(data stored in SCRATCH zone)

EMBL: CP001143

ID   CP001143; SV 1; circular; genomic DNA; STD; PRO; 74551 BP.
XX
AC   CP001143; ABAP01000000-ABAP01000142;
XX
PR   Project:PRJNA19467;
XX
DT   06-SEP-2008 (Rel. 97, Created)
DT   15-MAY-2014 (Rel. 120, Last updated, Version 5)
XX
DE   Salmonella enterica subsp. enterica serovar Dublin str. CT_02021853 plasmid
DE   pCT02021853_74, complete sequence.
XX
KW   .
XX
OS   Salmonella enterica subsp. enterica serovar Dublin str. CT_02021853
OC   Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales;
OC   Enterobacteriaceae; Salmonella.
OG   Plasmid pCT02021853_74
XX
RN   [1]
RP   1-74551
RX   DOI; 10.1128/JB.00297-11.
RX   PUBMED; 21602358.
RA   Fricke W.F., Mammel M.K., McDermott P.F., Tartera C., White D.G.,
RA   Leclerc J.E., Ravel J., Cebula T.A.;
RT   "Comparative genomics of 28 Salmonella enterica isolates: evidence for
RT   CRISPR-mediated adaptive sublineage evolution";
RL   J. Bacteriol. 193(14):3556-3568(2011).
XX
RN   [2]
RP   1-74551
RA   Ravel J., Fricke W.F., White D., McDermott P., Mammel M., Rosovitz M.,
RA   Leclerc J., Cebula T., Sebastian Y.;
RT   ;
RL   Submitted (27-AUG-2008) to the INSDC.
RL   J. Craig Venter Institute, 9704 Medical Center Drive, Rockville, MD 20850,
RL   USA
XX
DR   MD5; 79b13f10a4bd5b1a57b77baebae83502.
DR   BioSample; SAMN02604065.
DR   EnsemblGenomes-Gn; EBG00001087340.
DR   EnsemblGenomes-Gn; SeD_B0068.
DR   EnsemblGenomes-Tr; EBT00001689556.
DR   EnsemblGenomes-Tr; SeD_B0068-1.
DR   EuropePMC; PMC3133335; 21602358.
DR   EuropePMC; PMC3880295; 24404174.
DR   RFAM; RF00042; CopA.
XX
CC   The sequenced strain has been deposited at the Salmonella Genetic
CC   Stock Center at the University of Calgary under the care of Dr.
CC   K.E. Sanderson.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..74551
FT                   /organism="Salmonella enterica subsp. enterica serovar
FT                   Dublin str. CT_02021853"
FT                   /plasmid="pCT02021853_74"
FT                   /sub_species="enterica"
FT                   /strain="CT_02021853"
FT                   /mol_type="genomic DNA"
FT                   /serovar="Dublin"
FT                   /db_xref="taxon:439851"
FT   gene            115..240
FT                   /locus_tag="SeD_B0001"
FT   CDS_pept        115..240
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeD_B0001"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SeD_B0001"
FT                   /db_xref="EnsemblGenomes-Tr:ACH73519"
FT                   /protein_id="ACH73519.1"
FT                   /translation="MSTFFACDTMTGSFFRAWTDEKEKHYADSPRRDIPAVSDTT"
FT   gene            243..1115
FT                   /pseudo
FT                   /locus_tag="SeD_B0002"
FT                   /note="conserved hypothetical protein; this gene contains a
FT                   frame shift which may be the result of sequencing error;
FT                   identified by match to protein family HMM PF04754; match to
FT                   protein family HMM TIGR01784"
FT   gene            complement(1147..1713)
FT                   /pseudo
FT                   /locus_tag="SeD_B0003"
FT                   /note="conserved hypothetical protein; this gene contains a
FT                   frame shift which may be the result of sequencing error"
FT   gene            complement(1770..2171)
FT                   /locus_tag="SeD_B0004"
FT   CDS_pept        complement(1770..2171)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeD_B0004"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SeD_B0004"
FT                   /db_xref="EnsemblGenomes-Tr:ACH73540"
FT                   /protein_id="ACH73540.1"
FT                   /translation="MSQHNAALWLVRQLQGLIQESEMENMLKTMREHFPVRTVVIEQSL
FT                   DMFGVKRNEDGTLLFPRHSDKRFPVARIRKRLAAYGWRGERLNKEVARIVAGPDILPER
FT                   RDYSIIFPYGWEKKQLTREMRRMFLRKTG"
FT   gene            complement(2158..2277)
FT                   /locus_tag="SeD_B0005"
FT   CDS_pept        complement(2158..2277)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeD_B0005"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SeD_B0005"
FT                   /db_xref="EnsemblGenomes-Tr:ACH73513"
FT                   /protein_id="ACH73513.1"
FT                   /translation="MAHSAVTDAVMTAQVVNNIAGYWHELQCEMNDDAGSEPA"
FT   gene            complement(2289..2798)
FT                   /pseudo
FT                   /locus_tag="SeD_B0006"
FT                   /note="YacC; this gene contains a frame shift which may be
FT                   the result of sequencing error"
FT   gene            complement(2791..3906)
FT                   /locus_tag="SeD_B0007"
FT   CDS_pept        complement(2791..3906)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeD_B0007"
FT                   /product="TlpA"
FT                   /db_xref="EnsemblGenomes-Gn:SeD_B0007"
FT                   /db_xref="EnsemblGenomes-Tr:ACH73508"
FT                   /protein_id="ACH73508.1"
FT                   /translation="MRPATYEPEQIIEAGLALQAEGRNITGFALRNQVGGGNPTRLRQI
FT                   WDEYQASQSTVVTEPVAELPVEVAEEVKAVSAALSERITQLATELNDKAVRAAERRVAE
FT                   VTRAAGEQTAQAERELADAAQTVDDLEEKLDELQDRYDSLTLALESERSLRQQHDVEMA
FT                   QLKERLAAAEENTRQREERYQEQKTVLQDALNAEQAQHKNTREDLQKRLEQISAEANAR
FT                   TEELKSERDKVNTLLTRLESQENALASERQQHLATRETLQQRLEQAIADTQARAGEIAL
FT                   ERDRVSSLTARLESQEKASSEQLVRMGSEIASLTERCTQLENQRDDARLETMGEKETVA
FT                   ALRGEAEALKRQNQSLMAALSGNKQTGGQNA"
FT   gene            4165..4653
FT                   /pseudo
FT                   /locus_tag="SeD_B0008"
FT                   /note="YadA; this gene contains a frame shift which may be
FT                   the result of sequencing error"
FT   gene            complement(4763..4897)
FT                   /locus_tag="SeD_B0009"
FT   CDS_pept        complement(4763..4897)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeD_B0009"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SeD_B0009"
FT                   /db_xref="EnsemblGenomes-Tr:ACH73582"
FT                   /protein_id="ACH73582.1"
FT                   /translation="MSRHSYDTEKSGVALSLVWLERGHPRASAVADVLSAAGFPDFGK"
FT   gene            5308..6048
FT                   /locus_tag="SeD_B0010"
FT   CDS_pept        5308..6048
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeD_B0010"
FT                   /product="Mig5"
FT                   /note="identified by match to protein family HMM PF00484;
FT                   match to protein family HMM TIGR01409"
FT                   /db_xref="EnsemblGenomes-Gn:SeD_B0010"
FT                   /db_xref="EnsemblGenomes-Tr:ACH73565"
FT                   /protein_id="ACH73565.1"
FT                   /translation="MEQNQPAQPSRRAILKQTLAVSALSVTGLAALSVPTISFAASLSK
FT                   EERDGMTPDAVIEHFKQGNLRFRENRPAKHDYLAQKRNSIAGQYPAAVILSCIDSRAPA
FT                   EIVLDAGIGETFNSRVAGNISNRDMLGSMEFACAVAGAKVVLVIGHTRCGAVRCAIDNA
FT                   ELGNLTGLLDEIKPAIAKTEYSGERKGSNYDFVDAVARKNVELTIENIRKNSPVLKQLE
FT                   DEKKIKIVGSMYHLTGGKVEFFEV"
FT   gene            6255..6815
FT                   /locus_tag="SeD_B0011"
FT   CDS_pept        6255..6815
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeD_B0011"
FT                   /product="RlgA"
FT                   /note="identified by match to protein family HMM PF00239;
FT                   match to protein family HMM PF02796"
FT                   /db_xref="EnsemblGenomes-Gn:SeD_B0011"
FT                   /db_xref="EnsemblGenomes-Tr:ACH73522"
FT                   /protein_id="ACH73522.1"
FT                   /translation="MALYGYARVSTSDQDLTLQTQILRAAGCEIIRAEKASGSGRTGRS
FT                   ELQLLLEFLRPGDTLMVTRVDRLARSIKDLQDIVYALNQQGVTLRATEQPVDTRSAAGK
FT                   AFLDMLGVFAEFETNLRRERQMEGIAAAKARGVYRGRKPSIDPAEVYRLYTIEKMGATA
FT                   IARQLGIGRASVYRALENYEQPA"
FT   gene            6799..8463
FT                   /locus_tag="SeD_B0013"
FT   CDS_pept        6799..8463
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeD_B0013"
FT                   /product="integrase, catalytic region"
FT                   /note="identified by match to protein family HMM PF00665"
FT                   /db_xref="EnsemblGenomes-Gn:SeD_B0013"
FT                   /db_xref="EnsemblGenomes-Tr:ACH73575"
FT                   /protein_id="ACH73575.1"
FT                   /translation="MSSRRSAIPSDSLLQLRQRLDRLPPKSPERANQIAATAQLYGISV
FT                   TTVYRALHLVLKPRTAHRSDHGQPRILPPSELEHYCELIAALKLRTTNKSGRHLSTGRA
FT                   IQLLEEHGVETVQGLIKSPKGLLRKQTVNRWLSRWRLDQPRLLREPPAVRFQAENSNDC
FT                   WQFDMSPSDLKHIERPDWVDPARGEPTLMLFSVVDDRSGVAYQEYRCVYGEDAESALRF
FT                   LFNAMAPKTRSDFPFQGRPKLLYLDNGPVAKNHVFQNVMQSLKVDWLTHTPAGKDGTRT
FT                   TARSKGKVERPFRTVKEAHETLYHFHKPETELQANEWLWNYLSRYNAQRHRSEKHSRLE
FT                   DWLANIGQEGVRDMCSWEQYCRFAREPESRKVGVDARITIDGTAWEVEPDMAGETVILL
FT                   WGLFDEEMYVEFTGETWGPYYPVSGPVPLHRYRTFRRGKAAERADRIHALARQLNIPIS
FT                   ALSGSDLRVVSDDTQQRIDALPHQPFDTRKFEYHFPTVIAAKLAIADDLAIPLARMSDE
FT                   DRAFIDSILTETLNRSEVLARIRDYFRSRQSGEDHAG"
FT   gene            8453..9421
FT                   /locus_tag="SeD_B0014"
FT   CDS_pept        8453..9421
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeD_B0014"
FT                   /product="type II secretion system protein"
FT                   /db_xref="EnsemblGenomes-Gn:SeD_B0014"
FT                   /db_xref="EnsemblGenomes-Tr:ACH73554"
FT                   /protein_id="ACH73554.1"
FT                   /translation="MRVEVMEHYGLTQSIEQAGYYETAHHKQLMKDIKGAIREGRLIAV
FT                   CGVVGSGKTVTLRRLQQQLLDENKIIVARSLSVDKQSVRLATLINALFYDLAQDKQVQI
FT                   HKQGERRERELQELVKKGKRPVALFVDEAHDLNGNTLTGLKRLMEVVEDGGGRLSVVLA
FT                   GHPKLRNDLRRPTMEEIGYRTDIFTLDGITGSQREYIQWLLKTSTGKGKPEDILTTEAV
FT                   DLLAMKLRTPLQVQLHLTLAMEAGYQTGEKPITATLVESVLSRQLDDLEPTLTRHGYRL
FT                   KDMVEQFDAKPAEIRALFNNQLDPARTAELRDRMLAVGLPI"
FT   gene            complement(9610..10647)
FT                   /locus_tag="SeD_B0015"
FT   CDS_pept        complement(9610..10647)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeD_B0015"
FT                   /product="ransposase of"
FT                   /db_xref="EnsemblGenomes-Gn:SeD_B0015"
FT                   /db_xref="EnsemblGenomes-Tr:ACH73579"
FT                   /protein_id="ACH73579.1"
FT                   /translation="MPIIAAIPDEERQLMRKEAQQTHDKNHARRLIAMLMLHQGMTVTD
FT                   VARLLCAARSSVGRWINWFTLHGVEGLKSLRPGRAPRWPVADILQLLPLLVQRSPKDFG
FT                   WLRSRWSTELLALVINRLFDVTLHRSTLHRYLRQADMVWRGAAPTLKIKDPHYEEKRLV
FT                   IDQALAQEQTAHPVFYQDEVDIDLNPKIGADWMPKGQQKRIATPGQNQKHYLAGALHSG
FT                   TGRVHYVSGSSKSSDLFISLLETLRRTYRRAKTITLVADNYIIHKSRKVERWLEENPKF
FT                   RLLFLPMYSPWLNPIERLWLSLHETITRNHQCRYMWQLLKQVAQFMNAASLFPGNQQGL
FT                   AKVER"
FT   gene            complement(10855..10992)
FT                   /locus_tag="SeD_B0016"
FT   CDS_pept        complement(10855..10992)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeD_B0016"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SeD_B0016"
FT                   /db_xref="EnsemblGenomes-Tr:ACH73545"
FT                   /protein_id="ACH73545.1"
FT                   /translation="MLMAMNVELTAEQKIALEALQRKSRDPINEQNRCTTGPELNGRRY
FT                   "
FT   gene            11173..12147
FT                   /locus_tag="SeD_B0017"
FT   CDS_pept        11173..12147
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeD_B0017"
FT                   /product="virulence genes transcriptional activator"
FT                   /note="identified by match to protein family HMM PF00126"
FT                   /db_xref="EnsemblGenomes-Gn:SeD_B0017"
FT                   /db_xref="EnsemblGenomes-Tr:ACH73520"
FT                   /protein_id="ACH73520.1"
FT                   /translation="MQKKVTAILFLHIKTFFQDYSEKKGDIMDFLINKKLKIFITLMET
FT                   GSFSIATSVLYITRTPLSRVISGLERELKQRLFIRKNGTLIPTEFAQTIYRKVKSHYIF
FT                   LHALEQEIGPTGKTKQLEIIFDEIYPESLKNLIISALTISGQKTNIMGRAVNSQIIEEL
FT                   CQTNNCIVISARNYFHRESLVCRTSVEGGVMLFIPKKFFLCGKPDINRLAGTPVLFHEG
FT                   AKNFNLDTIYHFFEQTLGITNPAFSFDNVDLFSSLYRLQQGLAMLLIPVRVCRALGLST
FT                   DHALHIKGVALCTSLYYPTKKRETPDYRKAIKLIQQELKQSTF"
FT   gene            complement(12104..12250)
FT                   /locus_tag="SeD_B0018"
FT   CDS_pept        complement(12104..12250)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeD_B0018"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SeD_B0018"
FT                   /db_xref="EnsemblGenomes-Tr:ACH73538"
FT                   /protein_id="ACH73538.1"
FT                   /translation="MLRGELPLWRMGIADNLNLANAVNTGVAALTLHKVRRWTVSVPAV
FT                   SVL"
FT   gene            12321..12485
FT                   /pseudo
FT                   /locus_tag="SeD_B0019"
FT                   /note="lysozyme (Lysis protein) (Muramidase)
FT                   (Endolysin)(Morphogenesis protein 2); this gene contains a
FT                   frame shift which may be the result of sequencing error"
FT   gene            12659..13426
FT                   /locus_tag="SeD_B0020"
FT   CDS_pept        12659..13426
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeD_B0020"
FT                   /product="28.1 kDa virulence protein"
FT                   /note="identified by match to protein family HMM PF03538"
FT                   /db_xref="EnsemblGenomes-Gn:SeD_B0020"
FT                   /db_xref="EnsemblGenomes-Tr:ACH73567"
FT                   /protein_id="ACH73567.1"
FT                   /translation="MNMNQTTSPALSQVETAIRAPAGNFAKYNYYSVFDIVRQTRKQFI
FT                   NANMSWPGSRGGKAWDLAMGQAQYIRCMFRENQLTRRVRGTLQQTPDNGTNLSSSAVGG
FT                   IQGQAERRPDLATLMVVNDAINQQIPTLLPYHFPHDQVELSLLNTDVSLEDIISESSID
FT                   WPWFLSNSLTGDNSNYAMELASRLSPEQQTLPTEPDNSTATDLTSFYQTNLGLKTADYT
FT                   PFEALNTFARQLAITVPPGGTVDCGYSACQPAV"
FT   gene            13380..13556
FT                   /locus_tag="SeD_B0021"
FT   CDS_pept        13380..13556
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeD_B0021"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SeD_B0021"
FT                   /db_xref="EnsemblGenomes-Tr:ACH73578"
FT                   /protein_id="ACH73578.1"
FT                   /translation="MEQLIAGTLRASRQFSFPRYQSSEQQTILQNLSDVIVQVHSTALY
FT                   GGSTFEQAVEQTL"
FT   gene            13608..15389
FT                   /pseudo
FT                   /locus_tag="SeD_B0022"
FT                   /note="65 kDa virulence protein; this gene contains a frame
FT                   shift which may be the result of sequencing error;
FT                   identified by match to protein family HMM PF03534"
FT   gene            complement(15511..15657)
FT                   /locus_tag="SeD_B0023"
FT   CDS_pept        complement(15511..15657)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeD_B0023"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SeD_B0023"
FT                   /db_xref="EnsemblGenomes-Tr:ACH73503"
FT                   /protein_id="ACH73503.1"
FT                   /translation="MRYGYIAILLDINSQFFLIKRLVIQKTSFFIRRKNDISVRSEQKV
FT                   KEG"
FT   gene            15808..16395
FT                   /locus_tag="SeD_B0024"
FT   CDS_pept        15808..16395
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeD_B0024"
FT                   /product="phosphothreonine lyase OspF"
FT                   /EC_number="4.2.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:SeD_B0024"
FT                   /db_xref="EnsemblGenomes-Tr:ACH73555"
FT                   /protein_id="ACH73555.1"
FT                   /translation="MPVSHFKEALDVPDYSGMRQSGFFAMSQGFQLNNHGYDVFIHARR
FT                   ESPQSQGKFAGDKFHISVLRDMVPQAFQALSGLLFSEDSPVDKWKVTDMEKVVQQARVS
FT                   LGAQFTLYIKPDQENSQYSASFLHKTRQFIECLESRLSENGVISGQCPESDVHPENWKY
FT                   LSYRNELRSGRDGGEMQRQALREEPFYRLMTE"
FT   gene            16449..16568
FT                   /locus_tag="SeD_B0025"
FT   CDS_pept        16449..16568
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeD_B0025"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SeD_B0025"
FT                   /db_xref="EnsemblGenomes-Tr:ACH73517"
FT                   /protein_id="ACH73517.1"
FT                   /translation="MLINLLINKLQIFIEGSPLTDEFRHRKGITLMHIDMSAL"
FT   gene            16656..17306
FT                   /locus_tag="SeD_B0026"
FT   CDS_pept        16656..17306
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeD_B0026"
FT                   /product="virulence protein VsdE"
FT                   /note="identified by match to protein family HMM PF05563"
FT                   /db_xref="EnsemblGenomes-Gn:SeD_B0026"
FT                   /db_xref="EnsemblGenomes-Tr:ACH73505"
FT                   /protein_id="ACH73505.1"
FT                   /translation="MRVSGSASSQDIISRINSKNINNNDSNEVKRIKDALCIESKERIL
FT                   YPQNLSRDNLKQMARYVNNTYVHYSGNCVLLSACLHYNIHHRQDILSSKNTASPTVGLD
FT                   SAIVDKIIFGHELNQSYCLNSIDEVEKEILNRYDIKRESSFIISAENYIAPIIGECRHD
FT                   FNAVVICEYDKKPYVQFIDSWKTSNILPSLQEIKKHFSSSGEFYVRAYDEKHD"
FT   gene            complement(17433..17858)
FT                   /locus_tag="SeD_B0027"
FT   CDS_pept        complement(17433..17858)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeD_B0027"
FT                   /product="transposase"
FT                   /note="identified by match to protein family HMM PF01797"
FT                   /db_xref="EnsemblGenomes-Gn:SeD_B0027"
FT                   /db_xref="EnsemblGenomes-Tr:ACH73588"
FT                   /protein_id="ACH73588.1"
FT                   /translation="MSNHHESLEGFLRKRHSVSKLVVHLIFTTKYRCKLFDGQIIAQLR
FT                   DAFGSAAAKLECEIIEMDGEQDHVHLLIAYPLKLGVSVMVNNLKSVSSRLLRQQNTHLR
FT                   MQSKTGLLWSRSYFACSAGGATIETLKAYVLRQNTPE"
FT   gene            17915..18283
FT                   /pseudo
FT                   /locus_tag="SeD_B0028"
FT                   /note="transposase, IS605 family; this gene contains a
FT                   frame shift which may be the result of sequencing error"
FT   gene            complement(18350..18766)
FT                   /pseudo
FT                   /locus_tag="SeD_B0029"
FT                   /note="invasin; this gene contains a frame shift which may
FT                   be the result of sequencing error"
FT   gene            complement(18790..19458)
FT                   /pseudo
FT                   /locus_tag="SeD_B0030"
FT                   /note="conserved hypothetical protein; this gene contains a
FT                   frame shift which may be the result of sequencing error"
FT   gene            complement(19452..19940)
FT                   /locus_tag="SeD_B0031"
FT   CDS_pept        complement(19452..19940)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeD_B0031"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SeD_B0031"
FT                   /db_xref="EnsemblGenomes-Tr:ACH73502"
FT                   /protein_id="ACH73502.1"
FT                   /translation="MNQPLLFRTVAGRQSNHEGFYMPPGIRHLGTLSLYRAVAWWGLFL
FT                   GREFTRDDVSEAFSIEPRRASGILNYICNRHNDDDICFDSRLHPVRGGRAQLVVRIRAV
FT                   ESRPDTIRRQRTDRPGGKVSDRQYDRQMAHWLLSRPAGGDTAKLAAWQAACPVREASC"
FT   gene            complement(19965..20678)
FT                   /locus_tag="SeD_B0032"
FT   CDS_pept        complement(19965..20678)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeD_B0032"
FT                   /product="putative cyclic diguanylate phosphodiesterase
FT                   (EAL) domain protein"
FT                   /note="identified by match to protein family HMM PF00563"
FT                   /db_xref="EnsemblGenomes-Gn:SeD_B0032"
FT                   /db_xref="EnsemblGenomes-Tr:ACH73531"
FT                   /protein_id="ACH73531.1"
FT                   /translation="MHFSAFRLQQAIRNREFTPFYQPIVCATGGEVVGCEMLARWLHPQ
FT                   KGLLSAGNFIPAIEATGLGGALLRGLADEVCGDGQDLARSAGRRLMMTLNLSLSLVMTP
FT                   LFRPHLLALSIRLEQAGMTPVFEITEREDIRAFPQAAVFRQLAAGGLRFAVDDFGTGHA
FT                   GPASTVADRMIARTVSLARCQGARVIAEGIETPAQAARLRDAGGDYLQGWHCGAPMPFG
FT                   LFHFRLTQKSQPAFG"
FT   gene            complement(20687..21469)
FT                   /locus_tag="SeD_B0033"
FT   CDS_pept        complement(20687..21469)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeD_B0033"
FT                   /product="Rsd"
FT                   /note="identified by match to protein family HMM PF00589"
FT                   /db_xref="EnsemblGenomes-Gn:SeD_B0033"
FT                   /db_xref="EnsemblGenomes-Tr:ACH73536"
FT                   /protein_id="ACH73536.1"
FT                   /translation="MSQPPLPAVCTQAASALLPVAIDYPAALALRQMAMQHDDYPKYLL
FT                   APEVSALLHYVPDLHRRMLLATLWNTGARINEALALTRGDFSLAPPYPFVQLATLKQRA
FT                   EKAARTAGRMPSGSQPHRLVPLSDNQYVSELQMMVATLKIPLERRNRRTGRTEKARLWE
FT                   ITDRTVRTWIGEAVEAAAADDVTFSVPVTPHTFRHSYAMHMLYAGIPLKVLQALMGHKS
FT                   VSSTEVYTKVFALDVAARHRVQFQMPGADAVAMLKGGS"
FT   gene            complement(21504..22025)
FT                   /locus_tag="SeD_B0034"
FT   CDS_pept        complement(21504..22025)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeD_B0034"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SeD_B0034"
FT                   /db_xref="EnsemblGenomes-Tr:ACH73553"
FT                   /protein_id="ACH73553.1"
FT                   /translation="MTRSRICPDTESTGLSPASDALPVRETTEQFAQVFFGKSVSLLTP
FT                   EERFTTVYAGSRDIPADLHPASWFPADTWFRNELRACAAYVGRRQGWPLYHASEAERLR
FT                   ALYPLRLATPATDPGKQLLTRTALLKAGYSRATIAAMTPVAERQNRHSGDWYPLYRVQT
FT                   ETRDDSGEKT"
FT   gene            complement(22022..22312)
FT                   /locus_tag="SeD_B0035"
FT   CDS_pept        complement(22022..22312)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeD_B0035"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SeD_B0035"
FT                   /db_xref="EnsemblGenomes-Tr:ACH73549"
FT                   /protein_id="ACH73549.1"
FT                   /translation="MRVSEQVLLSSLRQGGCVRSFWRRSARLAGTPSPIVPDGLVLETP
FT                   GERGDTPLCHVDFAVVQKWLVCEETWTQTLGGTEFGGTVWRLRTDRENTTS"
FT   gene            complement(22314..22619)
FT                   /locus_tag="SeD_B0036"
FT   CDS_pept        complement(22314..22619)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeD_B0036"
FT                   /product="cytotoxic protein CcdB"
FT                   /note="identified by match to protein family HMM PF01845"
FT                   /db_xref="EnsemblGenomes-Gn:SeD_B0036"
FT                   /db_xref="EnsemblGenomes-Tr:ACH73561"
FT                   /protein_id="ACH73561.1"
FT                   /translation="MQFKVYTCKRESRYRLFVDVQSDIIDTPGRRMAVPLVSARLLSEK
FT                   VPRDLYPVMHIGDEPYRLLTTDMTSVPATVIGEEVADLSLRENDIKNAINLMFRGI"
FT   gene            complement(22621..22839)
FT                   /locus_tag="SeD_B0037"
FT   CDS_pept        complement(22621..22839)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeD_B0037"
FT                   /product="conserved domain protein"
FT                   /note="identified by match to protein family HMM PF07362"
FT                   /db_xref="EnsemblGenomes-Gn:SeD_B0037"
FT                   /db_xref="EnsemblGenomes-Tr:ACH73558"
FT                   /protein_id="ACH73558.1"
FT                   /translation="MKQRITVTVDSDSYQLLKAYDVNISGLVSTTMQNEARRLRAERWQ
FT                   EENREGMAEVASFIEANGSFADDNRNW"
FT   gene            22916..23056
FT                   /locus_tag="SeD_B0038"
FT   CDS_pept        22916..23056
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeD_B0038"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SeD_B0038"
FT                   /db_xref="EnsemblGenomes-Tr:ACH73583"
FT                   /protein_id="ACH73583.1"
FT                   /translation="MNTVNQLIVTELTVRRHYLHISYMYFLVHFTDACFQSLKRILLSR
FT                   Y"
FT   gene            complement(23061..23177)
FT                   /locus_tag="SeD_B0040"
FT   CDS_pept        complement(23061..23177)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeD_B0040"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SeD_B0040"
FT                   /db_xref="EnsemblGenomes-Tr:ACH73541"
FT                   /protein_id="ACH73541.1"
FT                   /translation="MNRQKIGSPENSRPVIPLRFYKLDCNCMWLKFHYEKDE"
FT   gene            23166..23294
FT                   /locus_tag="SeD_B0039"
FT   CDS_pept        23166..23294
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeD_B0039"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SeD_B0039"
FT                   /db_xref="EnsemblGenomes-Tr:ACH73509"
FT                   /protein_id="ACH73509.1"
FT                   /translation="MSIHDFPEVYHGQGISKAVFSALHAGSQGRGITQHLVATADD"
FT   gene            23287..23400
FT                   /locus_tag="SeD_B0041"
FT   CDS_pept        23287..23400
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeD_B0041"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SeD_B0041"
FT                   /db_xref="EnsemblGenomes-Tr:ACH73574"
FT                   /protein_id="ACH73574.1"
FT                   /translation="MTEPLHLVLPGRGAPVRIKKIRDHQKSDLRGEREKIT"
FT   gene            complement(23553..24374)
FT                   /locus_tag="SeD_B0042"
FT   CDS_pept        complement(23553..24374)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeD_B0042"
FT                   /product="VagD"
FT                   /db_xref="EnsemblGenomes-Gn:SeD_B0042"
FT                   /db_xref="EnsemblGenomes-Tr:ACH73495"
FT                   /protein_id="ACH73495.1"
FT                   /translation="MPPQLLCLGGAESSACQQSVQRVADVSLIPGGRERKRLRTFCFTA
FT                   LTYPVFQYQARYPLKFPRIIRHQHGTGGDGMPGNRRVVRTDRRPGEAQCHLNLRGGVYR
FT                   SAIPGQDGIEAGAERVDQLDETRRGLRSGGAEAHLGVGDGRDHDTVAAQHRLLKALQHR
FT                   FRLLAHDERTDTGIEHIGLRTWLFHSSKRPSSLTTSSRSAIKSGSAFSSCANEPQVGRT
FT                   GRRMMLSPSRTISSSLTPSKSRSRGRRMARLLPFLKMDTVLMILSRVSVDM"
FT   gene            24447..24734
FT                   /locus_tag="SeD_B0043"
FT   CDS_pept        24447..24734
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeD_B0043"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SeD_B0043"
FT                   /db_xref="EnsemblGenomes-Tr:ACH73525"
FT                   /protein_id="ACH73525.1"
FT                   /translation="MKKGILKMARIQCNRDRGNNSFDGVICLARGKSLTVYYMLLFVLK
FT                   NLYTANVIQNESTFSSRNLLIWYSSSVTLPAYSLSRPYRVLPGGAPSQPN"
FT   gene            complement(24809..25657)
FT                   /locus_tag="SeD_B0044"
FT   CDS_pept        complement(24809..25657)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeD_B0044"
FT                   /product="SrgB"
FT                   /note="identified by match to protein family HMM PF06977"
FT                   /db_xref="EnsemblGenomes-Gn:SeD_B0044"
FT                   /db_xref="EnsemblGenomes-Tr:ACH73521"
FT                   /protein_id="ACH73521.1"
FT                   /translation="MTLRRLLKQKPALLAGALLMVAGAATLYFPETWYPEETQWQLATE
FT                   KDIPGIQGGLSGLTWNPDSGTLFAVTDHPSSVVELDTDGNVLRVIPSDGDHDFEAIEYL
FT                   GRNRYVLSRERERILTTHHIDRNTSVLPPASYTLTLDVDRKSDNAGFEGLARGRGENAL
FT                   IVAQEKKPLRFLETDHSHDSLSVSDSLTHRLSLPWFLKDISGLHYDRKNRRLYVLSHES
FT                   ALVLVSDPEGGWWVMPLRRGHSGLERDIPQAEGIASDGRNSLWIVSEPDRFYRFSRTTT
FT                   S"
FT   gene            complement(25683..25829)
FT                   /locus_tag="SeD_B0045"
FT   CDS_pept        complement(25683..25829)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeD_B0045"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SeD_B0045"
FT                   /db_xref="EnsemblGenomes-Tr:ACH73504"
FT                   /protein_id="ACH73504.1"
FT                   /translation="MPDDERRAGYGGGRFSLRALILLLLTSAFISGFLTGALAMLWFVI
FT                   DCM"
FT   gene            complement(25819..25938)
FT                   /locus_tag="SeD_B0046"
FT   CDS_pept        complement(25819..25938)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeD_B0046"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SeD_B0046"
FT                   /db_xref="EnsemblGenomes-Tr:ACH73518"
FT                   /protein_id="ACH73518.1"
FT                   /translation="MNIIRGCMTGLTGIKLFLSGHLHTGNSPENFFAEGQHAG"
FT   gene            complement(26105..26317)
FT                   /locus_tag="SeD_B0047"
FT   CDS_pept        complement(26105..26317)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeD_B0047"
FT                   /product="conserved domain protein"
FT                   /note="identified by match to protein family HMM PF04703"
FT                   /db_xref="EnsemblGenomes-Gn:SeD_B0047"
FT                   /db_xref="EnsemblGenomes-Tr:ACH73534"
FT                   /protein_id="ACH73534.1"
FT                   /translation="MSNDACDKILSFMQSQANGRINIPVRTRSIADAAGLTIYQARAYL
FT                   VTLEGAGVVEKMNAGKGVSGRWRLV"
FT   gene            complement(26390..26974)
FT                   /locus_tag="SeD_B0048"
FT   CDS_pept        complement(26390..26974)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeD_B0048"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SeD_B0048"
FT                   /db_xref="EnsemblGenomes-Tr:ACH73537"
FT                   /protein_id="ACH73537.1"
FT                   /translation="MENAMSRRKRILLTGNCEYELLGLSHLLAGMGYAVVRPEMSPPGA
FT                   YDLALVALSAEPLAGWGRHLKGIRMLHAASPVPMVVLVPSRLQEMRLLRGTAQVISGRD
FT                   SLLRLRDMLRQALEGRAGPESSGELTELRKRTLISLCTAINRNASLKAASRKDYYLRAC
FT                   LVEYAGVENLHVLCTSGLLPGVITDETGQRF"
FT   gene            complement(27099..27812)
FT                   /locus_tag="SeD_B0049"
FT   CDS_pept        complement(27099..27812)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeD_B0049"
FT                   /product="K88 minor fimbrial subunit FaeJ"
FT                   /db_xref="EnsemblGenomes-Gn:SeD_B0049"
FT                   /db_xref="EnsemblGenomes-Tr:ACH73543"
FT                   /protein_id="ACH73543.1"
FT                   /translation="MKNYYLLLMLASASVSSQPLTVVQAHWQEGMAVGVTELSGTLYIR
FT                   DTAWQWQPVPLEMSRQEGMVSESRPGRRYYILKGYTTTLTSARPGLQPSVSLLHAGHGV
FT                   VRLEARGKLAKGQVRYGEITFTASHVLAWQDSTTAEKGWSVVSGNVTPDAAQDIKRLLW
FT                   QVRDYRWNPSYSGLKTRPDAFTVMPGSFLPDNGTKNQIAGAWLTSLEGIRVRFPGAEEP
FT                   VSRWQGSLTPVVNYF"
FT   gene            complement(27812..28087)
FT                   /locus_tag="SeD_B0050"
FT   CDS_pept        complement(27812..28087)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeD_B0050"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SeD_B0050"
FT                   /db_xref="EnsemblGenomes-Tr:ACH73497"
FT                   /protein_id="ACH73497.1"
FT                   /translation="MNIGKAAGPRSPVPGPAVFVGLERADGVFFFVSVRDIRQVQEHNG
FT                   RVRLVFGEGTTFMTRMSLSEFSAALYEAGGRSFFDSSAGKVTGGEV"
FT   gene            complement(28074..28838)
FT                   /locus_tag="SeD_B0051"
FT   CDS_pept        complement(28074..28838)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeD_B0051"
FT                   /product="minor fimbrial subunit"
FT                   /note="identified by match to protein family HMM PF02432"
FT                   /db_xref="EnsemblGenomes-Gn:SeD_B0051"
FT                   /db_xref="EnsemblGenomes-Tr:ACH73550"
FT                   /protein_id="ACH73550.1"
FT                   /translation="MKRMTILLLAASLLPSCVLAWNTPGEDFSGELKLGGPVTSTRNPW
FT                   VWKVGEGNTQINTKAVSVLRSGEQVIPVPLPAMTVLLGKTILTTPAGREGLAPQVTYGK
FT                   ETEGFALTWTAPGTASVTLPVTGEGNVRTGTFTFRMQAAGVLRHVLGDRAEYAGLYGDL
FT                   QGNGLPPQTQVMPAGQTPGVLQTLFDSEGPVWLRKMTVSSVSGLSRFSDAALRQVDGVY
FT                   GAQTVADSGELRFKGAVPSRWHTSLAVSIEYR"
FT   gene            complement(28866..29663)
FT                   /locus_tag="SeD_B0052"
FT   CDS_pept        complement(28866..29663)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeD_B0052"
FT                   /product="minor fimbrial subunit"
FT                   /note="identified by match to protein family HMM PF02432"
FT                   /db_xref="EnsemblGenomes-Gn:SeD_B0052"
FT                   /db_xref="EnsemblGenomes-Tr:ACH73501"
FT                   /protein_id="ACH73501.1"
FT                   /translation="MKITHHYKSIISALAALALFYSAAPRAGILDGGEIQFHGLVTDEA
FT                   PKWTWQVGSPDQTWAVDTADARTANGQLVFDLRGKGSLPFLEGHLYEVAERGGPGFTPF
FT                   ISFSSNGQPFSVTDGGSTTAQHFRASVPVRNPENGHVAGQLSFTLDQGMAVSAGHQEDG
FT                   AVLPAGMSLVNGQSVSGVQAGTLPQWLKSRLPSLLMLNRGFGNGMSTADNGQVISQGVL
FT                   ADGRVTRLAAAYASAVSDFELRLPAENTPAQWQAGLSVTVTVQ"
FT   gene            complement(29899..30222)
FT                   /locus_tag="SeD_B0053"
FT   CDS_pept        complement(29899..30222)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeD_B0053"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SeD_B0053"
FT                   /db_xref="EnsemblGenomes-Tr:ACH73489"
FT                   /protein_id="ACH73489.1"
FT                   /translation="MIYQTVADTSKANGNGYMQNAAYVKSMTSTQVKDHLPRILGADMI
FT                   TIAQDAVESSYTGPNVFNRADAKTIQGVYGSEIVAKSGQLSFPKDGVPSDWNAQMSVTV
FT                   SYQ"
FT   gene            30313..30471
FT                   /locus_tag="SeD_B0054"
FT   CDS_pept        30313..30471
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeD_B0054"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SeD_B0054"
FT                   /db_xref="EnsemblGenomes-Tr:ACH73494"
FT                   /protein_id="ACH73494.1"
FT                   /translation="MKKNSTTAGVHFTGGKTGINFFTGLRKTHPSIKNKSSFNIKSGRD
FT                   IVMIIFS"
FT   gene            30515..30658
FT                   /locus_tag="SeD_B0055"
FT   CDS_pept        30515..30658
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeD_B0055"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SeD_B0055"
FT                   /db_xref="EnsemblGenomes-Tr:ACH73496"
FT                   /protein_id="ACH73496.1"
FT                   /translation="MVYKYYIKRRGNIILFYDELIFRKNKIIYKISFTTIKFRPVVFRP
FT                   ET"
FT   gene            30802..30939
FT                   /locus_tag="SeD_B0056"
FT   CDS_pept        30802..30939
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeD_B0056"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SeD_B0056"
FT                   /db_xref="EnsemblGenomes-Tr:ACH73546"
FT                   /protein_id="ACH73546.1"
FT                   /translation="MLLTGWFGVLLLTAVRVAYAPVAVPVDTIPCYRSHNHLFHKVNVL
FT                   "
FT   gene            31630..32289
FT                   /locus_tag="SeD_B0057"
FT   CDS_pept        31630..32289
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeD_B0057"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SeD_B0057"
FT                   /db_xref="EnsemblGenomes-Tr:ACH73526"
FT                   /protein_id="ACH73526.1"
FT                   /translation="MKTNKQGCSSSNKNPVLGVSVAEIKDIVCVMSFGDVRLGALTVMR
FT                   FNKIKNAAITIGFALFGLTSSVHAADPATASLIIEAILTKPTCMITVPTTYDLGQLIRG
FT                   QVREHEPLLINVNCPGKDSLKTALKAKVLAGRLEGDDKVQMLVNGQGNGTLLSLKPVNE
FT                   SGASSPVKLTGAASGTFCEVDTVGYRQCQLIPVTEVHSEDTPGHASATLLFEVVYP"
FT   gene            32325..33119
FT                   /locus_tag="SeD_B0058"
FT   CDS_pept        32325..33119
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeD_B0058"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SeD_B0058"
FT                   /db_xref="EnsemblGenomes-Tr:ACH73559"
FT                   /protein_id="ACH73559.1"
FT                   /translation="MNRLISAFCITFCCHAYAITLDASITDFTVLFGQHMGHSACVGKF
FT                   PQGAPPSTFVGCRSNGDFSMYNSFTSKVIITRLPDKVSAAHGESLPCTVPSLRVRGGLE
FT                   FAKSTSDAGIVETIDISGMNVGESRTGDIKNAKYIALTPGTVISLEALQCDYSAGSLFG
FT                   DTSARVSANYSIEMPDSNFSTSVLYEVLAKIDKIGSKPDFTLSPTYVRCVGNTASGCMT
FT                   EPVTVSVKDVTNGHRIQVTGLVTGGIYHIYQILAVSTCPRVS"
FT   gene            33405..33769
FT                   /pseudo
FT                   /locus_tag="SeD_B0059"
FT                   /note="IS66 family element; this gene contains a frame
FT                   shift which may be the result of sequencing error;
FT                   identified by match to protein family HMM PF01527"
FT   gene            33766..33939
FT                   /pseudo
FT                   /locus_tag="SeD_B0061"
FT                   /note="ISSfl4 ORF2; this gene contains a frame shift which
FT                   may be the result of sequencing error"
FT   gene            34017..34193
FT                   /pseudo
FT                   /locus_tag="SeD_B0062"
FT                   /note="ISSfl4 ORF3; this region contains one or more
FT                   premature stops and/or frameshifts"
FT   gene            complement(34454..34576)
FT                   /locus_tag="SeD_B0063"
FT   CDS_pept        complement(34454..34576)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeD_B0063"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SeD_B0063"
FT                   /db_xref="EnsemblGenomes-Tr:ACH73535"
FT                   /protein_id="ACH73535.1"
FT                   /translation="MNDVTKLLSGVMPRLALQGDGPLREPSPRQQGIFCAVVNH"
FT   gene            34604..34771
FT                   /locus_tag="SeD_B0064"
FT   CDS_pept        34604..34771
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeD_B0064"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SeD_B0064"
FT                   /db_xref="EnsemblGenomes-Tr:ACH73557"
FT                   /protein_id="ACH73557.1"
FT                   /translation="MGRGGGAFQWWEWAGYQVFAPVSLVRILDVVTICMTGARRIATGG
FT                   TDGVSEPART"
FT   gene            34746..34865
FT                   /locus_tag="SeD_B0065"
FT   CDS_pept        34746..34865
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeD_B0065"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SeD_B0065"
FT                   /db_xref="EnsemblGenomes-Tr:ACH73524"
FT                   /protein_id="ACH73524.1"
FT                   /translation="MFPNRRGRESAARARILWNLSTGQVMNRLFIYKRERLCI"
FT   gene            complement(34931..35146)
FT                   /locus_tag="SeD_B0066"
FT   CDS_pept        complement(34931..35146)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeD_B0066"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SeD_B0066"
FT                   /db_xref="EnsemblGenomes-Tr:ACH73530"
FT                   /protein_id="ACH73530.1"
FT                   /translation="MKIRLTPEDFVRLSPGTACFLRGTLVLPAKISLILLPEWPEMFPP
FT                   EPFPVVIFSYSQITARDLSIKLQPIY"
FT   gene            complement(35158..36027)
FT                   /locus_tag="SeD_B0067"
FT   CDS_pept        complement(35158..36027)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeD_B0067"
FT                   /product="IncFII RepA protein"
FT                   /note="identified by match to protein family HMM PF02387"
FT                   /db_xref="EnsemblGenomes-Gn:SeD_B0067"
FT                   /db_xref="EnsemblGenomes-Tr:ACH73552"
FT                   /protein_id="ACH73552.1"
FT                   /translation="MTDTRTLFTHYRQVKNPNPEFTPREGKKTLPFCRKLMAKAEGFTS
FT                   RFDFSVHVAFVRSLGKRHRMPPLLRRRAIDALLQGLCFHYDPLANRVQRSITNLAIECG
FT                   LATESKSGNLSITRATRALKFMAELGLITYQTEYDPQIGCNIPTDITFTPALFSALDVS
FT                   DVAVVAARRSRVEWENQQRKKQNLEPLEMDELIAKAWRFVRERFRSYQSERKLHGLKRA
FT                   RARRDADRTRKDIETLVKLQLTREYASGRFTGGLDAMKRELQRRVKERMMMSRGKNYTR
FT                   LTMATVPI"
FT   gene            36115..36202
FT                   /locus_tag="SeD_B0068"
FT   ncRNA           36115..36202
FT                   /locus_tag="SeD_B0068"
FT                   /product="CopA-like RNA"
FT                   /ncRNA_class="antisense_RNA"
FT   gene            complement(36154..36267)
FT                   /pseudo
FT                   /locus_tag="SeD_B0069"
FT                   /note="conserved domain protein; this gene contains a frame
FT                   shift which may be the result of sequencing error"
FT   gene            complement(36345..36590)
FT                   /locus_tag="SeD_B0070"
FT   CDS_pept        complement(36345..36590)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeD_B0070"
FT                   /product="DNA replication protein"
FT                   /db_xref="EnsemblGenomes-Gn:SeD_B0070"
FT                   /db_xref="EnsemblGenomes-Tr:ACH73548"
FT                   /protein_id="ACH73548.1"
FT                   /translation="MSQIENAVTSSSKRIYRKGNPLSSAEKKRLSISRKKTTHKELNVF
FT                   IQNMHKESLQQLCEETGTTQAQMIELLIEREMAKRA"
FT   gene            complement(36722..36970)
FT                   /pseudo
FT                   /locus_tag="SeD_B0071"
FT                   /note="phospholipase D (PLD) family protein; this gene
FT                   contains a frame shift which may be the result of
FT                   sequencing error"
FT   gene            complement(36987..37103)
FT                   /pseudo
FT                   /locus_tag="SeD_B0072"
FT                   /note="endonuclease; this gene contains a frame shift which
FT                   may be the result of sequencing error"
FT   gene            complement(37317..37436)
FT                   /locus_tag="SeD_B0073"
FT   CDS_pept        complement(37317..37436)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeD_B0073"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SeD_B0073"
FT                   /db_xref="EnsemblGenomes-Tr:ACH73533"
FT                   /protein_id="ACH73533.1"
FT                   /translation="MPPPGKAITIYPDASAAGVVVQPWQSGKNKFPPIPAFLK"
FT   gene            complement(37399..37851)
FT                   /locus_tag="SeD_B0074"
FT   CDS_pept        complement(37399..37851)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeD_B0074"
FT                   /product="dsba oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:SeD_B0074"
FT                   /db_xref="EnsemblGenomes-Tr:ACH73544"
FT                   /protein_id="ACH73544.1"
FT                   /translation="MFKYWPTFVQQWENSLKAAQKGLEIWKSARADAWLAYHNGIFATS
FT                   HYEGALTSEDISSAAAAALKGHKIRGGNVNTKSILDASNRLAHTLALQGSPVMIMMPVK
FT                   EATEKNVTVIPGGAGQETLENAAVLILAGMERNDRATTREGNNNLS"
FT   gene            complement(37968..38531)
FT                   /locus_tag="SeD_B0075"
FT   CDS_pept        complement(37968..38531)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeD_B0075"
FT                   /product="FinO"
FT                   /note="identified by match to protein family HMM PF05286"
FT                   /db_xref="EnsemblGenomes-Gn:SeD_B0075"
FT                   /db_xref="EnsemblGenomes-Tr:ACH73577"
FT                   /protein_id="ACH73577.1"
FT                   /translation="MTDEKRPVLTLKRRTEGDAPVRSRKTVINVTTPPKWKVKKQKLSE
FT                   KAAREAELAAKKAQAGQELAVYLKLTPLNEAVSTLKPWWPGLFDGDTPRLFACGVREAL
FT                   FEDAARRGIPLSHKKIIRALKAIARSEAYLGAMKAGACRYDTEGYVTDHITVEEEQYAL
FT                   ARLAKVRAQNARKAELRAVLAQTV"
FT   gene            complement(38586..39326)
FT                   /gene="traX"
FT                   /locus_tag="SeD_B0076"
FT   CDS_pept        complement(38586..39326)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="traX"
FT                   /locus_tag="SeD_B0076"
FT                   /product="type-F conjugative transfer system pilin
FT                   acetylase TraX"
FT                   /EC_number="2.3.1.-"
FT                   /note="identified by match to protein family HMM PF05857;
FT                   match to protein family HMM TIGR02755"
FT                   /db_xref="EnsemblGenomes-Gn:SeD_B0076"
FT                   /db_xref="EnsemblGenomes-Tr:ACH73488"
FT                   /protein_id="ACH73488.1"
FT                   /translation="MTMDNATRNDSRAAQVDTRLQRLLAWSPGQRDLIKTVVLLLMVAD
FT                   HINRILHLDLTWLFLAGRGAFPLFALVWGLNLSRHTYIRQSAINRLWGWAVIAQSGYFL
FT                   AGFPWYEGNILFAFAVAAQALKWCELRCLFHSAAALLLLTAWIPLSGTSYGVAGVLVLV
FT                   ICYRLYRTADTEEHLALAACLVVAVPALNLVTSDAAAVAGLLVTGLTVWLVSLTGKSRP
FT                   RFWPTDFFPVFYTCHLAALGILAL"
FT   gene            complement(39346..43632)
FT                   /gene="traI"
FT                   /locus_tag="SeD_B0077"
FT   CDS_pept        complement(39346..43632)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="traI"
FT                   /locus_tag="SeD_B0077"
FT                   /product="conjugative transfer relaxase protein TraI"
FT                   /EC_number="3.6.1.-"
FT                   /note="identified by match to protein family HMM PF07057;
FT                   match to protein family HMM TIGR02760"
FT                   /db_xref="EnsemblGenomes-Gn:SeD_B0077"
FT                   /db_xref="EnsemblGenomes-Tr:ACH73493"
FT                   /protein_id="ACH73493.1"
FT                   /translation="MHQKVDRQERHTDVLARTVGMLPPEAGVIEKARAGIDEAISRERL
FT                   IPLDREKGLFTSGIHVLDELSVRALSSDIMKQNRVTVHPEKSVPRTGSYSDAVSVLAQD
FT                   RPSLAIISGQGSAAGQRERVAELTMMAREQGREVQIIAADRRSQTNLKQDERLSGELIT
FT                   GRRQLQEGMSFSPGSTVIVDQGEKLSLKETLTLLDGAARHNIQVLITDSGQRTGTGSAL
FT                   MAMKEAGVNSYRWQGGQQTPATVISEPDRNVRYARLAGDFVAAVKAGEESVAQVSGVRE
FT                   QAILAGMIRSELKTQGVLGQQDTMMTALSPVWLDSRNRYLRDMYREGMVMEQWNPEKRS
FT                   HDRYVIDRVTAQSHSLTLRDAQGETQMVRISALDSSWSLFRPEKIPVADGERLMVTGKI
FT                   PGLRVSGGDRLQVSAVNDGMMTVIVPGRAEPASLPVGDSPFTALKLENGWVETPGHSVS
FT                   DSAKVFVSVTQMAMDNATLNGLARSGRDVRLYSSLDETRTAEKLSRHPSFTVVSEQIKA
FT                   RAGEVSLETAISRQKAGLHTPAQQAIHLALPVVESKNLAFSQVELLTEAKSFAAEGTGF
FT                   AELGREIDAQIKRGDLLHVDVAKGYGTDLLISRASYDAEKSILHHILEGKEAVTPLMER
FT                   VSGELMETLTSGQRAATRMILETKDRFTVVQGYAGVGKTTQFRAVMSAVNLLPGSERPR
FT                   VVGLGPTHRAVGEMRSAGVEAQTLASFLHDTQLQQRSGETPDFSNTLFLLDESSMVGNT
FT                   DMARAYALIAAGGGRAVASGDTDQLQAIAPGQPFRLQQTRSAADVAIMKEIVRQTPELR
FT                   DAVYSLINRDVNKALSGLENVKPVQVPRLKGAWVPENSVTEFSRLQERELVKAAQEAEK
FT                   KGEAFPDVPVTLYEAIVRDYTGRTPDAREQTLIVTHLNEDRRVLNSMIQDALAKPGEQQ
FT                   VTVPVLTTANIRDGELRRLSTWENHQCALALVDKVYHRIAGISKEDGLITLQDADGNTR
FT                   LISPREAAAEGVTLYNPETIRVGAGDRMRFTKSDRERGYVANSVWPVTAVSGDGVTLSD
FT                   GKQTRVVRPGQDRAEQHIDLAYAITAHGAQGASETFAIALEGTEGGRKQMAGFESAYVA
FT                   LSRMKQHVQVYTDDRQGWTDAINRAAQKGTAHDVLEPKADREAMNAERLFSTARELRDV
FT                   AAGRAVLRNAGLALGDSRARFIAPGRKYPQPYVALPAFDRNGKSAGIWLNPLTTDDGAG
FT                   LRGFSGEGRVKGSEEAQFVALQGSRNGESLLADNMQEGVRIARDNPDSGVVVRIAGDGR
FT                   PWNPGAITGGRVWGDIPDSSVQPGAVNGEPVTAEILAQRQAEEAVRRETEQRAAEIVRK
FT                   MAEDKPDLPEEKTAQAVREIAGQEQDRMTPPERETPLPESVLREPVRERETIREVAREN
FT                   RVRERLQQTEQEMVRDLQKERTPDGD"
FT   gene            43658..44320
FT                   /locus_tag="SeD_B0078"
FT   CDS_pept        43658..44320
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeD_B0078"
FT                   /product="TnpR"
FT                   /note="identified by match to protein family HMM PF00239"
FT                   /db_xref="EnsemblGenomes-Gn:SeD_B0078"
FT                   /db_xref="EnsemblGenomes-Tr:ACH73523"
FT                   /protein_id="ACH73523.1"
FT                   /translation="MNRFCNMTSNVPTSFVRAYLRASTAEQDASRALETIEAFARERGL
FT                   IICSYYIENESGTRLERPELFRLLRDCQQNDILLIEDVDRLSRLSGEDWNTLKKMIRQK
FT                   DIRVMAVNVPTTWINSGMSEFDSRLFAAINDMLLDMLAAVARRDYEQRRERQKQGIEKA
FT                   RKDGKYKGRKPNQARHDAIIRLIESGSSWTQVQKVLGCSRGTISNALKRKTGQKSSK"
FT   gene            44971..45099
FT                   /locus_tag="SeD_B0079"
FT   CDS_pept        44971..45099
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeD_B0079"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SeD_B0079"
FT                   /db_xref="EnsemblGenomes-Tr:ACH73542"
FT                   /protein_id="ACH73542.1"
FT                   /translation="MPVVQLYFRFSPSFEGFFFHFLLRPIQLIALANRTMPLPALS"
FT   gene            45176..45292
FT                   /locus_tag="SeD_B0080"
FT   CDS_pept        45176..45292
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeD_B0080"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SeD_B0080"
FT                   /db_xref="EnsemblGenomes-Tr:ACH73580"
FT                   /protein_id="ACH73580.1"
FT                   /translation="MVRYVKSEILSKELHTRFHKEEVYRVALALLGRFFSLF"
FT   gene            45398..46525
FT                   /locus_tag="SeD_B0081"
FT   CDS_pept        45398..46525
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeD_B0081"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SeD_B0081"
FT                   /db_xref="EnsemblGenomes-Tr:ACH73511"
FT                   /protein_id="ACH73511.1"
FT                   /translation="MTITAYSKTFKRELDARQLKNLFDENNADSALSFRDFVKADIECP
FT                   ACNVSGGHYVAEAKSQSKGNVVKQAHFAFRDSQGKDTHLPFCDFYTGSDKLNVVSNDGR
FT                   VDFMRSGSEATQLIGLMVCAGIEANIFTQQDIRNMRQWFLDLREQGSFIFNLNPHIVQI
FT                   ARASLIRNKRNRDQYIVDISETKNSWFDIDNEVYQSLYFKFPELALDHRDNPELWGIRL
FT                   KGVVTKAKSIIVKDSGTSTFDRSILSEKYQLATQIASLVRSTHPRLRVLLGYTTNALRS
FT                   SNPLMAFAALLLFVSDWDVTVAEKKIKAILAVETVTDITAGNVVGMNPFIHYSAWILVK
FT                   ALHELQSELGYEVDFDAEFNFEKERLMKLYFPSEP"
FT   gene            46541..46696
FT                   /locus_tag="SeD_B0082"
FT   CDS_pept        46541..46696
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeD_B0082"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SeD_B0082"
FT                   /db_xref="EnsemblGenomes-Tr:ACH73569"
FT                   /protein_id="ACH73569.1"
FT                   /translation="MKIQRLRKNIKEAYLSSFKLSIASGLKVSNRLFKLPNVNNSIDTQ
FT                   PGGYPR"
FT   gene            complement(46684..47169)
FT                   /pseudo
FT                   /locus_tag="SeD_B0083"
FT                   /note="Abi family protein; this gene contains a premature
FT                   stop which may be the result of sequencing error;
FT                   identified by match to protein family HMM PF07751"
FT   gene            complement(47373..47489)
FT                   /locus_tag="SeD_B0084"
FT   CDS_pept        complement(47373..47489)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeD_B0084"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SeD_B0084"
FT                   /db_xref="EnsemblGenomes-Tr:ACH73498"
FT                   /protein_id="ACH73498.1"
FT                   /translation="MVHLKAEQNSYSILRSQKSRPDGLLETYDFTGFPDRNP"
FT   gene            complement(47832..48266)
FT                   /pseudo
FT                   /locus_tag="SeD_B0085"
FT                   /note="H-NS histone family protein; this gene contains a
FT                   frame shift which may be the result of sequencing error;
FT                   identified by match to protein family HMM PF00816"
FT   gene            complement(48282..48488)
FT                   /locus_tag="SeD_B0086"
FT   CDS_pept        complement(48282..48488)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeD_B0086"
FT                   /product="conserved domain protein"
FT                   /note="identified by match to protein family HMM PF05321"
FT                   /db_xref="EnsemblGenomes-Gn:SeD_B0086"
FT                   /db_xref="EnsemblGenomes-Tr:ACH73584"
FT                   /protein_id="ACH73584.1"
FT                   /translation="MKTKQEWLFQLRKCTSRDTLEKVIEINRYKLPLSESEAFYSAADH
FT                   RRAELVMNKLYDKVPSGVWKYVH"
FT   gene            complement(48485..50638)
FT                   /locus_tag="SeD_B0087"
FT   CDS_pept        complement(48485..50638)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeD_B0087"
FT                   /product="DNA topoisomerase III"
FT                   /note="identified by match to protein family HMM PF01131;
FT                   match to protein family HMM PF01396; match to protein
FT                   family HMM PF01751; match to protein family HMM TIGR01056"
FT                   /db_xref="EnsemblGenomes-Gn:SeD_B0087"
FT                   /db_xref="EnsemblGenomes-Tr:ACH73581"
FT                   /protein_id="ACH73581.1"
FT                   /translation="MRLFIAEKPAVANDIVKALGGNFTRHDGWFESDNAIVTNCFGHII
FT                   ESQPPENYNPEYKAWKVETLPLRLYPVKYQPVESAAKQVKTILELIRRGDVTEIVHAGD
FT                   PDDEGQLLVDEVLEYAGNTKPVKRVLINDNTLPAVKKALANLKDNRDFKGLYLKALARS
FT                   VADAVYGFSMTRAYTIPAKARGYQGVLSVGRVQTPVLGLIVNRTRANQNHKSSFYYTMT
FT                   GVFQRGADVLRANWKPGEFAPLTDRKLLDKAWADGTAASLAGKPATVEAAATDDKKTAA
FT                   PLPFNLVRLQQYMNKKFKMTAQKTLDVTQQLREKYKAITYNRSDCSYLSDEQFSEAPQV
FT                   IDALKSVFPQSLDIDSARKSKAFNSTKVTAHTAIIPTASVPDVNALSTDERNVYLAIAQ
FT                   HYLVQFMPEKAYQEVSVAIQCGDESFYARARKTTDSGFEAFLGAETTDEGESEDNDDSA
FT                   FELLCKIRTGETLTTKEVVVNKKKTTPPPLFTEASLLAALVRVADFVTDPTIKKLLKDK
FT                   DKDKKDEHGGIGTPATRAAILETLKKRNYITLEKGKLIPTDTGYALIDALPGIAVNPDM
FT                   TALWSEKQAAIENGDLTVEQFINDLYGELTGMISDVDLGEMKIEPAAPAGQFQRLDSPC
FT                   PSCGKHIVIRPKGYFCTGCEFKIWSEFSGKKITQAKAEKLVKSGKTDLIKGFKKKSGGT
FT                   YDTVLVLEDKKTGKLGFPARAKK"
FT   gene            complement(50643..51218)
FT                   /locus_tag="SeD_B0088"
FT   CDS_pept        complement(50643..51218)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeD_B0088"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SeD_B0088"
FT                   /db_xref="EnsemblGenomes-Tr:ACH73515"
FT                   /protein_id="ACH73515.1"
FT                   /translation="MQYALFDGMERKFLLDALEFGVLKDWKENQVKELPDIDEFVHPFH
FT                   VCYGGYLLNPDVSDLDISRKIKDQTGFWLAAIDDTRMDCHSIAYYDIHTLPLISCGHQK
FT                   IVPFAALIKADECIISKIASYSGFAVTAFLRIKDQDIATNILNREGIFAFNGCERRFRH
FT                   PVSEDNWQQVISEERAIRCAKRLIQCKG"
FT   gene            complement(51222..51368)
FT                   /locus_tag="SeD_B0089"
FT   CDS_pept        complement(51222..51368)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeD_B0089"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SeD_B0089"
FT                   /db_xref="EnsemblGenomes-Tr:ACH73547"
FT                   /protein_id="ACH73547.1"
FT                   /translation="MDVIKNARAFLKGTLDLSVQEADEDIEEREELYKKNGAQPDYLSY
FT                   LED"
FT   gene            complement(51529..51831)
FT                   /locus_tag="SeD_B0090"
FT   CDS_pept        complement(51529..51831)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeD_B0090"
FT                   /product="killer protein"
FT                   /db_xref="EnsemblGenomes-Gn:SeD_B0090"
FT                   /db_xref="EnsemblGenomes-Tr:ACH73587"
FT                   /protein_id="ACH73587.1"
FT                   /translation="MKKICKSLIVIFTVSWLTAPAYASDPCASVLCLYGKAVGQGGGSE
FT                   CRSAEKDFFNILKKKKGSIRWSKTFDARKAFLNQCSTADPAAISKIMSKFGRVRG"
FT   gene            complement(51828..52241)
FT                   /locus_tag="SeD_B0091"
FT   CDS_pept        complement(51828..52241)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeD_B0091"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SeD_B0091"
FT                   /db_xref="EnsemblGenomes-Tr:ACH73551"
FT                   /protein_id="ACH73551.1"
FT                   /translation="MKKILMISILFLTACSSPPEPPQVEWEKRPEVMNTQIMNWTPTSN
FT                   VIKSDNINSSWSNVLPSFKPENRLYDDSVFYAVAHSEKIVVRTSSFDSYWSAKCWLRKN
FT                   GATGVIEYQPLKRWLNSDYVEIYLSRINVQRLP"
FT   gene            complement(52238..54073)
FT                   /locus_tag="SeD_B0092"
FT   CDS_pept        complement(52238..54073)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeD_B0092"
FT                   /product="TaxB"
FT                   /note="identified by match to protein family HMM PF02534"
FT                   /db_xref="EnsemblGenomes-Gn:SeD_B0092"
FT                   /db_xref="EnsemblGenomes-Tr:ACH73564"
FT                   /protein_id="ACH73564.1"
FT                   /translation="MSLKLPDKGQWAFIGLVMCLVTYYTGSVAVYFLNGKTPLYIWKNF
FT                   DSMLLWRIITESNIRTDIRLTAIPSLLSGMVSSLIVPVFIIWQLNKTDVALYGDAKFAS
FT                   DNDLRKSKLLKWEKENDTDILVGVYKGKYLWYTAPDFVSLGAGTRAGKGAAIGIPNLLV
FT                   RKHSLIALDPKQELWKITSKVREILLGNKVYLLDPFNSKTHQFNPLFYIDLKAESGAKD
FT                   LLKLIEILFPSYGMTGAEAYFNNLAGQYWTGLAKLLHFFINYEPPWLNEFGLKPVFSIG
FT                   SVVDLYSNIDRELILSKREELEGTNGLDENALYHLRDALTKIREYHETEDEQRSSIDGS
FT                   FRKKMSLFYLPTVRKCTDGNDFDLRQLRREDITVYVGVNAEDISLAYDFLNLFFNFVVE
FT                   VTLRENPDFDPTLKHDCLMFLDEFPSIGYMPIIKKGSGYIAGFKLKLLTIYQNISQLNE
FT                   IYGIEGAKTLMSVHPCRIIYAVSEEDDAAKISEKLGYITTTSKSTSKSRGRSTSQGESE
FT                   SEARRALVLPQELGTLDFKEEFIILKGENPVKAEKALYYLDPYFMDRLMKVSPKLASLT
FT                   MELNKTEKIFGVKGLKYPSKEKMLSVGELESEVLL"
FT   gene            complement(54076..55106)
FT                   /pseudo
FT                   /locus_tag="SeD_B0094"
FT                   /note="pilx11 protein; this gene contains a frame shift
FT                   which may be the result of sequencing error; identified by
FT                   match to protein family HMM PF00437"
FT   gene            complement(55108..56313)
FT                   /locus_tag="SeD_B0095"
FT   CDS_pept        complement(55108..56313)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeD_B0095"
FT                   /product="pilx10 protein"
FT                   /note="identified by match to protein family HMM PF03743"
FT                   /db_xref="EnsemblGenomes-Gn:SeD_B0095"
FT                   /db_xref="EnsemblGenomes-Tr:ACH73512"
FT                   /protein_id="ACH73512.1"
FT                   /translation="MTEQENKIPTATEIEQQLRERRQKELEQAGKTPEEEPGKPALQLG
FT                   IEKLKKSRKGMIILVVGFLLLAAGVSVYYIPSIIRSVSSGDEKPASQPLATGAAKRQTG
FT                   LSEDIDPFNTAQKKTEKPEEEKVISSEKTEPPENKQQSFSRALDVSLDGSQAGNSSSSA
FT                   GTSVSHTAASEPESDKKDEAKATAQATESAPLAKITKLPYDPNLFIPEGTSIPCSLDRR
FT                   FVSDLAGKLECTVNSDIYSASGNVKLIERGTAAKLMYKAGSLNHGQGRVFVMAYKLRTR
FT                   SKPFIDIPLVDSQAAGALGEAGASGWIDTHFSERFLGAMMVGMIPDLSQAASGIAQNNR
FT                   DSQTDYTANSRQAFADIAREAFSNSVNIPPTLYKNQGEIITLIVGQDLDFSGIYKLKMK
FT                   GG"
FT   gene            complement(56310..57239)
FT                   /locus_tag="SeD_B0096"
FT   CDS_pept        complement(56310..57239)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeD_B0096"
FT                   /product="pilx9 protein"
FT                   /note="identified by match to protein family HMM PF03524"
FT                   /db_xref="EnsemblGenomes-Gn:SeD_B0096"
FT                   /db_xref="EnsemblGenomes-Tr:ACH73586"
FT                   /protein_id="ACH73586.1"
FT                   /translation="MKMNKGALIMALLMAAHVCNAAVLPSGSRFDPRNQIVSYNPNNTT
FT                   IINSAVGYTTTLVFDEDETVISARTGFPQGWAVNKEDNLVYLEVRPVKQTVQKNNTDAN
FT                   GNTSSESVSVALDPENELERWRMNLFVRTTKRNYSMELNARTFRQPEKIAFVVNYQYPQ
FT                   ERRKEQAEIEKKRTEALARRLEEQAINRSLENAKSPRNWQYWKRVAEGSQDISPDYAYD
FT                   DGRYTWFGFSPLKKIPSVFVMNGMQETLTNPVIKQSGSFTAVGVPVDKRFVLRLGEQVV
FT                   GIENLGFGKVRLPAGDTVSPDVKKEVIQ"
FT   gene            complement(57244..57957)
FT                   /locus_tag="SeD_B0097"
FT   CDS_pept        complement(57244..57957)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeD_B0097"
FT                   /product="pilx8 protein"
FT                   /note="identified by match to protein family HMM PF04335"
FT                   /db_xref="EnsemblGenomes-Gn:SeD_B0097"
FT                   /db_xref="EnsemblGenomes-Tr:ACH73568"
FT                   /protein_id="ACH73568.1"
FT                   /translation="MEFKLPGFKNKKDVTDSSVSFEEKNIALQERMNRIYKFGGIGGML
FT                   IGGLSLLALNAALPLKTTVVDAYLIDKVTGVAERLTSVKKENLSENEAIARYFITQYIK
FT                   HREGYNFFSLQHDYDYVMAYSAENVAADYNALFNSEQAPKLVYNKAEKTAMVQDNPSVI
FT                   ISPSSRTDDKDIGAYIRFRLTIRDVATGQTRQEFWNVRLTYRIEPQVEMVSGERNNNPL
FT                   KFVVTSYVRDKEARG"
FT   gene            complement(58117..58233)
FT                   /locus_tag="SeD_B0098"
FT   CDS_pept        complement(58117..58233)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeD_B0098"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SeD_B0098"
FT                   /db_xref="EnsemblGenomes-Tr:ACH73490"
FT                   /protein_id="ACH73490.1"
FT                   /translation="MRGQRKCMEGDLIMSVDTILNVLFIINGLVAIYFLCSE"
FT   gene            complement(58202..59335)
FT                   /locus_tag="SeD_B0099"
FT   CDS_pept        complement(58202..59335)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeD_B0099"
FT                   /product="pilx6 protein"
FT                   /note="identified by match to protein family HMM PF04610"
FT                   /db_xref="EnsemblGenomes-Gn:SeD_B0099"
FT                   /db_xref="EnsemblGenomes-Tr:ACH73563"
FT                   /protein_id="ACH73563.1"
FT                   /translation="MGIVTGIPDGTDLSGNVTSPANAGGVPGFNSDFFQTTHEVIFNIL
FT                   NKSISGKLSEYSDVAYTLGKYGVSLYVLWYAFTVLARKQQTPVPDFIWNICRFYIILLF
FT                   VKNTGGILTSATDAIDGLKNTLAGGDPWVWMDQLWVKVIQVATLIFDKDTSTVPVAGGI
FT                   GALLTYVGGVLALLLCSIVFASAELTLLLLSVTAPIFIMCLMFGFLRQMFNSWLQLNFS
FT                   SLLVFLFAALALRAGTWQLNMALSTSIATASENNLLQTGVTSLAAGIFMAWIIWQAKSY
FT                   ASQIAGVGVEGAMQGAAAMGIGAGVFGASRMARGALGMGRNAGIGAWKGLRRQEGGFGQ
FT                   SPGITGKTANLAGQGVNIGAKKLRQAAIERAKKMYGG"
FT   gene            complement(59345..59572)
FT                   /locus_tag="SeD_B0100"
FT   CDS_pept        complement(59345..59572)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeD_B0100"
FT                   /product="Eex protein"
FT                   /db_xref="EnsemblGenomes-Gn:SeD_B0100"
FT                   /db_xref="EnsemblGenomes-Tr:ACH73529"
FT                   /protein_id="ACH73529.1"
FT                   /translation="MKSIATAGLVIISVFSLSGCFEETKSVDWWLAHPKETYKKFEECQ
FT                   KSGSDSDNCKNVKRAHLSFERRKAVGLPIN"
FT   gene            complement(59573..60331)
FT                   /locus_tag="SeD_B0101"
FT   CDS_pept        complement(59573..60331)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeD_B0101"
FT                   /product="pilx5 protein"
FT                   /db_xref="EnsemblGenomes-Gn:SeD_B0101"
FT                   /db_xref="EnsemblGenomes-Tr:ACH73560"
FT                   /protein_id="ACH73560.1"
FT                   /translation="MKKQIMAAFVASLIVISGAQAGIPVAIDANPEWAIEAGRWTERLK
FT                   QWAETVKHYENQINAYKQELLSKTGIRDVQGLVQSAQSVSKELMQIYDQGNAFIDDYIK
FT                   NPESALSEQAKSLLSDYRVTDTCHNLGYSGDLVRGCEATFLSQLASVEYGNKLESKLRQ
FT                   DNQTMKDLIDQVKNAKDTKATQDATNAVALEQLKFEKLKFQYQMYRDKQRDLAEYKEKM
FT                   AQASFRKQQREAVPPSYRKAYMAMKSYEDD"
FT   gene            complement(60342..62972)
FT                   /locus_tag="SeD_B0102"
FT   CDS_pept        complement(60342..62972)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeD_B0102"
FT                   /product="pilx4 protein"
FT                   /note="identified by match to protein family HMM PF03135"
FT                   /db_xref="EnsemblGenomes-Gn:SeD_B0102"
FT                   /db_xref="EnsemblGenomes-Tr:ACH73562"
FT                   /protein_id="ACH73562.1"
FT                   /translation="MYALILPGWYAIRRVTQFDERFFDLLYLRTLVKGHPLSNKRFSAV
FT                   HYAGSQYDEVDISKVDNFMKLKDQSSVEELIPYSSHITDNIIVTKNRDLLATWQIDGAY
FT                   FECVDSEDLSILTDQLNTLIRSFEGKSVTLYPHRIRCKKDVRPVFNSKIPFVNRVMNDY
FT                   YESFPQSEFFENKLFLTICFKPFTTEDKVTHFFSRSKKQKDIFKEPVNEMNEICDRLNT
FT                   YLSRFHSRRLGLYEDHGVVYSDQLSLFQYLLSGRWQKVRVSSSPFYTYLGGKDLFFGND
FT                   AGQITASDHARYFRCIEIKDYFQETDAGILDALMYLPVEYVVTSSFTAMDKQSAIKALD
FT                   DQIDKLEMTDDAAKSLLADLKVGLDMVSSGYISFGKSHQTLVVFADSPERLVKDTNIVT
FT                   STLEDLGLIVTYSTLSLGAAYFAQLPGNYTLRPRLSTLSSLNFAEMESFHNFFSGKEKG
FT                   NTWGEKLITLRGSGNDIYHLNYHMTTEHQNFFGKNPTLGNTEILGTSNVGKTVLLMTKA
FT                   FAAQQFGTPESFPANRKLKKLTTVFFDKDRAGEVGIRAMGGSYYRVKEGEPTGWNPAAL
FT                   PPTKRNIAFMKDLVRLLCTLNSEPLDDYQNSLISDAVERLMQRSDRSYPISKLRPLIQE
FT                   PDDTETKRHGLKARLKPWTQGEEFGWVFDNREDTFDVDNLDVFGIDGTEFLDNKVLASA
FT                   ASFYLIYRVTMLADGRRLLIYMDEFWQWINNEAFRDFVYNKLKTGRKLDMVLVVATQSP
FT                   DELIKSPIAAAVREQCATHIYLANPKAKRSEYVDGLQVRELYFDKIKAIDPLSRQFLVV
FT                   KNPQRKGESDDFAAFARLELGKAAYYLPVLSASKPQLELFDEIWKEGMKPEEWLDTYLE
FT                   QANLI"
FT   gene            complement(63114..63410)
FT                   /locus_tag="SeD_B0103"
FT   CDS_pept        complement(63114..63410)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeD_B0103"
FT                   /product="pilx2 protein"
FT                   /db_xref="EnsemblGenomes-Gn:SeD_B0103"
FT                   /db_xref="EnsemblGenomes-Tr:ACH73539"
FT                   /protein_id="ACH73539.1"
FT                   /translation="MLKLNLNKRYLTLSLFMAALMLCVAEPAFADDVSTKTTGFLQKII
FT                   DFLTDIRKPAITIIALVIGYIAIFSRQHTSWIVPLVIGIIIFIVAPYIPDWLA"
FT   gene            complement(63388..64035)
FT                   /locus_tag="SeD_B0104"
FT   CDS_pept        complement(63388..64035)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeD_B0104"
FT                   /product="pilx1 protein"
FT                   /note="identified by match to protein family HMM PF01464"
FT                   /db_xref="EnsemblGenomes-Gn:SeD_B0104"
FT                   /db_xref="EnsemblGenomes-Tr:ACH73527"
FT                   /protein_id="ACH73527.1"
FT                   /translation="MLSTSTFLALAMQCAASVHPDTTHEVARVESGFNPYAIAEIIPKV
FT                   KRKPGDKGVVSYFPESKEAALKIVKNIELRNHRYSVGLMQITSTNFAKFGTTAEKMFDP
FT                   CENLKVSEKILVDCYKRGGDLVRGLSCYYSGNPETGVKPEPEFNNTSYVQRIGFSPPDN
FT                   KKIFIVPSVKEMIKKENKTTITPEEIIIYPQYAMRGTVSNEKETKDVEIKSE"
FT   gene            complement(64068..64280)
FT                   /locus_tag="SeD_B0105"
FT   CDS_pept        complement(64068..64280)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeD_B0105"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SeD_B0105"
FT                   /db_xref="EnsemblGenomes-Tr:ACH73573"
FT                   /protein_id="ACH73573.1"
FT                   /translation="MTAIKGKRKPQRNVLYLPTEVRVEVEKIAIEISFKRGRRISDSGF
FT                   VQYLIKKYKSQAMKELIHGADIPDE"
FT   gene            complement(65074..66255)
FT                   /locus_tag="SeD_B0106"
FT   CDS_pept        complement(65074..66255)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeD_B0106"
FT                   /product="relaxase/Mobilization nuclease domain protein"
FT                   /note="identified by match to protein family HMM PF03432"
FT                   /db_xref="EnsemblGenomes-Gn:SeD_B0106"
FT                   /db_xref="EnsemblGenomes-Tr:ACH73576"
FT                   /protein_id="ACH73576.1"
FT                   /translation="MGVYVDKEYRVKRKSSENGRKSAFAHKVKNGGKNYSRNVQERINR
FT                   KGASKEVVVKISGGAVTRQGIRNSIDYMSRESELPVMSESGRVWTGAEILEAKEHMIDR
FT                   ANDPQHVMNDKGKENKKITQNIVFSPPVLAKVKPEDLLESVRKTMQKKYPNHRFVLGYH
FT                   CDKKEHPHVHVVFRIRDNDGKRADIRKKDLREIRTGFCEELKLKGYDVKATHKQQHGLN
FT                   QSVKDAHNTAPKRQKGVYEVVDVGYDHYQNDKTKSKQHFIKLKTLNKGVEKTYWGADFG
FT                   DLCSRESVKAGDLVRLKKLGQKEVKIPALDKNGVQHGWKTVHRNEWQLENLGVKGVDRT
FT                   PSASKELVLNSPDMLLKQQQRMAQFTQQKASTLQSEQKLKTGIKFWGFGAYKI"
FT   gene            complement(66258..66872)
FT                   /locus_tag="SeD_B0107"
FT   CDS_pept        complement(66258..66872)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeD_B0107"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SeD_B0107"
FT                   /db_xref="EnsemblGenomes-Tr:ACH73500"
FT                   /protein_id="ACH73500.1"
FT                   /translation="MTSLAPFRNVCPVTYSRFLSENFMKKVQFRIDENQHDDLLDCLKT
FT                   LYPDEPALTVAEGMKLLANALLKSKAGSKDMNTFFDNNDFIKTTMYLTGKQRADIERAA
FT                   NRHGWTLSRECRYRIQTTLENELDFFDQELLMMNRCRNSIDKIGRNFHYIIVNDQTRVL
FT                   DKDGFYQDAERLTIEIFNLKNQFENYIMLCKGRTVSNKVEM"
FT   gene            66928..67263
FT                   /locus_tag="SeD_B0108"
FT   CDS_pept        66928..67263
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeD_B0108"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SeD_B0108"
FT                   /db_xref="EnsemblGenomes-Tr:ACH73514"
FT                   /protein_id="ACH73514.1"
FT                   /translation="MLEHQQKCKKADVVMAEHTYVCDRKPDQCGKDSAVRFAPRTVWQE
FT                   AQAQSRAIYQKAPPEIREGFGYSAKVALFRLLSVAFHALTGIKKPAPEVTHSFKVSFAW
FT                   FFATITT"
FT   gene            67244..67618
FT                   /locus_tag="SeD_B0109"
FT   CDS_pept        67244..67618
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeD_B0109"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SeD_B0109"
FT                   /db_xref="EnsemblGenomes-Tr:ACH73589"
FT                   /protein_id="ACH73589.1"
FT                   /translation="MPRLPLNIRHTRIPALLVQCRTISPLLLKAREKRTAPCRNSPLTK
FT                   DTKSCFVIKPPVYLSVLFCVFFSSAFLSNAIYSGKTWNGIKGKTGRPPFSTSFIADNMR
FT                   SDILFLAIESGVTVSGCPTT"
FT   gene            complement(67633..67812)
FT                   /locus_tag="SeD_B0110"
FT   CDS_pept        complement(67633..67812)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeD_B0110"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SeD_B0110"
FT                   /db_xref="EnsemblGenomes-Tr:ACH73572"
FT                   /protein_id="ACH73572.1"
FT                   /translation="MEREFSAKASLNRNIKFWFKQCGLSKERVIRCIDNWYDFAYPPSE
FT                   QEKAKKEAIEKLIK"
FT   gene            complement(67855..68184)
FT                   /locus_tag="SeD_B0111"
FT   CDS_pept        complement(67855..68184)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeD_B0111"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SeD_B0111"
FT                   /db_xref="EnsemblGenomes-Tr:ACH73492"
FT                   /protein_id="ACH73492.1"
FT                   /translation="MKVLTFKNDTVSVGDVFVSSWGYEQTNVTFYQVLSVHGKKNVTVR
FT                   EIRANSEYTDSMVGFKTPVLNDFTGECFKRQIKDFGDELAIKIEDFETAYKTLPEEKHR
FT                   FSSYY"
FT   gene            complement(68277..68492)
FT                   /locus_tag="SeD_B0112"
FT   CDS_pept        complement(68277..68492)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeD_B0112"
FT                   /product="YajA protein"
FT                   /db_xref="EnsemblGenomes-Gn:SeD_B0112"
FT                   /db_xref="EnsemblGenomes-Tr:ACH73528"
FT                   /protein_id="ACH73528.1"
FT                   /translation="MQNKPTPEEVKNARVAAGLTLKEAADIFGYQLNSWQMKESAGKAS
FT                   RSLSVGEYQYLLLLANMHPSYRLVKK"
FT   gene            complement(68482..68727)
FT                   /locus_tag="SeD_B0113"
FT   CDS_pept        complement(68482..68727)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeD_B0113"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SeD_B0113"
FT                   /db_xref="EnsemblGenomes-Tr:ACH73571"
FT                   /protein_id="ACH73571.1"
FT                   /translation="MDKDKIIKKNRGNYSYVIRTMDEDGDAVFHVLKYVKTIDKTKSRK
FT                   TVRKLIMDEKLNLASLMLLDNGILCDCLTKGDENAE"
FT   gene            complement(68772..69161)
FT                   /locus_tag="SeD_B0114"
FT   CDS_pept        complement(68772..69161)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeD_B0114"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SeD_B0114"
FT                   /db_xref="EnsemblGenomes-Tr:ACH73507"
FT                   /protein_id="ACH73507.1"
FT                   /translation="MKHKKGKQVLFHPEPKVGGRLKMQNYAKSVATEILRQLGGNRFIV
FT                   MTGAKSFSYFDENGECGVTFRLPSNFAMKGINLVKIKLDFTDTYQVKFSRVRGAEVKDI
FT                   SRFDNIYCDQLACLFTQETGLHTVL"
FT   gene            complement(69241..69522)
FT                   /locus_tag="SeD_B0115"
FT   CDS_pept        complement(69241..69522)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeD_B0115"
FT                   /product="putative stability protein StbE"
FT                   /note="identified by match to protein family HMM PF05016;
FT                   match to protein family HMM TIGR02385"
FT                   /db_xref="EnsemblGenomes-Gn:SeD_B0115"
FT                   /db_xref="EnsemblGenomes-Tr:ACH73585"
FT                   /protein_id="ACH73585.1"
FT                   /translation="MTYELAFDRRALKEWQKLGHTIREQFKKKLAERLENPRVPAARLH
FT                   GHADRYKIKLRASGYRLVYQVIDEKVVLLVIAVGRRESSEVYQIADLR"
FT   gene            complement(69512..69763)
FT                   /locus_tag="SeD_B0116"
FT   CDS_pept        complement(69512..69763)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeD_B0116"
FT                   /product="putative stability protein StbD"
FT                   /note="identified by match to protein family HMM PF02604"
FT                   /db_xref="EnsemblGenomes-Gn:SeD_B0116"
FT                   /db_xref="EnsemblGenomes-Tr:ACH73570"
FT                   /protein_id="ACH73570.1"
FT                   /translation="MSYQILTTTAASITDLKKNPMGTVAEGEGDAVAILNRNEPAFYCV
FT                   PPKLYAYYRELAEDAELNAVADERMKNPEIVKVNLDDL"
FT   gene            complement(69760..69960)
FT                   /locus_tag="SeD_B0117"
FT   CDS_pept        complement(69760..69960)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeD_B0117"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SeD_B0117"
FT                   /db_xref="EnsemblGenomes-Tr:ACH73491"
FT                   /protein_id="ACH73491.1"
FT                   /translation="MSSVKNRETVADYNETGKNAQNVLQSVLRRCRKELYLTCSDVFLN
FT                   ISTFKSAFKDAIMSMRQAEGL"
FT   gene            complement(70551..70703)
FT                   /locus_tag="SeD_B0118"
FT   CDS_pept        complement(70551..70703)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeD_B0118"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SeD_B0118"
FT                   /db_xref="EnsemblGenomes-Tr:ACH73532"
FT                   /protein_id="ACH73532.1"
FT                   /translation="MRTHPPFSAQPSTFHENYSAYPSTFHFEATKNNTYLNEIIDKKLG
FT                   TMFAE"
FT   gene            complement(70808..70921)
FT                   /locus_tag="SeD_B0119"
FT   CDS_pept        complement(70808..70921)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeD_B0119"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SeD_B0119"
FT                   /db_xref="EnsemblGenomes-Tr:ACH73510"
FT                   /protein_id="ACH73510.1"
FT                   /translation="MCKVVYPPYRFPPKLGSHERIFIIYIQYDRNAQASTF"
FT   gene            70977..71813
FT                   /locus_tag="SeD_B0120"
FT   CDS_pept        70977..71813
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeD_B0120"
FT                   /product="PI protein"
FT                   /note="identified by match to protein family HMM PF01051"
FT                   /db_xref="EnsemblGenomes-Gn:SeD_B0120"
FT                   /db_xref="EnsemblGenomes-Tr:ACH73499"
FT                   /protein_id="ACH73499.1"
FT                   /translation="MNLLSVTKKTKIRHRNEINSTFSSLPLSARRILFMAMAQIDSREE
FT                   LSEGATFRITAREYAFIADIDVTGAYRQLKEGAEELQASVIRIPRNQLLTAQGNQSSGH
FT                   TKKRGKLPSDAVRLMNLTAFCDYVESEGYIDIAFSHVIEPYITMLKDSYTTQVLISSVR
FT                   LADQNSNMLYQFIRKQYSSGKKTFFDIEVDVLKDELELFRIDNGEKVYLYQNFKDFNKV
FT                   FLQKNIEKINQYTEINHLEVRIVERVARRASKLRFSYKIDKESEGLDIRIPYGFRG"
FT   gene            71853..72299
FT                   /locus_tag="SeD_B0121"
FT   CDS_pept        71853..72299
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeD_B0121"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SeD_B0121"
FT                   /db_xref="EnsemblGenomes-Tr:ACH73487"
FT                   /protein_id="ACH73487.1"
FT                   /translation="MAKIYQFPQGEERAKFRKEIARERKKCFAVKTGCTFVKWLDWGWF
FT                   YLRLLAASVLHFIFVFVLAILGAFKWAVFWLGGILCVITWYHLNQQLWTPQNLTIPVIT
FT                   ATWILGLLAEPLMELLNKTMPWHKLLVPEPADESTENSSEISQQ"
FT   gene            72367..72789
FT                   /locus_tag="SeD_B0122"
FT   CDS_pept        72367..72789
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeD_B0122"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SeD_B0122"
FT                   /db_xref="EnsemblGenomes-Tr:ACH73566"
FT                   /protein_id="ACH73566.1"
FT                   /translation="MTSLTPFRNVCPVTYSRFLLEMFMKYLVKEFINEKYSKAVNILKD
FT                   NLKEHYHVFYGVRLSEILFPTSEYGTDAFFKEFELINSVILPLVIFDFIDRKPIMVIGF
FT                   EEVPGIDSLIDSGMEVVLLDGLSDLLLVEKLMPLFD"
FT   gene            complement(73014..73193)
FT                   /locus_tag="SeD_B0123"
FT   CDS_pept        complement(73014..73193)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeD_B0123"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SeD_B0123"
FT                   /db_xref="EnsemblGenomes-Tr:ACH73556"
FT                   /protein_id="ACH73556.1"
FT                   /translation="MNGEQHTDSLLKICETIEKRLKIFCILIASQALMIEGKNHHYLIN
FT                   LTLISLNEETVKIN"
FT   gene            complement(73428..73658)
FT                   /locus_tag="SeD_B0124"
FT   CDS_pept        complement(73428..73658)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeD_B0124"
FT                   /product="conserved domain protein"
FT                   /note="identified by match to protein family HMM PF09274"
FT                   /db_xref="EnsemblGenomes-Gn:SeD_B0124"
FT                   /db_xref="EnsemblGenomes-Tr:ACH73516"
FT                   /protein_id="ACH73516.1"
FT                   /translation="MSLEKAHTSVKKMTFGENRDLERVVTAPVSSGKIKRVNVNFDEEK
FT                   HTRFKAACARKGTSITDVVNQLVDNWLKENE"
FT   gene            complement(73710..74330)
FT                   /locus_tag="SeD_B0125"
FT   CDS_pept        complement(73710..74330)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SeD_B0125"
FT                   /product="plasmid partition protein ParF"
FT                   /note="identified by match to protein family HMM PF01656"
FT                   /db_xref="EnsemblGenomes-Gn:SeD_B0125"
FT                   /db_xref="EnsemblGenomes-Tr:ACH73506"
FT                   /protein_id="ACH73506.1"
FT                   /translation="MKVISFLNPKGGSGKTTAVINIATALSRSGYNIAVVDTDPQMSLT
FT                   NWSKAGKAAFDVFTAASEKDVYGIRKDLADYDFAIVDGAGSLSVITSAAVMVSDLVIIP
FT                   VTPSPLDFSAAGSVVTVLEAQAYSRKVEARFLITRKIEMATMLNVLKESIKDTGVKAFR
FT                   TAITQRQVYVKSILDGDSVFESSDGAAKGEIEILTKEIVRMFE"
XX
SQ   Sequence 74551 BP; 18799 A; 19040 C; 17217 G; 19495 T; 0 other;
     tagttcagca gtaccagttt ctgccaggac atggatatct ccgggcaagc aagctgatga        60
     ttaaaaaaga aagaggggac tgcccctgaa ggaattgcaa ttccgttcct cgcaatgtca       120
     acattttttg cctgtgatac tatgaccggg tcatttttca gagcatggac tgatgaaaaa       180
     gaaaaacact acgccgactc cccacgacgc gacattccgg cagtttctga cacaacctga       240
     cattgcccgg gattttatgg agctgcatct gccggcagat gctgcgtgcc atctgcgatc       300
     tcagtacact gaaactggaa tccggctcgt ttgttgagga tgatctccgc cagtatttca       360
     gcgacgtcct ctacagcctg aaaaccacag ccggcgacgg atatattcat gtcctggttg       420
     aacaccagtc aacacctgac aaacatatgg ctttccgcct gatacgctat gcggtggccg       480
     ccatgcagcg ccacctggag gcagggcata aaaaactgcc actggtgata ccagtgttgt       540
     tctatacggg gaaacgcagc ccgtatccat actccacccg ctggctggac gaatttgacg       600
     atacggctct ggcagacaaa ctctacagca gtgctttccc gctggtagac gttacggtca       660
     ttccggatga tgaaatcgcc ggccaccgta gcatggccgc cctgacttta ttgcagaaac       720
     atattcatca gcgggacctg gcagaattgg ttgaccggct ggcgcccatt ttgctggccg       780
     gatatctgtc ttcatcgcag gtaatatcgc tggtacacta tatagtgcag gcaggcgaaa       840
     catcggacgc cgaagccttt gtacgcgaac tggcacagcg tgtgccgcaa cacggagacg       900
     cacttatgac catcgcacaa cagctcgaac agaagggcat cgagaagggg attcagctcg       960
     gtgaacaacg tggtatcgaa aaaggccgtt cagaagggga gcgcgaagcg actctgaaaa      1020
     tagcccgtac catgctccag aactgcattg accgcaatac cgtcatgaaa atgaccggtc      1080
     tgactgaaga cgacctagcg cagatccgcc actaatcccc cttttctggc actccctgcc      1140
     cggccatcag cgaatactgg tggggcaggg aggcatcagg ctctgccagc cacagcgatc      1200
     aaacagcttc attacccccg ctacgttccc tgtcaaacgt gctgtcagcg aatttatctg      1260
     tcggccgctg tcgttaaaac cgacatcgag tttggcccgt gagagataaa tgccgttcac      1320
     gcctgcactg agcgccacag cattccggcc ggaccattcc cgatcgctca gcagacggta      1380
     gttccagtgc atatctttcg ctgtttccag agcatacgtc agccggaaca ggtcgttctg      1440
     ctcggacaac tcaccggtgc atgaacgcca gaggtaattc agcttgctgg ccagcttggc      1500
     gctgacgccc atctgacgtc cctgtttcaa aagccactcg atatcgggcg tcacatcacg      1560
     agaaaaacgc cgttgcttca gcgcagtcgc cagccagcgg gtgagaaaga ggttttcctg      1620
     tgccggcgag agaacgccac catcctgcct ggccagcgca agcgccacca gggcacacca      1680
     cgccagatga cctgattttt ctgtcaatgt cacggcttct cccgcaagtc agaaaaatga      1740
     tgtaattcat caggcataat cagcacacgt cagcccgtct tacggagaaa cattcgccgc      1800
     atctcacgcg tcagctgctt cttctcccat ccgtaaggga aaataatgct gtagtccctc      1860
     ctctcaggga ggatatcagg gcccgcgacg attcgcgcca cctccttatt caggcgttct      1920
     cctcgccagc cataagccgc cagtcgctta cggatacgtg caacgggaaa acgtttatcg      1980
     gagtgacggg ggaagagtaa cgtcccgtcc tcatttcgtt tgacaccaaa catatccaga      2040
     gactgttcga tcaccactgt tcgaacgggg aaatgctcac gcatagtttt caacatattc      2100
     tccatttcag actcctgaat taatccctgc aactgtctga ccagccagag agcagcgtta      2160
     tgctggctca ctccctgcgt catcattcat ttcacactgg agttcatgcc aatatccggc      2220
     aatattgttt accacctgtg ctgtcataac ggcgtcagtg acggcggaat gagccacccc      2280
     gatccagctc aggccagcct gactgacagc accggaaagc gatatggttc cgtaacgatt      2340
     tgtactgcag ctgctgccgg atcgatgccg actgtgggtt tcaggcgggt ctcaaatatc      2400
     ctctcaccgc gggcattcac cagaccgatt tccagcgcct gcgcgccggc atcaagtccg      2460
     gtcgtttcgg tatcgaggaa gacggggccc agtgctaacc aggtatgtgc cagcatggcg      2520
     aacctgccac gctcactctt catccgggcc tgcaggccca gacgtgtgct ggccagccgc      2580
     tgtttttctg tctgagggcg tttcgcccgc atcgggacgc agtcagccag ccgccatacg      2640
     ccgtatttcc cgccgtaagg acttttgtac attctgaccg gttccgcacc aggggctggc      2700
     ttcatcctga actcatcccg aagccgccct ttggtgtagc atttatcctc cgcccggggc      2760
     gcttcatcac aggcgtctga attgtcatca tcacgcattc tggccaccgg tctgtttatt      2820
     gcctgaaagc gccgccatca gtgactggtt ctgacgcttc agggcttcag cctcaccacg      2880
     cagtgccgcg accgtttctt tctcccccat cgtctccaga cgggcatcat cacgctggtt      2940
     ttccagctgt gtgcaacgct ctgtcagact ggctatttca ctgcccatac gcaccagttg      3000
     ctccgaggag gccttttcct gcgattccag ccttgcggtg aggctgctga ctctgtcacg      3060
     ttcaagtgca atctcaccgg cgcgcgcctg cgtgtcagcg atggcctgct cgaggcgttg      3120
     ctgcagcgtt tcgcgggtgg ccagatgctg ctgacgttct gaggccagcg cattttcctg      3180
     cgattcaagg cgggtaagga gagtattgac tttatcgcgt tcagacttca gttcttctgt      3240
     acgcgcatta gcttcggcag aaatttgctc cagtcgtttc tgcaggtctt cccgcgtgtt      3300
     tttgtgctgt gcctgctccg cattaagcgc atcctgcagc actgtcttct gctcctgata      3360
     ccgttcctct cgctgacggg tattctcttc agcggccgca agacgctctt tcagctgggc      3420
     catctccaca tcatgctgct gacgcagtga acgttctgac tccagcgcca gcgtcaaact      3480
     gtcatatctg tcctgcagtt catccagttt ttcttccagg tcgtcgactg tctgcgcggc      3540
     gtcggccagc tcccgctctg cctgtgcggt ctgttcaccg gcagcacgcg tgacttccgc      3600
     aacccggcgt tctgcagccc ggaccgcctt gtcattcagt tctgtcgcca gctgggtgat      3660
     gcgttcggac agcgcggcgg agacggcctt cacttcttca gccacttcca ctggcagctc      3720
     ggcaacgggt tcagtgacga ccgtgctctg tgaagcctgg tattcgtccc atatctggcg      3780
     gagacgtgtc ggattgccgc cacccacctg gttacgtagt gcgaacccgg tgatattccg      3840
     tccttcagcc tgcagggcca gccctgcttc aataatctgt tctggttcgt atgtcgccgg      3900
     acgcatctgt cagtctccgc ataaaggggt atgcttatat tatacacaaa caaactaaca      3960
     aataaactaa ctaacaaaca aattaaagac gtgacagggt agcgaaaaag ggcaccagga      4020
     cagcgcaccg ccggtcgaat tgctggcaca gcatgtccgg agcccgggcg ggatgcacca      4080
     caggtacgat gcacgccact ctccttgcca ggtactggtg ttaatgctaa tgtacgcata      4140
     cgttagcatt aactagagac agacatgccg caggatgaat cagtcgtcaa acgggccagg      4200
     gaatactttt tccgccacca ccggtataca gaggaagacc tggaatccga ctaccaggca      4260
     gaactgtgta actacaggga tgacacctgg gaagcaccac aacgggcagc cagactcagt      4320
     gcggccgtca agcgctacaa aacgtatgag atgctgtact tcttcttcca gatcgctgat      4380
     gaggccgggc tggactatac tccgctggtt gtaaagcgcc tgtgcgctca tcttttcgac      4440
     aggcagggca gccagaatat tattgttgat atctttggcc agaagggacg catgcaccgc      4500
     agccatgaca gtgatcctga cattattgct gccgttgccg aacgctaccg gcagcaggca      4560
     gaggaccact ggcagacagt tctgaagaat atcgggagag tgaagcagga ctaccagaaa      4620
     aatcagaaca gacagaaagg cgcaggggat taaatgcatg attaatgcta atgtatgcgt      4680
     acattagcat taatcacata agtcagtgaa aataaatcag gcttattcaa cgttgcgaag      4740
     gttctttggc cagttgctgg agctacttcc cgaaatcagg aaagcctgcg gctgaaagta      4800
     catcagcaac agcactggct ctgggatggc cacgttcaag ccagaccaga ctgagagcca      4860
     cacctgattt ctccgtatca taactgtgac gcgacaaccg gaattaccaa acggacactc      4920
     aaagaatgag atgaacgctc cagacttatg aagttcggaa cacacagagt tcctagttgt      4980
     agcggctcgc aatcgaaatc cccccgactc gcaatcagcg caaatttcgg ctcacattaa      5040
     ctgcaaatga aaaatgccac cggctcacat taagtgacaa tgggctcgca tttatcctgc      5100
     ccggctcgca atccattcca ccgggctcac aataactgca agtcaacttc gtcatatcgg      5160
     caaaccgact gccagcattc tattttccag ttcgactggt ctcagatatt tattcatact      5220
     ggttaaaaat tgtcgttttg gtttgattaa cgtttaccta cgtataatcg cagcaattgg      5280
     agttaactca gtaaatagga gcaaataatg gaacaaaacc aaccagcaca accttcacga      5340
     cgtgcaatac tgaaacaaac tcttgcagta tctgctttgt ctgtcaccgg gctggcggcc      5400
     ttatcggtac caactatctc tttcgccgca tcactgagca aagaggaacg tgacggtatg      5460
     actccagatg cagtcattga acattttaaa cagggtaacc tgcgcttccg ggaaaatcgc      5520
     ccggctaaac atgattacct ggcacagaag cgcaacagta ttgcgggtca gtatcctgct      5580
     gcggtgatcc ttagctgcat tgactcacgt gcgccggcgg aaattgtgct ggatgcgggg      5640
     atcggtgaga cgtttaattc ccgcgtagcg ggtaatatca gtaatcgcga tatgctgggc      5700
     agcatggagt ttgcctgtgc agttgccggc gcgaaagtag tgctggttat aggacacacc      5760
     cgctgtggcg cagtacgctg tgctattgat aatgctgaac tgggtaacct gacggggctg      5820
     ctggatgaaa ttaaacccgc gattgcaaaa acggagtata gcggtgagcg taaaggtagc      5880
     aattatgatt ttgtcgatgc ggtggcacga aaaaatgtcg agctgactat cgaaaacatc      5940
     cgcaaaaaca gcccggtgct gaaacaactg gaagatgaga agaaaattaa aatcgttggc      6000
     agtatgtatc accttactgg cggtaaggtt gagtttttcg aagtataact gaagcagtcc      6060
     gagtccgaat acagtcagcc tcgcattaca ttaagagctc attaaatttt ctctggaatg      6120
     aaaatgtatt ttttgagtac acccaaaacg cacagtctgg tgagacagtt tttctgtctc      6180
     atttgggttg tttttatccc attccggtgt tacgttttca tcatctagag ttaaacgaga      6240
     cagttttcac cattatggca ctttacggct atgcccgcgt ttcaaccagc gatcaggatc      6300
     ttactctgca gacacaaatt ctccgcgctg ctggttgtga aattattcgt gcagaaaaag      6360
     ccagcggaag cggccggacc ggaaggagcg agttgcagct gctgctggag ttcctgcgcc      6420
     ctggtgatac gttgatggtg acacgcgtgg atcgcctggc ccgcagcatt aaggacctgc      6480
     aggacattgt gtatgccctg aatcaacagg gcgtaacgct cagggcaaca gaacagccag      6540
     tggacacgcg ttcagctgca ggcaaagcct tcctcgatat gctgggtgtt ttcgctgagt      6600
     ttgaaaccaa tctgagacgt gaacgccaga tggaaggcat tgccgcggcg aaagccaggg      6660
     gcgtataccg gggaaggaaa ccgtccatag atcctgctga ggtatatcgt ctgtatacca      6720
     ttgagaagat gggagccaca gccatcgccc gccagctcgg gattgggagg gcgtcagtct      6780
     accgggcgct ggaaaattat gagcagccgg cgtagcgcga ttccgtctga ctccctgttg      6840
     caactacggc aacggctcga tcgcctgccg ccaaaaagcc ctgaacgtgc caatcagatt      6900
     gccgctaccg cccagctgta tggtatttca gtcacgacgg tttatcgcgc tcttcacctt      6960
     gttttgaaac cgcgaacggc ccaccgcagt gatcatggtc aaccccggat actgccaccg      7020
     tccgagctgg agcattactg cgaactgatt gctgcactga aattacgaac cacaaataaa      7080
     tccggccgcc atctgtcgac cggacgggca atacagctgc tggaagagca tggcgtggag      7140
     acggtccagg gattgattaa aagtcccaaa ggcttacttc gtaagcagac cgtcaatcgc      7200
     tggctttccc gctggcgtct cgaccagccc cgcctgttac gggagcctcc ggcggtaaga      7260
     tttcaggctg aaaacagcaa tgactgttgg cagtttgata tgtcgccatc cgatctcaaa      7320
     catattgagc ggcctgactg ggtagatcct gcccggggcg aacccacgct gatgctgttc      7380
     agcgtagtgg atgaccggag cggtgtcgca taccaggaat accggtgtgt gtacggtgag      7440
     gatgcggaat ctgcgctgcg ttttctcttt aacgccatgg ccccaaaaac caggtctgat      7500
     tttccttttc agggccgccc gaaattgctg tacctcgata atggaccggt ggccaaaaac      7560
     catgtattcc agaatgtgat gcagtccctg aaggttgact ggctgacgca tacgccggca      7620
     ggcaaggacg gcacccggac gacggcacgg tccaaaggta aagttgaacg tcctttccgg      7680
     accgtcaagg aggcacatga aactctgtac catttccata aaccggaaac ggagctgcag      7740
     gccaacgaat ggctctggaa ctatctgagc cgttataacg cgcagcgtca ccgcagcgag      7800
     aaacactccc gactggagga ctggctggca aatatcggcc aggaaggtgt gagggatatg      7860
     tgcagctggg aacaatactg tcggttcgcc cgggagccgg aatcccgcaa ggtgggtgtt      7920
     gatgcgcgga taacgataga cggcaccgca tgggaagttg aaccggatat ggcgggtgaa      7980
     accgtcattc tgctgtgggg gctgtttgac gaagagatgt atgtggagtt taccggtgaa      8040
     acatgggggc cttattatcc ggtgtcgggg cctgtgccgc tgcaccgtta ccggacgttc      8100
     agacgcggta aagcggctga acgggccgat cgtatccatg ctctggccag gcagctgaac      8160
     atccccatca gcgcattgtc cggcagcgat ctccgcgtgg tcagtgatga cactcagcag      8220
     cgcattgatg cgttgccaca tcagcccttt gatacccgaa aatttgaata ccactttccc      8280
     accgttattg cggcaaaact ggcaattgcc gacgatctgg ccataccgct ggccagaatg      8340
     tcggatgaag accgggcgtt tatcgacagt attctgactg agacgcttaa ccgtagtgaa      8400
     gtactcgccc gcatcagaga ctattttcgt agcagacaat caggagagga ccatgcgggt      8460
     tgaagtgatg gagcattatg gactgacgca gtctattgaa caggccgggt attatgaaac      8520
     tgcccaccat aagcagctga tgaaagacat taagggtgcg atacgcgaag gacgactgat      8580
     agcggtctgt ggcgtggtgg gaagcggtaa aaccgtcact ctgcgacgcc tgcagcagca      8640
     actgctggat gaaaataaaa tcattgtcgc ccgctccctg tcggtggaca aacagagtgt      8700
     ccggctcgcc acgctgatta atgccctgtt ttatgacctg gcacaggata aacaggtgca      8760
     gatccacaaa caaggtgaac gccgcgagcg tgagctgcag gaactggtca aaaaaggcaa      8820
     acgcccggtg gcgctgtttg ttgatgaagc ccatgacctg aacggtaata cactaacggg      8880
     gctcaaacgg ctgatggaag tggttgaaga cggcggtggt aggctgtccg tcgttctggc      8940
     cggtcaccca aaactgcgta atgacctgcg tcgtccgacg atggaggaaa ttggctatcg      9000
     taccgatatt tttacactgg acgggatcac cggcagtcag cgtgaatata tccagtggct      9060
     gctgaagacc agcaccggta agggtaagcc ggaagatatt ctaacgaccg aagccgttga      9120
     cctgctggcg atgaaactgc gaacaccgct gcaggtccag ttgcacctga cgctggcgat      9180
     ggaagcagga taccagacgg gcgaaaaacc gattactgcc actctggttg aatccgtgct      9240
     gtcacgtcag ctggatgacc tggagccgac gctcacgcga catggttacc ggctgaagga      9300
     tatggtggag cagttcgatg caaaaccagc tgaaatcagg gcattattta ataatcagtt      9360
     agaccctgcc cgcacggccg aactacgcga cagaatgctg gcggtcggtc tgccaatatg      9420
     acgatgttga tttgcagtta ttgtgagccc ggtggaatgg attgcgagcc gggcaggata      9480
     aatgcgagcc cattatcacc taatgtgagc cggtggcgtt tttcatttgc agttaatgtg      9540
     agccaaaatt ggcgctgatt gcgagtcggg gggatttcga ttgcgagccg ctacaaatag      9600
     cttcgcatat taccgctcca ctttagccag accctgttga ttgccgggaa acagtgaagc      9660
     ggcattcata aattgtgcta cctgtttcag taactgccac atgtaccgac actgatgatt      9720
     tctcgttatg gtttcgtgta acgacaacca cagtcgctct atcggattca gccacggcga      9780
     atacatcggc aggaacagca accggaactt cgggttttct tccagccagc gttccacttt      9840
     gcggctttta tggatgatgt agttatccgc caccagtgtg atggttttcg cccgcctgta      9900
     tgtacggcgt aacgtttcta acagactgat aaataaatca gaactcttgc tgctgccact      9960
     gacgtagtga acccgtcccg tacctgaatg cagtgcgcct gccagataat gcttctggtt     10020
     ctgtcccggc gtggcgatgc gtttctgttg ccctttgggc atccagtcag cgccaatttt     10080
     tgggttcagg tcgatgtcga cttcatcctg ataaaacaca ggatgtgcag tctgctcctg     10140
     agccagcgcc tgatcaatga caagccgttt ttcttcatag tgcggatctt tgattttcag     10200
     cgttggcgct gccccgcgcc agaccatatc tgcctgcctc agatatcggt gcagggtgga     10260
     gcggtgcagc gtcacatcaa aaagtcggtt gatgacgagt gccagaagct ccgtgctcca     10320
     gcgtgagcgc agccagccaa aatccttcgg ggaacgctgt accaatagtg gcaagagctg     10380
     aaggatatca gcgaccggcc agcgtggagc acgtccgggt ctgaggcttt ttagtccttc     10440
     aacaccatgt aaagtaaacc agtttatcca tcgaccaacg gatgaacggg cggcacagag     10500
     taatctggca acgtcagtga cggtcattcc ctgatgcagc atcagcatgg cgataagccg     10560
     tcgcgcatgg tttttatcgt gggtttgttg ggcctctttg cgcatcagtt gtcgttcttc     10620
     atcaggaatt gctgctatga tcggcatcgc tcagtccggt tggtgatttg tgatgtttgg     10680
     cgattgatca gatcgcacaa tccgggctga gttctctttc agtgatctac tattttgcga     10740
     agctatttag tgcacactaa tcgatttttc agacaacctt tctcgcctgg cgtgagtttt     10800
     cgttcgactg aacctataaa aaggctctgc attctgtcct gtagtgcgcc aggcctaata     10860
     acgcctcccg tttaattccg gcccggtcgt acatcggttc tgttcattta tgggatcgcg     10920
     actttttcgt tgtaatgctt caagagcgat tttttgttct gcggtcaact caacattcat     10980
     agccatcagc atgatcctga ttatttttga aaccaagcat cttcattgat catgggtata     11040
     catcgttgtt atccagctat acatcataac aggtcaatta aatccactca gaaataaagt     11100
     cagggtatgc ataaaatcta tcgcccataa tcctatccag taacaccatg attagtaaga     11160
     actaatcagt ctgtgcaaaa aaaggtcacc gccatcctgt ttttgcacat caaaacattt     11220
     tttcaggatt attctgaaaa aaaaggagat attatggatt tcttgattaa taaaaaatta     11280
     aaaattttca taacactgat ggaaacaggt tccttcagta tcgcaacatc agtactgtat     11340
     atcacccgaa ccccgctgag cagggttatt tcaggcctgg aaagagagct gaaacaaaga     11400
     ctctttatac ggaagaatgg cactcttatc ccaaccgaat ttgcacaaac tatttatcga     11460
     aaagtaaaat cccattatat tttcttacat gcactggagc aggaaatcgg acctacgggt     11520
     aaaacgaaac aactagaaat aatatttgac gaaatttatc cggaaagttt aaaaaatctg     11580
     atcatttcag cactgaccat ttccggccaa aaaacaaata taatggggag agccgttaac     11640
     agccaaataa tagaagaact gtgtcagaca aacaactgca ttgttatttc tgccagaaat     11700
     tattttcatc gggaatcgct tgtctgccgg acatcagtgg agggtggggt catgttattt     11760
     attcctaaaa aattctttct ctgcggcaaa cctgatatca acaggctggc cggaacacct     11820
     gtactttttc atgagggggc taaaaatttt aatctggaca ccatatacca tttttttgaa     11880
     cagacactag gtattaccaa ccctgcattc agttttgata acgtcgattt gttcagttca     11940
     ctgtaccggt tacaacaagg gctggcgatg ttactcatcc ccgtcagagt ctgtcgggct     12000
     ctgggattat caacagatca cgcactgcac atcaaaggcg tagcgctctg tacctccttg     12060
     tattacccga ccaagaaacg ggagacacca gattatcgta aagctataaa actgatacag     12120
     caggaactga aacagtccac cttctgacct tatgcagcgt aagggccgca acacctgtat     12180
     tcacggcatt tgccagattc agattgtcag caatccccat cctccatagc ggtagttcac     12240
     cgcggagcat ggagtaaacc ggctggtcgc cgtcaatctg acacagaatc agtttgatgc     12300
     tctggtggat tacctaaaac atgggcatta acgcgctggc tcacgccact ttactgaaga     12360
     aactgaataa cggtgactat gacggcgcag cgaatgaatt cctgaaatgg gaccacgcca     12420
     gcggtcaggt tgttcccggc ctgacccgac gccggagcgc tgaacgttgt ttattcctga     12480
     gttaatttgt tgtgccatct ttgcacaccg ggaaccgcga ttccgcacag cagaaaaata     12540
     gcacataaat aaactcaata taagccactc attttctggc aatacaaaat aattcccctg     12600
     cagacattat cagtcttcag gatttcattc tgtttatttt caggagtcat cattatttat     12660
     gaatatgaat cagaccacca gtccggcact ttcacaggtc gaaaccgcca tccgggcccc     12720
     ggcagggaat tttgcaaaat ataattatta ttccgtgttt gatattgtcc gtcagacccg     12780
     taaacagttt attaacgcca atatgtcatg gccgggctcc cgcggaggta aagcctggga     12840
     cctggcgatg ggccaggcgc agtatatccg ctgcatgttc cgagaaaatc aattgacccg     12900
     cagagttcgg gggaccttgc agcagacacc ggacaatggc acgaacctga gcagttccgc     12960
     tgtcggcggt attcagggac aggcagagcg tcggccggac ctggccaccc tgatggtggt     13020
     taatgatgcc attaaccagc aaataccgac cctgctgccg tatcattttc cacacgacca     13080
     ggtggagtta tctctgctga ataccgatgt gtcgctggaa gatattatca gcgagagcag     13140
     cattgactgg ccgtggttcc tgagcaactc gctgaccggc gataacagta actatgccat     13200
     ggagctcgcc agccggctgt caccagagca gcagacactg ccgaccgagc cggacaacag     13260
     taccgccact gacctgacct ctttttacca gaccaatctg gggctgaaaa ccgccgacta     13320
     tacgccattt gaagcactga atacctttgc ccgacagtta gcgattaccg ttcccccagg     13380
     tggaacagtt gattgcgggt actctgcgtg ccagccggca gtttagcttc ccgcgctacc     13440
     agagtagtga gcagcagacc attctgcaga atctgagcga cgtcattgtt caggtgcatt     13500
     ctaccgcgct gtacggcggc agcacttttg aacaggccgt agagcagacg ctgtaagcag     13560
     aaaatatacc tggccatcgt cagacggcca gtttcaggag atagtgtatg ttgatactaa     13620
     atggtttttc atctgccact ttagcgctga tcactccccc tttcctgcca aaagggggca     13680
     aggcgctgag tcagtcaggc cctgacggcc tagccagtat aacgctgcct ctgcccatca     13740
     gcgccgaacg cggctttgcg cctgcgctgg cgctgcacta cagcagcggt ggcggcaatg     13800
     gccccttcgg cgtgggctgg tcctgcgcga caatgagcat tgcccgccgc accagccatg     13860
     gcgtgccgca gtataacgac agcgatgagt ttctggggcc ggacggagaa gtgctggttc     13920
     aaacgctcag caccggtgat gcccccaatc ccgtcacctg cttcgcgtac ggtgacgtat     13980
     cgttcccgca aagctacacg gtgacccgct atcagccccg cacggagagc agtttttatc     14040
     gcctggagta ctgggtgggc aacagcaacg gcgatgattt ctggttactg catgacagta     14100
     acggcatcct gcacctgctg gggaaaaccg ccgcagcacg cctcagcgat ccgcaggccg     14160
     cctctcatac ggcgcaatgg ctggttgagg agtcggtgac ccctgccggc gagcatatct     14220
     attactccta cttggcggag aacggtgaca atgtggacct caatgggaac gaggccggac     14280
     gcgatcgcag cgccatgcgc tatctcagca aggtacagta tggcaacgcg acccccgccg     14340
     ccgatctgta cctctggact agcgccacac ccgcggtaca gtggctgttc accctagtgt     14400
     ttgactacgg cgaacgtggt gtagatccac aggtaccgcc tgcattcact gctcagaaca     14460
     gctggctcgc ccgccaggat cccttctccc tgtataacta cggctttgag atccgcctcc     14520
     atcgcctgtg ccgccaagtc ctgatgttcc accactttcc tgatgaactg ggtgaagccg     14580
     atacgctggt ttcccgtctg ctgctggagt atgacgaaaa tccgatactg acacagcttt     14640
     gcgctgctcg gacgctggcc tatgaaggcg acggttatag aagagctcct gtcaacaata     14700
     tgatgccacc gccaccgcca ccgcctcctc cgatgatggg aggtaattca tctcgaccaa     14760
     aatcaaaatg ggcgattgta gaggaatcaa agcagattca agctctgagg tactattcag     14820
     ctcaagggta cagtgtgatt aataaatatt tacgtgggga tgattatcct gaaacacagg     14880
     caaaagaaac tctgctctcc agagactatc tttccacaaa tgaacccagt gatgaggagt     14940
     ttaaaaatgc catgtcagtt tatataaatg atattgcgga gggattaagt tcacttcccg     15000
     aaacagatca cagagtcgta taccggggcc tgaagcttga taagcctgca ttatcggatg     15060
     tgctgaagga atacactact ataggtaata taataataga taaagctttt atgagtacat     15120
     cgccagataa ggcatggata aatgacacta ttctcaacat atacctagaa aaaggacata     15180
     aaggtagaat actcggagat gttgcacatt ttaagggaga ggcagagatg cttttccctc     15240
     caaatactaa actcaaaatc gaaagcattg taaattgtgg atcccaagac tttgcaagcc     15300
     agcttagtaa gctgagatta agtgatgatg caactgctga cacaaacagg ataaaaagaa     15360
     taataaacat gagggtactc aactcataga tactaagaat ctattccaga agtggtatga     15420
     gcggcctagc tctataaggg gttatactcc ggaaccccag atttttccgt caccctaggc     15480
     ccgcaaagta gtgcatctaa acttttgcca ttacccttct ttaactttct gctcggaacg     15540
     gaccgaaata tcattttttc gcctgataaa aaatgaggtt ttctggataa ctaatcgttt     15600
     tattaaaaaa aactgagaat ttatatctaa taatatggcg atatatccat atcgcaaagg     15660
     agatttccca tgcccataaa taggcctaat ctaaatctaa acatccctcc tttgaatatt     15720
     gtagctgctt atgatggggc ggaaatacca tctacaaata agcacctgaa aaataatttc     15780
     aactccttgc acaaccaaat gcggaagatg ccggtatccc actttaaaga ggcgctggat     15840
     gtgcctgact attcagggat gcgccagagt ggtttctttg ctatgagcca aggttttcag     15900
     ctgaataacc atggttacga tgttttcatc catgctcgtc gagaatcacc tcagtctcag     15960
     ggcaaatttg ccggtgacaa gttccacatc agtgtgctca gggatatggt gccacaagca     16020
     tttcaagcgc tgtccggatt gctgttttca gaggacagtc cggtagataa gtggaaagtg     16080
     accgatatgg agaaggtcgt tcaacaagcc cgtgttagcc tgggcgctca gttcacgttg     16140
     tatataaaac cagaccagga aaattcgcag tacagtgcgt cgtttctcca caagacacgg     16200
     caatttatag agtgtctgga atccagacta tccgaaaatg gggttatttc aggacagtgt     16260
     cctgagtcag acgttcatcc tgaaaattgg aaatatctca gttatcgtaa tgaactacga     16320
     agtgggcgtg atggtggtga aatgcagaga caggctttac gtgaggaacc gttttatcgt     16380
     ttgatgacag agtaagtatg ggtttgggga gcaacggaac agtaaacgcc gttaaacagc     16440
     tattttaaat gctcattaat ttattaatca ataaattaca aattttcatt gaaggctccc     16500
     cacttactga cgaattccgg caccgtaaag gaataacgct catgcatatt gatatgtccg     16560
     cactgtaatg gtgaaaatta cataagcaag agcgtttttt gaaaaatatt atatttaatg     16620
     ttttgtaata tgcattttat tgaggtagtg taactatgag agtttctggt agtgcgtcat     16680
     cccaagatat aatatcacgt ataaattcaa aaaatatcaa taataatgat tcaaatgaag     16740
     tcaagagaat taaagatgcg ctttgtattg aatcaaaaga gagaattttg tatccacaaa     16800
     atttgagtcg agataattta aaacaaatgg ctagatatgt aaataataca tacgtccatt     16860
     actctgggaa ctgcgtttta ttatcagcgt gtttacatta taacatacat caccgacagg     16920
     atatattaag ttcgaagaac actgcctctc ctacagtggg attagacagc gccattgttg     16980
     ataaaatcat ttttggtcat gagcttaacc aatcatattg tttaaattcc atcgatgagg     17040
     tggaaaaaga aatattaaac cgttatgaca ttaagaggga aagttctttt atcattagcg     17100
     cagagaacta catagctcca ataattggcg aatgtagaca tgatttcaac gctgtggtta     17160
     tctgtgaata tgataaaaaa ccatatgtac aattcattga ttcttggaaa acatccaaca     17220
     tacttcctag cttacaagaa ataaaaaaac acttctcatc atcaggggaa ttttatgtca     17280
     gggcttatga tgaaaaacac gattgataac ttttttaaat attcatttta tgaatggtaa     17340
     gttaatagag agccttagca agatccgctg taaaccctcg cccaatgcgg gcggggatat     17400
     aaggcgaaaa gcccgaaggg ctttagggca ggctactccg gcgtattctg tctgagcacg     17460
     tatgctttaa gcgtttctat cgtggcacca ccggcgctac aggcaaagta agaacgagac     17520
     cacagcagcc cggttttgct ctgcatccgc aagtgggtat tctgctgacg gagaagccgc     17580
     gacgataccg actttaaatt atttaccatc acgctgaccc ccagttttag cggatacgct     17640
     atcagcagat ggacgtgatc ttgttcacca tccatctcga taatttcgca ctccaacttt     17700
     gccgcagccg aaccaaaagc atcacgtaac tgagcgataa tctgcccgtc aaacagcttg     17760
     cagcggtatt ttgtcgtaaa gattaaatgc acaaccagct tacttacact atgccgttta     17820
     cgaagaaagc cttccagtga ttcgtggtga ttactcaatt gaatttttca cttaacatgt     17880
     taaaataaat acaatatatt aatgagcgct gaatatgtta agagccacga aagtatgcat     17940
     atatccgaca ccggaacagg cggagcacct taacgcccag ttcggtgcag tccgttttgt     18000
     gtacagcaaa tctctgcata tcaagaaaca cgcttatcaa cgacacggcg taagtttaac     18060
     cccgcgtaaa gacattaaac cgcttctggc tgtagcgaaa aaattccgta aattccgtaa     18120
     attccgtaaa ttccgtaaat acgcatggct aaaggaatat gactctattg cgttgcaaca     18180
     ggcggtgatc aatctcgatg ttgccttttc caactgcttc aatccgaagc taaaagcccg     18240
     cttccctatg ttcaagcgca aacacggcaa gctgttgggg taaaagtgct ggatggtgcg     18300
     gtcagaatcc cgaaaatccc ggtgattgaa gcacaattgc atcgtgaaat tactggcacg     18360
     tcacctcctg cttacggtac tcgaggataa tgtcattgtt acggtcagtc aggtcgtagc     18420
     ggctgcccgc caggctgcgc agggcgccca cggcatccgg atccagctgg ctgcgcaggc     18480
     tgtcaccaat gcggtaactc gcttctgccc cgaagcgggt gtcatgctcc ccggccttgc     18540
     cggcgcgctg ctccgcgctg agcttcagca gcggcaccgg agtccagctg accccggcgg     18600
     tcagggcgtg cgggttcttc tgccgctcat ccttcccgaa caggcccact tcatttccgt     18660
     aatactgctc atacaccatc ttcgccccga gctgcgggta cgacggcagg tagccttcag     18720
     cacgcaggtc ccagccgctg gccggacgct cttcgtagtc ctccacatcc ggggaggttt     18780
     tccagccggt caggccgaca taggcgttgg cggaaagctt aaggaagtcg cgccagtatt     18840
     ctccgccgaa gccggcgcgg gcgtggtcgc gggagaggtc atagtcgagg aagatgttcg     18900
     ccccgagcat gtcagacggc cggaagtgac ggtaaccatc ccggcggcgg cctgaccgtc     18960
     cggatggctg gcgaggaagc tgccggcctg tgaggccatg ccggccatct gctgcgcctg     19020
     cgcgtcctca ttttcccggt cagcagcaaa cggaccgcgg gcgtcatggc ggttattgtc     19080
     acctttcccg ccggtcagcg ggaccgccgg cacgtcaagc tcgtcgcctg ccgccagccc     19140
     cgcgcacggc gcagccagct gctgaccgcg gccttcagct gagtcgcgga ggcggtgcgc     19200
     ggcagcaggc agtccggcct gagaccgagg gtgttcagga agacagcctg tcctcctgag     19260
     cccagcagcg ccagtttcag ggacagtgat gtcctggcgt gatggcaggc cgggagaggc     19320
     cgccagcagc acatggctgc ctgccggcgg cgcggtctgt aaccaccggg caacactcat     19380
     gttcacgggg tccagatgtg cgagcaggcg cgtcagcgcc aggcgggtaa actgacagtc     19440
     actgacgata atcagcatga tgcctcccgg accgggcagg ctgcctgcca ggcggctagt     19500
     tttgccgtat caccgccggc cgggcgggac agcaaccagt gcgccatctg gcggtcatac     19560
     tgccggtcac tcaccttccc gcccggccgg tctgtccgct gccggcggat ggtgtccggg     19620
     cgggattcca ctgcccggat acgcaccacg agctgggcgc ggcctccccg cacggggtgc     19680
     aggcgggaat caaagcaaat gtcgtcgtca ttgtgacggt tacagatgta attgaggata     19740
     ccgctggcac ggcggggctc aatgctgaac gcctcgctga cgtcatcgcg ggtaaactcc     19800
     cggcccagaa acagccccca ccaggccacg gcccggtaca gggacagggt gcccagatgg     19860
     cggatgcccg ggggcatgta aaacccttca tggttgctct gcctgccggc aacggtccgg     19920
     aataacaacg gctggttcat agaaatgact cctgtgcgca taacttaacc aaaggccggc     19980
     tggctttttt gcgtcagccg gaaatgaaac agcccgaagg gcatcggggc gccgcagtgc     20040
     cagccctgca ggtaatcgcc ccccgcgtcc cgcaggcgcg ccgcctgcgc cggggtctcg     20100
     ataccttcgg caatgacccg ggccccctgg caccgggcca gactgacggt gcgcgcaatc     20160
     atccgatcag ccaccgtgct ggcgggaccg gcatgaccgg tgccgaagtc gtccacggcg     20220
     aaccgcagcc ccccggcggc aagctggcgg aataccgccg cctgaggaaa ggcgcggata     20280
     tcttcccgct cggtgatttc aaagacgggg gtcatgccgg cctgctccag ccggatgctg     20340
     agggccagca ggtgcggacg gaaaagcggc gtcataacca ggctcaggct gagattcagc     20400
     gtcatcatca gcctgcggcc ggcactgcgg gcaaggtcct gcccgtcccc gcagacctcg     20460
     tcggccagtc cgcgcagcag cgctccgccg aggccggtgg cttcaatggc gggaataaag     20520
     ttcccggcgc tcagcaggcc cttctgcgga tgcagccagc gggccagcat ttcgcagccc     20580
     accacctccc ctcctgtggc gcagacaatg ggctgataaa acggcgtaaa ctcccggttc     20640
     cggatggcct gttgcaggcg aaaggctgaa aaatgcatac acgtctctat gaacctcctt     20700
     tgagcatagc cactgcatca gcacccggca tctgaaactg cacccggtgt cgtgcggcaa     20760
     catcaagcgc aaacactttc gtgtacactt ccgtcgagct caccgatttg tgtcccatca     20820
     gcgcctgcag caccttcagc ggtatgccgg cgtacagcat gtgcatcgca taggagtggc     20880
     ggaatgtatg gggtgtcacc gggactgaga acgtcacgtc gtcagccgct gcggcctcaa     20940
     ccgcctcccc aatccaggta cggaccgtcc ggtcggtgat ctcccagagg cgcgcctttt     21000
     ccgttctgcc ggtacgtctg ttacgacgct ccagcgggat tttcagcgtg gccaccatca     21060
     tctgcagttc gctgacatac tggttatcag aaagcggcac caagcggtgg ggctggctgc     21120
     cggacggcat ccgtcctgcc gttctggccg ccttttccgc ccgctgtttc agagtggcca     21180
     gctgcacaaa cggataaggt ggtgccagcg aaaagtctcc ccgtgtcaag gccagcgcct     21240
     cgttaatccg tgcgccggta ttccatagag tggccagcag catcctgcga tgcagatcag     21300
     ggacgtagtg gagcagggca cttacctccg gagccagcag atatttcggg tagtcgtcat     21360
     gctgcattgc catctggcgc agtgcgaggg ccgccgggta atcaatggcc accggcagca     21420
     gggcggacgc tgcctgcgta cagacagcag gtaacggtgg ctgactcatg tcctctctcc     21480
     gttaagtgaa atattccggg acatcatgtt ttttccccgg agtcatctct ggtttcagtc     21540
     tgaaccctgt ataaaggata ccagtcgccg ctgtgacggt tctgccgttc ggccaccggt     21600
     gtcatggccg caatcgtggc acgtgagtaa cccgctttca gcagcgccgt acgggtcagc     21660
     aattgttttc ccggatcggt cgcgggcgtg gcgagccgta gcggatagag tgcgcgcagc     21720
     cgttccgctt ctgaagcgtg atacagtggc cagccctgac gacgtccgac ataggccgcg     21780
     caggcgcgaa gttcgttacg aaaccaggtg tcggccggaa accagctcgc cggatgcaaa     21840
     tccgcaggta tatcccggga gccggcgtac accgtcgtga accgctcttc cggcgtcagc     21900
     agggacacgg attttccgaa aaagacctgt gcaaactgtt ctgtcgtctc cctgaccggc     21960
     agggcatccg atgccggact gagaccggtg gattcagtat ccggacagat gcgtgaccgt     22020
     gtcatgaggt ggtgttctcc ctgtcagtac gcagtcgcca gaccgtcccg ccgaactccg     22080
     ttcccccgag ggtctgtgtc caggtttcct cgcagaccag ccacttctgt accaccgcaa     22140
     aatccacatg acagagtggg gtatccccgc gttcaccggg ggtttccagc acaagcccgt     22200
     ccggaacgat cggagagggc gtacccgcca gtctggcgga gcggcgccag aaactccgca     22260
     cacagccgcc ctgacgtaga ctactgagca gcacctgttc gctgacacgc atatcagatc     22320
     ccccggaaca tcaggttaat ggcgtttttg atatcgttct cccggaggct gagatcggcc     22380
     acctcttccc cgatgacggt ggccggcaca ctggtcatat ccgtggtcag caggcggtaa     22440
     ggctcatccc cgatatgcat caccgggtaa agatcgcggg gaaccttttc cgacagcaga     22500
     cgggcgctga ccagcgggac agccatccgc cgtccggggg tgtcaatgat gtcgctctgc     22560
     acgtccacaa acagccggta gcgactctcc cttttacagg tgtaaacctt aaactgcata     22620
     tcaccagttc ctgttgtcgt cagcaaacga tccgttagcc tctataaagc tggccacctc     22680
     agccatacct tcccgatttt cttcctgcca gcgttcggct cgcagacggc gggcttcgtt     22740
     ctgcatggtc gtactgacca gaccggagat attcacgtcg tatgccttga gcagctgata     22800
     gctgtcgctg tccactgtca ctgtaattcg ctgcttcatg attcacctct tttttacata     22860
     cttcaggtat gcaattaagt atacattccg atgaagcaaa aatctgccac gcattgtgaa     22920
     tactgttaac cagcttatag tgactgagtt aactgttcgc cgccattatc tacatatctc     22980
     ttatatgtat tttctcgtgc attttactga tgcatgtttt caatccttaa aacgcatact     23040
     gttatcacgc tattagtaaa tcactcatct ttttcataat gaaactttaa ccacatgcaa     23100
     ttacaatcca acttataaaa acgtaacgga attacaggac ggctattttc aggtgatccg     23160
     attttttgtc tattcacgac tttccggaag tgtaccacgg tcagggaata agcaaagcgg     23220
     tcttttctgc cctgcacgcc gggtcacagg gaaggggtat aacacaacat ctggtagcaa     23280
     cagcagatga ctgagccgct acatcttgtg ttaccgggtc gcggcgcacc ggtgaggata     23340
     aagaagatcc gggaccacca gaaatcggat ctgcgcgggg aaagagagaa aatcacatag     23400
     gctgaacata tccatatgcc tgacatctgc atatccgtgg catacgcata tcctaaccat     23460
     ctgcatatgc tgaatctata catatgccga acatctgcct atactgaaca tatgcacaca     23520
     cccggtgcaa tgaacatcat tccggatatg catcacatat ccacacttac ccgggagaga     23580
     atcatgagaa ccgtatccat ttttaaaaac ggcaacaacc gcgccatccg ccttccacgc     23640
     gatctggatt ttgagggggt gagcgagctg gaaatcgtcc gggaagggga cagcatcatc     23700
     ctgcgccctg tccggccgac ctggggctcg ttcgcgcagc tcgaaaaagc tgacccggac     23760
     tttatggcgg agcgcgagga cgttgtcagc gacgaaggac gctttgagct atgaaacagc     23820
     cacgtacgaa gacctatatg ctcgatacct gtatctgttc gttcatcatg cgcgagcagt     23880
     cggaagcggt gctgaagcgc cttgagcagg cggtgctgcg cggccaccgt atcgtgatct     23940
     cggccatcac ctactccgag atgcgcttcg gcgccaccgg acctaaggcc tcgccgcgtc     24000
     tcgtccagct ggtcgacgcg ttctgcgccc gcctcgatgc catcctgccc tgggatcgcg     24060
     ctgcggtaga cgccaccacg gagattaagg tggcactgtg cctcgccggg acgccgatcg     24120
     gtccgaacga cacggcgatt gccgggcatg ccatcgccgc cggtgccgtg ctggtgacga     24180
     ataatacgcg ggaatttgag cgggtaccgg gcctggtact ggaagactgg gtaagttaac     24240
     gctgtaaaac aaaatgtgcg gaggcgtttc cgctcacggc ctcccggtat gagactgacg     24300
     tcggcgacgc gctggacgct ctgctggcac gcgctagatt cagcgccgcc caggcacagg     24360
     agctgcggtg gcaccgcata cgctggccgc tgacgggtga taaagaattt gagcagcgct     24420
     acgggaaatt ttgattaaac gcatccgtga aaaaaggaat actgaaaatg gccagaattc     24480
     agtgcaaccg tgatcggggc aataattcat tcgacggggt gatttgtctg gcccggggaa     24540
     aatcgttaac tgtgtactac atgttgcttt tcgttttaaa aaacttatat acagcgaatg     24600
     ttattcagaa cgaaagtact ttctccagcc gcaacctgct catctggtat tcctcatctg     24660
     ttacactccc cgcttacagt ctgtccagac cgtatcgagt acttccggga ggagctcctt     24720
     ctcagccaaa ttaaagccac acggtcagga ttatacccag aagcccgtta atcgtgctgc     24780
     ccacaggggg gcgtattttt atccgcactc atgacgtcgt tgtccggctg aagcggtaaa     24840
     accggtctgg ctcactgact atccacagcg aattccggcc atcagaagct atcccttccg     24900
     cctgcggaat gtcccgctcc agaccactgt gtccccggcg cagcggcatc acccaccagc     24960
     cgccctcggg gtctgacacc agtaccaggg ctgattcatg ggaaagcaca tacagccgcc     25020
     tgtttttcct gtcgtaatgc aggccggaga tatccttcag gaaccacggc agggacaacc     25080
     ggtgcgtcag tgaatcactg accgacagag agtcatggct gtggtccgtt tctaaaaaac     25140
     gaagcggttt cttttcctgc gccactatca gggcattctc tccccgtcca cgggcaaggc     25200
     cttcaaaacc ggcattgtcg ctttttctgt ccacatccag ggtcagggtg tatgacgccg     25260
     gcggcaggac agacgtattc ctgtcaatgt ggtgggtggt gagtatccgc tcccgttccc     25320
     gggacaggac atagcggttc cggccgagat actcaatggc ctcaaaatca tggtcgccat     25380
     ccgatggtat cacccgcagc acgttcccgt ccgtgtccag ctccaccacc gacgacggat     25440
     ggtcggtcac ggcaaacagc gttccgctgt ccgggttcca cgtcaggccg gagagaccgc     25500
     cctgtatacc gggaatgtct ttttctgtcg caagctgcca ctgcgtttcc tccgggtacc     25560
     aggtttccgg aaaatacagt gtggccgcac cggccaccat cagaagagcg ccagccagca     25620
     gtgccggttt ttgtttaagt aaacgtctca gagtcatggt tccggatgtt cagttcatcg     25680
     cattacatgc agtcaatgac aaaccagagc atggccaggg ctccggtcag gaagccggag     25740
     atgaaagcgc tggtcagcag cagtaaaatc agcgcccgga gcgaaaagcg tcccccgcca     25800
     tacccggcgc gtctttcgtc atccggcatg ttgtccttct gcaaaaaaat tctccgggga     25860
     attaccggta tggagatgtc cggataaaaa gagctttatt cccgtaaggc ctgtcatgca     25920
     gccccggatt atattcattc aatattcagt aacagaaata ccgatacaaa aaacaccagt     25980
     gatattatga cgacaaaaga aatacagatg taataaatca tcttcagaaa gttcatcagt     26040
     cagttaccgc aatatctgtt ccagccactt gttctctcca tgcccctgtt ttaccggata     26100
     tccgtcagac cagccgccat cggccggaca cgcctttacc tgcattcatt ttctccacca     26160
     cgcccgctcc ctcaagcgta accagataag ccctggcctg gtatattgtc agcccggccg     26220
     catccgcaat actccgggtt ctgacaggta tatttatcct gccgtttgcc tgtgactgca     26280
     taaaagacag aattttgtcg caagcgtcat tactcatttt gttctcctgt gactacgggg     26340
     aagcaatggt gtcccggaag ctgaaatacc tgccccgggt cttcacatat cagaaccgtt     26400
     gtccggtttc atctgtaatc accccgggta acaggccgct cgtgcacagt acatgcaggt     26460
     tctccacccc tgcatactcc accaggcagg cccggaggta ataatccttg cgtgatgccg     26520
     ccttcagtga ggcattcctg tttatggccg tacacaggga tatcagagtc cgctttcgca     26580
     actcagtcag ttcacctgag ctttccggcc cggctcttcc ctcaagcgcc tgacgcagca     26640
     tgtcacgcag ccggaggagg ctgtcccggc cactgataac ctgcgcagtt cctctcagga     26700
     gccgcatttc ctgcagccgc gaaggtacca gaacaaccat gggaaccgga ctggccgcgt     26760
     gcagcattct gatacccttc agatgccgcc cccagccggc cagcggctcc gcactcagtg     26820
     ccaccagggc caggtcatat gccccgggag gtgacatctc cggtcgcacc acggcatacc     26880
     ccataccggc aagcagatgt gacagcccca gcagttcata ttcacagttc cccgtcagca     26940
     gtatgcgttt ccggcgggac atggcatttt ccatttatct gcccccgcta acttaacgcc     27000
     gggcttatca gctctgccag catggctgcc agtcccacaa gaaccagcag ataaaccgtg     27060
     accagtacac gtacagatat tttcattacg atccctgctc agaaatagtt caccaccggc     27120
     gtcaggctcc cctgccaccg gctcaccggc tcctctgcac cgggaaaacg gacccggata     27180
     ccctccaggg acgtcaacca agccccggca atttgatttt ttgtgccgtt atccggcagg     27240
     aaactgccgg gcattaccgt aaaggcgtcc ggccgggtct tcagacccga gtaagacggg     27300
     ttccaccggt aatctcttac ctgccacagc aggcgtttta tatcctgtgc cgcatccggc     27360
     gtgacgttgc cgctgaccac gctccagccc ttctctgcgg tggtactgtc ctgccaggcc     27420
     agtacatggc tggcagtaaa ggtaatttcg ccataccgca cctgcccctt cgccagtttg     27480
     ccccgggcct caaggcggac gacgccatgt ccggcatgca gcaggcttac cgacggctgc     27540
     agcccgggac gggctgatgt cagggtcgtg gtataccctt taagaatgta ataacgtctc     27600
     cccggacggc tttcactcac catgccctcc tgccggctca tctccagcgg gacgggctgc     27660
     cactgccagg ccgtatcccg gatatacagt gtgccgctga gttcagtcac gcccacggcc     27720
     atgccttcct gccagtgggc ctgtacgact gtcagcggct ggctgctcac ggatgcggat     27780
     gctagcatca gcaacagata atagtttttc attacacttc tcccccggtt acctttcctg     27840
     cggaactgtc aaaaaaagag cggccaccgg cctcatataa agcagcagaa aactcagaca     27900
     gcgacattct ggtcatgaat gtcgtgcctt ccccgaatac cagcctgacc cggccgttat     27960
     gttcctgcac ctgccggata tcccggacac tcacaaagaa aaacacgccg tcagcccgct     28020
     ccagccccac aaaaacggcg gggcccggaa cgggtgaccg ggggcctgca gccttaccga     28080
     tattcaatgc tcaccgccag ggaggtatgc cagcgggacg gtaccgcccc cttaaaacgc     28140
     agctcaccgc tgtccgccac cgtctgtgcg ccgtataccc cgtcaacctg gcgcagggcg     28200
     gcgtcactga accggctcag tccggacacg ctgctgaccg tcatcttccg gagccagacc     28260
     gggccttcac tgtcaaacag ggtctgcagc acacccggcg tctgccctgc cggcatcacc     28320
     tgcgtctgtg gcggcaagcc gttgccctgc aggtcgccat acagcccggc atactccgcc     28380
     cggtccccca ggacatggcg cagcacaccc gccgcctgca tccggaaggt gaatgtcccg     28440
     gtacggacat ttccctcccc cgtcaccggc agtgtcaccg atgccgtacc cggcgccgtc     28500
     cacgtcagtg caaaaccctc ggtttcctta ccgtacgtca cctgcggcgc aagcccctcc     28560
     cggccggccg gggtggtcag gatagttttt cccagcagga ccgtcatggc cggcagggga     28620
     accggtatta cctgctcccc actgcgcagg acagagacag ctttcgtgtt tatctgtgtg     28680
     ttcccttccc cgaccttcca gacccaggga ttacgggtgc tggtcaccgg cccgcccagc     28740
     ttcagctctc cgctgaagtc ttcccccggc gtgttccacg ccagcacaca ggacggcagc     28800
     agactggcgg ccagcagtaa aatcgtcatt cgtttcattg tgttcttcct ctccctgccc     28860
     gttctttact ggaccgtcac cgtcacactc agcccggcct gccactgcgc cggcgtgttt     28920
     tctgccggca ggcgcagctc aaaatccgag acggcggacg cataggccgc cgccagccgg     28980
     gtcacccggc cgtcagccag cacgccctga ctgataacct gaccgttatc tgccgtgctc     29040
     attccgttac cgaagccccg gttcagcatc agcagggaag gcagacggct tttgagccac     29100
     tgcggcaggg tgccggcctg cacaccgctc acgctctgcc cgtttacgag cgacatgcct     29160
     gccggcagaa ccgccccgtc ttcctggtgt ccggcgctga cggccattcc ctggtcaagg     29220
     gtgaaagaaa gctgtcccgc cacgtgaccg ttctccgggt tacgtaccgg gacagaggcg     29280
     cggaagtgtt gcgccgtcgt gctgccgcca tccgtcacgg aaaacggctg cccgttactg     29340
     ctgaaggaga taaaaggggt gaagccggga ccaccgcgct ctgccacctc atacagatgg     29400
     ccttccagaa acggcaggga gcccttgccg cgtaaatcaa aaaccagttg tccgttcgct     29460
     gtacgggcat cagcggtatc caccgcccat gtctggtcag gggagcccac ctgccaggtc     29520
     catttcggag cctcgtcagt gaccagaccg tgaaactgta tttccccgcc gtcaagaatt     29580
     ccggcccggg gtgctgcgga ataaaacagg gccagcgcgg ccagggcgga aataatagat     29640
     ttataatgat gcgttatttt catcgttatt cactctgttt tatccgttgg tcataattaa     29700
     taaacaacga gcattcagat aagccgaaaa gaataaaccc ggcaccggcg tacgcggaca     29760
     tttcctgact gacagagaag caggaaataa ctatgccgga ataccgggtt tattaccggt     29820
     gaatggccgt aaaacggctc accggatttt agagtcaggc aaaaatcaca tcctgtttat     29880
     gcctagctgc ctgctgcatt actgataaga aacagtaacg ctcatctgag cattccagtc     29940
     acttggtacg ccgtctttag ggaaagatag ttggcctgat ttagccacaa tctcagaacc     30000
     atataccccc tgaatagttt tagcatcagc gcgattaaat acatttggac cagtgtaaga     30060
     gctttcaacg gcatcctggg caatggtgat catatctgca cccaaaatac ggggtagatg     30120
     atctttgact tgtgtagaag tcattgattt aacataggca gcattctgca tgtaaccatt     30180
     accatttgct tttgaagtat cagctaccgt ctgatatatc accctatcgg tagggcggtc     30240
     agcagttgcc cccctaggtg atatttgcta aagcgaacat atccatgttg aaggtaagtg     30300
     taccagtttt aaatgaaaaa aaattcaact acagccggag tccattttac cggtggtaag     30360
     acaggaatca attttttcac agggctgagg aaaacacatc caagcattaa aaacaaatca     30420
     tccttcaata taaaaagcgg gagggacata gtgatgataa tattttcata agcattaaaa     30480
     ctcttaattg cgatatatat taaacatatt cctgatggta tataagtact atataaaacg     30540
     taggggtaat atcattctgt tttatgatga gttaatattc agaaagaata aaataatcta     30600
     caaaatatca ttcactacta taaaattcag gccggttgta ttccggcctg agacgtagga     30660
     aataattatt tgtaagccac catatagctg atggtggact ggtatgcacc agcaacctgg     30720
     ccacccacta actgagtttt gaactgcaga ccttcaccat cggttttcag tttctcccct     30780
     tcaaacagta cagcgttatt cgtgctgtta accggctggt ttggcgtttt actgttgact     30840
     gcagtcagag tggcatatgc ccccgtggca gtgccagtag atacaatccc ttgctacaga     30900
     agccataatc atctttttca taaagtcaac gttttataat taagtttttt gacgagtaca     30960
     acgcatgaaa aaattatgtg tattgttcac attgcaatac ctagaggtta ctgaattctt     31020
     ttctaggaaa agacgttatt cgctcatccc acatatttat attgtgctaa tgttaaaaaa     31080
     ttcaatttag acagaaaata acgttgttat aaccccgcgc ataatcaact atgataagtt     31140
     tttgagaaaa aaaacacgca aacaacgaac agtgtgaacg caaaatacga ataacgatac     31200
     tactattgct caaataacgt gcttacaaat tcagtatgtc ctttagcccc atctaatagt     31260
     tattacattg ttatttttgt atgcatttgt tacgtcctga tatcgtgtaa ctgcataccc     31320
     agtgacggct acgctatccg cattattctt ctccgccctg atcgacggga ttgtccgcgc     31380
     actgggtcag aaacaatggg taaatatact ttcctcgata cactgcattg ttagcgcaaa     31440
     caatgagatc cactatcggt tgaatatacg taattctggt acatttgatt gattagttcg     31500
     cgttttggca ttggtatttt cacaaattgc cgtgcggcga catttttgaa agcatataat     31560
     tgtgagacta atgtaaagtt aagaaacaat tacgatattg tttaatacgt gctcatatct     31620
     tacctgtaca tgaagacaaa taagcaaggc tgttcatcaa gtaataaaaa tccggtgctt     31680
     ggtgtatctg tagccgaaat aaaggatatt gtctgtgtta tgtcgttcgg cgatgtccgt     31740
     ctgggagcat taaccgttat gcgattcaat aaaattaaga acgccgcaat aactattggg     31800
     tttgccctgt tcgggctgac ttcatcagta catgctgctg atcctgcaac agcctcgcta     31860
     attatagaag ctatattaac aaaaccaact tgcatgatta ctgttccaac cacttatgat     31920
     ttggggcagt tgattcgtgg gcaagtcaga gagcatgaac cattacttat taatgtcaat     31980
     tgccctggaa aagactcact gaaaacggcg ctaaaggcta aggttctagc gggaaggtta     32040
     gaaggagatg ataaagtgca gatgctagta aatggccaag gtaatggtac attgttatca     32100
     ttaaagcctg tgaatgaatc tggagcaagt tctcctgtta aacttacagg agcggcatca     32160
     ggtacttttt gcgaagttga tactgttgga tatcgccagt gtcagctaat tcctgttacg     32220
     gaggttcact cagaggatac gccggggcat gcttcggcaa cattattgtt tgaggtagtt     32280
     tatccgtaaa cacattaaat tctctgagga atagagatat ttgtatgaat cgcctgatat     32340
     cagccttctg tattacattc tgttgtcatg cttacgctat aaccctagat gccagtatta     32400
     ctgattttac ggtactattt gggcaacata tggggcacag tgcttgtgta ggcaaatttc     32460
     cacaaggtgc tccacccagt acttttgtag gatgccgatc gaatggtgat ttttcaatgt     32520
     ataattcatt tacctcaaaa gtcatcatta ctcggttgcc cgacaaagta tccgctgcac     32580
     atggtgagag tctgccatgt acagttccct cgttgagggt ccggggaggg ttagaattcg     32640
     ctaagtcaac ctccgatgca ggaatagtcg aaactattga tattagtgga atgaatgtag     32700
     gtgaaagccg gacaggggat attaaaaatg ccaaatatat tgcccttacg cccggaactg     32760
     ttatcagcct agaggcgctt cagtgtgatt acagtgctgg ttcgcttttt ggcgatacat     32820
     ctgctcgagt ctctgctaat tattcaatag aaatgcctga tagtaatttc agcacctcgg     32880
     tactatatga ggtactggct aaaattgaca aaattgggag caaacccgac tttactttgt     32940
     caccgactta tgtcaggtgt gtaggtaaca ctgcgtccgg gtgcatgact gaacctgtga     33000
     cagtaagcgt aaaagatgta actaatggtc acagaattca agtcactggt ctggtaactg     33060
     gagggattta tcatatatat caaatactgg ccgtgtcgac ctgcccgagg gtaagttgac     33120
     aaatcttgtc aacaccgtct cttctggggg aatacagcaa gtgacatcag ggcgttttgt     33180
     tatcccggga ggaggaactg aagggacccg attctatacg gtgaactaca ctttaaccgt     33240
     agaataagtg tttcacctca ctgggggata taaggtgcat cagggttgcc cttgacatca     33300
     gttacatgtc tcacgtccgg agtaaacgtc cagcgagtgc cgtctggtca taatctgatt     33360
     catccgacaa agtggtgtcc accaaataag tagtgggaac taaagtgtca gatatgcaga     33420
     aaaatgtgac tcccggcagg cgtaagggct gccctaatta ttctcctgag tttaagcagc     33480
     agcttgttgc ggcctcctgc gaacccggct tatccatctc aaaactggcg cttgaaaacg     33540
     gcattaacgc caatctgttg tttaaatggc gcaagggaaa gctgctatta cctttcagct     33600
     actccctgtg actctcaatg ccacctccgt acagccagaa ctaaccgctg aaggcccgga     33660
     ggttctcagt atcagctgtg aggcaacgtt ctggcacggg acgcttcgcc tcaacggcac     33720
     tgtcagcgaa aagctcctga ctctgctgat acaggaactg aagcgatgat cccgttacct     33780
     tccgggacca agatctggct ggttgcaaaa gtgcagacgg tgctgaaaga tgatccgatg     33840
     tccggccacc tcttcatctt ccggggtcac agtggcagtc aggtcaaact gctgtggtct     33900
     accggagaca gctggagcgc gggcgtcagc ccgcgatagc aaagtgttcc tgacaccggc     33960
     gcagctggat aagcttcggc aatcgttccg aaaaggtctc ccgctgcatc gcacagatgg     34020
     aagccgacct gaaccggctg cagaaagaag gcgatgcgct gcgtcagacc cgcacccgca     34080
     aaccgttccc cgcatcactc ccccgtgacg aaaaacagct gcagccggca gaggcatgct     34140
     gcccggactg cggcgatgcg ttgagttatt tgggcgaaga tgccgccgaa tagctggagc     34200
     tgatgcgcag cgccttccgg gttatccgga cctgcgggaa aaacacgtct gtacaaaatg     34260
     cgacgccatc gagcgaggta tcgccgggcc ggggctgctg gcccgagtgc tgagttcaaa     34320
     gtatgcagag tataccccga tgtatcgtca gtcagaaata tacagttgcc aagtgtagag     34380
     cgatttcttt cagtttgtct tcggtcttga attgtcaact gctgaatcgc gggggcccct     34440
     tcggggttcc gattcagtgg ttgacaactg cacagaaaat accctgctgg cggggtgatg     34500
     gttcacgcag tgggccatcg ccctgcaaag ccagacgggg cataacgcca ctcagtagtt     34560
     tagttacatc attcattatt aaaagcgact ccattccggc cctttgggcc ggggcggcgg     34620
     cgcttttcag tggtgggaat gggctggata tcaggttttt gctccggttt cgttggtcag     34680
     gattttggat gttgtaacta tttgcatgac cggggcccgg cgcatcgcga cgggaggtac     34740
     tgatggtgtt tccgaaccgg cgcggacgtg agtccgctgc aagggcgcgc attctctgga     34800
     acctgtccac agggcaggtg atgaataggt tatttattta taagagagaa agattatgta     34860
     tttaaaagaa gtatagatct ggggtttaaa ggaaaccacg cactttgaaa tcaggtcgcc     34920
     tggcgctttg tcagtatatc ggttgtaact ttatggaaag gtcccttgca gttatctgtg     34980
     agtaactgaa tattacgacc ggaaatggct caggcgggaa catttctggc cattctggca     35040
     gcagaatgag agatattttg gcaggaagaa cgagcgttcc gcgcagaaaa caggcggtgc     35100
     caggcgacag acgtacaaaa tcctccggcg tcagccggat tttcataatc tggtgggtta     35160
     tatggggacg gtggccatgg tcagtcgcgt gtagtttttg ccccgcgaca tcatcatgcg     35220
     ctctttcacg cgccgctgca gctcccgctt catggcatca agcccgccgg taaagcgtcc     35280
     gctggcgtat tcccgcgtca gctgcagttt caccagtgtt tcgatgtcct tacgggttct     35340
     gtccgcgtca cgccgcgccc gggcgcgttt cagtccgtgc agtttacgtt cagactggta     35400
     gctgcggaac cgttcgcgca caaatcgcca ggctttcgct atcagttcgt ccatctccag     35460
     cggctccaga ttctgctttt tgcgctgctg attttcccat tcgacacgac tgcggcgggc     35520
     ggccacaaca gccacgtcag agacgtcgag cgcggagaac agtgccggcg tgaaggtgat     35580
     atcggtcggg atgttgcagc caatctgcgg atcatactcg gtctggtagg taatcagccc     35640
     cagctctgcc ataaacttca gcgcccgtgt ggcgcgggtg atggacagat tgccactttt     35700
     tgactcggtg gccagaccgc actctatagc cagattggtg atggatctct gtacacggtt     35760
     ggccagtgga tcataatgga agcacaaccc ctgaagcagc gcatcgatgg cacgacggcg     35820
     cagcaaaggc ggcatccggt gacgctttcc cagcgaacga acgaacgcca catggacgga     35880
     aaaatcaaaa cgggacgtga acccttcggc tttcgccatc agcttacgac agaacggcag     35940
     ggtctttttc ccttctcgcg gcgtgaattc cggatttgga tttttgacct gtcggtaatg     36000
     agtgaacagt gttcgggtgt cagtcacttc tgcctgcact tacaatgcac ggaaggagta     36060
     aatgccacag aaacaagtat tgaaattttc tgagcataaa actatactcc ctgcatagcc     36120
     tgattggtgg ctatacagtt taagtaggcc ccgttaatct tctgtcccgc caagaataga     36180
     aagattatcg gggtttttgc ttttctggtc ccgggtagac acctcatcag aaccagttcc     36240
     ctgccacctt acggcgtggc cagccatcaa aattctttag acgatcagca atctaacact     36300
     cactgacgag acgatcaaga aagttactca ttcaccttct tatctcaggc tcttttggcc     36360
     atttcccgtt caattagtaa ctcaatcatt tgagcctgag tagttccagt ctcttcacaa     36420
     agctgctgca agctttcttt atgcatgttt tgtatgaaaa cattgagctc tttatgcgtc     36480
     gtcttttttc gtgaaataga taatctcttc ttctcagcgg aagataaggg attacccttt     36540
     ctgtaaatgc gtttcgatga ggaagttact gcattttcaa tctgcgacat ctctgcctcc     36600
     tcaaggatca aacctggatc gtttgcagag aatactacag atttctaaaa tcagcgactt     36660
     actttatgaa cgtaacctgt gttggcgcac ggtttacgtt tcaggatcgt ttcctgggat     36720
     gtcagtacgt ctgtttccag tccgttccct gcgcccagcg ggatgtccag tggttcaggt     36780
     agctgcgggc taagactggg tcatcccaga cgacaagcac gttctccgaa ttcgaacggt     36840
     ctgctgcacg ggaatagtta aacgatccca cttcagtgtg gcgaccgtcg ctgacgataa     36900
     ctttgtcatg aagaattttg tacacactga cagtacgaac cggaatgccg gcactggtca     36960
     gcaggttcat tgtcaccctg ctggcgttat tgttttttcc cggtattggc tttccagtcc     37020
     agtacccccc tgacatccac tccccgacgt tttgcactaa taagagcgcc agccacctcc     37080
     ggagaggtga aggaataccc catcagccgg atattatgtt gcgcagcctc aatagtctta     37140
     agaaccagct gctctgcgct gccctccggt gaaaaaccgg cctaaacgga cggtgccgca     37200
     atagctggca gggagcccag cagggataaa cacgcaagtg tgagcaacgt caatccatga     37260
     cctttcctga gtctcattat gtacctcata tgaacttgat tagagtagtg attttattac     37320
     ttcagaaacg ccggaatcgg gggaaacttg tttttcccgg attgccaggg ttggacaacg     37380
     acgccagcgg cggaggcatc aggataaatt gttattgcct tccctggtgg tggcacgatc     37440
     attacgctcc atcccggcca gaatcagcac ggccgcgttt tccagggttt cctgtcccgc     37500
     gccgcccggt atcactgtca cgttcttctc cgtggcctcc ttaaccggca tcattatcat     37560
     caccggcgag ccctgcagcg caagcgtatg tgccagtcgg ttactggcat ccagtatgct     37620
     tttcgtgttc acgtttcccc ccctgatttt atgccctttc agggcggcgg ccgccgcact     37680
     actgatatct tcactggtga gcgcgccttc ataatgactg gtggcaaaaa taccgttgtg     37740
     atacgcaagc caggcatccg ccctcgctga tttccagatt tccagcccct tctgtgcggc     37800
     tttcagcgag ttttcccact gctgtacaaa tgtgggccag tacttaaaca catagcggac     37860
     ctgcggccta gcttcacagc ctgcagcatc ggggtaaggc cggtgccacg ccgtacagac     37920
     ggtctttctg tttcatccgt tcactcatta tactgggctt ctccggttca gaccgtctgc     37980
     gccagcaccg cgcggagttc cgcttttctg gcgttctgcg cccggacctt tgccagccgc     38040
     gccagcgcgt actgttcttc ctccaccgta atatgatccg tcacataccc ttccgtgtca     38100
     taccggcagg ccccggcttt catcgcgccg agatacgctt cagaacgggc aatcgctttc     38160
     agcgcacgga ttattttttt gtgtgacagc gggataccgc gcctggcggc atcctcaaat     38220
     agggcctcac gcacgccaca ggcgaaaagg cggggcgtgt cgccgtcaaa cagccccggc     38280
     caccagggct tcagggtgct gacggcctca ttcagcggcg tcagcttcag gtaaaccgcc     38340
     agctcctgtc cggcctgcgc tttcttcgcc gccagctccg cctcccgggc cgccttttcc     38400
     gacagtttct gctttttcac cttccacttc ggcggcgtgg tgacgttaat cacggtcttc     38460
     cggctgcgga cgggcgcgtc gccctccgtc ctgcgtttca gcgtcagtac cggtcgtttc     38520
     tcgtctgtca tagtcattcc tgccttacca catcatcctg tccggataaa agatatcaca     38580
     cccggctaca gtgccagaat gcccagggca gccagatggc aggtgtagaa taccgggaaa     38640
     aaatcagtcg gccagaaccg gggccgtgat ttgcctgtca gcgaaacaag ccataccgtc     38700
     agcccggtca ccagaagtcc tgccaccgcc gcggcatcac tggtgaccag attcagcgcg     38760
     gggacggcca ccaccaggca ggccgcaagc gccagatgtt cttcagtatc tgcggtccgg     38820
     tacagccggt aacagatgac cagcaccagc acgccggcaa cgccgtagct ggttccggac     38880
     aggggtatcc acgccgtcag cagtaacagc gcggccgcag agtgaaacag gcagcgcagc     38940
     tcacaccact tcagcgcctg cgcggccacc gcaaaggcaa acagaatatt cccttcatac     39000
     cacggaaatc ccgccagaaa atatccggac tgtgcgataa ccgcccatcc ccacagccgg     39060
     ttaatcgcag actggcggat atacgtatgc cgggacaggt tcagccccca caccagggca     39120
     aacagcggaa acgccccgcg cccggccaga aacagccacg tcagatccag gtgcaggata     39180
     cggttaatat ggtcagccac catcagcagc agcaccacgg ttttgatgag atccctctgt     39240
     ccaggcgacc aggccagcag tcgctgcagc cgggtatcca cctgggctgc ccgcgaatcg     39300
     ttacgtgtgg cgttatccat cgtcatcgtg gtttatcttc ccgtatcagt ccccgtccgg     39360
     ggttctctct ttctgcaggt cacgcaccat ctcctgctcc gtctgctgca gccgctcccg     39420
     aacccggttt tcccgcgcca cttcccggat ggtctcccgc tcccgtaccg gttcgcgcag     39480
     cacactctcc ggcagcgggg tttcccgttc aggcggggtc attctgtcct gctcctggcc     39540
     ggcaatctct ctgaccgcct gcgcggtttt ctcctccggc aggtcaggtt tatcctcagc     39600
     cattttacgg acaatctctg cggcacgctg ctctgtttca cggcggactg cctcttctgc     39660
     ctgccgctgt gccagaatct ctgccgtgac cggctccccg ttgaccgcgc cgggttgcac     39720
     actgctgtca ggaatatcgc cccacaccct gccgccggta atggcgccgg gattccacgg     39780
     acgcccgtca ccggcaattc tcaccaccac gccgctgtca gggttatcgc gggcaatccg     39840
     gacgccctcc tgcatgttat cagccagcag gctttcgccg ttacgactgc cctgcagggc     39900
     cacaaactgc gcctcttcgc tgcctttcac ccgtccttca ccgctgaagc cccgcagccc     39960
     ggcaccgtca tccgttgtca gtgggttcag ccagataccg gcggatttac cgttacggtc     40020
     aaacgccggc agcgccacat acggctgcgg atatttgcgc cccggtgcaa taaaacgcgc     40080
     ccggctgtct cccagcgcca gtccggcgtt tcgcagcacg gcacggccgg cggccacgtc     40140
     ccgcagttcc cgggcggtgc tgaacagccg ctctgcattc atggcctccc ggtctgcttt     40200
     cggctccagc acatcgtggg cagtaccttt ctgtgcggct ctgttgatgg catcagtcca     40260
     gccctgacga tcgtcggtgt acacctgcac atgctgtttc atacgcgaca gggccacata     40320
     cgccgactca aaaccggcca tctgtttccg gcccccttcg gttccctcca gcgcaatggc     40380
     aaacgtctca ctggccccct gcgcaccgtg ggcggtgatg gcatacgcca ggtcaatatg     40440
     ctgctctgcc ctgtcctgcc cgggacgcac cacgcgggtc tgtttcccgt ctgacagcgt     40500
     gacaccgtca ccggaaaccg cggtcaccgg ccagacgctg ttggccacat acccgcgttc     40560
     cctgtcactc ttcgtgaaac gcatccggtc accggccccc acccggatag tttccggatt     40620
     gtacagtgtg acgccctctg ccgctgcttc ccgaggggaa atcaggcgcg tgttgccgtc     40680
     ggcatcctgc agggttatca gcccgtcctc cttactgata ccggcaatcc ggtgatacac     40740
     tttatccacc agggcaagcg cgcactgatg attctcccag gtggacagac ggcgcagctc     40800
     cccgtcacgg atattcgcgg tggtcagtac agggacagtg acctgctgct cacccggttt     40860
     cgccagtgca tcctgaatca tgctgttcag cacccgacga tcctcattca gatgcgtgac     40920
     aatcagcgtc tgctcccggg cgtccggcgt tctgccggta tagtcgcgga caatggcctc     40980
     atacagcgtc acgggcacat ccggaaaggc ttcgcccttt ttctccgcct cctgtgcggc     41040
     tttcaccagt tcccgctcct gcagacggct gaactccgtc accgagtttt ccggcaccca     41100
     tgcccccttc aggcggggaa cctgaaccgg cttcacgttt tcaagcccgg acagtgcctt     41160
     attcacatcc cggttaatca ggctgtacac ggcgtcccgc agttccggtg tctggcgcac     41220
     aatctctttc atgatggcca catcggcggc actgcgtgtc tgctgcagac ggaaaggctg     41280
     accgggtgcg atggcctgca gctggtccgt gtcaccacta gccacggcac gaccaccacc     41340
     ggccgcaatc agggcgtatg cccgcgccat atcggtgttg cccaccatcg aactctcatc     41400
     aaggaggaac agcgtgttgc tgaaatccgg tgtttcaccg ctgcgctgct gcagctgcgt     41460
     gtcatgcaga aaggacgcca gcgtctgtgc ttccacgccg gcactgcgca tctccccgac     41520
     cgccctgtgg gtcggcccca gccccacgac gcggggacgc tcactcccag gcagtaggtt     41580
     cacggcagac atcaccgccc ggaactgggt ggtcttgccc accccggcgt agccctgtac     41640
     cacggtgaaa cggtctttcg tttcgagtat catacgggtg gcggcacgct gtccggatgt     41700
     cagagtctcc atgagttcgc cggataccct ctccatcagt ggcgtgaccg cctcctttcc     41760
     ctcaaggata tgatgcagaa tactcttttc agcgtcatac gatgcacggg aaatcagcag     41820
     gtctgtacca taaccttttg ccacatccac atgcagtaaa tcgccccgtt ttatctgcgc     41880
     atcaatttcc cgtcccagtt cagcaaaacc ggttccctct gcagcaaacg acttcgcctc     41940
     cgtcagcagc tccacctgac tgaatgccag gtttttactt tccaccaccg gaagggcaag     42000
     gtgaatggcc tgctgtgccg gcgtgtgaag cccggctttc tggcggctga tggcggtttc     42060
     cagcgatacc tcaccggcac gcgcctttat ctgctcagaa acgaccgtaa aagacgggtg     42120
     acgggagagt ttttcagcag tgcgggtctc atccagtgag gaatacagcc ggacatcccg     42180
     gccgctgcgg gccagaccgt tcagggtggc gttgtccatc gccatctgtg tgacggaaac     42240
     aaaaactttc gcactgtcac tgacggaatg cccgggtgtt tccacccagc cgttttccag     42300
     cttcagcgcc gtgaacgggg aatcccccac aggcagggaa gccggctcag cccgtcccgg     42360
     aacgatgacc gtcatcatgc catcgttcac cgctgatacc tgcagccggt cgccgccgga     42420
     gacgcgaagc ccgggaattt ttcccgtcac cataagacgc tcgccgtctg ccaccggtat     42480
     cttctccggc cggaagagtg accagctgct gtccagggct gaaatccgca ccatctgcgt     42540
     ctctccctgc gcatcccgca gggtcagact gtgactttgt gcggtcaccc ggtcaatcac     42600
     ataccggtca tgggaccgtt tctccgggtt ccactgctcc atcaccatcc cttcacggta     42660
     catgtcgcgc aggtaacggt tccggctgtc cagccagacc ggtgacagcg cggtcatcat     42720
     ggtgtcctgc tgcccgagta ccccctgcgt cttcagctca ctgcgtatca tccccgccag     42780
     tatggcctgc tcacgcacgc cgctgacctg cgccacgctc tcttccccgg ctttcaccgc     42840
     ggccacaaaa tccccggcca gccgggcata gcggacattc cggtccggct cgctgataac     42900
     ggtcgccggg gtctgctgcc cgccctgcca gcggtaactg ttcacgccgg cctccttcat     42960
     ggccatcagc gcgctgccgg taccggtgcg ctgaccgctg tcggtaatga gcacctggat     43020
     gttatgacgc gccgcgccat ccagcagggt cagagtctcc ttcagggaca gcttttcgcc     43080
     ctggtcgaca ataacggtac tgcccgggga aaatgacatg ccctcctgca actgacgacg     43140
     cccggttatc agctcaccgg acagacgttc atcctgcttc aggttcgtct gcgaacggcg     43200
     gtcggcggca ataatctgca cctcacgccc ctgctcccgg gccatcatcg tcagctccgc     43260
     cacccgctcc cgctgaccgg cagcactgcc ctgaccactg ataatggcca gtgacgggcg     43320
     atcctgagcc aagacactca ccgcgtcgct gtaacttccc gtgcggggca cgctcttctc     43380
     cggatggacg gtcacccggt tctgcttcat gatatcgctg ctgagtgccc ggacagacag     43440
     ctcatcgagc acatgaatac cggaggtgaa cagtcctttc tcccggtcga gggggataag     43500
     ccgctcgcgg ctgatggcct catcaatccc ggcccgggct ttctcaatca cgccggcttc     43560
     cggcggcagc atgccaaccg ttctggccag cacgtcggta tgcctttcct gtcgatctac     43620
     tttctggtgc attttgggta tagtggtgta accttatgtg aaccggttct gtaatatgac     43680
     ttcaaatgta ccaacaagct ttgtccgcgc ttatctgaga gcttcaacag cagaacagga     43740
     tgcttcgcgt gccctggaaa ctatcgaggc ttttgccagg gaaagaggcc tgatcatttg     43800
     cagctactat attgagaatg aatccggcac ccgtcttgag cgcccggaac tttttcgtct     43860
     tctgagagat tgccaacaaa atgacatttt gcttatcgag gatgtggaca gactttcccg     43920
     cctgtcaggg gaagactgga atacgttgaa gaaaatgatc cggcagaaag acatccgggt     43980
     tatggcggtg aatgtgccga cgacatggat taattctggt atgagtgagt ttgacagccg     44040
     gttgtttgca gccattaacg atatgctgct ggatatgctg gccgcagttg ccagaaggga     44100
     ctatgaacaa cgtcgggaac gccagaaaca agggatagag aaagcaagga aagacggcaa     44160
     atataaaggg cgtaaaccta atcaagccag acatgatgca attatcaggt tgatagaaag     44220
     cggtagctcc tggacacagg tacagaaagt gctagggtgc agccgtggca caatcagtaa     44280
     tgcgctaaaa cgtaaaaccg ggcagaaatc cagtaagtag aggagtaggg ggcaatatac     44340
     ctgcaaggca ggatattaac tcaggagatt gggtgtgtgg tgtttagtca atgcatttga     44400
     atattgtaac taaaatatgt ttttattaaa ggccggaggt ggttagcccc cggccttagt     44460
     tacgtttccg ctgtcatcag tcgatgaact ggcgaatcag ttccagaatt gcaatcagcg     44520
     cgtttgcaac ggcgaccaca gccctgagaa cgatgattaa caaattaatc atccgtttct     44580
     ccagtaaaac tggaggaaat caccgttgct tactcataca ctgcctgtca caacggctct     44640
     ctcgcattgt taggtgtaga gtgacctcct cctgccagag caccgaatac agcaccacct     44700
     gtttatccag ccaggacttt aaaatcgttc atacccgcag atacgggaag agcaggattg     44760
     caagtcaact acatgactaa ctgactgatt atacgctaca caaaacaccc gttacaccac     44820
     taaatgtggt tccttaacca catttagttg ctttacagca ccatagtgaa taaaatgtaa     44880
     acgttaggtg tagagtaacc ttctccggtc agagccacca actcaaggct ggaaaacaca     44940
     aaaaagcccg attaccagtc gggttttttt gtgcctgttg ttcagttgta cttccgtttt     45000
     tccccttcat ttgagggatt tttctttcat tttttgttgc ggccaataca gctgatcgcg     45060
     ttggccaaca gaacgatgcc gttaccggca ttatcatgaa tcccgttttt tcagtaagtt     45120
     gcagcataca aagtaattaa aaaaacgtca tttcttgttg atgtatgcag tagcggtggt     45180
     gcgctacgtg aaatctgaga ttttgtcaaa ggaattacac acgagatttc acaaagaaga     45240
     ggtttatcgc gtagctttag cattgttagg acgctttttt agcctgtttt gaacagaact     45300
     atctatagta ataggacgca ctcccacgct atatgccgtt taactccaag gaatggcaat     45360
     atgataaaat acgctttctc ataaatgagg acttctaatg acaattacgg cctactccaa     45420
     aacgttcaag cgtgaacttg atgccaggca gttgaaaaat ctttttgatg aaaataatgc     45480
     cgattcagcg ctgagtttcc gggattttgt gaaagcagat attgaatgcc cagcctgcaa     45540
     tgtttctggc ggtcattatg ttgcagaagc taaatcgcag tcgaaaggca atgttgtaaa     45600
     gcaggctcat tttgcatttc gcgacagcca aggaaaagat actcatcttc ctttctgtga     45660
     tttttacact ggttcagaca agctaaatgt cgtttctaac gacgggcgtg ttgatttcat     45720
     gcgttctggc tctgaagcca cgcaactgat cggcttaatg gtctgtgccg ggattgaagc     45780
     caatatattc actcagcaag acattcggaa catgcgacaa tggttcctag acttgcgtga     45840
     gcaaggttcg tttatcttca atctgaatcc acatatcgta cagattgcca gagcttctct     45900
     gataagaaac aaaagaaata gagatcaata cattgttgat atcagtgaaa ccaagaatag     45960
     ttggtttgat attgataatg aagtctacca gtcgctttac ttcaagtttc ccgagttggc     46020
     tttggatcat cgggataatc ccgaactatg ggggataagg cttaaagggg ttgtcactaa     46080
     agctaaaagc attattgtga aggactcggg tacatccaca tttgataggt caatcctttc     46140
     tgaaaaatat cagttggcaa cacaaattgc atcactggtt agaagtactc atccacggct     46200
     acgcgtactg ttaggataca caaccaacgc tctgaggagt agcaatccac tgatggcatt     46260
     tgcagcgctt ctgctgtttg tatctgattg ggatgttaca gtcgctgaaa agaagattaa     46320
     agcgatattg gccgtagaaa cagtgactga cattaccgct ggtaatgtgg ttggcatgaa     46380
     cccttttatc cattatagcg cgtggatctt ggttaaagcc ctgcatgaac tacaatctga     46440
     gctggggtac gaagttgatt ttgacgctga gtttaacttc gaaaaagaaa gactgatgaa     46500
     actatatttt cctagtgagc cataaacgtt tctgagttaa atgaagatac agagacttcg     46560
     taagaacatt aaagaagcat atctgtccag tttcaaactt tcaatagctt cagggttaaa     46620
     agtctctaac agacttttta aattgccgaa tgttaataac tcaattgaca cccaaccagg     46680
     aggctatcca cgatgaaacg gacagtattc attaaaatac ttttctttat aatgttttgc     46740
     gaactcttct tttgattttc tgaatgatgc gctcacatta gaaacagttt tgatatgatt     46800
     atcactattg ttaaatagtg agaaatccag ataccagaaa gaatttttat ttattccagt     46860
     aacccaataa tcaaaagaac tacgcacggc aatttcgatt ttttggatca gcttaaacac     46920
     caacagtcgt aaatcctgat caaacagata tagattatgc gctttatcaa aagttgcatc     46980
     cggataatat ctgcgagtag tttcatcacg aaagggaatc agataggctt taaatcgata     47040
     gtagctacat ctctcaagca ctttccgagc attatcaaca tcattgataa ttaaaccatc     47100
     ccgttgcagc ttctgacaca agtcggtact tgactggtaa ggttttttgt atggaatgag     47160
     atctgacaat tcaacacccc tatcaaaaag tcaaaaaaaa agcctccact cttacgacat     47220
     aaagtctgga ggaagctgtt gttgctatga atagtacact attcattatg tttttttaac     47280
     aaaaagtgcc atttgtaacg aataactagg agataattca caatcatcat cgagctggtt     47340
     acggcagtat tagaactaat caactggctc ctttaaggat ttcggtctgg aaaaccagta     47400
     aaatcgtatg tttctagcag tccatcgggg cggctttttt gtgagcgaag aatagaatag     47460
     ctgttctgtt cagctttgag gtgtaccact gagctgtatc cttcaggaca cagggaaaaa     47520
     tcttacttca gttcgtactg taattctctc tcggtcacta ggggggcttc agtacagcga     47580
     agatgatatt tttcaatgat ctctttggct gacagtgagg gggctattct actgagccta     47640
     ccgctgacca cgttgttcat gccggacata cactgttcgg cacttttaaa ggtaagtagc     47700
     gcctagggcc tacatacgtt ctggccttcc tgactggtaa ggcacaatga accgaccaaa     47760
     acgaacattg aaatcatgac tgaatctcct tatttttaat aacgccctcc agaaaaagga     47820
     gggctgtaga atcacttctc gatgagaaac tcatcaaggg agcgacctcc tgccagtgct     47880
     tcagcaatcg gttttggcgc acgcccacga ccagaccagt atttcgtttc accattttct     47940
     tcaaattgat acttgggtgg cgcttttggt aacgtttttt tacgtgattt tggtgcttct     48000
     tcggacagac caagcagttc ttccggtgag aaaccctctc cggcgattaa ctgaagcagt     48060
     tcctgacgtt tccgttcacg ctctgctcgt tcaaccgctt cacgttcagc atcttcacga     48120
     cgttcttcaa taacaacgtt gagcttttcc tgcatttcga gcaactgctc aaaatcaatc     48180
     tcacgggcaa acacacgcaa tgaacgaata ttcatcatag tccggctgat aatgccgtat     48240
     tcatcttctt tagtcagttc gctcataatt aatcctcttg tttagtggac gtacttccag     48300
     acgccggaag gaaccttatc ataaagttta ttcataacca gttctgcgcg gcgatggtct     48360
     gcggcagaat aaaatgcctc tgattctgat aaaggcagct tgtaacggtt aatctcaata     48420
     actttttcaa gagtatctct tgatgtacat tttcttaact gaaaaagcca ttcctgcttt     48480
     gttttcactt cttagccctt gccggaaaac ccagcttccc tgttttctta tcctcaagga     48540
     caagaactgt atcatacgtt ccaccacttt tctttttaaa tcccttaatc aaatcggttt     48600
     tccctgattt aaccagtttt tcggcctttg cctgggtgat tttcttacca gaaaactcac     48660
     tccagatttt aaattcacat ccggtacaga aataaccttt cggcctgata acaatatgtt     48720
     taccacagga agggcaggga gagtccaggc gttgaaactg ccctgctggc gcagcgggtt     48780
     caatcttcat ctcgcccagg tcaacatcag aaatcatgcc tgtcagttca ccgtacagat     48840
     cattaataaa ctgttcaacc gtcaggtcgc cattttctat ggcagcctgc ttttcagacc     48900
     ataatgctgt catatcagga ttaaccgcta taccaggcag ggcatcaata agcgcatatc     48960
     cggtatcagt aggaataagt ttcccttttt ccagcgtgat atagtttctt ttcttcaacg     49020
     tttccagaat cgctgcacgg gtagctggcg taccaatgcc gccatgttca tcttttttgt     49080
     ctttatcttt atccttcaac aattttttaa tcgttgggtc agtgacaaaa tccgcgacac     49140
     gaacaagcgc agcaagcaag gaggcttcag taaataatgg cggcggtgtc gttttcttct     49200
     tattaactac aacttctttt gtcgtcagtg tttctcctgt gcgaatttta cagagcagtt     49260
     caaaagcgga atcatcgtta tcttctgatt caccttcgtc tgtggtttcc gcaccaagaa     49320
     atgcctcaaa tccgctgtca gttgtttttc tggcacgagc atagaacgac tcatcaccac     49380
     actgaatggc aaccgatact tcctggtatg ctttttcagg catgaactga acaagatagt     49440
     gttgtgcgat cgcaaggtaa acattgcgct cgtcggtgct gagtgcgtta acatcaggca     49500
     cactggcagt cgggattatc gcagtatgcg cagtcacctt tgtactgtta aacgccttgc     49560
     ttttacgtgc ggaatcaata tccagcgact gaggaaatac tgatttcagg gcatcgataa     49620
     cctgtggcgc ttcgctgaat tgttcatcag aaagatatga gcaatcagag cggttataag     49680
     tgatcgcttt gtatttttcg cgtagttgtt gcgtaacatc cagcgttttt tgcgctgtca     49740
     ttttgaactt tttgttcatg tattgctgga gcctgaccag gttaaatggc aacggtgcag     49800
     cagttttttt atcatcagtt gctgctgctt caactgtagc cggttttcct gcaagggatg     49860
     ctgccgttcc gtctgcccac gccttatcaa gtaatttacg gtcggtcagc ggagcaaatt     49920
     cacctggttt ccagttcgcc ctgagaacat cagcaccacg ctgaaaaact ccggtcatgg     49980
     tgtagtaaaa actggattta tggttctggt tagcacgggt acgattcaca atcaggccaa     50040
     gaacgggtgt ctggacgcgc ccgacagaca gaacgccctg atatcctctg gcttttgcag     50100
     gaatggtgta agcacgcgtc atggagaagc catagacggc atcggcaact gaacgcgcca     50160
     gcgccttaag gtaaagccct ttgaaatcac gattatcttt aagatttgcc agtgcctttt     50220
     tcactgccgg aagcgtgttg tcgtttatca gaacgcgctt cacgggtttt gtgtttcctg     50280
     catattccaa gacttcatca acaagtagct gtccctcatc atcaggatcg ccagcgtgaa     50340
     caatttcagt cacgtctcca cgtctgataa gttcgagaat cgttttaacc tgttttgctg     50400
     cactttcaac aggctgatac ttcacgggat aaagacgtaa aggaagcgtt tcaaccttcc     50460
     aggctttgta ttcaggatta tagttttccg gcggttgtga ttcgataata tgaccaaaac     50520
     agttcgtcac aatggcgtta tcactttcaa accagccatc atggcgggta aaattgccac     50580
     caagtgcctt aacaatatca tttgctactg cgggtttttc tgcgataaaa agtctcattt     50640
     tgttatcctt tacattgaat taatcttttt gcacaacgga tagcacgttc ttctgatatt     50700
     acctgttgcc agttatcttc acttactgga tgtctgaatc tgcgttcaca gccattaaaa     50760
     gcaaaaatcc cctcacggtt aagtatattc gttgcgatat cctggtcttt aattctcaaa     50820
     aaggctgtta cggcaaaacc agaatacgaa gcaatttttg aaatgatgca ttcatcagct     50880
     tttattaacg ctgcaaaagg aactatcttc tgatgaccac acgaaattaa agggagggtg     50940
     tgaatatcat aataagctat tgaatgacaa tccatgcggg tatcatcaat agctgccagc     51000
     cagaatcctg tctgatcttt tatttttctg ctaatatcta aatctgaaac atcagggttt     51060
     aataaatatc caccataaca gacatggaag gggtgaacaa attcatcaat atcaggaagt     51120
     tcttttacct gattttcttt ccagtccttc aggacaccaa attcaagagc atccagcaaa     51180
     aactttcgtt ccatcccatc aaataatgca tattgcatgt gttaatcctc caggtaactt     51240
     aaatagtcag gttgcgcccc gttcttctta taaagttctt ccctttcttc tatatcttca     51300
     tctgcttcct gcacgctcag atcaagggtt cctttcaaaa aggcacgagc attttttatt     51360
     acatccactt atgcactacc agcagataag cacaataaaa tagctataat agatttggtt     51420
     actttcattt ctaacctcag tgattgtaac taatcatcac atttcgttgg cgcgaaatgt     51480
     gatacttgca gtaccctgat acccgttggc gcgggtatca ggttttaatt aacctctgac     51540
     acgaccaaac ttactcatga ttttcgatat agccgctgga tcagccgttg aacactgatt     51600
     cagaaatgct ttacgggcat caaaagtttt actccagcga atgcttcctt ttttcttttt     51660
     cagaatatta aaaaaatcct tttcagcact tctgcactca ctccctccac cttgcccgac     51720
     tgcttttcca tataagcaaa gtaccgaagc gcaagggtca gatgcatacg caggtgctgt     51780
     cagccaggac acagtaaaaa ttacgattag acttttgcat atctttttca tggtaacctc     51840
     tgaacattta ttcttgacag ataaatttca acatagtcac tattcaacca tctttttagt     51900
     ggctgatatt caataacacc tgttgcacca ttttttctta gccagcattt cgcagaccag     51960
     taactatcaa aagaagatgt ccttacaact attttttcag agtgggcaac ggcataaaaa     52020
     acagaatcat cgtaaagacg attttctggt ttaaaactag gtaacacatt actccatgag     52080
     gaatttatat tatctgattt aataacgttg gatgttggtg tccagttcat tatttgtgta     52140
     ttcataactt caggccgttt ttcccattca acctgtggcg gttcaggtgg agaggaacag     52200
     gctgtgagga aaagaatact gatcataagt atttttttca tagcaaaacc tcagactcca     52260
     gctctcctac ggagagcatt ttttcttttg acggatattt aagccctttc acaccaaata     52320
     ttttttccgt cttatttagt tccatcgtca atgatgccag tttgggactc accttcatta     52380
     atctgtccat aaaatacgga tcaaggtaat aaagtgcctt ttctgcttta acagggttct     52440
     ctcccttcag gatgataaac tcttctttaa agtccagcgt tcccagctcc tgtggaagca     52500
     ccagagctct tcgggcttca ctttctgatt cgccctgtga tgttgagcgt ccccggctct     52560
     tgcttgtgct ctttgaggta gtagtaatat acccaagttt ttctgatatc ttcgcggcat     52620
     cgtcctcttc gctgacagca tagataatac ggcatggatg aacactcatc agcgttttgg     52680
     ctccctcaat accatagatt tcatttagct gactgatatt ctgataaatt gtcagaagct     52740
     taagtttaaa acctgcaata taccctgacc cctttttaat aattggcata taaccaatcg     52800
     aagggaactc atcaagaaac atcagacagt catgtttcag ggtgggatca aaatcaggat     52860
     tttcacgcaa tgtcacttca acaacgaagt tgaaaaacag gttcagaaaa tcgtaagcca     52920
     gtgatatatc ttccgcatta acaccgacat aaacagtgat atcttcccgt cgcaactgac     52980
     ggagatcgaa atcattacca tcagtacatt tacgaacggt tgggagataa aacaggctca     53040
     ttttcttacg gaaagaacca tcaatgcttg aacgctgttc atcttccgtt tcgtgatatt     53100
     ccctgatttt ggtcagggca tcgcgcaaat gatacaacgc gttttcatca agcccgtttg     53160
     ttccctccag ttcttcccgc ttactgagta tcagttcccg gtcaatattg ctgtacaagt     53220
     cgacgacaga accgattgag aaaacgggtt taagcccgaa ctcattaagc cagggcggct     53280
     catagttaat aaagaaatga agcaacttag ccagtcctgt ccagtattga cccgcaagat     53340
     tattaaagta cgcttctgcc cctgtcatgc cataagacgg aaacagaatt tcaatcagtt     53400
     taagcagatc cttagcccca ctctccgctt ttaaatcaat atagaaaagg ggattaaact     53460
     ggtgtgtttt actgttgaaa gggtcgagca gataaacttt attacccagc agtatttcac     53520
     gcaccttact ggtgattttc cacaattcct gttttggatc taacgcaatc agagagtgtt     53580
     ttctgaccag aagattaggg ataccaatgg cggcaccttt acctgcgcgg gttcctgcgc     53640
     caagtgatac aaaatctggt gcggtatacc acaggtattt acctttatat accccgacga     53700
     gaatatcagt atcgttttct ttctcccatt tcagaagttt cgattttctt aaatcattat     53760
     cactggcaaa cttcgcgtca ccataaagag caacatctgt tttattcagt tgccagataa     53820
     taaaaacagg cacgatgaga gacgaaacca tacctgataa aagagagggg atagcggtta     53880
     acctgatatc tgtccgtata ttactctctg ttattattcg ccacaggagc atggaatcaa     53940
     aatttttcca tatataaagc ggcgtttttc cgttcaggaa gtaaacagca acagaaccag     54000
     tataatatgt cacgagacac ataaccagac cgataaaagc ccactggcct ttatctggga     54060
     gttttaaaga cataatcact ccttcagttt tctgaaatag tcatcaaaat gaagttgttt     54120
     gtagtaaata ccggaagcga accgaaaatc ttcatcatca aggtatttaa tactcatgat     54180
     aatatcaata ttactcagta cacgtcttaa aatgacattg aatggtagat tctgacattc     54240
     aggattcata taacatcgct ggacaatccc aagcacggca gattcaggac tactttcgtg     54300
     aacggtggtg atgtttcctg catggcctga actcgatgct ttcagaaaat cccatgcctc     54360
     agccccctga tttctgtcat cagaatcctg tccggattca tacgaaaaca ggaacgcaga     54420
     agactcgctg aggtaataac cttactctca ccctctgccg gatagtaaag ttttacatgg     54480
     tttttatgga atctgaattt tgcttcatca gtatcttcaa tagaaataca ccgcagatga     54540
     tgcggtatat attccagaca ggcatttgca aaggtagttt taccagaccc cgtccctcca     54600
     cagaaaacta tcgttttccc ctgactcagt gattcaggta taacccgttc aaaatattcg     54660
     gaagtgatta aagcagaaat attatcttcc ataatggaat caccacttaa accaccgacg     54720
     cgtgaataaa acccctgttt tataaatttg tcatgactga taaaaatacc tgacggctta     54780
     cggattgtta tagaaacagt atctttttct gttgccggtg ggatcacaac ctgaacacgt     54840
     tctccacccg gaagcgtggc ggaacgcagg ggatattcag gagtcacaga accaccgtca     54900
     tgaaaatcag ccagtgtgga tgcaaaagaa agacaatcac tgtaactcat cttttgttca     54960
     taccattgcc actttcccct gacctttata aatatttctc ctggtcggtt aacagcgatt     55020
     tccgtgacac catcaatctc attcagccag tgataaaaat aatcgttgac cacatcataa     55080
     atcagatgtc tgttttcgtt attcacatta accccctttc attttcagtt tataaatacc     55140
     tgaaaaatcc agatcctgac cgacaatcag agtaataatt tcgccctgat ttttataaag     55200
     cgttggcgga atattcacac tattagaaaa tgcttcgcgt gctatatcag caaaagcctg     55260
     gcgactgttt gccgtatagt cggtctggct gtccctgttg ttctgtgcaa taccactggc     55320
     ggcctgactt aaatccggta tcatcccgac catcattgca ccaagaaaac gttcactgaa     55380
     atgagtgtca atccaaccag aagcaccggc ttcgcctaac gcgccagccg cctgtgagtc     55440
     aaccagggga atatcaataa aaggcttact gcgagtacgt agcttgtaag ccataacaaa     55500
     cacacgccct tgtccatgat ttaaagaccc ggccttatac atcagttttg cggcggttcc     55560
     tctttcgata agttttacat taccgctggc gctgtatata tcgctgttga ccgtacattc     55620
     cagtttcccc gccaggtcag aaacaaaacg cctgtccagt gaacagggaa ttgatgtccc     55680
     ttccgggata aacaaatttg ggtcatatgg aagtttcgtt attttcgcca gtggcgcaga     55740
     ttctgtagcc tgtgcggttg cttttgcttc atccttttta tcgctttctg gctcactggc     55800
     cgcagtatgt gaaactgacg ttcccgctga actgctgctg tttcctgcct ggctgccatc     55860
     aagagaaaca tcaagtgcac ggctgaagct ctgctgttta ttttccggcg gttcagtctt     55920
     ttcagaagaa atgacttttt cttcctctgg tttctctgtt tttttctgtg cggtattaaa     55980
     aggatcgata tcttcgctca gtccggtctg acgtttagcc gctccggttg caagcggctg     56040
     acttgcgggt ttctcatccc ctgacgacac agaacggata atggacggga tataataaac     56100
     agaaacaccg gcagcaagca gaagaaaacc cacgacgagg ataatcatcc ctttacgtga     56160
     ctttttaagt ttttcaatac caagctgcaa tgctggcttg ccaggctctt cttccggagt     56220
     cttcccggcc tgttccagtt ctttctgtct gcgttcccgt agctgctgtt caatttcggt     56280
     tgcagtcggg attttatttt cctgttcagt cactggatca cctctttctt aacatccggg     56340
     gataccgtat ctccggctgg taaacgtact tttccgaagc ccaggttctc aatccccacc     56400
     acctgctcac caagacgtaa aacaaaacgc ttatcaaccg gtacgccaac agccgtaaaa     56460
     ctcccgctct gtttaatcac aggattggta agagtctcct gcataccgtt catcacaaag     56520
     acgctgggaa ttttctttaa cggactgaag ccgaaccagg tataacgacc atcgtcatat     56580
     gcataatcag ggctgatatc ctggctgcct tcagcaaccc gcttccagta ctgccagtta     56640
     cggggcgatt tcgcattttc cagggaacgg ttgattgcct gttcctccag gcgtctggca     56700
     agagcctctg tgcgtttctt ctcaatttcg gcctgttcct tccggcgttc ctgcggatac     56760
     tggtaattca ccacaaacgc aattttctcc ggctgtcgga acgttctggc gttcagctcc     56820
     atgctgtaat tacgtttcgt ggtgcgaaca aacagattca ttcgccagcg ttcaagctca     56880
     ttttccgggt caagagcaac actgacggat tcagaagagg tgttaccgtt tgcatccgta     56940
     ttatttttct gaacagtttg tttaacagga cgaacttcca ggtataccag gttatcttct     57000
     ttattaaccg cccatccctg cggaaaaccg gttctggcac tgataactgt ttcatcttca     57060
     tcaaatacca gtgtggtggt gtatccaacg gcactgttaa ttatggtggt attattgggg     57120
     ttataactga ctatctgatt gcgtgggtca aagcgactgc ctgaaggaag aacagcagca     57180
     ttacagacgt gcgccgccat cagaagcgcc ataattaacg ctcctttatt cattttcata     57240
     ttattaacct ctggcttctt tatcgcgaac gtagcttgtt acaacgaact taagaggatt     57300
     gttattacgt tcccctgaca ccatttcaac ctgcggttcg atacgataag tcaggcgaac     57360
     attccagaac tcctggcggg tttgtccggt agcaacatcc ctgatggtca gacgaaaacg     57420
     aatatacgca ccgatatctt tatcatccgt ccgtgacgaa ggtgaaatta tgacagatgg     57480
     attatcctga accattgccg ttttttctgc tttgttataa acaagttttg gtgcctgttc     57540
     actgttaaat aatgcgttat aatctgccgc gacattctcc gcgctgtaag ccattacata     57600
     atcataatca tgctggagac tgaaaaaatt ataaccttca cgatgtttta tatactgggt     57660
     gataaaatat cgggcaatgg cttcgttttc agaaagattt tcttttttaa cagaagtcag     57720
     acgttcagcc acacctgtaa ccttatcgat aaggtaggca tcaacaactg ttgttttcag     57780
     tggtaatgct gcatttaatg caagtaaaga cagaccacca attaacatgc ctccgatacc     57840
     accgaattta taaatacgat tcattctctc ctgtagtgca atgttttttt cttcaaacga     57900
     aactgatgag tcagtaacgt cttttttatt tttaaatccg ggaagtttaa attccatttt     57960
     gcattacctc agcagaatta acaggttcgc ttttcccgga aacgggcggt agtttatgtg     58020
     acgcctgaca accagcgaga caaagcgtca cgaaagccac aataagtagt ttcataatat     58080
     gaacacctgt ataacagatt aatatttaca gaagactcac tctgaacaaa gaaaatagat     58140
     cgcgacaagc ccgttaatta tgaaaagaac atttaaaatg gtatcaacac tcataattaa     58200
     atcaccctcc atacattttc tttgccctct caatagctgc ctgacgaagc tttttggcac     58260
     caatattaac gccctgtccg gccaggttag cggtcttacc cgttattccc ggagactgac     58320
     caaacccgcc ttcctgacga cgcagacctt tccatgcacc aataccggca tttctgccca     58380
     taccaagtgc gccacgcgcc atacgggatg caccgaaaac gccagcacca atccccatag     58440
     cggctgcgcc ctgcatggca ccttcaacac ccacacctgc aatctgtgaa gcataacttt     58500
     tcgcctgcca gataatccag gccatgaaaa tgccagcagc taatgaagtt actcccgttt     58560
     gaagaagatt gttttctgat gctgtagcaa tagacgtact taatgccatg tttaattgcc     58620
     atgtcccagc tcttagtgct aatgctgcaa atagaaaaac cagtaacgag ctaaaattaa     58680
     gctgtagcca gctattaaac atttgccgaa ggaaaccaaa catcaaacac atgataaata     58740
     ttggcgcagt gacagaaagt aatagtaatg ttaattcagc agatgcaaat actatagaac     58800
     aaagcaataa tgccaaaact ccaccaacat aagttaataa agcaccaatc ccaccggcaa     58860
     caggcacagt agatgtatct ttatcaaaaa taagagttgc aacttgtata accttcaccc     58920
     ataactgatc catccatacc cacggatctc cccctgccaa tgtatttttc aatccatcaa     58980
     tagcatctgt tgctgatgta agtattcccc ctgtattctt aacaaaaagc aatattatgt     59040
     aaaacctaca gatattccag ataaaatcag gtacaggtgt ctgttgtttc cttgctaata     59100
     cagtaaaggc ataccataaa acatacagag aaactccata tttaccaaga gtataagcca     59160
     catctgaata ttcacttaat tttccagata tactcttatt gagaatatta aatataactt     59220
     catgagttgt ctgaaaaaaa tcagaattaa acccaggaac acctcccgca tttgcgggag     59280
     aggttacatt acctgataaa tcagtaccat ccggtatacc agtgacaatc cccatacatc     59340
     accctcaatt tattggtaaa ccaaccgcct ttctccgttc aaaagacaaa tgtgctcgct     59400
     taacgttctt acaattatca gaatcgctac cagacttctg acactcttca aattttttgt     59460
     atgtctcctt cggatgtgca agccaccaat caaccgattt tgtttcttca aaacatccag     59520
     aaagactaaa aacagatata atgacaaggc cagcagtagc gatacttttc atttaatcat     59580
     cctcatatga tttcattgcc atataagctt ttctgtaaga aggaggcacg gcttcacgtt     59640
     gctgttttct gaaagaagcc tgagccatct tctctttata ttctgcaaga tctcgttgct     59700
     tatcgcgata catttgatac tgaaatttga gcttctcgaa cttcagttgt tcaagtgcaa     59760
     cagcgtttgt tgcatcctgc gtggccttcg tatccttcgc atttttgact tgatcaataa     59820
     ggtctttcat cgtctggttg tcctgacgaa gcttgctctc cagcttgtta ccgtattcca     59880
     cgcttgccag ttgagaaagg aacgtcgctt cacatccccg taccaggtca ccggaatatc     59940
     ccaggttatg acaggtatct gttaccctgt aatctgacaa taacgatttg gcctgttccg     60000
     ataacgcact ttcaggattt ttaatgtaat cgtcaataaa agcattcccc tgatcataaa     60060
     tctgcatcag ctccttactc actgactgtg cggactgcac cagtccctgc acatcacgga     60120
     tacccgtttt tgacagcagc tcctgtttgt acgcatttat ctgattttcg taatgtttca     60180
     ccgtttctgc ccattgctta aggcgttctg tccatcgtcc ggcttcaatc gcccattcag     60240
     ggttggcgtc gatggcaaca ggtatccctg cctgagcgcc ggaaataaca atcagtgaag     60300
     cgacgaatgc cgccataatt tgctttttca ttggtgattc ctcaaataag gttcgcctgt     60360
     tccagatagg tatcaagcca ctcttccggc ttcattcctt ctttccagat ttcatcgaac     60420
     agttctaact ggggttttga tgcactgaga accggtaagt aatacgctgc ttttcccagc     60480
     tccagtctgg caaaagcagc aaaatcatca ctttcacctt tcctctgtgg gttcttaaca     60540
     accaggaact ggcgggacag cggatcaata gctttaattt tgtcaaaata aagctccctg     60600
     acctgcaaac catcaacata ttcactacgt ttggctttcg ggtttgccag atagatatga     60660
     gtggcgcatt gctcacgaac cgctgccgca atgggtgatt taatcagttc atccggtgac     60720
     tgtgtggcta cgacaagcac catatcgagt ttacgtccgg ttttcagctt gttgtaaaca     60780
     aagtccctga acgcttcgtt attgatccat tgccagaact catccatgta gataagaagc     60840
     ctgcgaccat cggccaacat ggtgacccga tagatgagat agaatgaagc agcactggcc     60900
     agcaccttat tatccaggaa ctccgttcca tcaataccga aaacatccag gttatcgaca     60960
     tcaaacgtgt cttcccgatt gtcgaacacc cagccaaact cttccccctg cgtccacggc     61020
     ttaagacggg ctttaagtcc atgacgtttg gtttcagtat catccggctc ctggataaga     61080
     ggccgtagtt tactgatagg ataagagcga tctgaccgtt gcataagacg ttcaaccgca     61140
     tctgaaatca ggctgttctg gtaatcatcg agcggctcac tgttgagagt acaaagcagc     61200
     ctcaccaggt ccttcataaa agcgatatta cgttttgttg gcggcagtgc ggcgggattc     61260
     cagcctgtcg gctctccctc cttcacccgg taataagatc cccccattgc ccgtataccg     61320
     acttcacctg cccggtcttt atcgaaaaaa accgtggtca gttttttcag ttttctgttt     61380
     gcagggaatg attccggcgt accgaactgc tgggcggcaa atgcttttgt catcagtaat     61440
     acggttttac ccacgttaga cgtaccgaga atttcggtat tccccagcgt cgggttctta     61500
     ccgaagaaat tctgatgttc agtcgtcata tggtaattca gatggtagat atcattacct     61560
     gacccccgaa gagtaatcag tttttccccc caggtatttc ctttttcttt tcctgaaaag     61620
     aaattatgaa aactttccat ttcggcaaaa ttaagactac tgagggtact cagacgaggg     61680
     cgaagcgtat aatttcctgg tagctgagca aaataagctg cgccaagact cagtgttgaa     61740
     taagtgacaa tcagccccaa atcttccaga gtggaagtca cgatattggt gtctttcacc     61800
     agacgctccg gtgaatccgc aaagacaacc agggtctgat gcgatttccc gaaagaaata     61860
     tatccactgg aaaccatatc cagtccgact ttcagatctg ccagcaaaga tttggcagca     61920
     tcatctgtca tttccagctt atcgatctga tcatccagcg ccttaatcgc tgactgctta     61980
     tccatcgcag taaaggacga tgtcacgaca tactcaacgg ggagatacat cagagcatcc     62040
     agaataccgg catccgtctc ctgaaaataa tccttaatct ctatgcaacg aaaataccgg     62100
     gcatggtctg acgcggtaat ttgtccggca tcattaccaa agaacaggtc ttttcctccc     62160
     agatatgtat aaaacggact actgctaacc ctgacctttt gccatcgacc agaaagtaga     62220
     tactggaaca gagataactg atctgaataa acaaccccat gatcttcata aagcccaaga     62280
     cgtcgggaat gaaaacggga cagataggta ttcaacctgt cgcaaatttc attcatttca     62340
     ttaacaggct ctttaaagat atctttttgt tttttactgc gtgaaaagaa atgtgttact     62400
     ttatcttccg tagtaaaagg tttaaaacaa atcgtcagaa ataatttatt ctcgaaaaat     62460
     tcagactgag ggaatgactc gtaataatca ttcattactc tgttcacaaa aggaatttta     62520
     ctgttaaata ctggtctgac gtccttttta cacctgatac gatgaggata aagcgtaaca     62580
     gatttccctt caaagctacg tataagcgta ttaagctgat ctgtcagaat tgacaaatct     62640
     tcagaatcaa cacactcaaa gtaagcaccg tctatctgcc aggttgccag caaatcccgg     62700
     ttttttgtaa cgataatatt atcagtgata tgtgaagagt acggaattaa ctcttcaaca     62760
     gaagactggt ctttcagctt cataaagtta tccacttttg aaatatcaac ttcgtcgtac     62820
     tggctccccg cataatggac tgcgctgaat cgcttgtttg ataaaggatg ccctttgaca     62880
     agagttctca gatacagaag gtcaaaaaag cgttcatcaa actgtgttac acgcctgatg     62940
     gcataccagc caggaagaat aagggcatac atagcctcat gaatccagac accaagcaga     63000
     acacaaataa tgcacattcc aagaaagggg tagagcggaa cgcccagccc ccttattaaa     63060
     gcagggcgcg taagaccttt aaaaagagta ctcatagtgc gcccatcctt taattacgca     63120
     agccagtcag gaatatatgg tgcaacaata aagatgataa ttccgataac aagtgggact     63180
     atccatgagg tatgttgacg agaaaatatc gcaatatatc caataacaag agcaataatt     63240
     gtaattgcag gtttacgaat atccgttaaa aaatcaatta ttttctgtaa aaaaccagtt     63300
     gtcttcgtag acacatcatc cgcaaaagca ggttctgcaa cacaaagcat caacgcagcc     63360
     ataaatagag aaagcgttaa ataacgttta ttcagattta atttcaacat cttttgtttc     63420
     cttttcattt gatacagtgc cacgcatggc gtattgagga tatataatga tttcttcagg     63480
     tgtgatagtc gtcttattct cctttttaat catttccttt acagagggaa caataaaaat     63540
     ttttttatta tcaggagggc taaatcctat acgttgtaca taacttgtat tattaaattc     63600
     aggttctggc tttactcctg tttctggatt gccggaataa tagcaactca gaccacgcac     63660
     taagtcgcca cctcgtttat aacagtcaac cagtattttt tctgatacct taagattttc     63720
     gcatggatca aacattttct ctgctgttgt gccgaacttt gcaaaattgg tacttgttat     63780
     ttgcataagt cctacagagt aacgatgatt ccgtaattca atgtttttaa cgatcttaag     63840
     tgctgcctcc tttgattctg gaaagtaaga tactacgcct ttatcaccag gtttgcgttt     63900
     aacctttggt attatttccg caatcgcata tgggttaaaa cctgattcaa ccctggcgac     63960
     ttcgtgcgtt gtgtcaggat gaacgctggc agcgcattgc atggcaagcg caagaaaagt     64020
     agaagtagat aacataaata ttccacattc agaacaccgg ggcgctatca ctcgtcagga     64080
     atatcagccc catgaataag ttctttcatc gcctgagatt tgtatttttt aataagatac     64140
     tgaacaaaac cagaatcaga gatacgtctc cccctcttga aacttatttc aattgcaatt     64200
     ttttcaactt caacacgaac ttctgtagga aggtagagta cattgcgttg cggtttccgc     64260
     tttcctttta tagctgtcat tttttaacct gtcgtatttt ctgttacaca catagtcggc     64320
     aaagacttgt ccacgctttg aagcgtctgc aaggagaagt atttttgcca gacaggagtt     64380
     attcatcagg cttaaattca tcgaaaaaat cttctcctgc tcttttactt catttatgac     64440
     actcagagga acttcagcag gatattcacc aaaactgacc agtccataaa catttttcat     64500
     ccgggtaaag caggatggat gtacaacctc aaaatccaga agaacgaata cataaccggg     64560
     aaacattgga atgatttgtc ccctgtatgc actacagtca cgcctcttat agaaagtgcg     64620
     tataactgga ttgtagtaag cgataccgct ccgggataac tgcaacagaa ccgactgatg     64680
     aaaatgcgga gaacactgaa gcaggtaaaa ctgtttctgt cctttcatac tcaatccccg     64740
     atatacagat gtgacaaaac acaagccaac cgtggttgct tgtgagaaat cacgccccta     64800
     tgaagagaga ctttttacta ttgcgcgaag tttatactac aagtagctta tgctaagttc     64860
     aacacataaa acagatcttt ctatattgat aaatcaattt tactttcatt tattccacat     64920
     aaacaataaa acacagaata ttcatctttt gcagatctgt tttttagatc gatagatcga     64980
     atgatagcta aaacgcagaa tttcgatctg tttttaaggt gaaaagatga gcaagcgaac     65040
     taaaataaat atttttctag cataatcaat atattaaatc ttataagccc caaagcccca     65100
     aaatttaatc cctgttttca gcttctgttc tgactgtaac gtggatgctt tctgctgcgt     65160
     aaactgcgcc attcgctgtt gttgcttcaa cagcatatca gggctgttca gtaccagctc     65220
     tttgctggct gaaggtgttc tgtctacgcc cttaaccccc agattttcta actgccactc     65280
     atttctgtga accgttttcc agccatgctg aacaccgttt ttatcgagcg ccgggatttt     65340
     tacttctttc tgaccaagtt tcttcagtct gacaagatca cctgctttaa cgctttcccg     65400
     cgaacataag tccccaaaat cagcccccca gtatgttttc tcaaccccct tgttaagagt     65460
     ctttagcttt ataaaatgtt gcttagactt tgttttatcg ttctgataat ggtcgtagcc     65520
     aacatcaaca acctcataaa cacctttctg tctttttggt gctgtattat gtgcatcttt     65580
     aacagactga ttaagtccat gctgttgctt atgggtcgct ttaacgtcat aaccttttaa     65640
     cttcaactct tcacaaaaac ctgtacgaat ttcccgtaaa tcttttttcc tgatatcagc     65700
     gcgtttaccg tcattatctc ggatacgaaa aacaacatga acgtgaggat gttctttctt     65760
     gtcacagtgg tatccaagaa caaaacggtg attaggatat tttttctgca tcgttttcct     65820
     gacagactcc aacaaatctt caggctttac tttcgctaaa actggaggcg agaagacaat     65880
     attctgtgtg atttttttat tttctttacc tttatcattc atcacatgct gaggatcatt     65940
     agcacgatct atcatatgct ctttagcctc cagaatttcg gcacccgtcc atacccgacc     66000
     gctttcactc atcactggta gctctgactc acggctcata taatcaatac tgttccgaat     66060
     cccctgacga gtaacagcac ctccagatat tttgacaaca acctccttac tggcaccctt     66120
     gcggttgata cgttcctgaa cattgcggct atagttcttt ccaccatttt tgactttatg     66180
     agcgaaagct gacttacgac cattttctga tgactttcgt ttaacacgat attctttatc     66240
     aacgtaaacg cccataatca catctccact ttatttgaaa cagttctccc tttacataac     66300
     ataatgtaat tctcaaactg attcttaaga ttaaaaattt ctattgtaag acgctccgca     66360
     tcctgataga aaccatcttt atcaagaacc ctggtctgat cattaacaat gatataatgg     66420
     aaattacgac cgatcttatc aattgaatta cggcaacgat tcatcatcag cagttcctgg     66480
     tcaaagaaat ccagttcatt ttcaagtgtc gtctgtatgc ggtaacgaca ttctcgtgat     66540
     aacgtccatc cgtgacgatt agcagctctt tcaatatcag ccctttgttt acctgttaag     66600
     tacatcgttg ttttgataaa atcattatta tcaaaaaacg tattcatatc cttactgcct     66660
     gctttacttt ttaataaagc atttgctaaa agtttcatgc cttcagctac tgttaaagct     66720
     ggttcatctg gataaagagt tttaaggcaa tccagcaaat catcatgctg attttcatca     66780
     attctgaatt gaactttttt cataaaattc tccgacaaga accgactgta ggtcaccggg     66840
     caaacgttgc ggaatggcgc aagagacgtc attttgcggc gtttgcccta tcctgcatcg     66900
     cagtgaatct ggcaccgctc ataaattgtg cttgagcatc aacaaaaatg caaaaaggct     66960
     gatgttgtca tggctgaaca tacgtacgtc tgcgaccgga aacccgatca atgcggtaag     67020
     gacagtgccg tcaggttcgc tccgcgaacg gtctggcagg aagcgcaagc gcagtcccgc     67080
     gcaatatatc agaaagcacc tcccgaaata cgggagggct tcggctattc agctaaggtt     67140
     gctctgttca ggttgctgag tgtagccttc catgccctga cgggcatcaa aaagccagcg     67200
     ccggaagtta ctcattcttt caaggttagc tttgcttggt tttttgccac gattaccact     67260
     taatatccgc catactcgta ttcctgcttt attagtccag tgcagaacaa tttctccttt     67320
     gctgttaaaa gcaagagaaa agcgtacagc gccttgccgc aattctccac tgacaaagga     67380
     cacaaaatca tgttttgtca taaagcctcc ggtttattta tctgttctct tttgtgtctt     67440
     tttttccagt gcttttctga gtaatgccat atactcagga aagacatgga atggcatcaa     67500
     agggaaaacc ggacgcccac ccttttcaac gtcatttatt gctgataata tgcgttccga     67560
     cattttattc ctcgcaatag aatcaggtgt cacggtatca ggttgcccca caacctgata     67620
     ccatctttat ctttacttta ttaacttctc aattgcttct ttttttgctt tctcctgttc     67680
     tgatggtggg tatgcaaagt cataccagtt atcaatacaa cgaataactc tttctttaga     67740
     taacccacat tgcttaaacc aaaattttat atttcggttt aatgatgctt ttgcgctaaa     67800
     ctctctttcc attttcagac ctttactaaa agggggaata tcccccttga ttaattagta     67860
     gtaagaagaa aatcgatgtt tttcttccgg tagagtttta tacgcagttt caaaatcttc     67920
     gattttgatt gccagctcat caccaaaatc ttttatctgg cgcttaaaac attcaccagt     67980
     aaaatcattt aaaacgggag tcttaaagcc gaccattgaa tctgtatatt ctgaattggc     68040
     gcgaatctcg cgaacggtga cgtttttttt accgtgaaca gaaagaacct ggtagaaggt     68100
     tacattggtt tgctcatagc cccaggatga tacaaagaca tcaccaacag agacagtatc     68160
     atttttaaaa gttaatactt tcatttttag ctcccgccca gcttgggctc tggatgaaag     68220
     agaacctgtt tccctttctt gtgttttatt atacctgcat ttgcaggtat aacaagttat     68280
     ttttttacca gcctgtaaga cggatgcata tttgctaata gcaataaata ctgatattca     68340
     ccaacagata aagaacgact ggccttacct gcactttctt tcatctgcca ggaattcagt     68400
     tgataaccaa aaatatcagc agcttcttta agagtaagac ctgccgcaac ccgtgcattc     68460
     tttacttctt caggtgtagg tttattctgc attttcatcc ccttttgtca gacaatcaca     68520
     caaaatccca ttatccagaa gcatcaatga tgccaggttg agtttttcgt ccattatcaa     68580
     ttttcttact gttttcctgc ttttagtttt atcaatcgtc ttaacatatt ttaagacgtg     68640
     aaaaaccgca tccccatctt catccatcgt tctgattaca taagagtaat tacctctgtt     68700
     tttcttaatt atcttatctt tatccatatt attcctcata actaaaaaag gggcttaatg     68760
     ccccttttta tctataacac ggtatgtaac cctgtttcct gtgtaaataa acacgctaac     68820
     tgatcacaat agatattatc gaatcttgaa atatctttaa cttcagcacc acgtacacga     68880
     gaaaatttca cctggtacgt atcagtaaaa tccagtttaa tttttactaa gttgatgcct     68940
     ttcattgcaa aatttgacgg taaacggaaa gttaccccac actcaccgtt ttcatcaaag     69000
     taagaaaaac ttttagcacc agtcataaca ataaaacgat taccaccaag ttgacgtaaa     69060
     atctctgtgg ctacagattt agcgtagttt tgcattttta acctcccgcc cactttgggc     69120
     tctggatgaa agagaacctg tttccctttc ttgtgtttca ctatacctgc atttgcaggt     69180
     attgcaaatt tttaatgctc tcgttcagac tgtaaacagt caatcatttg atgattaatc     69240
     ttagcgcaaa tctgcgatct gatagacttc gctgctttcc cttcttccaa cggcaataac     69300
     gagtaaaacg actttctcat caatgacttg atatacaagt ctgtagccag atgcacgaag     69360
     tttgatttta tagcgatcag catgaccatg taaccgggct gcgggtacgc gtggattttc     69420
     cagccgttct gccagtttct ttttgaattg ttcacggatg gtgtggccga gtttctgcca     69480
     ttccttcagt gctctgcggt caaaagccag ttcataggtc atccaggtta accttcacaa     69540
     tttccgggtt tttcatgcgc tcatcagcaa cagcgtttaa ctcagcatct tcagcgagtt     69600
     cccgatagta ggcgtaaagt tttggtggaa cgcaatagaa cgccggttcg tttcggttca     69660
     ggatcgcaac agcgtcccct tcaccttcag ctacggttcc cataggattt tttttcaggt     69720
     cagtaatact ggccgctgtg gttgtcagaa tttgatagct cataagccct ccgcttgtct     69780
     cattgacata atagcatctt taaaagcact cttaaaagtg cttatgttga gaaaaacatc     69840
     agaacaggtg agatatagct ctttccgaca tcgtcttaaa acgctctgta acacgttctg     69900
     agcgtttttt cccgtttcgt tgtagtcagc tacggtttca cggtttttaa cgctgctcaa     69960
     cgctttttag cggccttgtt gctgtgatct gttgccatga tccggataga agttcaattt     70020
     tgatcaaaat ttcctcaagg caacgactgt tttgtaaata ccctctaaaa cgcgctgtat     70080
     cgcattctga gtgatttttt cgatttcgca tggtttttaa ctatggttgt atcgaacgaa     70140
     gcggcagaaa gcgattcagg gcttctcagt gaaagatcca aaaaggatca atcaacggat     70200
     cgtatgatct gaactcttct ggttttgaga aaggagacac cgctcgccgc agccgaacga     70260
     ccgagcgtag cgagttagtg agcgaggaag cggaatagca cagggattac atcaggcact     70320
     tacgcacagt ggttaaaaag cgagcatgtt gtttttatgt gtggttgtcc tggttcagcg     70380
     tgatctgtcc tccgggttta cgcaaagtta tccacaggca ctgtgaattt tttgttttga     70440
     gcagagttat ccacagattt tttgtgtttt tttgcttatt aaacttcttg tttttaagat     70500
     cttaaatgta gatcggtaga tctactttaa gatctttaac ttattttaac ttattctgca     70560
     aacattgtgc caagtttttt atcaataatt tcattaagat aggtgttgtt ttttgtcgcc     70620
     tcaaaatgaa aggtggatgg gtacgcactg taattttcat gaaaggtgga tggctgcgca     70680
     ctgaaaggtg gatgggtacg cactgaaagg tggatgggta cgcatttttc tgtttttatt     70740
     cagatattcg tatctttgta tcttcatttc tttagttctt tatagtgctc taatttaacg     70800
     tatgacgtta aaaggtggat gcctgcgcat ttctatcata ttgaatataa atgataaaaa     70860
     ttctttcatg tgatccgagt tttggtggaa atctataagg tggataaacc actttacaca     70920
     tttccgcttt tgtggttatg atttcaccat cagaacttaa aaaacacagg taatgtatga     70980
     acttactgag cgttacaaag aaaacaaaaa ttcgccacag aaatgaaatt aacagcacat     71040
     tctcatcgtt gcctttgtct gccagaagaa ttttgtttat ggctatggcg cagattgatt     71100
     cacgtgaaga gttatctgag ggagcaacct ttcgtattac ggctcgggaa tatgcattta     71160
     tcgctgatat tgatgtaaca ggtgcttacc ggcagttaaa agagggggca gaagaacttc     71220
     aggccagtgt tattcgcatt ccgcgaaatc aacttctcac agctcagggc aatcaaagct     71280
     ctggacatac gaagaagaga ggtaaattac cttctgatgc agtcaggctt atgaacttga     71340
     ctgcgttttg tgattatgtt gaaagtgaag gatatattga tattgctttt tcacatgtca     71400
     ttgagccata tatcacgatg ttaaaggatt cttacactac tcaggttttg atatcgtctg     71460
     taagactcgc tgatcaaaat tcaaatatgc tttatcagtt tatcaggaaa caatacagca     71520
     gtggtaaaaa gacatttttc gacattgaag tagatgtatt aaaggatgaa cttgaattat     71580
     tcagaataga taatggcgaa aaagtttacc tttatcagaa ttttaaggac tttaataaag     71640
     tttttctgca aaaaaacatt gaaaaaataa atcaatatac agagattaat catctcgaag     71700
     ttagaatcgt tgagagagtc gcaagaagag catccaagct aaggttttct tataaaatag     71760
     ataaagaaag tgaaggccta gatatcagaa taccatacgg tttcagagga taattgcata     71820
     aacttcgttt tgagatcgaa atgaggtaac tcatggctaa aatctatcaa ttccctcagg     71880
     gggaagaacg tgctaaattc aggaaagaaa tcgccaggga gcgtaagaaa tgttttgcag     71940
     tgaaaacagg gtgcactttt gttaagtggc ttgactgggg atggttttat cttcgtcttc     72000
     ttgccgcgag tgttttacat tttatctttg tttttgtgtt agccattctt ggtgcgttta     72060
     aatgggctgt gttctggctg ggtggtattt tgtgtgtcat cacctggtat catctcaatc     72120
     agcagttatg gacgccacaa aatctgacta taccggtgat tacggcaacc tggattttgg     72180
     gactgctggc tgagcctctg atggagctgc tcaacaaaac tatgccctgg cacaagttac     72240
     ttgttcccga acctgcggac gaaagcaccg agaacagtag cgagataagc cagcaatgat     72300
     gccactcagc tgttatgcca gtccctgcct tttcactgcg atgcaggata gggtaaacgc     72360
     cgcaaaatga cgtctctgac gccattccgc aacgtttgcc cggtgaccta cagtcggttc     72420
     ttattggaga tgtttatgaa atatctggtc aaagagttta ttaacgagaa atattctaag     72480
     gctgttaata ttttaaagga taatcttaaa gaacactatc atgtttttta tggtgtgaga     72540
     ttaagtgaga ttctttttcc tactagtgaa tatggcacag atgctttctt taaagaattt     72600
     gaattaatta acagtgtaat acttccatta gtaatatttg attttataga ccgaaagccg     72660
     atcatggtta tcggctttga ggaagtgcct gggattgatt cacttattga ctctggtatg     72720
     gaagttgttt tgttagatgg tttaagcgat ctgctactgg ttgaaaaatt gatgccattg     72780
     tttgattaaa tccctggaaa tacatgttac ccattcgtat taatgcattt tacacgaacg     72840
     atgtttattc catttacctg ttttcataac ttctccccta cggagaacta accaaactga     72900
     tctgcatcta tgatcttaat tatataaaat ttggggggcg tgattctaat gtcctcattg     72960
     tattggtaac aatctttttt ccatcgtttt tattttgata tttaatattg ctctcaattg     73020
     atttttaccg tttcttcatt caatgatatg agcgtcaaat tgattagata atggtgattt     73080
     ttaccctcta tcatcaaagc ttgtgaagct attaatatac aaaaaatttt cagtcgtttt     73140
     tctattgtct cacatatttt taagagagaa tctgtatgct gttcgccatt cacttatgta     73200
     ggccacttcg tactaatcgc ttcaatctaa agaacttcac ttttccttag cgtttgttat     73260
     cgcagaaatt cccacggacc ccattttgtc cgaactccta ctgatagatt aaatcctgaa     73320
     tcatctaagt tttgcagaat caagtaacta ttggctgttg tacatagcca gggctgcttt     73380
     gagaacagtt gttttgcgtc ggcctgtctg ttcgcttcgg cttccaatta ttcgttctct     73440
     ttgagccagt tatctacaag ctggttcacc acgtcagtga ttgatgtacc tttcctggcg     73500
     catgcagcct taaaccgggt gtgcttttct tcatcaaaat taacgttaac acgtttgatt     73560
     tttccagatg atactggtgc tgttactact cgttccagat ctctgttttc accaaaggtc     73620
     atttttttta ctgacgtatg cgctttttca agtgacattc aggctactcc ggtttttata     73680
     cttatttgat tatatgagta aatgtgtaat tactcaaaca ttctaactat ctcttttgta     73740
     aggatttcta tttcaccttt tgcagcacca tcactggatt caaacacgct gtcgccatca     73800
     agaattgatt tcacgtaaac ctgacgttgt gtaatagctg tacgaaatgc tttaacaccg     73860
     gtgtctttga tactttcttt aagcacattc aacatggttg ccatttctat cttacgggtg     73920
     atcagaaagc gggcttcaac tttgcggctg taagcctgtg cttccagaac agtaacgacg     73980
     cttcctgctg cggagaaatc cagagggctg ggggtgacag ggataattac cagatcgctt     74040
     accatgacgg ctgcggaggt gattactgag agtgaacctg ccccgtccac aatagcaaag     74100
     tcatagtccg ccagatcttt tcggattcca tagacgtctt tttcagatgc tgctgtaaat     74160
     acgtcaaatg ctgccttgcc cgctttgctc cagttcgtca ggctcatttg tggatctgta     74220
     tctaccacag caatgttgta tccgctcctg ctcaacgcag tggctatgtt gattacggca     74280
     gttgttttac ctgaaccccc tttcggattc agaaatgaga tcaccttcat actcaaatcc     74340
     tcaattgcgt gtctactcaa ttactcctgt gagtttttga gtttatcata ctctttgtat     74400
     gagtaaaggt taatatgagt ttatgtgtat atgagttaag gggtgtctac tcatttgagc     74460
     tgtcttgtgt atatgagtgt ttgagtttat gagtgtgtag tgacaaggtc acatctactc     74520
     attatttgtt ttttttggtt cttttagagt g                                    74551
//

If you have problems or comments...

PBIL Back to PBIL home page