQIAAL
FT                   APTKLNYKNGVMIASIISLLICPWKLMENQDSIYLFLDIIGGMLGPVIGVMLAHYFVVM
FT                   RGKINLDELYTASGDYKYYDNGFNLTAFSVTLVAVILSLGGKFIPFMEPLSRVSWFVGV
FT                   IVAFVVYALLKKRTRFENTGEQKLVG"
FT   gene            566821..568182
FT                   /gene="allB"
FT                   /locus_tag="SeAg_B0569"
FT   CDS_pept        566821..568182
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="allB"
FT                   /locus_tag="SeAg_B0569"
FT                   /product="allantoinase"
FT                   /EC_number="3.5.2.5"
FT                   /note="identified by match to protein family HMM PF01979;
FT                   match to protein family HMM PF07969; match to protein
FT                   family HMM TIGR03178"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0569"
FT                   /db_xref="EnsemblGenomes-Tr:ACH51150"
FT                   /db_xref="GOA:B5EYC3"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR017593"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5EYC3"
FT                   /protein_id="ACH51150.1"
FT                   /translation="MSFDLIIKNGTVILENEARVIDIAVQGGKIAAIGENLGEAKNVLD
FT                   ATGLIVSPGMVDAHTHISEPGRTHWEGYETGTRAAAKGGITTMIEMPLNQLPATVDRET
FT                   IELKFDAAKGKLTIDAAQLGGLVSYNLDRLHELDEVGVVGFKCFVATCGDRGIDNDFRD
FT                   VNDWQFYKGAQKLGEMDQTVLVHCENALICDELGEEAKREGRVTAHDYVASRPVFTEVE
FT                   AIRRVLYLAKAAGCRLHVCHISSPEGVEEVTRARQEGQDVTCESCPHYFVLDTDQFEEI
FT                   GTLAKCSPPIRDQENQKGMWEKLFNGEIDCLVSDHSPCPPEMKAGNIMQAWGGIAGLQN
FT                   CMDVMFDEAVQKRGMSLPMFGKLMATNAADIFGLKHKGRIAPGKDADLVFIQPDSSYVL
FT                   KNEDLEYRHKVSPYVGRTIGARITKTILRGDVIYDIEHGFPVPPKGQFILKHQQ"
FT   gene            568241..569539
FT                   /locus_tag="SeAg_B0570"
FT   CDS_pept        568241..569539
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0570"
FT                   /product="putative purine permease YbbY"
FT                   /note="identified by match to protein family HMM PF00860"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0570"
FT                   /db_xref="EnsemblGenomes-Tr:ACH52942"
FT                   /db_xref="GOA:B5EYC4"
FT                   /db_xref="InterPro:IPR006043"
FT                   /db_xref="UniProtKB/TrEMBL:B5EYC4"
FT                   /protein_id="ACH52942.1"
FT                   /translation="MFPVINRESVLSGFQWFFFIFCNTVVVPPTLLSAFHLPADNLLML
FT                   TQYAFLTTALACLVQAFCGHRRAIMEGPTGLWWGAILTITLGEASRGTPLNDIASSLSV
FT                   GIAISAMVTIFIGISGLGHRLARLFTPAVMVFFMLLLGAQLTSIFFKGMLGLPFGIADT
FT                   SARIKLAPFGLAVAVMCFILAMIIFLQQRISRYALLVGTVVGWGLWRLCFPSSHLPPGE
FT                   LSWRWFPLGSHGTLMPGIIVTAVMTGLVNISNTYGAIRGTDIFYPHQGSGSSRYRRSFM
FT                   ISGLMTLVTVPFAVVPFSPFVSSIGLLTQTGDSSRKSFICGSALCLLVAIITPLTRLFC
FT                   AIPLAISSAVMLVSYLPLLYSGLVFSQQITFTARNIYRLALPLFVGIFLMGLPPVYLQD
FT                   LPLMIRPLLSNGLLVGILLAVLMENLIPWERIK"
FT   gene            569562..570710
FT                   /locus_tag="SeAg_B0571"
FT   CDS_pept        569562..570710
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0571"
FT                   /product="glycerate kinase 1"
FT                   /EC_number="2.7.1.31"
FT                   /note="identified by match to protein family HMM PF02595;
FT                   match to protein family HMM TIGR00045"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0571"
FT                   /db_xref="EnsemblGenomes-Tr:ACH51402"
FT                   /db_xref="GOA:B5EYC5"
FT                   /db_xref="InterPro:IPR004381"
FT                   /db_xref="InterPro:IPR018193"
FT                   /db_xref="InterPro:IPR018197"
FT                   /db_xref="InterPro:IPR036129"
FT                   /db_xref="UniProtKB/TrEMBL:B5EYC5"
FT                   /protein_id="ACH51402.1"
FT                   /translation="MKIVIAPDSFKESLSADKCCQAIKAGFSTVFPDARYVCLPIADGG
FT                   EGTVDAMVAATGGKRVSVDVSGPMGEKVNGFYGLTGDGKTAIIEMAAASGLMLVAPEAR
FT                   NPLLASSFGTGELIRHALDAGIRHIILGIGGSATVDGGMGVAQALGVRFLDAQGTPLGA
FT                   GGGNLSRLASIDLQGCDPRISECRIEVACDVDNPLVGPRGAAAVFGPQKGATPEMVETL
FT                   ENGLRNYARVLHALTGRDMSQIPGGGAAGGMGIAAIVFLEAEMKPGIEIVMQAVKLEEA
FT                   VKEASLVITGEGRIDSQTAGGKAPIGVASVAKRHHVPVIGIAGVLGDGVEVVHRHGIDA
FT                   VFSILPRLAPLPEVLANGEQNLYHSACNIARVIKLGQDIGTR"
FT   gene            complement(570790..571575)
FT                   /locus_tag="SeAg_B0572"
FT   CDS_pept        complement(570790..571575)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0572"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF05899;
FT                   match to protein family HMM PF07883; match to protein
FT                   family HMM TIGR03214"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0572"
FT                   /db_xref="EnsemblGenomes-Tr:ACH50889"
FT                   /db_xref="InterPro:IPR008579"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR017627"
FT                   /db_xref="UniProtKB/TrEMBL:B5EYC6"
FT                   /protein_id="ACH50889.1"
FT                   /translation="MGYLNNVTGYRDDLLANRAIVKHGNYALLTPDGLVKNIIPGFENC
FT                   DVTILSTPKLGASFVDYLVTLHQNGGNQQGFGGEGIETFLYVIAGNIEAKAEGKTFSLT
FT                   QGGYLYCPPGEMMTFSNAQTEDSQLFLYKRRYTPVEGHAPWLVSGNASQLERIHYEGME
FT                   DVILLDFLPKELGFDMNMHILSFEPGASHGYIETHVQEHGAYILSGQGVYNLDNNWVPV
FT                   KKGDYIFMGAYSLQAGYGVGRGEAFSYIYSKDCNRDVMI"
FT   gene            complement(571586..572821)
FT                   /gene="allC"
FT                   /locus_tag="SeAg_B0573"
FT   CDS_pept        complement(571586..572821)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="allC"
FT                   /locus_tag="SeAg_B0573"
FT                   /product="allantoate amidohydrolase"
FT                   /note="identified by match to protein family HMM PF01546;
FT                   match to protein family HMM PF07687; match to protein
FT                   family HMM TIGR01879; match to protein family HMM
FT                   TIGR03176"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0573"
FT                   /db_xref="EnsemblGenomes-Tr:ACH50666"
FT                   /db_xref="GOA:B5EYC7"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR010158"
FT                   /db_xref="InterPro:IPR017591"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:B5EYC7"
FT                   /protein_id="ACH50666.1"
FT                   /translation="MIKHFRHAIEETLPWLSSIGADPTGGMTRLLYSPEWLETQQQFKK
FT                   RMAESGLETRFDDVGNLYGRLCGTQFPEQVILSGSHIDTVVNGGNLDGQFGALAAWLAL
FT                   DWLKATYGAPLRTVEVVSMAEEEGSRFPYVFWGSKNIFGLANPEEVRHIQDAKGTGFVD
FT                   AMQACGFTLPAAPLAARTDIRAFVELHIEQGCVLESNGQSIGVVNAIVGQRRYTVTLNG
FT                   ESNHAGTTPMGYRRDTVHAFSRICSQSIEKAKQHGDPLVLTFGKVEPQPNTVNVVPGKT
FT                   TFTIDCRHTDAAVLREFTEQLENDMRAICDEMDISIDIDLWMDEAPVPMNAELVAALTR
FT                   LCETEQLNYRIMHSGAGHDAQIFAPRVPTCMIFVPSINGISHNPAERTNINDLAEGVKT
FT                   LALMLHQLAWQK"
FT   gene            complement(572843..573892)
FT                   /gene="allD"
FT                   /locus_tag="SeAg_B0574"
FT   CDS_pept        complement(572843..573892)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="allD"
FT                   /locus_tag="SeAg_B0574"
FT                   /product="ureidoglycolate dehydrogenase"
FT                   /EC_number="1.1.1.154"
FT                   /note="identified by match to protein family HMM PF02615;
FT                   match to protein family HMM TIGR03175"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0574"
FT                   /db_xref="EnsemblGenomes-Tr:ACH50161"
FT                   /db_xref="GOA:B5EYC8"
FT                   /db_xref="InterPro:IPR003767"
FT                   /db_xref="InterPro:IPR017590"
FT                   /db_xref="InterPro:IPR036111"
FT                   /db_xref="UniProtKB/TrEMBL:B5EYC8"
FT                   /protein_id="ACH50161.1"
FT                   /translation="MKISRETLHQLIENKLYKAGLKREHAAIVADVLVYADARGIHSHG
FT                   AVRVEYYAERISKGGTNREPTFRIENTGPCTAILHADNAAGQVAAKMGMEHAIEIAKKN
FT                   GIAVVGISRMGHSGAISYFVRQAAREGLIGLSICQSDPMVVPFGGADIYYGTNPLAFAA
FT                   PGEGDDIITFDMATTVQAWGKVLDARSRNESIPESWAVDKNGAPTHDPFAVNALLPAAG
FT                   PKGYGLMMMIDILSGILLGLPFGRQVSSMYEDLHAGRNLGQLHLVINPAFFSSCELFRK
FT                   HISQTMQELNSVKPAPGFKQVYYPGQDQDIKQKNADMNGIDIVDDIYQYLISDALYLKS
FT                   YETKNPFAQ"
FT   gene            574208..575872
FT                   /locus_tag="SeAg_B0575"
FT   CDS_pept        574208..575872
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0575"
FT                   /product="bacterial FdrA protein"
FT                   /note="identified by match to protein family HMM PF06263"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0575"
FT                   /db_xref="EnsemblGenomes-Tr:ACH49196"
FT                   /db_xref="GOA:B5EYC9"
FT                   /db_xref="InterPro:IPR003781"
FT                   /db_xref="InterPro:IPR005811"
FT                   /db_xref="InterPro:IPR016102"
FT                   /db_xref="UniProtKB/TrEMBL:B5EYC9"
FT                   /protein_id="ACH49196.1"
FT                   /translation="MIHAFIKKGCFQDSVSLMIISRKLSESENVDDVSVMMGTPANKSL
FT                   LETTGFWHDDFHGATPNDICVAIRTEAVDDGITQVIVRQLEEALQQLAQGSSGSQSLIQ
FT                   VRRWESACQKLPEANLALVSVAGEYAAELAEQALDRSLNVMIFSDNVTLDDEIRLKRRA
FT                   RDKGLLVMGPDCGTAMIANTPLAFANVMPEGNIGVIGASGTGIQELCSQIALAGEGITH
FT                   AIGLGGRDLSAEVGGISALTALDILSADEKSQVLAFVSKPPADAVRQHIIAAMKATGKP
FT                   VVALFLGFSSPVAREENVWFASTLDEAARLACLLSRVTSQRKEMVSTGGVIRGLYTGGT
FT                   LAAEAAGLLAGYLGVAADTEHHHGMMLDADGHQIIDLGDDFYTVGRPHPMIDPALRNQL
FT                   IAGLGAQPQVRVLLVDVVIGFGATADPAASLIQAWQKACAARASDQPLFAIATVTGTER
FT                   DPQCRSQQIAALEDAGITVVDSLPEATLLAAELIRPTLSSTHPSAPRLLEAVAVINAGL
FT                   RSFALDLQAAGMPVVHYQWAPVAGGNKKLARLLERLQ"
FT   gene            575882..577141
FT                   /locus_tag="SeAg_B0576"
FT   CDS_pept        575882..577141
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0576"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF06545"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0576"
FT                   /db_xref="EnsemblGenomes-Tr:ACH48552"
FT                   /db_xref="InterPro:IPR009499"
FT                   /db_xref="InterPro:IPR024033"
FT                   /db_xref="UniProtKB/TrEMBL:B5EYD0"
FT                   /protein_id="ACH48552.1"
FT                   /translation="MFTSVAQANAAVIEQIRRARPHWLDVKPASSLISVLNQGKTLLHA
FT                   GPPMRWQEMTGPMKGACIGACLFEGWAKDEMSALALLEQGKVNFIPCHHVNAVGPMGGI
FT                   TSASMPMLVVENITDGNRAYCNLNEGIGKVMRFGAYGEDVQQRLRWMRDVLMPVLSAAL
FT                   GRLERGLDLTAMMAQGITMGDEFHQRNIASSALLMRTLAPHIARLEHDKQQIAEVMDFL
FT                   SVTDQFFLNLAMAYCKAAMDAGAQIRAGSIVTAMTRNGDMFGIRVSGLGDRWFTAPVNT
FT                   PQGLFFTGFSQDQANPDMGDSAITETFGIGGAAMIAAPGVTRFVGAGGMEAAKSVSEEM
FT                   AEIYLERNMQLQIPGWDFQGACLGLDIRRVVETGITPLINTGIAHKEAGIGQIGAGTVR
FT                   APLACFEQALEALAESMGVS"
FT   gene            577153..577962
FT                   /locus_tag="SeAg_B0577"
FT   CDS_pept        577153..577962
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0577"
FT                   /product="putative cytoplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0577"
FT                   /db_xref="EnsemblGenomes-Tr:ACH52477"
FT                   /db_xref="InterPro:IPR021530"
FT                   /db_xref="UniProtKB/TrEMBL:B5EYD1"
FT                   /protein_id="ACH52477.1"
FT                   /translation="MKRIHPLMASRQSADYRQPWQMSGVWRRSINFVAKSGELLTLHRR
FT                   GSGFSPGGWILRGGDFDALRDVLTDGEKPQSTAAGIQIGEFLLCEPERRCSLRVPRYLA
FT                   SPRLNATYMQRSEETGLFGPLTVAAAQPLCPELRQFCHCFQSALAGAATDWRLWLGKGP
FT                   GLTPSHDDTLTGMLLAAWYFGAIDERAGRNFFAQSGSLDRATTLVSVSYLRYAAMGYFA
FT                   SPLLHFIHALRRDVRTETAIDGLLALGHTSGADTLLGFWLGQQIVKG"
FT   gene            577966..578859
FT                   /gene="arcC"
FT                   /locus_tag="SeAg_B0578"
FT   CDS_pept        577966..578859
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="arcC"
FT                   /locus_tag="SeAg_B0578"
FT                   /product="carbamate kinase"
FT                   /EC_number="2.7.2.2"
FT                   /note="identified by match to protein family HMM PF00696;
FT                   match to protein family HMM TIGR00746"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0578"
FT                   /db_xref="EnsemblGenomes-Tr:ACH51974"
FT                   /db_xref="GOA:B5EYD2"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR003964"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="UniProtKB/TrEMBL:B5EYD2"
FT                   /protein_id="ACH51974.1"
FT                   /translation="MKTLVVALGGNALLQRGEALTAENQYRNIADAVPALARLARSYRL
FT                   AIVHGNGPQVGLLALQNLAWKAVEPYPLDVLVAESQGMIGYMLAQRLALEPDMPPVTTV
FT                   LTRIKVSADDPAFLEPEKFIGPVYSPEEQMALEATYGWHMKRDGKYLRRVVASPAPRQI
FT                   IESAAIELLLKEGHVVICSGGGGVPVAGEGEGVEAVIDKDLAAALLAEQIAADGLIILT
FT                   DADAVYEHWGTPQQRAIRQASPDELAPFAKADGAMGPKVTAVSGYVKRCGKPAWIGALS
FT                   RIDDTLAGRAGTCICL"
FT   gene            complement(578900..579967)
FT                   /gene="purK"
FT                   /locus_tag="SeAg_B0579"
FT   CDS_pept        complement(578900..579967)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purK"
FT                   /locus_tag="SeAg_B0579"
FT                   /product="phosphoribosylaminoimidazole carboxylase, ATPase
FT                   subunit"
FT                   /EC_number="4.1.1.21"
FT                   /note="identified by match to protein family HMM PF02222;
FT                   match to protein family HMM TIGR01161"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0579"
FT                   /db_xref="EnsemblGenomes-Tr:ACH51476"
FT                   /db_xref="GOA:B5EYD3"
FT                   /db_xref="InterPro:IPR003135"
FT                   /db_xref="InterPro:IPR005875"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR040686"
FT                   /db_xref="UniProtKB/TrEMBL:B5EYD3"
FT                   /protein_id="ACH51476.1"
FT                   /translation="MKQVCVLGNGQLGRMLRQAGEPLGIAVWPVGLDAEPTAVPVQQSV
FT                   ITAEIERWPETALTRELARHPAFVNRDVFPIIADRLTQKQLFDKLGLATAPWQLLTSAD
FT                   EWSGIFDRLGELAIIKRRVGGYDGRGQWRLRADETGQLPDDCYGECIVERGIHFSGEVS
FT                   LVGARAHDGSTVYYPLTHNLHQDGILRTSVAFPQANAEQQEQAESMLSAIMQALNYVGV
FT                   MAMECFITPEGLLINELAPRVHNSGHWTQNGASISQFELHLRAITGLPLPAPVINAPSV
FT                   MINLIGSELNYDWLKLPLVHLHWYDKAVRPGRKVGHLNLTDSDTSRLSATLEALSPLLP
FT                   GEYASGIIWAQSKLK"
FT   gene            complement(579964..580473)
FT                   /gene="purE"
FT                   /locus_tag="SeAg_B0580"
FT   CDS_pept        complement(579964..580473)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purE"
FT                   /locus_tag="SeAg_B0580"
FT                   /product="phosphoribosylaminoimidazole carboxylase,
FT                   catalytic subunit"
FT                   /EC_number="4.1.1.21"
FT                   /note="identified by match to protein family HMM PF00731;
FT                   match to protein family HMM TIGR01162"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0580"
FT                   /db_xref="EnsemblGenomes-Tr:ACH51027"
FT                   /db_xref="GOA:B5EYD4"
FT                   /db_xref="InterPro:IPR000031"
FT                   /db_xref="InterPro:IPR024694"
FT                   /db_xref="InterPro:IPR033747"
FT                   /db_xref="InterPro:IPR035893"
FT                   /db_xref="UniProtKB/TrEMBL:B5EYD4"
FT                   /protein_id="ACH51027.1"
FT                   /translation="MSSRNNPARVAIVMGSKSDWATMQFAAEIFEILDVPHHVEVVSAH
FT                   RTPDKLFSFAETAEENGYQVIIAGAGGAAHLPGMIAAKTLVPVLGVPVQSAALSGVDSL
FT                   YSIVQMPRGIPVGTLAIGKAGAANAALLAAQILAQHDAELHQRIADWRKAQTDEVLENP
FT                   DPRGTL"
FT   gene            complement(580591..581313)
FT                   /gene="lpxH"
FT                   /locus_tag="SeAg_B0581"
FT   CDS_pept        complement(580591..581313)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lpxH"
FT                   /locus_tag="SeAg_B0581"
FT                   /product="UDP-2,3-diacylglucosamine hydrolase"
FT                   /EC_number="3.6.1.-"
FT                   /note="identified by match to protein family HMM PF00149;
FT                   match to protein family HMM TIGR01854"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0581"
FT                   /db_xref="EnsemblGenomes-Tr:ACH48829"
FT                   /db_xref="GOA:B5EYD5"
FT                   /db_xref="InterPro:IPR010138"
FT                   /db_xref="InterPro:IPR024654"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5EYD5"
FT                   /protein_id="ACH48829.1"
FT                   /translation="MATLFIADLHLQTEEPAIVAGFLRFLAVEARQADALYILGDLFEA
FT                   WIGDDDPNPLHREIAAAIKAVVNVGVPCFFIHGNRDFLIGKRFARESGMILLPQEKVLD
FT                   LYGRNVLIMHGDTLCTDDAGYQAFRAKVHNPWVQRLFLTLPLFIRRRIAARMRAGSKAA
FT                   NSSKSLDIMDVNAQTVVAEMEKHRVQWLVHGHTHRPAVHELSVNDQPAFRVVLGAWHHE
FT                   GSMVKVTPDNVELIAFPL"
FT   gene            complement(581316..581810)
FT                   /gene="ppiB"
FT                   /locus_tag="SeAg_B0582"
FT   CDS_pept        complement(581316..581810)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ppiB"
FT                   /locus_tag="SeAg_B0582"
FT                   /product="peptidylprolyl isomerase"
FT                   /EC_number="5.2.1.8"
FT                   /note="identified by match to protein family HMM PF00160"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0582"
FT                   /db_xref="EnsemblGenomes-Tr:ACH50662"
FT                   /db_xref="GOA:B5EYD6"
FT                   /db_xref="InterPro:IPR002130"
FT                   /db_xref="InterPro:IPR020892"
FT                   /db_xref="InterPro:IPR024936"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:B5EYD6"
FT                   /protein_id="ACH50662.1"
FT                   /translation="MVTFHTNHGDIVIKTFDDKAPETVKNFLDYCREGFYNNTIFHRVI
FT                   NGFMIQGGGFEPGMKQKATKEAIKNEANNGLKNTRGTLAMARTQAPHSATAQFFINVAD
FT                   NDFLNFSGESLQGWGYCVFAEVVEGMDVVDKIKGVATGRSGMHQDVPKEDVIIENVTVS
FT                   E"
FT   gene            581983..583368
FT                   /gene="cysS"
FT                   /locus_tag="SeAg_B0583"
FT   CDS_pept        581983..583368
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysS"
FT                   /locus_tag="SeAg_B0583"
FT                   /product="cysteinyl tRNA synthetase"
FT                   /EC_number="6.1.1.16"
FT                   /note="identified by match to protein family HMM PF01406;
FT                   match to protein family HMM PF09190; match to protein
FT                   family HMM PF09334; match to protein family HMM TIGR00435"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0583"
FT                   /db_xref="EnsemblGenomes-Tr:ACH52504"
FT                   /db_xref="GOA:B5EYD7"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015273"
FT                   /db_xref="InterPro:IPR015803"
FT                   /db_xref="InterPro:IPR024909"
FT                   /db_xref="InterPro:IPR032678"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5EYD7"
FT                   /protein_id="ACH52504.1"
FT                   /translation="MLKIFNTLTRQKEEFKPIHAGEVGMYVCGITVYDLCHIGHGRTFV
FT                   AFDVVARYLRFLGYKLKYVRNITDIDDKIIKRANENGESFVALVDRMIAEMHQDFDALN
FT                   ILRPDSEPRATHHIQEIIELTRTLIEKGHAYVADNGDVMFDVPTDPTYGQLSRQDLEQL
FT                   QAGARVDVVDVKRNPMDFVLWKMSKEGEPSWPSPWGEGRPGWHIECSAMNCKQLGNHFD
FT                   IHGGGSDLMFPHHENEIAQSTCAHDGEYVNYWMHSGMVMVDREKMSKSLGNFFTVRDVL
FT                   KYYDAETVRYFLMSGHYRSQLNYSEENLKQARASLERLYTALRGTDKSAAPAGGEAFEA
FT                   RFVEAMNDDFNTPEAYSVLFDMAREVNRLKGEDMTAANAMASHLRKISGVLGLLEQEPD
FT                   VFLQSGAQADDGEVAEIEALIQQRLDARKAKDWAAADAARDRLAEMGIILEDGPQGTTW
FT                   RRK"
FT   gene            complement(583412..584236)
FT                   /locus_tag="SeAg_B0584"
FT   CDS_pept        complement(583412..584236)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0584"
FT                   /product="putative outer membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0584"
FT                   /db_xref="EnsemblGenomes-Tr:ACH52048"
FT                   /db_xref="InterPro:IPR014547"
FT                   /db_xref="UniProtKB/TrEMBL:B5EYD8"
FT                   /protein_id="ACH52048.1"
FT                   /translation="MKRFAFALWLSAISLNAYADSANCHQKANTPESIAATMDQALQLK
FT                   QQLNSQPDPVVILVRQGQDMSSRHLTWSHAGYAMRQPNGDWRVYHNLNTCGTAESALYI
FT                   QGLYEFLADDLVNQSIAVLRPRSDIATALQTLLHSATKLNLFHSPRYNLIAWPFSGPYQ
FT                   NSNGWLLEVFARANDAQVWSRNDARRWLQLQGYQPSIVSAGTFERLGAKLFTPNVFTDD
FT                   QPAELLRKGNVGLNSGDSVIRFIAHYSRAIPGCEHQNLGESVCVYLSPGAKK"
FT   gene            complement(584233..584670)
FT                   /locus_tag="SeAg_B0585"
FT   CDS_pept        complement(584233..584670)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0585"
FT                   /product="putative inner membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0585"
FT                   /db_xref="EnsemblGenomes-Tr:ACH49533"
FT                   /db_xref="UniProtKB/TrEMBL:B5EYD9"
FT                   /protein_id="ACH49533.1"
FT                   /translation="MNKMTFAAAVVCFSFSHASYSEEMSATGWYAASSAVVSVGSSALV
FT                   SGIILSPVLLPLNLSIGSVVENKKQKTALLTTKSPDNKDIKMQVPLNVVKEGNLKAGDK
FT                   VTLEKTQEGTGAYLKKEGKVLAHMVNQDDAGLSSNQTVPAK"
FT   gene            complement(584663..585208)
FT                   /locus_tag="SeAg_B0586"
FT   CDS_pept        complement(584663..585208)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0586"
FT                   /product="inner membrane protein YbcI"
FT                   /note="identified by match to protein family HMM PF04307"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0586"
FT                   /db_xref="EnsemblGenomes-Tr:ACH52327"
FT                   /db_xref="GOA:B5EYE0"
FT                   /db_xref="InterPro:IPR007404"
FT                   /db_xref="UniProtKB/TrEMBL:B5EYE0"
FT                   /protein_id="ACH52327.1"
FT                   /translation="MPTVITHAAVPLCFGAGLGLKVIPPRLLFAGVVLAMLPDADVLAF
FT                   KFGVAYGNVFGHRGFTHSLLFAFVLPLLCVLAGRRWFRAGQVRCWLFLTVSLLSHSLLD
FT                   SITTGGKGVGWLWPWSDERFFAPWQVIKVAPFALSSYITPYGHQVILSELLWVWLPGSI
FT                   LVLFLWVLKTHIKRNQYE"
FT   gene            complement(585336..585548)
FT                   /locus_tag="SeAg_B0587"
FT   CDS_pept        complement(585336..585548)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0587"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0587"
FT                   /db_xref="EnsemblGenomes-Tr:ACH49015"
FT                   /db_xref="GOA:B5EYE1"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:B5EYE1"
FT                   /protein_id="ACH49015.1"
FT                   /translation="MATFSLGKHPHVELCDLLKLEGWSESGAQAKIAIADGLVKVDGAV
FT                   ETRKRCKIVAGQTVSFEGQSVNVVA"
FT   gene            complement(585550..586416)
FT                   /gene="folD"
FT                   /locus_tag="SeAg_B0588"
FT   CDS_pept        complement(585550..586416)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folD"
FT                   /locus_tag="SeAg_B0588"
FT                   /product="methylenetetrahydrofolate
FT                   dehydrogenase/methenyltetrahydrofolate cyclohydrolase"
FT                   /EC_number="1.5.1.5"
FT                   /EC_number="3.5.4.9"
FT                   /note="identified by match to protein family HMM PF00763;
FT                   match to protein family HMM PF02882"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0588"
FT                   /db_xref="EnsemblGenomes-Tr:ACH49385"
FT                   /db_xref="GOA:B5EYE2"
FT                   /db_xref="InterPro:IPR000672"
FT                   /db_xref="InterPro:IPR020630"
FT                   /db_xref="InterPro:IPR020631"
FT                   /db_xref="InterPro:IPR020867"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5EYE2"
FT                   /protein_id="ACH49385.1"
FT                   /translation="MAAKIIDGKTIAQQVRSEVAQKVQARVAAGLRAPGLAVVLVGSNP
FT                   ASQIYVASKRKACDEVGFVSRSYDLPETTSEAELLALIDTLNADNTIDGILVQLPLPAG
FT                   IDNVKVLERIAPDKDVDGFHPYNVGRLCQRAPRLRPCTPRGIVTLLERYNIDTYGLNAV
FT                   VIGASNIVGRPMSMELLLAGCTTTVTHRFTKDLRHHVEHADLLIVAVGKPGFIPGEWIK
FT                   EGAIVIDVGINRLENGKVVGDVVFDEAAARASYITPVPGGVGPMTVATLIENTLQACIE
FT                   YHDPQGK"
FT   gene            586963..587520
FT                   /locus_tag="SeAg_B0589"
FT   CDS_pept        586963..587520
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0589"
FT                   /product="type-1 fimbrial protein, A chain"
FT                   /note="identified by match to protein family HMM PF00419"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0589"
FT                   /db_xref="EnsemblGenomes-Tr:ACH49944"
FT                   /db_xref="GOA:B5EYE3"
FT                   /db_xref="InterPro:IPR000259"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="InterPro:IPR036937"
FT                   /db_xref="UniProtKB/TrEMBL:B5EYE3"
FT                   /protein_id="ACH49944.1"
FT                   /translation="MKHKLMTSTIASLMFVAGAAVAADPTPVSVSGGTIHFEGKLVNAA
FT                   CAVSTKSADQTVTLGQYRTASFTAIGNTTAQVPFSIVLNDCDPKVAATAAVAFSGQADN
FT                   TNPNLLAVSSADNSTTATGVGIEILDNTSSPLKPDGATFSAKQALVEGTNTLRFTARYK
FT                   ATAAATTPGQANADATFIMKYE"
FT   gene            587634..588128
FT                   /locus_tag="SeAg_B0590"
FT   CDS_pept        587634..588128
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0590"
FT                   /product="fimbrial protein internal segment"
FT                   /note="identified by match to protein family HMM PF00419"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0590"
FT                   /db_xref="EnsemblGenomes-Tr:ACH50432"
FT                   /db_xref="GOA:B5EYE4"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="InterPro:IPR036937"
FT                   /db_xref="UniProtKB/TrEMBL:B5EYE4"
FT                   /protein_id="ACH50432.1"
FT                   /translation="MSPVIAQPVMVESGRIHLRGQLVNGGCAVATESQDLRVLMGQYRT
FT                   NAFTGPGSFAPVSVPFSLRLISCSAEVWRHVGIAFAGVTPAEDPHVFLASGEGIGNAGI
FT                   GLALFDDQQRQIIPNTLPLHYTPILTSEMTLHFTARYRAISENMTPGRIHSEVWFTLVY
FT                   P"
FT   gene            588172..588864
FT                   /locus_tag="SeAg_B0591"
FT   CDS_pept        588172..588864
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0591"
FT                   /product="chaperone protein FimC"
FT                   /note="identified by match to protein family HMM PF00345;
FT                   match to protein family HMM PF02753"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0591"
FT                   /db_xref="EnsemblGenomes-Tr:ACH52505"
FT                   /db_xref="GOA:B5EYE5"
FT                   /db_xref="InterPro:IPR001829"
FT                   /db_xref="InterPro:IPR008962"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR016147"
FT                   /db_xref="InterPro:IPR016148"
FT                   /db_xref="InterPro:IPR018046"
FT                   /db_xref="InterPro:IPR036316"
FT                   /db_xref="UniProtKB/TrEMBL:B5EYE5"
FT                   /protein_id="ACH52505.1"
FT                   /translation="MLNSIKLGFIVLLTLFTSLNVQAAGGIALGATRVIYPSAAKQTSL
FT                   AISNSDTQERYLVNSWIENSAGQKEKTFIVTPPLFVSEPKSENTLRIIYAGQPLPGDRE
FT                   SLFWMNVKAIPSVDKSHIEGKNVLQLAILSRIKLFVRPANLPQTPEDAPTLLKFSRVGN
FT                   HLKITNPSAYYLTLVNISVGAKKIDNVMIAPKSDMQIPLPTGAQGSVTFQTVNDYGALT
FT                   SATTASLG"
FT   gene            588895..591507
FT                   /locus_tag="SeAg_B0592"
FT   CDS_pept        588895..591507
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0592"
FT                   /product="outer membrane usher protein SfmD"
FT                   /note="identified by match to protein family HMM PF00577"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0592"
FT                   /db_xref="EnsemblGenomes-Tr:ACH50899"
FT                   /db_xref="GOA:B5EYE6"
FT                   /db_xref="InterPro:IPR000015"
FT                   /db_xref="InterPro:IPR018030"
FT                   /db_xref="InterPro:IPR025885"
FT                   /db_xref="InterPro:IPR025949"
FT                   /db_xref="InterPro:IPR037224"
FT                   /db_xref="InterPro:IPR042186"
FT                   /db_xref="UniProtKB/TrEMBL:B5EYE6"
FT                   /protein_id="ACH50899.1"
FT                   /translation="MKKTTWFAGRFPGYVSPLNGVALSVLAALCPLTSRGESYFNPAFL
FT                   SADTASVADLSRFEKGNHQPPGIYRVDIWRNDEFVATQDIRFEAGAVGAGDKSGGLMPC
FT                   FTPEWIKRLGVNTAAFPVSDKGVDTTCIHLPEKIPGAEVAFDFASMRLNISLPQASLLN
FT                   SARGYIPPEEWDEGIPAALINYSFTGSRGTDSDSYFLSLLSGLNYGPWRLRNNGAWNYS
FT                   KGDGYHSQRWNNIGTWVQRAIIPLKSELVMGDSNTGNDVFDSVGFRGARLYSSDNMYPD
FT                   SLQGYAPTVRGIARTAAKLTIRQNGYVIYQSYVSPGAFAITDLNPTSSSGDLEVTVDEK
FT                   DGSQQRYTVPYSTVPLLQREGRVKYDLVAGDFRSGNSQQSSPFFFQGTVIAGLPAGLTA
FT                   YGGTQLADRYRAVVVGAGRNLGDWGAVSVDVTHARSQLADDSTHQGQSLRFLYAKSLNN
FT                   YGTNFQLLGYRYSTRGFYTLDDVAYRSMEGYDYEYDSDGRRHKVPVAQSYHNLRYSKKG
FT                   RFQVNISQNLGDYGSLYLSGSQQNYWNTADTNTWYQLGYASGWQGISYSLSWSWSESVG
FT                   ISGADRILAFNMSVPFSVLTGRRYARDTILDRTYATFNANRNRDGDNSWQTGVGGTLLE
FT                   GRNLSYSVTQGRSSTNGYSGSASASWQATYGTLGVGYNYDRDHHDYNWQLSGGVVGHAD
FT                   GITFSQPLGDTNVLIKAPGAKGVRIENQTGVKTDWRGYAVMPYATVYRYNRVALDTNTM
FT                   DNHTDVENNVSSVVPTEGALVRAAFDTRIGVRAIITARLGGRPLPFGAIVRETASGITS
FT                   MVGDDGQIYLSGLPLKGELFIQWGEGKNARCIAPYALAEDSLKQAITIASATCIRPSS"
FT   gene            591522..592529
FT                   /locus_tag="SeAg_B0593"
FT   CDS_pept        591522..592529
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0593"
FT                   /product="mannose binding protein FimH"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0593"
FT                   /db_xref="EnsemblGenomes-Tr:ACH48884"
FT                   /db_xref="GOA:B5EYE7"
FT                   /db_xref="InterPro:IPR000259"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="InterPro:IPR036937"
FT                   /db_xref="UniProtKB/TrEMBL:B5EYE7"
FT                   /protein_id="ACH48884.1"
FT                   /translation="MKIYSALLLAGTALFFTHPALATVCRNSNGTVTDIFYDLSDVFTS
FT                   GNNQPGQVVTLPEKSGWVGVNATCPAGTTVNYTYRSYVSELPVQSTEGNFKYLKLNDYL
FT                   LGAMSITDSVAGVFYPPRNYIRMGVDSNVSQQMPFGVQDSKLVFKLKVIRPFINMVTIP
FT                   RQTMFTVYVTTSTGDALSTPVYTISYSGKVEVPQNCEVNAGQVVEFDFGDIGASLFSQA
FT                   GAGNRPQGVTPQTKTIAIKCTNVAAQAYLSMRLEAEKASGQAMVSDNPDLGFVVANSNG
FT                   TPLTPNNLSSKIPFHLDDNAAARVGIRAWPISVTGNKPAEGPFTARGYLRVDYD"
FT   gene            592539..593057
FT                   /locus_tag="SeAg_B0594"
FT   CDS_pept        592539..593057
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0594"
FT                   /product="major fimbrial subunit"
FT                   /note="identified by match to protein family HMM PF00419"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0594"
FT                   /db_xref="EnsemblGenomes-Tr:ACH49613"
FT                   /db_xref="GOA:B5EYE8"
FT                   /db_xref="InterPro:IPR000259"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="InterPro:IPR036937"
FT                   /db_xref="UniProtKB/TrEMBL:B5EYE8"
FT                   /protein_id="ACH49613.1"
FT                   /translation="MIFRRVFIAIGCVLFSPLSQANSSLGEVNIELRGNVVDFTCAVVA
FT                   GDSNKSVNLGTWPTKQLHAAGDATQPVAFSLKLEGCPPGSASITFSGTPAPGTALLALA
FT                   DTAMAQKLAIEIRDGDQRRLPLEQASKAVDIDNNGNATLKFYANYIALADGVQPGLANA
FT                   DATFLINYN"
FT   gene            complement(593103..593735)
FT                   /locus_tag="SeAg_B0595"
FT   CDS_pept        complement(593103..593735)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0595"
FT                   /product="fimbriae Z protein"
FT                   /note="identified by match to protein family HMM PF00072;
FT                   match to protein family HMM PF00196"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0595"
FT                   /db_xref="EnsemblGenomes-Tr:ACH52903"
FT                   /db_xref="GOA:B5EYE9"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:B5EYE9"
FT                   /protein_id="ACH52903.1"
FT                   /translation="MKPASVIIMDEHPIVRMSIEVLLGKNSNIQVVLKTDDSRTAIEYL
FT                   RTYPVDLVILDIELPGTDGFTLLKRIKSIQEHTRILFLSSKSEAFYAGRAIRAGANGFV
FT                   SKRKDLNDIYNAVKMILSGYSFFPSETLNFISNTRTPKGGHHDMPLSNREVTVLRYLAN
FT                   GMSNKEIAEQLLLSNKTISAHKANIFSKLGLHSIVELIDYAKSHELL"
FT   gene            complement(594339..595061)
FT                   /locus_tag="SeAg_B0596"
FT   CDS_pept        complement(594339..595061)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0596"
FT                   /product="fimbriae Y protein"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0596"
FT                   /db_xref="EnsemblGenomes-Tr:ACH48823"
FT                   /db_xref="GOA:B5EYF0"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:B5EYF0"
FT                   /protein_id="ACH48823.1"
FT                   /translation="MRSVPRRERHRRLRNAKDCACRYHSPTPQIFDHLELLNQQLNYAL
FT                   PVGIISQAIITTDNYLGYSLSHYLFSGKRTAAFRSLDDISLWIEKGSLRQLIVDMEALP
FT                   VSCIEALNQLRALSWQQSDIQIYLLVSDKTPAITQFIRMAGRFFVLSRQQNLASVREAL
FT                   LSAAKPRLSESFSRTDWLMIETLAQGASLKEIARQQSIPYHRVVYRLKQLITLLNLPHR
FT                   QSFLRLIQQLNVTFHDIF"
FT   gene            complement(595022..595174)
FT                   /locus_tag="SeAg_B0597"
FT   CDS_pept        complement(595022..595174)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0597"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0597"
FT                   /db_xref="EnsemblGenomes-Tr:ACH52528"
FT                   /db_xref="UniProtKB/TrEMBL:B5EYF1"
FT                   /protein_id="ACH52528.1"
FT                   /translation="MKHQSNEALLFTLVQRWNKVIYGQPYYQIYIRAMEKAGCAAYHAG
FT                   KDTAV"
FT   gene            complement(595553..596149)
FT                   /locus_tag="SeAg_B0599"
FT   CDS_pept        complement(595553..596149)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0599"
FT                   /product="fimbriae W protein"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0599"
FT                   /db_xref="EnsemblGenomes-Tr:ACH48725"
FT                   /db_xref="GOA:B5EYF2"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:B5EYF2"
FT                   /protein_id="ACH48725.1"
FT                   /translation="MLSIAIKEQNSHFEHGLKIIMTRLANQWQQKIDFLPPEEIDNADI
FT                   AFLALDDDWFSAGCYQIPMHTQHQLRVIICNKCDKEKLMFRPCLYMLPHIYREDDVEEI
FT                   TRKMILILHKRALRHSVPSGICHYCTTRHFSVTERHLLKLIASGYHLSETAALLSLSEE
FT                   QTKSLRRSIMRKLHVKTEQQFLKYIRVNLHFLLSK"
FT   gene            596105..596341
FT                   /locus_tag="SeAg_B0598"
FT   CDS_pept        596105..596341
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0598"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0598"
FT                   /db_xref="EnsemblGenomes-Tr:ACH51561"
FT                   /db_xref="UniProtKB/TrEMBL:B5EYF3"
FT                   /protein_id="ACH51561.1"
FT                   /translation="MLKVTVLFLNSDTQHKKYPTRQVNHGEILKKLIDFLNTGGLNSHF
FT                   MRAEMCPGDFLEPGIAPEKTIFVHLVSNQNKSH"
FT   gene            596404..596480
FT                   /locus_tag="SeAg_B0600"
FT   tRNA            596404..596480
FT                   /locus_tag="SeAg_B0600"
FT                   /product="tRNA-Arg"
FT   gene            complement(597045..597263)
FT                   /pseudo
FT                   /locus_tag="SeAg_B0601"
FT                   /note="ISEhe3, transposase OrfA; this region contains one
FT                   or more premature stops and/or frameshifts; identified by
FT                   match to protein family HMM PF01527; match to protein
FT                   family HMM PF02954"
FT   gene            complement(597650..599290)
FT                   /locus_tag="SeAg_B0602"
FT   CDS_pept        complement(597650..599290)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0602"
FT                   /product="putative inner membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0602"
FT                   /db_xref="EnsemblGenomes-Tr:ACH51171"
FT                   /db_xref="GOA:B5EYF4"
FT                   /db_xref="UniProtKB/TrEMBL:B5EYF4"
FT                   /protein_id="ACH51171.1"
FT                   /translation="MVNNRLKMVIAILIVFSLVYSIGFITPMNSDDYTYALRELSLSSV
FT                   KMHYLGWSGRVVSDTISTSLLKFFSPHIYNAINSAALTLMVLCWTMIPATLTKSSPSPY
FT                   VMIFLFFLYFVANPALGQTNFWLVGSANYLWTNMFIAIYILISIYLSNGKKSNLILFVY
FT                   AISSIFAGCSNENTSLVVVLISVAYFFIMNRNKYLLIGVFGSAIGAGVLLLAPGNLSRA
FT                   STIQDWYNQPLAWRVLEHFSERLPSAMGAYWQVYIAFIILLISVVLSRNSSSKLMFGSF
FT                   LFMLGAIAANVAFLASPAMPSRALNGALCFMILSISFVAHSAFTKFNKASIYLSVTTYA
FT                   MAFLYFIPSYILYYSSIKSISKQTEIREEIIDRAKHNKQDQAIIPDYYFPPVLHAGPSL
FT                   DTFNSEAMSRYYGIDLKITAPGFFDYSRAFNFKPLNINAKICNNVYIKSLWIYKQQMGI
FT                   KTFVIFEFNKNPADSLDENTAMFISFKTKDGKIINADVDKKTFQIDGRWLSGRAINGID
FT                   SNELESITSGTWDVRTGARTNENITEIIK"
FT   gene            complement(599283..600209)
FT                   /locus_tag="SeAg_B0603"
FT   CDS_pept        complement(599283..600209)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0603"
FT                   /product="bactoprenol glucosyl transferase"
FT                   /EC_number="2.4.1.-"
FT                   /note="identified by match to protein family HMM PF00535"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0603"
FT                   /db_xref="EnsemblGenomes-Tr:ACH51527"
FT                   /db_xref="GOA:B5EYF5"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:B5EYF5"
FT                   /protein_id="ACH51527.1"
FT                   /translation="MKISLVVPVFNEEDTIPIFYKTVREFNELKEYEVEIVFINDGSKD
FT                   ATESIINKIAASDPLVIPLSFTRNFGKEPALFAGLDHATGDAVIPIDVDLQDPIEVIPH
FT                   LIEKWQAGADMVLAKRSDRSTDGRMKRKTAEWFYKLHNKISNPKIEENVGDFRLMSREV
FT                   VENIKQMPERNLFMKGVLSWVGGKTDVVEYARAERVAGDSKFNGWKLWNLALEGITSFS
FT                   TFPLRIWTYIGLFIAGMSFLYGAWMIIDKLIFGNNVPGYPSLLVSVLFLGGVQLIGIGI
FT                   LGEYIGRIYIETKKRPKYIIKNEKKNG"
FT   gene            complement(600206..600568)
FT                   /locus_tag="SeAg_B0604"
FT   CDS_pept        complement(600206..600568)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0604"
FT                   /product="bactoprenol-linked glucose translocase"
FT                   /note="identified by match to protein family HMM PF04138"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0604"
FT                   /db_xref="EnsemblGenomes-Tr:ACH49921"
FT                   /db_xref="GOA:B5EYF6"
FT                   /db_xref="InterPro:IPR007267"
FT                   /db_xref="InterPro:IPR016480"
FT                   /db_xref="UniProtKB/TrEMBL:B5EYF6"
FT                   /protein_id="ACH49921.1"
FT                   /translation="MLKLFAKYTSIGVLNTLIHWGVFAFCVYGMHTHQALANFSGFVIA
FT                   VSFSFYANARFTFNASTTTLRYMMYVGFMGTLSAVVGWMADKCSLPPLLTLITFSAISL
FT                   ICGFIYSKFIVFRDAK"
FT   gene            complement(600991..601236)
FT                   /locus_tag="SeAg_B0605"
FT   CDS_pept        complement(600991..601236)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0605"
FT                   /product="copE1"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0605"
FT                   /db_xref="EnsemblGenomes-Tr:ACH50688"
FT                   /db_xref="UniProtKB/TrEMBL:B5EYF7"
FT                   /protein_id="ACH50688.1"
FT                   /translation="MESRQLSATAHEMMNNGDAFAHQQMAQTQKLSAPTPVENATPFSE
FT                   MDDYEKAMVIHQSMNNAHSFAHEIQAEEHHKQIKHN"
FT   gene            complement(601436..601810)
FT                   /locus_tag="SeAg_B0606"
FT   CDS_pept        complement(601436..601810)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0606"
FT                   /product="sensor kinase CusS"
FT                   /EC_number="2.7.13.3"
FT                   /note="identified by match to protein family HMM PF02518"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0606"
FT                   /db_xref="EnsemblGenomes-Tr:ACH49554"
FT                   /db_xref="GOA:B5EYF8"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B5EYF8"
FT                   /protein_id="ACH49554.1"
FT                   /translation="MRFEGRACWITGDPIMLRRAISNLLSNAMRYTPPGKTITLRIKEA
FT                   DDQIHIIVENPGTPIAPEHLPRLFDRFYRVDPYRQRKGEGSGIGLAIVKSIVIAHQGKV
FT                   SVTSDTRATRFILTLPKHLR"
FT   gene            601865..602080
FT                   /locus_tag="SeAg_B0607"
FT   CDS_pept        601865..602080
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0607"
FT                   /product="cation efflux system protein CusA"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0607"
FT                   /db_xref="EnsemblGenomes-Tr:ACH50214"
FT                   /db_xref="GOA:B5EYF9"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="UniProtKB/TrEMBL:B5EYF9"
FT                   /protein_id="ACH50214.1"
FT                   /translation="MLRVRSKTMTVAVIIAGLLPVLWGTGAGSEVMSRIAAPMIGGMIT
FT                   APLLSLFIIPAAYKLMWLRRHRRLAA"
FT   gene            complement(602131..602985)
FT                   /locus_tag="SeAg_B0608"
FT   CDS_pept        complement(602131..602985)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0608"
FT                   /product="transcriptional regulator, AraC family protein"
FT                   /note="identified by match to protein family HMM PF00165"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0608"
FT                   /db_xref="EnsemblGenomes-Tr:ACH48664"
FT                   /db_xref="GOA:B5EYG0"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="InterPro:IPR032783"
FT                   /db_xref="UniProtKB/TrEMBL:B5EYG0"
FT                   /protein_id="ACH48664.1"
FT                   /translation="MDALSRLLTLNAPQGSIDKNCPLGGDWQLPHAAGELSVIRWHTVT
FT                   QGEAQLEMPTGDAMTLTPGKVVILPQNSAHRLRQSGESPTHIVCGSLRLHTTSRYFLTA
FT                   LPEVLCLAPPPHSPASIWINAAILLLQQESERHLPGADVLYSQQCATLFTLAVRDWLLQ
FT                   AGTAKSVLNLLLHPRLGRVILHMLETPAHPWTVETLAQRVHMSRASFAQLFRDVSATTP
FT                   LAVLTTLRLQIAAQTLSREALPVMVIAESVGYASESSFHKAFVREFGCTPGEYRKRVSA
FT                   LGR"
FT   gene            603201..604526
FT                   /locus_tag="SeAg_B0609"
FT   CDS_pept        603201..604526
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0609"
FT                   /product="probable pyridine nucleotide-disulfide
FT                   oxidoreductase YkgC"
FT                   /note="identified by match to protein family HMM PF00070;
FT                   match to protein family HMM PF01266; match to protein
FT                   family HMM PF02852; match to protein family HMM PF07992"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0609"
FT                   /db_xref="EnsemblGenomes-Tr:ACH50361"
FT                   /db_xref="GOA:B5EYG1"
FT                   /db_xref="InterPro:IPR001100"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR012999"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B5EYG1"
FT                   /protein_id="ACH50361.1"
FT                   /translation="MTQYQALIIGFGKAGKTLAATLAKTGWRVAIIEQSASMFGGTCIN
FT                   IGCIPTKTLVHDAEREGDFSVAMQRKAAVVNFLRDKNFHNLADLDNVDVIEGRAEFIDN
FT                   HTLRVFQADGERVLRGEKIFINTGAESVIPAITGLTTTAGVFDSTGLLSLSQRPARLGI
FT                   LGGGYIGLEFASMFANFGTKVTIFEAAPQFLPREDRDIAQAITRILQEKGVELILNANV
FT                   QAVSSKEGAVQVETPEGAHLVDALLVASGRKPATAGLQLQNAGVEVNERGGIIVDDYLR
FT                   TTADNIWAMGDVTGGLQFTYISLDDFRIVRDGLLGDGKRSTRDRQNVPYSVFMTPPLSR
FT                   VGLTEEQARASGATVQVVTLPVAAIPRARVMNDTRGVLKAVVDVNTQRIVGVSLLCVDS
FT                   HEMINIVKTVMDADLPYTVLRDQIFTHPTMSESLNDLFSLIK"
FT   gene            604683..604919
FT                   /locus_tag="SeAg_B0610"
FT   CDS_pept        604683..604919
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0610"
FT                   /product="conserved domain protein"
FT                   /note="identified by match to protein family HMM PF07338"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0610"
FT                   /db_xref="EnsemblGenomes-Tr:ACH52344"
FT                   /db_xref="InterPro:IPR010854"
FT                   /db_xref="InterPro:IPR025543"
FT                   /db_xref="InterPro:IPR036275"
FT                   /db_xref="UniProtKB/TrEMBL:B5EYG2"
FT                   /protein_id="ACH52344.1"
FT                   /translation="MLKITTLIASLLAAPLAFSASAQPLTDVEYISVSAVSATPSMLED
FT                   AIARLAQSKQASSWKITSMRIDNTGYATAILYK"
FT   gene            604932..605492
FT                   /locus_tag="SeAg_B0611"
FT   CDS_pept        604932..605492
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0611"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF04224"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0611"
FT                   /db_xref="EnsemblGenomes-Tr:ACH49317"
FT                   /db_xref="GOA:B5EYG3"
FT                   /db_xref="InterPro:IPR007339"
FT                   /db_xref="InterPro:IPR016865"
FT                   /db_xref="UniProtKB/TrEMBL:B5EYG3"
FT                   /protein_id="ACH49317.1"
FT                   /translation="MDKYLRLLSQGDRLGLTLIRLSIAIVFIWIGLLKFVPYEADSITP
FT                   FVANSPFMSFFYEHPEEYRQHLTHEGELKPEERAWQTANNTYAFSDGLGVVELIIAALV
FT                   LANPVSRWLGLAGGVLAFLTPFVTLSFLITTPEAWVMPLGDAHYGFPYLSGAGRLVLKD
FT                   TLMLAGAVMIMADSARSLLLQRQ"
FT   gene            complement(605587..606762)
FT                   /locus_tag="SeAg_B0612"
FT   CDS_pept        complement(605587..606762)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0612"
FT                   /product="heat shock protein DnaJ domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0612"
FT                   /db_xref="EnsemblGenomes-Tr:ACH52488"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:B5EYG4"
FT                   /protein_id="ACH52488.1"
FT                   /translation="MNKIIKRLEIIKSAIELEDEEIIRQQLIYLKNEPQDAVISAIAHA
FT                   IEARRFSDAMQEIAAWLQAQRALSTWQDPSIAASKLELKALEAQLRDLIDKRNARVQIL
FT                   DDFNDLYHLRLGPLMSRILELRKQLAVSMQRKQEAEIKRREKDYQSCLQFISQAVDQLA
FT                   TLKQQWTGLNAASREAVGIRQRIQQQTELITALLAEIRELEADFSHQDDSAFRQAQENA
FT                   EQDYHQYREQQQEAQFRYARDQRLSADERSELKRLWRQASRLCHPDVVADELKEKAHQM
FT                   MVQLNQARQNADLAAIRALLTQLQSGLEPMMASDRLNNLEHLRHKIRQLRTQIDALLKE
FT                   ITQLETENAWRLASSVADKEAYFSEQERALTEIRNTLEAQVQQVEQELLSG"
FT   gene            607088..608482
FT                   /locus_tag="SeAg_B0613"
FT   CDS_pept        607088..608482
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0613"
FT                   /product="phenylalanine-specific permease"
FT                   /note="identified by match to protein family HMM PF00324"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0613"
FT                   /db_xref="EnsemblGenomes-Tr:ACH52955"
FT                   /db_xref="GOA:B5EYG5"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004840"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniProtKB/TrEMBL:B5EYG5"
FT                   /protein_id="ACH52955.1"
FT                   /translation="MKNASTASGASVSDAASKNEPTLQRGLQNRHIQLIALGGAIGTGL
FT                   FLGIGPAIQMAGPAVLLGYGVAGIIAFLIMRQLGEMVVEEPVSGSFAHFAWKYWGPFAG
FT                   FLSGWNYWVMFVLVGMAELTAAGIYMQYWLPDVPTWIWAAAFFIIINAVNLVNVRLYGE
FT                   TEFWFALIKVLAIIGMIGFGLWLLFSGHGGEHASIDNLWRYNGFFATGWHGLLLSLAVI
FT                   MFSFGGLELIGITAAEARDPQKSIPKAVNQVVYRILLFYIGSLVVLLALYPWVEVKSNS
FT                   SPFVMIFHNLDSNVVASALNFVILVASLSVYNSGVYSNSRMLFGLSVQGNAPKFLTRVS
FT                   HRGVPVNSLILSGAITSLVVLINYLLPQKAFSLLMALVVATLLLNWIMICLAHLRFRAA
FT                   MRRKGRETQFKALFYPAGNYLCIAFLALILVLMCTMDDMRLSAILLPVWIVFLFIAFTV
FT                   LRRKAH"
FT   gene            complement(608524..609771)
FT                   /locus_tag="SeAg_B0614"
FT   CDS_pept        complement(608524..609771)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0614"
FT                   /product="transporter, small conductance mechanosensitive
FT                   ion channel"
FT                   /note="identified by match to protein family HMM PF00924"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0614"
FT                   /db_xref="EnsemblGenomes-Tr:ACH51581"
FT                   /db_xref="GOA:B5EYG6"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR011066"
FT                   /db_xref="InterPro:IPR030192"
FT                   /db_xref="UniProtKB/TrEMBL:B5EYG6"
FT                   /protein_id="ACH51581.1"
FT                   /translation="MQELISQVEDLAGIEMNHTTSLVVIFGIIFLTAVVVHIILHWIVL
FT                   RAFEKRANASSRLWLQIITQNKLFHRLAFTLQGIIVNIQAALWLQKGSEAADILTTCAQ
FT                   LWIMTYALLSLFSLLDVIFNLSQKWPAASQLPLKGIFQGIKLIGAIIVGILMISLLIGQ
FT                   SPAILISGLGAMAAVLMLVFKDPILGLVAGIQLSANDMLKLGDWLEMPKYGADGAVIDI
FT                   GLTTVKVRNWDNTITTIPTWSLVSDSFKNWSGMSASGGRRIKRSINIDATSIHFLDDDE
FT                   KQRLLTAQLLKPYLTSRHQEIDEWNKQLDAPESALNHRRMTNIGTFRAYLNEYLRHHPR
FT                   IRKDMTLMVRQLAPDDHGLPIEIYAFTNTVVWLEYESIQADIFDHIFAVVEEFGLRIHQ
FT                   TPTGSDIRALSGTLRH"
FT   gene            609801..609983
FT                   /locus_tag="SeAg_B0615"
FT   CDS_pept        609801..609983
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0615"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0615"
FT                   /db_xref="EnsemblGenomes-Tr:ACH50956"
FT                   /db_xref="UniProtKB/TrEMBL:B5EYG7"
FT                   /protein_id="ACH50956.1"
FT                   /translation="MTAEWHLCKSGRLRFRHNQQQTGKSATGVIHTLYFIQRPINVVIL
FT                   RGSLFLNRRQSVNNE"
FT   gene            610082..612052
FT                   /locus_tag="SeAg_B0616"
FT   CDS_pept        610082..612052
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0616"
FT                   /product="lipase 1"
FT                   /EC_number="3.1.1.3"
FT                   /note="identified by match to protein family HMM PF00657;
FT                   match to protein family HMM PF03797; match to protein
FT                   family HMM TIGR01414"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0616"
FT                   /db_xref="EnsemblGenomes-Tr:ACH49814"
FT                   /db_xref="GOA:B5EYG8"
FT                   /db_xref="InterPro:IPR001087"
FT                   /db_xref="InterPro:IPR005546"
FT                   /db_xref="InterPro:IPR017186"
FT                   /db_xref="InterPro:IPR036514"
FT                   /db_xref="InterPro:IPR036709"
FT                   /db_xref="UniProtKB/TrEMBL:B5EYG8"
FT                   /protein_id="ACH49814.1"
FT                   /translation="MTQKRTLLKYGILSLALAAPLSACAFDSLTVIGDSLSDTGNNGRW
FT                   TWDSGQNKLYDEQLAERYGLELSPSSNGGSNYAAGGATATPELNPQDNTADQVRQWIAK
FT                   TGGKADHNGLYIHWVGGNDLAAAIAQPTMAQQIAGNSATSAAAQVGLLLDAGAGLVVVP
FT                   NVPDISATPMLLEAVITAGLGAAAPPALKAALDALAEGATPDFASRQQAIRKALLAAAA
FT                   TVSSNPFIQQLLVEQLLAGYETAAGQASALTDYYNQMEEKGLEQHGGNIARADINGLFK
FT                   EILANPQAFGLTNTVGMACPPGVSASACSSAMPGFNASQDYLFADHLHPGPQVHTIIAQ
FT                   YIQSIIAAPVQATYLNQSVQSMAQGSRTTLDSRYQQLRQGENPVGSLGMFGGYSGGYQR
FT                   YDNNEADGNGNHNNLTVGVDYQLNEQVLLGGLIAGSLDKQHPDDNYRYDARGFQAAVFS
FT                   HLRAGQAWLDSDLHYLSAKFSNIQRSITLGALRRVEEGETNGRLWGARLTSGYDFVMMP
FT                   WLTTGPMLQYAWDYSHVNGYSEKLNTSTSMRFGDQNAHSQVGSAGWRLDLRHSIIHSWA
FT                   QINYRRQFGDDTYVANGGLKSTALTFSRDGKTQDKNWVDIAIGADFPLSATVSAFAGLS
FT                   QTAGLSDGNQTRYNVGFSARF"
FT   gene            complement(612318..612971)
FT                   /locus_tag="SeAg_B0617"
FT   CDS_pept        complement(612318..612971)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0617"
FT                   /product="oxygen-insensitive NAD"
FT                   /EC_number="1.-.-.-"
FT                   /EC_number="1.5.1.34"
FT                   /note="identified by match to protein family HMM PF00881"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0617"
FT                   /db_xref="EnsemblGenomes-Tr:ACH49190"
FT                   /db_xref="GOA:B5EYG9"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="InterPro:IPR033878"
FT                   /db_xref="UniProtKB/TrEMBL:B5EYG9"
FT                   /protein_id="ACH49190.1"
FT                   /translation="MDIVSVALQRYSTKAFDPSKKLTAEEADKIKTLLQYSPSSTNSQP
FT                   WHFIVASTEEGKARVAKSAAGNYTFNERKMLDASHVVVFCAKTAMDDAWLERVVDQEEA
FT                   DGRFATPEAKAANDKGRRFFADMHRVSLKDDHQWMAKQVYLNVGNFLLGVAAMGLDAVP
FT                   IEGFDAEVLDAEFGLKEKGYTSLVVVPVGHHSVEDFNAGLPKSRLPLETTLTEV"
FT   gene            complement(613068..613436)
FT                   /locus_tag="SeAg_B0618"
FT   CDS_pept        complement(613068..613436)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0618"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF04237"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0618"
FT                   /db_xref="EnsemblGenomes-Tr:ACH50868"
FT                   /db_xref="InterPro:IPR007351"
FT                   /db_xref="InterPro:IPR038056"
FT                   /db_xref="UniProtKB/TrEMBL:B5EYH0"
FT                   /protein_id="ACH50868.1"
FT                   /translation="MDGQTLHACAKRFALELPFTEHCWPFGPQYDVFKVGGKIFMLFTE
FT                   HHCRPVVNLKSDPQKSLVNQQIYPSIAPGYHMNKKHWISVYAGEDITVSLLNDLINDSW
FT                   NLVVDGLPKREQLRLRPR"
FT   gene            complement(613436..614017)
FT                   /locus_tag="SeAg_B0619"
FT   CDS_pept        complement(613436..614017)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0619"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="identified by match to protein family HMM PF00440"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0619"
FT                   /db_xref="EnsemblGenomes-Tr:ACH50230"
FT                   /db_xref="GOA:B5EYH1"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="UniProtKB/TrEMBL:B5EYH1"
FT                   /protein_id="ACH50230.1"
FT                   /translation="MARPKSEDKKQALLEAATQAIAQSGIAASTAVIARNAGVAEGTLF
FT                   RYFATKDELINTLYLHLKQDLCQSMIMELDRSITDAKMMTRFIWNSYISWGLNHPARHR
FT                   AIRQLAVSEKLTKETEQRADDMFPELRDLCHRSVLMVFMSDEYRAFGDGLFLALAETTM
FT                   DFAARDPARAGEYIALGFEAMWRALTREEQ"
FT   gene            614306..614647
FT                   /locus_tag="SeAg_B0620"
FT   CDS_pept        614306..614647
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0620"
FT                   /product="transposon tn10 tetd protein"
FT                   /note="identified by match to protein family HMM PF00165"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0620"
FT                   /db_xref="EnsemblGenomes-Tr:ACH51861"
FT                   /db_xref="GOA:B5EYH2"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="UniProtKB/TrEMBL:B5EYH2"
FT                   /protein_id="ACH51861.1"
FT                   /translation="MTISAQVIDTIVEWIDDNLNQPLRIDDIARHAGYSKWHLQRLFMQ
FT                   YKGESLGRYVRERKLKLAARDLRDTDQKVYDICLKYGFDSQQTFTRIFTRTFNLPPGAY
FT                   RKEKHGRTH"
FT   gene            complement(614653..614877)
FT                   /locus_tag="SeAg_B0621"
FT   CDS_pept        complement(614653..614877)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0621"
FT                   /product="putative inner membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0621"
FT                   /db_xref="EnsemblGenomes-Tr:ACH51229"
FT                   /db_xref="GOA:B5EYH3"
FT                   /db_xref="InterPro:IPR010590"
FT                   /db_xref="UniProtKB/TrEMBL:B5EYH3"
FT                   /protein_id="ACH51229.1"
FT                   /translation="MTAAGILLMALLSSLLLPAPSLGLALAQKLVGIFHLMDLNQLYTL
FT                   LFCLWFLLLGALEYYVIRFIWRRWFSLAD"
FT   gene            complement(614968..616086)
FT                   /locus_tag="SeAg_B0622"
FT   CDS_pept        complement(614968..616086)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0622"
FT                   /product="carboxylate-amine ligase YbdK"
FT                   /EC_number="6.3.-.-"
FT                   /note="identified by match to protein family HMM PF04107;
FT                   match to protein family HMM TIGR02050"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0622"
FT                   /db_xref="EnsemblGenomes-Tr:ACH49509"
FT                   /db_xref="GOA:B5EYH4"
FT                   /db_xref="InterPro:IPR006336"
FT                   /db_xref="InterPro:IPR011793"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5EYH4"
FT                   /protein_id="ACH49509.1"
FT                   /translation="MALNDFHVSEPYTLGIELEMQVINPPGYDLSQDSSTLIDAVKPQL
FT                   TAGEIKHDITESMLEMATGVCRDIDQAAAQLSAMQHVILQAASEHHLGICGGGTHPFQK
FT                   WQRQEVCDNERYQRTLENFGYLIQQATVFGQHVHVGCANGDDAIYLLHGLSHFVPHFIA
FT                   LSAASPYMQGSDTRFACARLNIFSAFPDNGPMPWVSNWQEFAGLFRRLSYTTMIDSIKD
FT                   LHWDIRPSPAFGTVEVRVMDTPLTLDHAINMAGLIQATAHWLLTERPFKPQEQDYLLYK
FT                   FNRFQACRYGLEGVLTDVYTGDRRRLADDTLRLLDNVTPSARKLGADSAIDALRLQVKK
FT                   GGNEAQYMREFIADGGSLIGLVQKHCEIWTGQ"
FT   gene            complement(616098..616802)
FT                   /locus_tag="SeAg_B0623"
FT   CDS_pept        complement(616098..616802)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0623"
FT                   /product="4'-phosphopantetheinyl transferase EntD"
FT                   /EC_number="2.7.8.-"
FT                   /note="identified by match to protein family HMM PF01648"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0623"
FT                   /db_xref="EnsemblGenomes-Tr:ACH48966"
FT                   /db_xref="GOA:B5EYH5"
FT                   /db_xref="InterPro:IPR003542"
FT                   /db_xref="InterPro:IPR008278"
FT                   /db_xref="InterPro:IPR037143"
FT                   /db_xref="InterPro:IPR041354"
FT                   /db_xref="UniProtKB/TrEMBL:B5EYH5"
FT                   /protein_id="ACH48966.1"
FT                   /translation="MLTSHFPLPFAGHRLHIVDFDASSFHEHDLLWLPHHDRLRSAGHK
FT                   RKAEHLAGRIAAVHALREMGVRTVPGIGDKRQPLWPDGLFGSISHCASTALAVISRQRI
FT                   GIDIEKIMSQHTATELAPSIIDSDERQILQASTLPFPLALTLAFSAKESVYKAFSDRVT
FT                   LPGFNSAKVTSLTATHISLHLLPAFAATMAERTVRTEWFQRGNSVITLVSAITRFPHDR
FT                   SAPASILSAIPR"
FT   gene            complement(616849..619104)
FT                   /locus_tag="SeAg_B0624"
FT   CDS_pept        complement(616849..619104)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0624"
FT                   /product="ferrienterobactin receptor"
FT                   /note="identified by match to protein family HMM PF00593;
FT                   match to protein family HMM PF07715; match to protein
FT                   family HMM TIGR01783"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0624"
FT                   /db_xref="EnsemblGenomes-Tr:ACH50512"
FT                   /db_xref="GOA:B5EYH6"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010105"
FT                   /db_xref="InterPro:IPR010916"
FT                   /db_xref="InterPro:IPR010917"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039426"
FT                   /db_xref="UniProtKB/TrEMBL:B5EYH6"
FT                   /protein_id="ACH50512.1"
FT                   /translation="MNKKIHSLTLLVNLGIYGAALPVMAEDKTDSAALTNEDTIVVTAA
FT                   QQNLQAPGVSTITADEIRKNPPARDVSEIIRTMPGVNLTGNSTSGQRGNNRQIDIRGMG
FT                   PENTLILIDGKPVTSRNSVRLGWRGERDTRGDTAWVPPEMIERIEVLRGPAAARYGNGA
FT                   AGGVVNIITKKGGSEWHGSWNTYFNAPEHKDEGATKRTNFSLNGPLGGDFSFRLYGNLD
FT                   KTQADARNINQGHQSERTGSYADTLPAGREGVINKDINGVVRWDFAPLQSLELEAGYSR
FT                   QGNLYAGDTQNTNTNQLVKDNYGKETNRLYRQNYSLTWNGGWDNGVTTSNWVQYEHTRN
FT                   SRMPEGLAGGTEGIFDPKASQKYADADLNDVTLHSEVSLPFDLLVNQNLTLGTEWAQQR
FT                   MKDELSNSQTFMGGNIPGYSSTNRSPYSKAEIFSLFAENNMELTDSTMLTPGLRFDHHS
FT                   IVGDNWSPSLNLSQGLGDDFTLKMGIARAYKAPSLYQTNPNYILYSKGQGCYATGAGTG
FT                   IGCYMMGNDDLKAETSINKEIGLEFKRDGWLAGITWFRNDYRNKIEAGTVPLQRINNGK
FT                   TDVYQWENVPKAVVEGLEGTLNVPVSDTVNWTNNVTYMLQSKNKETGERLSIIPQYTLN
FT                   STLSWQVRQDVSLQSTFTWYGKQEPKKYDYQGNPVTGTDKQAVSPYSIVGLSATWDVTK
FT                   NVSLTGGVDNLFDKRLWREGNAQTVRDTQTGAYMAGAGAYTYNEPGRTWYMSINTHF"
FT   gene            619293..620507
FT                   /locus_tag="SeAg_B0625"
FT   CDS_pept        619293..620507
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0625"
FT                   /product="enterochelin esterase"
FT                   /note="identified by match to protein family HMM PF00756"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0625"
FT                   /db_xref="EnsemblGenomes-Tr:ACH50027"
FT                   /db_xref="GOA:B5EYH7"
FT                   /db_xref="InterPro:IPR000801"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR021764"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B5EYH7"
FT                   /protein_id="ACH50027.1"
FT                   /translation="MKEALATGSEAWWRTKTGPEWIREKDGNYRVTFWWRDPQGNETHS
FT                   PIRRVWVYITGVTDHHQNAQPQTMERIAGTDVWRWSTALSANWRGSYCFIPTERDDVFA
FT                   AFAPGETPDRNALREGWRQLLPQAIADPLNSQSWRGGRGHAVSALEMPDAPLQPGWDRP
FT                   EMPYSPPLMMQWHSERLGNSRRVWILTTGDEAPEERPLAILLDGQFWAENMPVWPALAS
FT                   LTHQRLLPGAVYLLIDAIDTRHRSQELPCNTDFWLAVQQELLPQVRAVTPFSDDAGRTV
FT                   VAGQSFGGLSALYAGLNWPTRFGCVLSQSGSFWWPHRITPPEGEVITRLKTGALCARGL
FT                   RIVLEAGVREPIVFQANQALYAQLNTSQQSIFWRQVDGGHDALCWRGGLTQGLMLLWQP
FT                   LIDTL"
FT   gene            620538..620756
FT                   /locus_tag="SeAg_B0626"
FT   CDS_pept        620538..620756
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0626"
FT                   /product="conserved domain protein"
FT                   /note="identified by match to protein family HMM PF03621"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0626"
FT                   /db_xref="EnsemblGenomes-Tr:ACH50187"
FT                   /db_xref="InterPro:IPR005153"
FT                   /db_xref="InterPro:IPR037407"
FT                   /db_xref="InterPro:IPR038020"
FT                   /db_xref="UniProtKB/TrEMBL:B5EYH8"
FT                   /protein_id="ACH50187.1"
FT                   /translation="MEFSNPFDNPQGQFYILQNAQRQFSLWPAACALPAGWDVVCEPQS
FT                   QDACQQWLNTRWTTLNPAHYADKQEAK"
FT   gene            620753..624637
FT                   /locus_tag="SeAg_B0627"
FT   CDS_pept        620753..624637
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0627"
FT                   /product="enterobactin synthetase component F"
FT                   /EC_number="2.7.7.-"
FT                   /note="identified by match to protein family HMM PF00501;
FT                   match to protein family HMM PF00550; match to protein
FT                   family HMM PF00668; match to protein family HMM PF00975;
FT                   match to protein family HMM TIGR01733"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0627"
FT                   /db_xref="EnsemblGenomes-Tr:ACH48526"
FT                   /db_xref="GOA:B5EYH9"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR001031"
FT                   /db_xref="InterPro:IPR001242"
FT                   /db_xref="InterPro:IPR006162"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR010071"
FT                   /db_xref="InterPro:IPR020802"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:B5EYH9"
FT                   /protein_id="ACH48526.1"
FT                   /translation="MTQRLPLVAAQPGIWMAEKLSDLPSAWSVAHYVELNGELDAPLLA
FT                   KAVAVGMQQADTLRMRFTEENGEVWQWIDPEHTFSEPPIADLRDHPDPHHAALALMQAD
FT                   LRQNLRADSGKPLAFHQLIRIDDTRWYWYQRYHHLLVDGFSFPAITRQIAAIYRAWQSD
FT                   APTPESPFTPFADVVEEYQRYHQSKAWQRDGAFWAQQRRELPPPASISAAPLPGRSASA
FT                   DVLRMKLSAPAGAFRQLAAHMPEIPRADLALALVTLWLGRLCGRMDYAAGFIFMRRMGS
FT                   AALTATGPVLNVLPLAVNLYATEDLPTLAKRLAAQLKKMRRHQRYDAEQIVRDSGRAAG
FT                   ETPLFGPVLNIKMFDYYLDLPGIQAQTHTLATGPVNDLELALFPDENGGLDIELLANAQ
FT                   RYDDATLSRHALRLMALITQFADNPALCCGDAQMLLAEEQTQLTHLNNTAVTIPAATLS
FT                   DLVAQQAQKTPEASALADAHYHFTYREMREQVVALAYALRERGVQPGDSVAVALPRSVF
FT                   LTLALHGIVEAGAAWLPLDTGYPDDRLRMMLEDAQPKLLITTQAQLARFHDIPGMEYLC
FT                   YSQPLPVSNATPLGLSLPHHTAYIIFTSGSTGRPKGVMVGQTAIVNRLLWMQDHYPLTA
FT                   DDVVAQKTPCSFDVSVWEFFWPFIAGAKLVMAEPEAHRDPLAMQRFFAQYGVTTTHFVP
FT                   SMLAAFIASLTPASAGKSCASLKRVFCSGEALPTALCREWETLTNAPLHNLYGPTEAAV
FT                   DVSWYPACGDELAAVDGNSIPIGYPVWNTGLRILDAHMQPVPPGVAGDLYLTGIQLAQG
FT                   YLGRPDLTASRFIADPFAPGERMYRTGDVARWLDSGAVEYLGRSDDQLKIRGQRIELGE
FT                   IDRVMQTLPDVEQAVAHACVFNQAAATGGDARQLVGYLVSHSGLPLDLPALQEKLRQKL
FT                   PAHMVPVVLLQLAGLPLSANGKLDRKALPLPDLTPRVKGRAPQSATEIAVAAAFSRLLG
FT                   CEINDVESDFFALGGHSLLAMKLAAQLSQTFNRQVTPGQVMVASDVAQLSKLLDTDDDE
FT                   RSRNLGFGPLLPLRESDGPTLFCFHPASGFAWQFSVLSRYLSPSWSIMGIQSPRPAGPM
FT                   QTATTLDEVCEHHLATLLARQPHGPYYLLGYSLGGTLAQGIAARLRARGETVAFLGLLD
FT                   TWPPETQNWREKEANGLNPDVLAEIERERAAFVAAQQGNASEALFTAIEGNYADAVRLL
FT                   TTAHSVPFDGHATLFVADKTVPEGVSPEQSWSPWIASLAIYRQPCAHVDIISPSAFETI
FT                   GPIISELINK"
FT   gene            624888..626024
FT                   /locus_tag="SeAg_B0628"
FT   CDS_pept        624888..626024
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0628"
FT                   /product="ferric enterobactin transport protein FepE"
FT                   /note="identified by match to protein family HMM PF02706"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0628"
FT                   /db_xref="EnsemblGenomes-Tr:ACH49204"
FT                   /db_xref="GOA:B5EYI0"
FT                   /db_xref="InterPro:IPR003856"
FT                   /db_xref="UniProtKB/TrEMBL:B5EYI0"
FT                   /protein_id="ACH49204.1"
FT                   /translation="MPSLNVKQEKNQSFAGYSLPPANSHEIDLFSLIEVLWQAKRRILA
FT                   TVFAFACVGLLLSFLLPQKWTSQAIVTPAESVQWQGLERTLTALRVLDMEVSVDRASVF
FT                   NLFIKKFSSPSLLEEYLRSSPYVMDQLKGAQIEEQDLHRAIVVLSEKMKAVDSNVGKKN
FT                   ETSLFTSWTLSFTAPTREEAQKVLAGYIQYISDIVVKETLENIRNQLEIKTRYEQEKLA
FT                   MDRVRLKNQLDANIQRLHYSLEIANAAGIKRPVYSNGQAVKDDPDFSISLGADGISRKL
FT                   EIEKGVTDVAEIDGDLRNRQYHVEQLAAMNVSDVKFTPFKYQLSPSLPVKKDGPGKAVI
FT                   IILAALIGGMMACGGVLLRHAMVSRKMENALAIDERLV"
FT   gene            complement(626077..626871)
FT                   /locus_tag="SeAg_B0629"
FT   CDS_pept        complement(626077..626871)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0629"
FT                   /product="ferric enterobactin transport ATP-binding protein
FT                   FepC"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0629"
FT                   /db_xref="EnsemblGenomes-Tr:ACH52009"
FT                   /db_xref="GOA:B5EYI1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B5EYI1"
FT                   /protein_id="ACH52009.1"
FT                   /translation="MTESVARLRGDQLTLGYGSYTVAKNLNVSIPDGHFTAIIGPNGCG
FT                   KSTLLRTLSRLMTPVDGHVWLDGEQIQRYASKEVARRIGLLAQNATTPGDITVQELVAR
FT                   GRYPHQPLFTRWRKEDADAVASAMRATGITSLATQSVDTLSGGQRQRAWIAMVLAQETS
FT                   IMLLDEPTTWLDISHQIDLLELLSDLNREKGYTLAAVLHDLNQACRYATHLIALREGNI
FT                   VAQGAPKEIVTAELIEKIYGLRCMIIDDPVAGTPLVVPLGRR"
FT   gene            complement(626868..627857)
FT                   /locus_tag="SeAg_B0630"
FT   CDS_pept        complement(626868..627857)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0630"
FT                   /product="ferric enterobactin transport system permease
FT                   protein FepG"
FT                   /note="identified by match to protein family HMM PF01032"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0630"
FT                   /db_xref="EnsemblGenomes-Tr:ACH52812"
FT                   /db_xref="GOA:B5EYI2"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:B5EYI2"
FT                   /protein_id="ACH52812.1"
FT                   /translation="MFLSRRLIVSCLLLAAGCFAIGLWSLQSGAVPLETGQIIAALLGD
FT                   APRNITLVVTEWRLPRVLMALLIGAALGVSGAIFQSLMRNPLGSPDVMGFNTGAWSGVL
FT                   VAMVLFGQHLTAIALAAMAGGIVTSLIVWLLAWRNGIETFRLIIIGIGIRAMLVAFNTW
FT                   LLLQASLETALTAGLWNAGSLNGLTWAKTWPSAPLIIVMLTGAALLVRRMRLLEMGDDS
FT                   ACALGVSVERSRLMLMLVAVSLTAAATALAGPISFIALVAPHIARRLSGTARWGLTQSA
FT                   LCGALLLLAADACAQQLFMPYQLPVGVVTVSLGGIYLIVLLIQESRKK"
FT   gene            complement(627857..628864)
FT                   /locus_tag="SeAg_B0631"
FT   CDS_pept        complement(627857..628864)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0631"
FT                   /product="ferric enterobactin transport system permease
FT                   protein FepD"
FT                   /note="identified by match to protein family HMM PF01032"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0631"
FT                   /db_xref="EnsemblGenomes-Tr:ACH51682"
FT                   /db_xref="GOA:B5EYI3"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:B5EYI3"
FT                   /protein_id="ACH51682.1"
FT                   /translation="MSCSFSVTRAFAVPGLLLLLSLAAVLSLVIGAKPLPAAAVLEAFT
FT                   GVCQSADCTIVLDARLPRTLAGLLAGGALGLAGALMQTLTRNPLADPGILGVNNGASFA
FT                   IVLGAALFGFSTPLEQLFMAFSGALIASLIVAFTGSQGGGQLSPVRLTLAGVALGAVLE
FT                   GLTSGIALLNPEVYDQLRFWQAGSLDIRSLQTLKVALAPVVIAGIVALFLSRALNSLSL
FT                   GSDTATALGSKVARTQLIGLLAITVLCGSATALVGPIAFIGLMMPHMARWLVGADHRWS
FT                   LPVTLLATPALLLFADIIGRLLVPGELRVSVVSAFIGAPVLIFLVRRKSNGGGL"
FT   gene            628975..630219
FT                   /locus_tag="SeAg_B0632"
FT   CDS_pept        628975..630219
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0632"
FT                   /product="enterobactin exporter EntS"
FT                   /note="identified by match to protein family HMM PF07690"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0632"
FT                   /db_xref="EnsemblGenomes-Tr:ACH51778"
FT                   /db_xref="GOA:B5EYI4"
FT                   /db_xref="InterPro:IPR010290"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR023722"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B5EYI4"
FT                   /protein_id="ACH51778.1"
FT                   /translation="MNRQSWLLNLSLLKTHPAFRAVFLARFISIVSLGLLGVAVPVQIQ
FT                   MMTHSTWQVGLSVTLTGGAMFIGLMVGGVLADRYERKKVILLARGTCGIGFIGLCVNSL
FT                   LPEPSLLAIYLLGLWDGFFASLGVTALLAATPALVGRENLMQAGAITMLTVRLGSVISP
FT                   MLGGILLASGGVAWNYGLAAAGTFITLLPLLTLPRLPVPPQPRENPFIALLAAFRFLLA
FT                   SPLIGGIALLGGLVTMASAVRVLYPALAMSWQMSAAQIGLLYAAIPLGAAIGALTSGQL
FT                   AHSVRPGLIMLVSTVGSFLAVGLFAIMPVWIAGVICLALFGWLSAISSLLQYTLLQTQT
FT                   PENMLGRMNGLWTAQNVTGDAIGAALLGGLGAMMTPVASASVSGFGLVIIGLLLLLVLG
FT                   ELRRFRQTPPVSDAG"
FT   gene            complement(630282..631238)
FT                   /locus_tag="SeAg_B0633"
FT   CDS_pept        complement(630282..631238)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0633"
FT                   /product="ABC superfamily"
FT                   /note="identified by match to protein family HMM PF01497"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0633"
FT                   /db_xref="EnsemblGenomes-Tr:ACH49997"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:B5EYI5"
FT                   /protein_id="ACH49997.1"
FT                   /translation="MRLPAFYRWLLLVVGLSISGISLAQDAGWPRQIQDSRGVHTLDHK
FT                   PARIVSTSVTLTGSLLAIDAPVVASGATTPNNRFADDQGFMRQWSDVAKARHVARLYIG
FT                   EPNAETVAAQMPDLILISATGGDSALALYDQLSAIAPTLVINYDDKSWQSLLTQLGEIT
FT                   GQEKQAAARIAEFEAQLTTVKQRIALPPQPVSALVYTPAAHSANLWTPESAQGKLLTQL
FT                   GFTLATLPRGLQTSKSQGKRHDIIQLGGENLAAGLNGESLFLFAGDNKDVAALYANPLL
FT                   AHLPAVQNKRVYALGTETFRLDYYSAILLLNRLAALF"
FT   gene            631547..632722
FT                   /locus_tag="SeAg_B0634"
FT   CDS_pept        631547..632722
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0634"
FT                   /product="isochorismate synthase EntC"
FT                   /EC_number="5.4.4.2"
FT                   /note="identified by match to protein family HMM PF00425;
FT                   match to protein family HMM TIGR00543"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0634"
FT                   /db_xref="EnsemblGenomes-Tr:ACH49651"
FT                   /db_xref="GOA:B5EYI6"
FT                   /db_xref="InterPro:IPR004561"
FT                   /db_xref="InterPro:IPR005801"
FT                   /db_xref="InterPro:IPR015890"
FT                   /db_xref="UniProtKB/TrEMBL:B5EYI6"
FT                   /protein_id="ACH49651.1"
FT                   /translation="MDMSLAEDAQETMATLAPDRFFFMSPYRSFTTSGCFARYTEPAVA
FT                   GDSPDSPFQQKLRQQFAEAKSQGIANPILVGAIPFDTRQPSSLFIPMAWQSFSRQQKQR
FT                   TARYFTDHQPLTVTARKAIPEQDAFEAMVARAAMLTATPDVDKVVLSRLIDITTDVAVD
FT                   SGALLERLVAQNPVSYNFHVPLADGGVLLGASPELLLRKEGERFSSLPLAGSARRQPDD
FT                   VLDREAGNRLLASQKDRHEHELVTQAMKQILRDRSTELQLPSSPQLITTPTLWHLGTPF
FT                   EGKANAGENALTLACLLHPTPALSGFPHQVAKKLIAELEPFDRELFGGIVGWCDAEGNG
FT                   EWVVTIRCAKLHGNQVRLFAGAGIVPASSPVGEWRETGVKLSTMLNVFGLH"
FT   gene            632732..634342
FT                   /locus_tag="SeAg_B0635"
FT   CDS_pept        632732..634342
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0635"
FT                   /product="2,3-dihydroxybenzoate-AMP ligase"
FT                   /EC_number="2.7.7.58"
FT                   /note="identified by match to protein family HMM PF00501;
FT                   match to protein family HMM TIGR02275"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0635"
FT                   /db_xref="EnsemblGenomes-Tr:ACH48976"
FT                   /db_xref="GOA:B5EYI7"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR011963"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:B5EYI7"
FT                   /protein_id="ACH48976.1"
FT                   /translation="MRIPFTRWPDEFARRYREKGYWQDVPLTDILTRHADSDKTAVIEG
FT                   ERAFSYRQLNQAADNLACYLRRQGIKPGETALVQLGNVPELYITFFALLKLGVAPVLAL
FT                   FSHQRTELNAYAMQIAPTLVIADRQHTLFAGEDFLNTFVAEHRSVRVVLLRNDDGDHSL
FT                   DAAMRQAAEDFTATPSPADEVAYFQLSGGTTGTPKLIPRTHNDYYYSVRRSNEICGFNE
FT                   ETRFLCAIPAAHNYAMSSPGALGVFLAKGTVVLATDPSATLCFPLIEKHQINATALVPP
FT                   AVSLWLQAIQEWGGNAPLASLRLLQVGGARLSATLAARIPAEIGCQLQQVFGMAEGLVN
FT                   YTRLDDSPERIINTQGRPMCPDDEVWVADADGNPLPPGEIGRLMTRGPYTFRGYFNSPQ
FT                   HNASAFDANGFYCSGDLISIDQDGYITVHGREKDQINRGGEKIAAEEIENLLLRHPAVI
FT                   HAALVSMEDELLGEKSCAYLVVKEPLRAVQVRRFLREQGVAEFKLPDRVECVASLPLTP
FT                   VGKVDKKQLRQRLASRSPL"
FT   gene            634356..635213
FT                   /gene="entB"
FT                   /locus_tag="SeAg_B0636"
FT   CDS_pept        634356..635213
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="entB"
FT                   /locus_tag="SeAg_B0636"
FT                   /product="isochorismatase"
FT                   /EC_number="3.3.2.1"
FT                   /note="identified by match to protein family HMM PF00550;
FT                   match to protein family HMM PF00857"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0636"
FT                   /db_xref="EnsemblGenomes-Tr:ACH51542"
FT                   /db_xref="GOA:B5EYI8"
FT                   /db_xref="InterPro:IPR000868"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR016291"
FT                   /db_xref="InterPro:IPR036380"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/TrEMBL:B5EYI8"
FT                   /protein_id="ACH51542.1"
FT                   /translation="MAIPKLQSYALPTALDIPTNKVNWAFEPERAALLIHDMQDYFVSF
FT                   WGRNCPMMDQVIANIAALRQYCKEHHIPVYYTAQPKEQSDEDRALLNDMWGPGLTRSPE
FT                   QQKVVEALTPDEADTVLVKWRYSAFHRSPLEQMLKDTGRNQLIITGVYAHIGCMTTATD
FT                   AFMRDIKPFMVADALADFSREEHLMALNYVAGRSGRVVMTESLLPTPVPASKAALRALI
FT                   LPLLDETDEPLDDENLIDYGLDSVLMMGLAARWRKVHGDIDFVMLAKNPTIDAWWALLS
FT                   RGVE"
FT   gene            635213..635968
FT                   /gene="entA"
FT                   /locus_tag="SeAg_B0637"
FT   CDS_pept        635213..635968
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="entA"
FT                   /locus_tag="SeAg_B0637"
FT                   /product="2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase"
FT                   /EC_number="1.3.1.28"
FT                   /note="identified by match to protein family HMM PF00106;
FT                   match to protein family HMM PF08659"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0637"
FT                   /db_xref="EnsemblGenomes-Tr:ACH49886"
FT                   /db_xref="GOA:B5EYI9"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR003560"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B5EYI9"
FT                   /protein_id="ACH49886.1"
FT                   /translation="MPCIDFSDKTVWVTGAGKGIGYATALAFVDAGARVIGFDREFTQE
FT                   NYPFATKVMDVADAAQVAQVCQRVLQKTPRLDVLVNAAGILRMGATDALSVDDWQQTFA
FT                   VNVGGAFNLFSQTMAQFRRQQGGAIVTVASDAAHTPRIGMSAYGASKAALKSLALTVGL
FT                   ELAGCGVRCNVVSPGSTDTDMQRTLWVSEDAEQQRIRGFGEQFKLGIPLGKIARPQEIA
FT                   NTILFLASDLASHITLQDIVVDGGSTLGA"
FT   gene            635971..636384
FT                   /locus_tag="SeAg_B0638"
FT   CDS_pept        635971..636384
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0638"
FT                   /product="putative esterase YbdB"
FT                   /note="identified by match to protein family HMM PF03061;
FT                   match to protein family HMM TIGR00369"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0638"
FT                   /db_xref="EnsemblGenomes-Tr:ACH48467"
FT                   /db_xref="GOA:B5EYJ0"
FT                   /db_xref="InterPro:IPR003736"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR026576"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:B5EYJ0"
FT                   /protein_id="ACH48467.1"
FT                   /translation="MIWKRHLTLDELNATSQNTLVAHLGIVYTRLGDDVLEAEMPVDAR
FT                   THQPFGLLHGGASAALAETLGSMAGYLMTRDGQCVVGTELNATHHRAISQGKVRGVCLP
FT                   LHLGRQNQSWEITLFDEQGRRCCTCRLGTAVMG"
FT   gene            636566..638671
FT                   /gene="cstA"
FT                   /locus_tag="SeAg_B0639"
FT   CDS_pept        636566..638671
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cstA"
FT                   /locus_tag="SeAg_B0639"
FT                   /product="carbon starvation protein A"
FT                   /note="identified by match to protein family HMM PF02554"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0639"
FT                   /db_xref="EnsemblGenomes-Tr:ACH49233"
FT                   /db_xref="GOA:B5EYJ1"
FT                   /db_xref="InterPro:IPR003706"
FT                   /db_xref="InterPro:IPR025299"
FT                   /db_xref="UniProtKB/TrEMBL:B5EYJ1"
FT                   /protein_id="ACH49233.1"
FT                   /translation="MNKSGKYLVWTALSVLGAFALGYIALNRGEQINALWIVVASVCVY
FT                   LIAYRFYGLYIAKKVLAVDPTRMTPAVRHNDGLDYVPTDKKVLFGHHFAAIAGAGPLVG
FT                   PVLAAQMGYLPGMIWLLAGVVLAGAVQDFMVLFVSTRRDGRSLGELVKEEMGATAGVIA
FT                   LVACFMIMVIILAVLAMIVVKALTHSPWGTYTVAFTIPLAIFMGIYLRYLRPGRIGEVS
FT                   VIGLVFLIFAIISGGWVAASPTWAPYFDFTGVQLTWMLVGYGFVAAVLPVWLLLAPRDY
FT                   LSTFLKIGTIVGLAVGILIMRPTLTMPALTKFVDGTGPVWTGDLFPFLFITIACGAVSG
FT                   FHALISSGTTPKMLANEGQACFIGYGGMLMESFVAIMALVSACIIDPGVYFAMNSPMAV
FT                   LAPAGTADVVASAAQVVSSWGFAITPDTLHQIANEVGEQSIISRAGGAPTLAVGMAYIL
FT                   HGALGGMMDVAFWYHFAILFEALFILTAVDAGTRAARFMLQDLLGVVSPGLKRTDSLPA
FT                   NLLATALCVLAWGYFLHQGVVDPLGGINTLWPLFGIANQMLAGMALMLCAVVLFKMKRQ
FT                   RYAWVALVPTAWLLICTLTAGWQKAFSPDAKIGFLAIANKFQAMIDSGNIPPQYTESQL
FT                   AQLVFNNRLDAGLTIFFMVVVVVLAVFSIKTALAALKIDKPTANETPYEPMPENVDEIV
FT                   TQAKGAH"
FT   gene            638735..638932
FT                   /locus_tag="SeAg_B0640"
FT   CDS_pept        638735..638932
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0640"
FT                   /product="conserved domain protein"
FT                   /note="identified by match to protein family HMM PF04328"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0640"
FT                   /db_xref="EnsemblGenomes-Tr:ACH52430"
FT                   /db_xref="InterPro:IPR007423"
FT                   /db_xref="UniProtKB/TrEMBL:B5EYJ2"
FT                   /protein_id="ACH52430.1"
FT                   /translation="MFDTLSKAGKYLGQAAKMMIGVPDYDNYVEHMRITHPDQTPMTYE
FT                   EFFRERQDARYGGKGGARCC"
FT   gene            complement(638968..640056)
FT                   /locus_tag="SeAg_B0641"
FT   CDS_pept        complement(638968..640056)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0641"
FT                   /product="alcohol dehydrogenase, iron-containing"
FT                   /EC_number="1.1.1.1"
FT                   /note="identified by match to protein family HMM PF00465;
FT                   match to protein family HMM PF01761"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0641"
FT                   /db_xref="EnsemblGenomes-Tr:ACH52557"
FT                   /db_xref="GOA:B5EYJ3"
FT                   /db_xref="InterPro:IPR001670"
FT                   /db_xref="InterPro:IPR016205"
FT                   /db_xref="InterPro:IPR018211"
FT                   /db_xref="UniProtKB/TrEMBL:B5EYJ3"
FT                   /protein_id="ACH52557.1"
FT                   /translation="MNHTEIRVVTGPANYFSHAGSLGRLTDFFTPEQLSHAVWVYGERA
FT                   IAAARPYLPEAFERAGAKHLQFTGHCSERHVAQLAHACNDDRQVVIGVGGGALLDTAKA
FT                   LARRLALPFVAIPTIAATCAAWTPLSVWYNDAGQALQFEIFDDANFLVLVEPRIILQAP
FT                   DDYLLAGIGDTLAKWYEAVVLAPQPETLPLTVRLGINSACAIRDLLLDSSEQALADKQQ
FT                   RRLTQAFCDVVDAIIAGGGMVGGLGERYTRVAAAHAVHNGLTVLPQTEKFLHGTKVAYG
FT                   ILVQSALLGQDDVLAQLITAYRRFHLPARLSELDVDIHNTAEIDRVIAHTLRPVESIHY
FT                   LPVTLTPDTLRAAFEKVEFFRI"
FT   gene            640174..641343
FT                   /locus_tag="SeAg_B0642"
FT   CDS_pept        640174..641343
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0642"
FT                   /product="aminotransferase YbdL"
FT                   /EC_number="2.6.1.-"
FT                   /note="identified by match to protein family HMM PF00155;
FT                   match to protein family HMM PF01053"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0642"
FT                   /db_xref="EnsemblGenomes-Tr:ACH51667"
FT                   /db_xref="GOA:B5EYJ4"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:B5EYJ4"
FT                   /protein_id="ACH51667.1"
FT                   /translation="MKIMRNNPLIPKSKLPNLGTTIFTQMSALAQKHQAINLSQGFPDF
FT                   DGPRYLHERLAYHVAQGANQYAPMTGAQALREAIADKTAEIYGYRPDDVSDITVTAGAT
FT                   EALYAAITALVRAGDEVICFDPSYDSYAPAVALSGGVLKRIALTPPHFRVDWQAFSALL
FT                   SERTRLVILNTPHNPTATVWRQEDIEALWQAIGEREIYVLSDEVYEHICFAVEGHASVL
FT                   AHPQLRERAVAVSSFGKTFHMTGWKIGYCVAPAAISAEIRKVHQYLTFCVNTPAQLALA
FT                   DMLRAAPEHYRALPDFYRKKRDVLVNALAQSRLKVLPCEGTYFLLIDYSAVSTLNDVEF
FT                   CQWLTEEVGVAAIPLSVFCAAPFPHQLIRLCFAKQESTLLAAAERLCKL"
FT   gene            complement(641344..641961)
FT                   /locus_tag="SeAg_B0643"
FT   CDS_pept        complement(641344..641961)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0643"
FT                   /product="IbrB protein"
FT                   /note="identified by match to protein family HMM PF02195"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0643"
FT                   /db_xref="EnsemblGenomes-Tr:ACH50186"
FT                   /db_xref="InterPro:IPR003115"
FT                   /db_xref="InterPro:IPR036086"
FT                   /db_xref="UniProtKB/TrEMBL:B5EYJ5"
FT                   /protein_id="ACH50186.1"
FT                   /translation="MQHRLTTEITHFLSELPEEERIAAINEFRMAIHSVSPFRDEPVDC
FT                   VLWVKNDHISPNDYNPNNVAPPEKKLLLKSIEQDGFTQPIVVVKADAEEYEIVDGFHRH
FT                   ELGKGKAALKRRLKGYLPITCLDRERHERMAATIRHNRARGRHQIHAMSEIVRELSLLG
FT                   WDESKIGQELGMDADEVLRLKQINGLQELFADRRFSRAWTVK"
FT   gene            complement(641934..643169)
FT                   /locus_tag="SeAg_B0644"
FT   CDS_pept        complement(641934..643169)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0644"
FT                   /product="IbrA protein"
FT                   /note="identified by match to protein family HMM PF01507"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0644"
FT                   /db_xref="EnsemblGenomes-Tr:ACH49884"
FT                   /db_xref="GOA:B5EYJ6"
FT                   /db_xref="InterPro:IPR002500"
FT                   /db_xref="InterPro:IPR021845"
FT                   /db_xref="UniProtKB/TrEMBL:B5EYJ6"
FT                   /protein_id="ACH49884.1"
FT                   /translation="MSVYKVPLEQNVLEAAQERIMWTLETLPRVCVSFSGGKDSGLMLH
FT                   LTATLARKMNKKIHVLFIDWEAQFSCTIAYIESLREYYADVIERFYWVALPLTTQNSLS
FT                   QYQPEWQCWQPGTDWVRQPPEDAITDPAFFSFYQQGMTFEQFVRDFADWFSEKRPAAML
FT                   VGIRSDESYNRFAAIANSHKLRFADDKPWTTLAPKGHTWYIYPIYDWKTADIWTWFAKT
FT                   GKPCNPLYNLMYQAGVPPRYMRICEPFGPEQRQGLWLYHVIEPERWAAMCARVSGALSG
FT                   GIYAGQDSHFYGHRKILKPDHLNWEEYALLLLHSMPEVTAEHYRNKIAVYLQWYKKKGM
FT                   NTIPQTQHGDIGSRDIPSWRRICKVLLNNDYWCRALSFSPTKPKNYQRYNERMKAKRQE
FT                   WGILCNTDSQPK"
FT   gene            complement(643335..644237)
FT                   /locus_tag="SeAg_B0645"
FT   CDS_pept        complement(643335..644237)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0645"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="identified by match to protein family HMM PF00126;
FT                   match to protein family HMM PF03466"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0645"
FT                   /db_xref="EnsemblGenomes-Tr:ACH50418"
FT                   /db_xref="GOA:B5EYJ7"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B5EYJ7"
FT                   /protein_id="ACH50418.1"
FT                   /translation="MANLYDLKKFDLNLLVIFECIYQHLSISKAAETLYITPSAVSQSL
FT                   QRLRTQFNDPLFIRSGKGITPTVTGINLHYHLENNLNSLEQTINIMNQSSLKKKFIIYS
FT                   PQLLITQYVMKLVKYIRKDPQVEIEHHDILTTDEQPEDLLAYRKADVVVSSAPLNNRSI
FT                   VCSHFNRMECILVCSENHPRLGDTATIDEILQESFTQLVARASGIKEYHSLIDDVLGER
FT                   IIGFRSKSLMTIANAISSTELIGFLPESLVDYYSSSIKLKKVTTPFTIAPIQLYLMYNR
FT                   ASLNNSGFAELIEHITKKH"
FT   gene            complement(644554..645300)
FT                   /locus_tag="SeAg_B0646"
FT   CDS_pept        complement(644554..645300)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeAg_B0646"
FT                   /product="thiol:disulfide interchange protein DsbG"
FT                   /db_xref="EnsemblGenomes-Gn:SeAg_B0646"
FT                   /db_xref="EnsemblGenomes-Tr:ACH49556"
FT                   /db_xref="GOA:B5EYJ8"
FT                   /db_xref="InterPro:IPR009094"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR033954"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B5EYJ8"
FT                   /protein_id="ACH49556.1"
FT                   /translation="MIKRTLLLAMLPILAHAEELPAPVKAIEKQGITILKSFEAPGGMK
FT                   GYLGKYQDMGVTIYLTPDGKHAISGYMYNEKGENLSNALIEKEIYAPAGREMWQKMEKA
FT                   SWILDGKKDAPVVLYVFADPFCPYCKQFWQQARPWVESGKVQLRTLLVGVIKPESPATA
FT                   AAILAAKDPAKTWYDYEASAGKMKLEVPASIPPAQMKVINQNQQLMDDLGANATPAIYY
FT                   MNKDKILQQVVGLPEKAQLDAMMGQP"
FT   gene            645741..646304
FT                   /gene="ahpC"
FT                   /locus_tag="SeAg_B0647"
FT   CDS_pept        645741..646304
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ahpC"
FT                   /locus_tag="SeAg_B0647"
FT                   /product="alkyl hydroperoxide reductase subunit C"
FT                   /EC_number=