(data stored in ACNUC7421 zone)

EMBL: CP001145

ID   CP001145; SV 1; circular; genomic DNA; STD; PRO; 1424912 BP.
XX
AC   CP001145;
XX
PR   Project:PRJNA30729;
XX
DT   28-SEP-2008 (Rel. 97, Created)
DT   22-MAY-2014 (Rel. 120, Last updated, Version 4)
XX
DE   Coprothermobacter proteolyticus DSM 5265, complete genome.
XX
KW   .
XX
OS   Coprothermobacter proteolyticus DSM 5265
OC   Bacteria; Coprothermobacterota; Coprothermobacteria; Coprothermobacterales;
OC   Coprothermobacteraceae; Coprothermobacter.
XX
RN   [1]
RC   Publication Status: Online-Only
RP   1-1424912
RX   PUBMED; 24831154.
RA   Alexiev A., Coil D.A., Badger J.H., Enticknap J., Ward N., Robb F.T.,
RA   Eisen J.A.;
RT   "Complete Genome Sequence of Coprothermobacter proteolyticus DSM 5265";
RL   Genome Announc 2(3):e00470-14(2014).
XX
RN   [2]
RP   1-1424912
RA   Dodson R.J., Durkin A.S., Wu M., Eisen J., Sutton G.;
RT   ;
RL   Submitted (29-AUG-2008) to the INSDC.
RL   The J. Craig Venter Institute, Rockville, MD, USA
XX
DR   MD5; 31e2b7c658e82b99ae7f905ccb82d7fc.
DR   BioSample; SAMN02603927.
DR   CABRI; DSM 5265.
DR   EnsemblGenomes-Gn; COPRO5265_1600.
DR   EnsemblGenomes-Gn; COPRO5265_1601.
DR   EnsemblGenomes-Gn; COPRO5265_1603.
DR   EnsemblGenomes-Gn; COPRO5265_1604.
DR   EnsemblGenomes-Gn; COPRO5265_1605.
DR   EnsemblGenomes-Gn; COPRO5265_1606.
DR   EnsemblGenomes-Gn; COPRO5265_1607.
DR   EnsemblGenomes-Gn; COPRO5265_1608.
DR   EnsemblGenomes-Gn; COPRO5265_1609.
DR   EnsemblGenomes-Gn; COPRO5265_1610.
DR   EnsemblGenomes-Gn; COPRO5265_1611.
DR   EnsemblGenomes-Gn; COPRO5265_1612.
DR   EnsemblGenomes-Gn; COPRO5265_1613.
DR   EnsemblGenomes-Gn; COPRO5265_1614.
DR   EnsemblGenomes-Gn; COPRO5265_1615.
DR   EnsemblGenomes-Gn; COPRO5265_1616.
DR   EnsemblGenomes-Gn; COPRO5265_1617.
DR   EnsemblGenomes-Gn; COPRO5265_1618.
DR   EnsemblGenomes-Gn; COPRO5265_1619.
DR   EnsemblGenomes-Gn; COPRO5265_1620.
DR   EnsemblGenomes-Gn; COPRO5265_1621.
DR   EnsemblGenomes-Gn; COPRO5265_1622.
DR   EnsemblGenomes-Gn; COPRO5265_1623.
DR   EnsemblGenomes-Gn; COPRO5265_1624.
DR   EnsemblGenomes-Gn; COPRO5265_1625.
DR   EnsemblGenomes-Gn; COPRO5265_1626.
DR   EnsemblGenomes-Gn; COPRO5265_1627.
DR   EnsemblGenomes-Gn; COPRO5265_1628.
DR   EnsemblGenomes-Gn; COPRO5265_1629.
DR   EnsemblGenomes-Gn; COPRO5265_1630.
DR   EnsemblGenomes-Gn; COPRO5265_1631.
DR   EnsemblGenomes-Gn; COPRO5265_1632.
DR   EnsemblGenomes-Gn; COPRO5265_1633.
DR   EnsemblGenomes-Gn; COPRO5265_1634.
DR   EnsemblGenomes-Gn; COPRO5265_1635.
DR   EnsemblGenomes-Gn; COPRO5265_1636.
DR   EnsemblGenomes-Gn; COPRO5265_1637.
DR   EnsemblGenomes-Gn; COPRO5265_1638.
DR   EnsemblGenomes-Gn; COPRO5265_1639.
DR   EnsemblGenomes-Gn; COPRO5265_1640.
DR   EnsemblGenomes-Gn; COPRO5265_1641.
DR   EnsemblGenomes-Gn; COPRO5265_1642.
DR   EnsemblGenomes-Gn; COPRO5265_1644.
DR   EnsemblGenomes-Gn; COPRO5265_1645.
DR   EnsemblGenomes-Gn; COPRO5265_1646.
DR   EnsemblGenomes-Gn; COPRO5265_1647.
DR   EnsemblGenomes-Gn; COPRO5265_1648.
DR   EnsemblGenomes-Gn; COPRO5265_1649.
DR   EnsemblGenomes-Gn; COPRO5265_1650.
DR   EnsemblGenomes-Gn; COPRO5265_1651.
DR   EnsemblGenomes-Gn; COPRO5265_1652.
DR   EnsemblGenomes-Gn; COPRO5265_1653.
DR   EnsemblGenomes-Gn; COPRO5265_1654.
DR   EnsemblGenomes-Gn; COPRO5265_1655.
DR   EnsemblGenomes-Gn; COPRO5265_1657.
DR   EnsemblGenomes-Gn; COPRO5265_1658.
DR   EnsemblGenomes-Gn; COPRO5265_1659.
DR   EnsemblGenomes-Gn; COPRO5265_1660.
DR   EnsemblGenomes-Gn; EBG00001055578.
DR   EnsemblGenomes-Gn; EBG00001055579.
DR   EnsemblGenomes-Gn; EBG00001055580.
DR   EnsemblGenomes-Gn; EBG00001055581.
DR   EnsemblGenomes-Gn; EBG00001055582.
DR   EnsemblGenomes-Gn; EBG00001055583.
DR   EnsemblGenomes-Gn; EBG00001055584.
DR   EnsemblGenomes-Gn; EBG00001055585.
DR   EnsemblGenomes-Gn; EBG00001055586.
DR   EnsemblGenomes-Gn; EBG00001055587.
DR   EnsemblGenomes-Gn; EBG00001055588.
DR   EnsemblGenomes-Gn; EBG00001055589.
DR   EnsemblGenomes-Gn; EBG00001055590.
DR   EnsemblGenomes-Gn; EBG00001055591.
DR   EnsemblGenomes-Gn; EBG00001055592.
DR   EnsemblGenomes-Gn; EBG00001055593.
DR   EnsemblGenomes-Gn; EBG00001055594.
DR   EnsemblGenomes-Gn; EBG00001055595.
DR   EnsemblGenomes-Gn; EBG00001055596.
DR   EnsemblGenomes-Gn; EBG00001055597.
DR   EnsemblGenomes-Gn; EBG00001055598.
DR   EnsemblGenomes-Gn; EBG00001055599.
DR   EnsemblGenomes-Gn; EBG00001055600.
DR   EnsemblGenomes-Gn; EBG00001055601.
DR   EnsemblGenomes-Gn; EBG00001055602.
DR   EnsemblGenomes-Gn; EBG00001055603.
DR   EnsemblGenomes-Gn; EBG00001055604.
DR   EnsemblGenomes-Gn; EBG00001055605.
DR   EnsemblGenomes-Gn; EBG00001055606.
DR   EnsemblGenomes-Gn; EBG00001055607.
DR   EnsemblGenomes-Gn; EBG00001055608.
DR   EnsemblGenomes-Gn; EBG00001055609.
DR   EnsemblGenomes-Gn; EBG00001055610.
DR   EnsemblGenomes-Gn; EBG00001055611.
DR   EnsemblGenomes-Gn; EBG00001055612.
DR   EnsemblGenomes-Gn; EBG00001055613.
DR   EnsemblGenomes-Gn; EBG00001055614.
DR   EnsemblGenomes-Gn; EBG00001055615.
DR   EnsemblGenomes-Gn; EBG00001055616.
DR   EnsemblGenomes-Gn; EBG00001055617.
DR   EnsemblGenomes-Gn; EBG00001055618.
DR   EnsemblGenomes-Gn; EBG00001055619.
DR   EnsemblGenomes-Gn; EBG00001055620.
DR   EnsemblGenomes-Gn; EBG00001055621.
DR   EnsemblGenomes-Gn; EBG00001055622.
DR   EnsemblGenomes-Gn; EBG00001055623.
DR   EnsemblGenomes-Gn; EBG00001055624.
DR   EnsemblGenomes-Gn; EBG00001055625.
DR   EnsemblGenomes-Gn; EBG00001055626.
DR   EnsemblGenomes-Gn; EBG00001055627.
DR   EnsemblGenomes-Gn; EBG00001055628.
DR   EnsemblGenomes-Gn; EBG00001055629.
DR   EnsemblGenomes-Gn; EBG00001055630.
DR   EnsemblGenomes-Gn; EBG00001055632.
DR   EnsemblGenomes-Gn; EBG00001055633.
DR   EnsemblGenomes-Gn; EBG00001055634.
DR   EnsemblGenomes-Gn; EBG00001055635.
DR   EnsemblGenomes-Gn; EBG00001055636.
DR   EnsemblGenomes-Gn; EBG00001055637.
DR   EnsemblGenomes-Gn; EBG00001055638.
DR   EnsemblGenomes-Gn; EBG00001055639.
DR   EnsemblGenomes-Gn; EBG00001055640.
DR   EnsemblGenomes-Gn; EBG00001055641.
DR   EnsemblGenomes-Gn; EBG00001055642.
DR   EnsemblGenomes-Gn; EBG00001055643.
DR   EnsemblGenomes-Gn; EBG00001055644.
DR   EnsemblGenomes-Gn; EBG00001055645.
DR   EnsemblGenomes-Gn; EBG00001055646.
DR   EnsemblGenomes-Gn; EBG00001055647.
DR   EnsemblGenomes-Gn; EBG00001055648.
DR   EnsemblGenomes-Gn; EBG00001055649.
DR   EnsemblGenomes-Gn; EBG00001055650.
DR   EnsemblGenomes-Gn; EBG00001055651.
DR   EnsemblGenomes-Gn; EBG00001055652.
DR   EnsemblGenomes-Gn; EBG00001055653.
DR   EnsemblGenomes-Gn; EBG00001055655.
DR   EnsemblGenomes-Gn; EBG00001055656.
DR   EnsemblGenomes-Gn; EBG00001055657.
DR   EnsemblGenomes-Gn; EBG00001055658.
DR   EnsemblGenomes-Gn; EBG00001055659.
DR   EnsemblGenomes-Gn; EBG00001055660.
DR   EnsemblGenomes-Gn; EBG00001055661.
DR   EnsemblGenomes-Gn; EBG00001055662.
DR   EnsemblGenomes-Gn; EBG00001055663.
DR   EnsemblGenomes-Tr; COPRO5265_1600-1.
DR   EnsemblGenomes-Tr; COPRO5265_1601-1.
DR   EnsemblGenomes-Tr; COPRO5265_1603-1.
DR   EnsemblGenomes-Tr; COPRO5265_1604-1.
DR   EnsemblGenomes-Tr; COPRO5265_1605-1.
DR   EnsemblGenomes-Tr; COPRO5265_1606-1.
DR   EnsemblGenomes-Tr; COPRO5265_1607-1.
DR   EnsemblGenomes-Tr; COPRO5265_1608-1.
DR   EnsemblGenomes-Tr; COPRO5265_1609-1.
DR   EnsemblGenomes-Tr; COPRO5265_1610-1.
DR   EnsemblGenomes-Tr; COPRO5265_1611-1.
DR   EnsemblGenomes-Tr; COPRO5265_1612-1.
DR   EnsemblGenomes-Tr; COPRO5265_1613-1.
DR   EnsemblGenomes-Tr; COPRO5265_1614-1.
DR   EnsemblGenomes-Tr; COPRO5265_1615-1.
DR   EnsemblGenomes-Tr; COPRO5265_1616-1.
DR   EnsemblGenomes-Tr; COPRO5265_1617-1.
DR   EnsemblGenomes-Tr; COPRO5265_1618-1.
DR   EnsemblGenomes-Tr; COPRO5265_1619-1.
DR   EnsemblGenomes-Tr; COPRO5265_1620-1.
DR   EnsemblGenomes-Tr; COPRO5265_1621-1.
DR   EnsemblGenomes-Tr; COPRO5265_1622-1.
DR   EnsemblGenomes-Tr; COPRO5265_1623-1.
DR   EnsemblGenomes-Tr; COPRO5265_1624-1.
DR   EnsemblGenomes-Tr; COPRO5265_1625-1.
DR   EnsemblGenomes-Tr; COPRO5265_1626-1.
DR   EnsemblGenomes-Tr; COPRO5265_1627-1.
DR   EnsemblGenomes-Tr; COPRO5265_1628-1.
DR   EnsemblGenomes-Tr; COPRO5265_1629-1.
DR   EnsemblGenomes-Tr; COPRO5265_1630-1.
DR   EnsemblGenomes-Tr; COPRO5265_1631-1.
DR   EnsemblGenomes-Tr; COPRO5265_1632-1.
DR   EnsemblGenomes-Tr; COPRO5265_1633-1.
DR   EnsemblGenomes-Tr; COPRO5265_1634-1.
DR   EnsemblGenomes-Tr; COPRO5265_1635-1.
DR   EnsemblGenomes-Tr; COPRO5265_1636-1.
DR   EnsemblGenomes-Tr; COPRO5265_1637-1.
DR   EnsemblGenomes-Tr; COPRO5265_1638-1.
DR   EnsemblGenomes-Tr; COPRO5265_1639-1.
DR   EnsemblGenomes-Tr; COPRO5265_1640-1.
DR   EnsemblGenomes-Tr; COPRO5265_1641-1.
DR   EnsemblGenomes-Tr; COPRO5265_1642-1.
DR   EnsemblGenomes-Tr; COPRO5265_1644-1.
DR   EnsemblGenomes-Tr; COPRO5265_1645-1.
DR   EnsemblGenomes-Tr; COPRO5265_1646-1.
DR   EnsemblGenomes-Tr; COPRO5265_1647-1.
DR   EnsemblGenomes-Tr; COPRO5265_1648-1.
DR   EnsemblGenomes-Tr; COPRO5265_1649-1.
DR   EnsemblGenomes-Tr; COPRO5265_1650-1.
DR   EnsemblGenomes-Tr; COPRO5265_1651-1.
DR   EnsemblGenomes-Tr; COPRO5265_1652-1.
DR   EnsemblGenomes-Tr; COPRO5265_1653-1.
DR   EnsemblGenomes-Tr; COPRO5265_1654-1.
DR   EnsemblGenomes-Tr; COPRO5265_1655-1.
DR   EnsemblGenomes-Tr; COPRO5265_1657-1.
DR   EnsemblGenomes-Tr; COPRO5265_1658-1.
DR   EnsemblGenomes-Tr; COPRO5265_1659-1.
DR   EnsemblGenomes-Tr; COPRO5265_1660-1.
DR   EnsemblGenomes-Tr; EBT00001658885.
DR   EnsemblGenomes-Tr; EBT00001658886.
DR   EnsemblGenomes-Tr; EBT00001658887.
DR   EnsemblGenomes-Tr; EBT00001658888.
DR   EnsemblGenomes-Tr; EBT00001658889.
DR   EnsemblGenomes-Tr; EBT00001658890.
DR   EnsemblGenomes-Tr; EBT00001658891.
DR   EnsemblGenomes-Tr; EBT00001658892.
DR   EnsemblGenomes-Tr; EBT00001658893.
DR   EnsemblGenomes-Tr; EBT00001658894.
DR   EnsemblGenomes-Tr; EBT00001658895.
DR   EnsemblGenomes-Tr; EBT00001658896.
DR   EnsemblGenomes-Tr; EBT00001658897.
DR   EnsemblGenomes-Tr; EBT00001658898.
DR   EnsemblGenomes-Tr; EBT00001658899.
DR   EnsemblGenomes-Tr; EBT00001658900.
DR   EnsemblGenomes-Tr; EBT00001658901.
DR   EnsemblGenomes-Tr; EBT00001658903.
DR   EnsemblGenomes-Tr; EBT00001658904.
DR   EnsemblGenomes-Tr; EBT00001658905.
DR   EnsemblGenomes-Tr; EBT00001658906.
DR   EnsemblGenomes-Tr; EBT00001658907.
DR   EnsemblGenomes-Tr; EBT00001658908.
DR   EnsemblGenomes-Tr; EBT00001658909.
DR   EnsemblGenomes-Tr; EBT00001658910.
DR   EnsemblGenomes-Tr; EBT00001658911.
DR   EnsemblGenomes-Tr; EBT00001658912.
DR   EnsemblGenomes-Tr; EBT00001658913.
DR   EnsemblGenomes-Tr; EBT00001658914.
DR   EnsemblGenomes-Tr; EBT00001658915.
DR   EnsemblGenomes-Tr; EBT00001658916.
DR   EnsemblGenomes-Tr; EBT00001658917.
DR   EnsemblGenomes-Tr; EBT00001658918.
DR   EnsemblGenomes-Tr; EBT00001658919.
DR   EnsemblGenomes-Tr; EBT00001658920.
DR   EnsemblGenomes-Tr; EBT00001658921.
DR   EnsemblGenomes-Tr; EBT00001658922.
DR   EnsemblGenomes-Tr; EBT00001658923.
DR   EnsemblGenomes-Tr; EBT00001658924.
DR   EnsemblGenomes-Tr; EBT00001658925.
DR   EnsemblGenomes-Tr; EBT00001658926.
DR   EnsemblGenomes-Tr; EBT00001658927.
DR   EnsemblGenomes-Tr; EBT00001658928.
DR   EnsemblGenomes-Tr; EBT00001658929.
DR   EnsemblGenomes-Tr; EBT00001658930.
DR   EnsemblGenomes-Tr; EBT00001658931.
DR   EnsemblGenomes-Tr; EBT00001658932.
DR   EnsemblGenomes-Tr; EBT00001658933.
DR   EnsemblGenomes-Tr; EBT00001658934.
DR   EnsemblGenomes-Tr; EBT00001658935.
DR   EnsemblGenomes-Tr; EBT00001658936.
DR   EnsemblGenomes-Tr; EBT00001658937.
DR   EnsemblGenomes-Tr; EBT00001658938.
DR   EnsemblGenomes-Tr; EBT00001658939.
DR   EnsemblGenomes-Tr; EBT00001658940.
DR   EnsemblGenomes-Tr; EBT00001658941.
DR   EnsemblGenomes-Tr; EBT00001658942.
DR   EnsemblGenomes-Tr; EBT00001658943.
DR   EnsemblGenomes-Tr; EBT00001658944.
DR   EnsemblGenomes-Tr; EBT00001658945.
DR   EnsemblGenomes-Tr; EBT00001658946.
DR   EnsemblGenomes-Tr; EBT00001658947.
DR   EnsemblGenomes-Tr; EBT00001658948.
DR   EnsemblGenomes-Tr; EBT00001658949.
DR   EnsemblGenomes-Tr; EBT00001658950.
DR   EnsemblGenomes-Tr; EBT00001658951.
DR   EnsemblGenomes-Tr; EBT00001658952.
DR   EnsemblGenomes-Tr; EBT00001658953.
DR   EnsemblGenomes-Tr; EBT00001658954.
DR   EnsemblGenomes-Tr; EBT00001658955.
DR   EnsemblGenomes-Tr; EBT00001658956.
DR   EnsemblGenomes-Tr; EBT00001658957.
DR   EnsemblGenomes-Tr; EBT00001658958.
DR   EnsemblGenomes-Tr; EBT00001658960.
DR   EnsemblGenomes-Tr; EBT00001658961.
DR   EnsemblGenomes-Tr; EBT00001658962.
DR   EnsemblGenomes-Tr; EBT00001658963.
DR   EnsemblGenomes-Tr; EBT00001658964.
DR   EnsemblGenomes-Tr; EBT00001658965.
DR   EnsemblGenomes-Tr; EBT00001658966.
DR   EnsemblGenomes-Tr; EBT00001658967.
DR   EnsemblGenomes-Tr; EBT00001658968.
DR   EnsemblGenomes-Tr; EBT00001658969.
DR   EnsemblGenomes-Tr; EBT00001658970.
DR   EuropePMC; PMC4022818; 24831154.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00162; SAM.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00373; RNaseP_arch.
DR   RFAM; RF00515; PyrR.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01315; CRISPR-DR2.
DR   RFAM; RF01852; tRNA-Sec.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   RFAM; RF01990; SECIS_4.
DR   SILVA-LSU; CP001145.
DR   SILVA-SSU; CP001145.
DR   StrainInfo; 43270; 1.
XX
CC   This strain was obtained from ATCC and grown by Frank Robb.  DNA
CC   was isolated at UMD.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1424912
FT                   /organism="Coprothermobacter proteolyticus DSM 5265"
FT                   /strain="DSM 5265"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:309798"
FT   gene            7..774
FT                   /locus_tag="COPRO5265_0001"
FT   CDS_pept        7..774
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0001"
FT                   /product="putative nitrilase 2"
FT                   /EC_number="3.5.5.1"
FT                   /note="identified by match to protein family HMM PF00795"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ACI16886"
FT                   /db_xref="GOA:B5Y6H6"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y6H6"
FT                   /protein_id="ACI16886.1"
FT                   /translation="MYGRRSQVKAALVVNEVTANLDANYEKVLSCIDECAQNGAQLIVF
FT                   GEAAITGLINNDEPTHDFPLASPVPGPITDTLCKKATELNVHIATGILEKDGSKLYDSA
FT                   ILISPAENVVLKYRRMSPGWHGGRADPKVYCEGTEVSKCYTPLGSFAFLICGDLFDEHI
FT                   RAEVCKLHPDWLLHLMARSLEDGSFDQAQWDKEKLEYVEQVKTCGITTLMVNYLASAEL
FT                   EDKNFGGAMVVLPSGQILSELPIGKEGILYVDL"
FT   gene            964..1782
FT                   /locus_tag="COPRO5265_0002"
FT   CDS_pept        964..1782
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0002"
FT                   /product="caax amino protease family"
FT                   /note="identified by match to protein family HMM PF02517"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18233"
FT                   /db_xref="GOA:B5Y6H7"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y6H7"
FT                   /protein_id="ACI18233.1"
FT                   /translation="MLVTLIVFLSLGAASSILQNHFADRMAQGYLMEYCLSTAIVQVLL
FT                   SLLVMWIMKRNNLFYKNEFTSKGLWKGLKLGWLAYIFAVLLFSLNYMGQDKTLFITPNP
FT                   LYVLIVLFSALATGFLEEILVRGFVLNAINVKLLNVKDGTKKAMLWSSMIFALAHFFNL
FT                   VMNPNFLPVLANVIQAFMLGLYLAAIYVLSENLLAPSIIHGLIDFASFIFYAILSPEAL
FT                   SKMMSGTQAAVSSGQILVTFFVQIAITVPFLIAALLMMKNVKQKVPKEVI"
FT   gene            1867..2502
FT                   /locus_tag="COPRO5265_0003"
FT   CDS_pept        1867..2502
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0003"
FT                   /product="SAM-dependent methyltransferase, UbiE/COQ5
FT                   family"
FT                   /note="identified by match to protein family HMM PF01209;
FT                   match to protein family HMM PF08241; match to protein
FT                   family HMM PF08242"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ACI16820"
FT                   /db_xref="GOA:B5Y6H8"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y6H8"
FT                   /protein_id="ACI16820.1"
FT                   /translation="MHMRRIEPFEKHAKEYDVWFDENELVYLSELEAVRSMIPVDGTGI
FT                   EIGVGTGRFAAPLGIKLGLEPSKSMASLARQRGIEVVEGEAEALPFEDGSFDFVLMVTV
FT                   ICFLNDVGKALSEAYRVLKPGGCIVIAFIDKNSPIGKMYEQRKNEDVFYKEATFYSVEE
FT                   VSAVLQQAGFKNLSFCQTVFQEETKPGEVQKPQPGYGKGSFVVVRAEK"
FT   gene            2592..3380
FT                   /gene="thiD"
FT                   /locus_tag="COPRO5265_0004"
FT   CDS_pept        2592..3380
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiD"
FT                   /locus_tag="COPRO5265_0004"
FT                   /product="phosphomethylpyrimidine kinase"
FT                   /EC_number="2.7.4.7"
FT                   /note="identified by match to protein family HMM PF08543;
FT                   match to protein family HMM TIGR00097"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17756"
FT                   /db_xref="GOA:B5Y6H9"
FT                   /db_xref="InterPro:IPR004399"
FT                   /db_xref="InterPro:IPR013749"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y6H9"
FT                   /protein_id="ACI17756.1"
FT                   /translation="MTIAGSDSGGGAGIEADLATFLHLHVFGTVAITAVTAQNSRGVHG
FT                   VFDIPPDGVRAQIDAVLKDFSVGAVKTGMLSREETISEVAKALSEYNCKKLVVDPVMVA
FT                   QSGDSLIFGDAVKALEEKLLPLAFIVTPNIPEAQILTGITIKSSEDMKKAAKAISKLGP
FT                   QSVLVKGGHLEEKQLVDLFYYEGEFYTFTHEKIDTLDHHGTGCTLSAAITAELAANTET
FT                   VEAVKRAIDYTRLGIEHRFKGGKGYGCVGHIFDIDWLRED"
FT   gene            3409..4221
FT                   /gene="thiM"
FT                   /locus_tag="COPRO5265_0005"
FT   CDS_pept        3409..4221
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiM"
FT                   /locus_tag="COPRO5265_0005"
FT                   /product="hydroxyethylthiazole kinase"
FT                   /EC_number="2.7.1.50"
FT                   /note="identified by match to protein family HMM PF02110;
FT                   match to protein family HMM TIGR00694"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ACI16808"
FT                   /db_xref="GOA:B5Y6I0"
FT                   /db_xref="InterPro:IPR000417"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5Y6I0"
FT                   /protein_id="ACI16808.1"
FT                   /translation="MVSQPSVNIKEILEQVVSTKPLVYHMTNMVAMAEQAHLTLAIGAS
FT                   PVMSLSSEEAAEMVNIANAVLINIGTPSKEANEAMLSAAHTAKRLGKPAILDPVGYGAT
FT                   KLRINLVERLLETGAFSLVKGNGGEISLLAGERAEVRGVDSVGSPPAAIAAKTVAQKYN
FT                   CIAAATGPDDYVSDGERVYVLRSGHEWLTRISGSGCWAGTLMAACLSVTEPLPAAMSAL
FT                   SLMGAASQIAAEQSDGPGTFRIRMFDVMYQITQNPHAFSFPQWELMEV"
FT   gene            4226..4861
FT                   /gene="thiE"
FT                   /locus_tag="COPRO5265_0006"
FT   CDS_pept        4226..4861
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiE"
FT                   /locus_tag="COPRO5265_0006"
FT                   /product="thiamine-phosphate pyrophosphorylase"
FT                   /EC_number="2.5.1.3"
FT                   /note="identified by match to protein family HMM PF02581;
FT                   match to protein family HMM TIGR00693"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17434"
FT                   /db_xref="GOA:B5Y6I1"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022998"
FT                   /db_xref="InterPro:IPR034291"
FT                   /db_xref="InterPro:IPR036206"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5Y6I1"
FT                   /protein_id="ACI17434.1"
FT                   /translation="MVTKEQLKEKLKLYVILDRKLGNGVPLRQQAQLAIAGGATAIQLR
FT                   DKEMKGRDYYQAALVIKDVCKENNVLFIVNDRLDVALAAEADGVHLGQEDLPLHAAKKL
FT                   APPGFIIGISAVNVEQAKLAEKGGADYLGVGDVFGTASKPDAKLTGVDMLKMICQSTSL
FT                   PCVAIGGINVNNAKIVLDAGAIGIAVISAVVSQKDITGAAKALRELIP"
FT   gene            4975..7065
FT                   /gene="nrdD"
FT                   /locus_tag="COPRO5265_0007"
FT   CDS_pept        4975..7065
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nrdD"
FT                   /locus_tag="COPRO5265_0007"
FT                   /product="anaerobic ribonucleoside-triphosphate reductase"
FT                   /EC_number="1.17.4.2"
FT                   /note="identified by match to protein family HMM PF03477;
FT                   match to protein family HMM TIGR02487"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18086"
FT                   /db_xref="GOA:B5Y6I2"
FT                   /db_xref="InterPro:IPR005144"
FT                   /db_xref="InterPro:IPR012833"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y6I2"
FT                   /protein_id="ACI18086.1"
FT                   /translation="MFESIRKRDGRIVPFEAEKITNAIAKAGQATGEFDRDVAQKLMIK
FT                   VVNVAQTVIKEEIPSVEQIQDIVEEVLLDSPYRKTAKAYIIYREDHAKMREIVSKANSD
FT                   LVDQYLERIDWQVNENSNMSFSLQGLNNYISSEISKVYWLNRIYPKEIRQAHLNGDFHI
FT                   HDLGTLSVYCVGWDLIDLLRYGFKGAGSGKVESKPAKHFRSALGQVVNFFYTLQGEAAG
FT                   AQAFSNFDTLLAPFIRYDGLSYREVKQAVQEFLFNVNVPTRVGFQTPFTNITLDLTPPK
FT                   HLANQPVIIGGEFQEAVYGDFQKEMDMLNRAFLEVMLEGDAKGRPFTFPIPTYNITEDF
FT                   DWDNENMELLWEITAKYGIPYFSNFINSDMKPEDVRSMCCRLRINTQKLERKGGGLFGA
FT                   NPKTGSIGVVTINLPRLAYLCHSEEEFFEALAKMMDLAKNSLEIKRKVLERFTEQGLYP
FT                   YTKFYLKDIKNTFGGYWKNHFSTIGLIGMNEACLNLLGTDIGSEEGHRFALKTLDFMRE
FT                   RLIQYQEETSNNYNLEATPAEGTSYRLAKIDKEKYPDIVCANEAHWKEGAEPFYTNSTQ
FT                   LPVNYTDDIFEALDLQDELQTKYTGGTVMHLFVGERISDPRTVKLLVKRICEKYRLPYF
FT                   TVTPTFSICPNHGYLSGEHDKCPECGSETEVYSRVVGYLRPVKQWNHGKKEEFRMRKTF
FT                   KV"
FT   gene            7083..7775
FT                   /locus_tag="COPRO5265_0008"
FT   CDS_pept        7083..7775
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0008"
FT                   /product="anaerobic ribonucleoside-triphosphate reductase
FT                   activating protein"
FT                   /EC_number="1.97.-.-"
FT                   /note="identified by match to protein family HMM PF04055;
FT                   match to protein family HMM TIGR02495"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17191"
FT                   /db_xref="GOA:B5Y6I3"
FT                   /db_xref="InterPro:IPR001989"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR012840"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y6I3"
FT                   /protein_id="ACI17191.1"
FT                   /translation="MIIGGLQKFSLIDYPGKISAILFTRGCNFRCPYCHNPELVDPQQY
FT                   AEPWQEEEFWAFLQSRTQKLDAVVVTGGEPTLQEDLQPFLEKIRKMGFLIKLDTNGSNP
FT                   DVLKDLLSANLVDYIAMDIKAPLEKYSEVTKVPVDKPDIEKSIELIKQSTVDHEFRTTI
FT                   ARNILSREDIVNIAKMLQGEKLYILQRCVPTKILDPLFLAQFEPYTHEELEQIANLTEN
FT                   YVLQCLVR"
FT   gene            7976..8728
FT                   /locus_tag="COPRO5265_0009"
FT   CDS_pept        7976..8728
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0009"
FT                   /product="ABC transporter ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17816"
FT                   /db_xref="GOA:B5Y6I4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y6I4"
FT                   /protein_id="ACI17816.1"
FT                   /translation="MIELTGVTKIYRSGVKAVDNLSLTVQSGELFGFIGPNGAGKSTTI
FT                   KMMVGLLEPTSGSIKIDGYDIRTQPLEVKKSIAYVPDNPDIYEKLTGIEYLNFIADVYD
FT                   VPSHLRQERLNYLLDAFDMTNAIGGLIEGYSHGMRQKTVLIGALLHNPSVWILDEPMVG
FT                   LDPRSAFQLKKMMREHCDQGHTVFFSTHVLEVAERLCDRIGIIDRGRLVACGTLEELRH
FT                   GQRNESLEELFLQLTDEETVQGAQSEQQ"
FT   gene            8688..10400
FT                   /locus_tag="COPRO5265_0010"
FT   CDS_pept        8688..10400
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0010"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17022"
FT                   /db_xref="GOA:B5Y6I5"
FT                   /db_xref="InterPro:IPR031599"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y6I5"
FT                   /protein_id="ACI17022.1"
FT                   /translation="MKKQYKVRKVNSNNRAFLSLVKTQLKVQFNLSALRYKIFKNKRTL
FT                   MQTLFAVLIMLFLLFLFFGFFSTAFNLVVKAGFMVGQPELVLVVALLSAQLLGLVTGIF
FT                   TLMSTFYYSKDLPMLITMPFKPWQIIATKLLVTQITLYTLLVPLLVAGIGLYAYYIQVG
FT                   AMYWIVAAIVTLTSPLLPLSIAAVIVVILMRFVNLTKNRTIFTVLGSLVGAAIGIGIQL
FT                   FSQRLTTMGNAPEILSEQANILKAVSAAFPPSLWGAKAIALPNAQGLLYLLLFLGVSFA
FT                   AFICMLAISEQVFYKAAIAGMESTAPQKRLTRKEISKASNTTRSHTMALFSKEWKLFWR
FT                   TPLFLSNALSPFIIFFIAVFLPMITSSSGGQRGNDLSQLLNVPNGDLIVNFILAGILLM
FT                   SIAMNSVSYTAFSREGSTYWMSLTIPVERREQVNAKLMNCVAIETVFATLITVAFSLLL
FT                   RRSLSDTVMVLALLVPAMIPPICVNMALDALMPKLDWVTPQQLFKRGIFTLLFFLLSLI
FT                   PVGIMGATAIFLLNKQVSANLIYVSIICLSVVIAAITYELLLMASKNFYKLPQ"
FT   gene            complement(10428..10565)
FT                   /locus_tag="COPRO5265_0011"
FT   CDS_pept        complement(10428..10565)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0011"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17702"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y6I6"
FT                   /protein_id="ACI17702.1"
FT                   /translation="MHYTPGAPPGALVHIIIDILKEQKKSIVLLSNLSTSFTHIQFVVV
FT                   "
FT   gene            10683..11270
FT                   /locus_tag="COPRO5265_0012"
FT   CDS_pept        10683..11270
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0012"
FT                   /product="vitamin B12 dependent methionine synthase,
FT                   activation domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ACI16801"
FT                   /db_xref="GOA:B5Y6I7"
FT                   /db_xref="InterPro:IPR037010"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y6I7"
FT                   /protein_id="ACI16801.1"
FT                   /translation="MAKGGKETVAKVYVPEKATCMPDKKVFLARAGARYAFLVKEKDFM
FT                   ERANRLFLEGFSHIDPVIYYITSDSQTLLPQLLPSIFQGVKQVTVFLSTLGEEIDNLIS
FT                   SYLNRGKTFDAFLLDAWASEALETLNESFDKELRQKFGEGTMRFSPGYGDVDVRMNQYI
FT                   VKELIRVENVRVLSSGEMVPRKTTTCMIGWYQ"
FT   gene            11267..13594
FT                   /locus_tag="COPRO5265_0013"
FT   CDS_pept        11267..13594
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0013"
FT                   /product="5-methyltetrahydrofolate S-homocysteine
FT                   methyltransferase"
FT                   /note="identified by match to protein family HMM PF00809;
FT                   match to protein family HMM PF02310; match to protein
FT                   family HMM PF02574; match to protein family HMM PF02607"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17204"
FT                   /db_xref="GOA:B5Y6I8"
FT                   /db_xref="InterPro:IPR000489"
FT                   /db_xref="InterPro:IPR003726"
FT                   /db_xref="InterPro:IPR003759"
FT                   /db_xref="InterPro:IPR006158"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="InterPro:IPR036589"
FT                   /db_xref="InterPro:IPR036594"
FT                   /db_xref="InterPro:IPR036724"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y6I8"
FT                   /protein_id="ACI17204.1"
FT                   /translation="MNRKTFLELLSERVLFLDGAYGTEFFKQGYKGAVELLNIDTPKVV
FT                   EDLQKAYAEAGADVVLTNTFSANRLKLRSMGLEEYIRKINENAVKIARHAAPGKLVLGD
FT                   MSSTGMFVRPLGDLDFEEAYNVFREQAALLIDAGVDGIIVETMSDLKELKAAILAIRNV
FT                   STDIPLIAHMTFEADGISVTGTSVEIFATLMNDLDVDVVGINCTLEPKDMLPVFMRLAE
FT                   YCHKPLSVEPNAGKPLYNKGVLTYKSTPEEFAVYMADFVELGANLVGGCCGTGPDHIAL
FT                   MSKYVGKQKPRQRTVRNDQFLSSRTVIKTVEPFLVIGERINASGRKKLQKSFQDMDYTE
FT                   ILNLARKQEEEGSAVIDVNLGIEKLLTHEHFKQAVLELDRVSSLPLSLDIQDAAFLETA
FT                   MREYVGRPLINSALAREEHLNSRLALLKKYGGMLIVLTMEKDIPQTAQERLSVAKKAVE
FT                   IIKANGVDLKRVFFDPLVLPLGAGSDYHVTLNTIKLLTESGLQTSIGLSNLSFGLPNRE
FT                   SINAAFLGLSVENGLSAAILNSKEATTMNVLQGCLALKGKQLGTTQNAIDDELVNLIVK
FT                   GQKDALLEFTKQQLKEHDPLYVSQHILAEAMQKVGELYAKGVIYLPHLILAAETVQPCF
FT                   DYLNSLLGEAQVKLGKVLLATVHGDIHDIGKNIVATVLRSGGFDVYDVGKDVPAHTILE
FT                   ACQEYKPDIVGLSAMMTTTVSRVKEVVDMLKANNIQAFVIAGGASMNRQLADEFGVEYA
FT                   KDAMEALQICKAFMERKGGNEP"
FT   gene            13591..14940
FT                   /locus_tag="COPRO5265_0015"
FT   CDS_pept        13591..14940
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0015"
FT                   /product="aspartate kinase"
FT                   /note="identified by match to protein family HMM PF00696;
FT                   match to protein family HMM PF01842; match to protein
FT                   family HMM TIGR00657"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17542"
FT                   /db_xref="GOA:B5Y6I9"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001341"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR005260"
FT                   /db_xref="InterPro:IPR027795"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y6I9"
FT                   /protein_id="ACI17542.1"
FT                   /translation="MKSIVLKFGGSTLKSKGDLEKIQNILRLRQTPFVLVVSAVNGVTN
FT                   MLKEALDNLATLDIEEFLENMEHIYQAFLRNPSLELHQRVFAIRDFLLGAQLIGEAPPF
FT                   VYDYVLSHGERCSSLLLTIHLNGRGITCSEMLPEQFGLITDGTYGNATVDLSQTEAHVK
FT                   QHFEEDQNYVVPGFYGVCDGKVTVLGRGGSDYTATSLAYCLSAERVELYKDVPGFMSCD
FT                   PKFLKEAKPIRQLSYDEAAELSYFGAKILHHSAIEPASKGHIPVHIYNMNTFNSQEGPD
FT                   TVISADSCITHGVVKSISFTDDVAVIQFAGENVGRVPGILGTIASTLGNANINIKSVIT
FT                   SQTSINVLISKQDIDKCKKATQRMNIPHVENILYKADISLIAAVGDGLLKRHSVAARIF
FT                   SAVSKQGINVEMISAGASNVTIYFLVRTADRQKALKAIHEEFFSGGEQNP"
FT   gene            complement(14915..15142)
FT                   /locus_tag="COPRO5265_0014"
FT   CDS_pept        complement(14915..15142)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0014"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17068"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y6J0"
FT                   /protein_id="ACI17068.1"
FT                   /translation="MRIGGVVWPKLINAPLEHMGAKVPVVTTSTFSAISLGEDSFAICT
FT                   TSSAVKTTACPLRILALISSMVFMGSVHLH"
FT   gene            14937..16268
FT                   /locus_tag="COPRO5265_0016"
FT   CDS_pept        14937..16268
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0016"
FT                   /product="inosine-5'-monophosphate dehydrogenase related
FT                   protein viii"
FT                   /note="identified by match to protein family HMM PF00037;
FT                   match to protein family HMM PF01837"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ACI16899"
FT                   /db_xref="InterPro:IPR002708"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y6J1"
FT                   /protein_id="ACI16899.1"
FT                   /translation="MKTIEEINAKIRSGQAVVLTAEEVVQMAKESSPKEIAEKVDVVTT
FT                   GTFAPMCSSGAFINFGHTTPPMRMEKIKLSDVEVYGGVAAVDGFLGATQESDEDKSFGG
FT                   AHIIEALIKGKDVFLEAQGKGTDCYPRKAFAGFINKDMINDFFLFNPRNAYQNYAAATN
FT                   SSKRILYTYMGKLLPNFGNMNYSTSGELSPLLKDPNMLTIGLGTRIFLCGTEGYVVWPG
FT                   TQFTDQVQVNQWGIPMGSARTLAVIGDAKKMNARYLRAAYFKNYGVTLFVGIGIPIPII
FT                   NDDVAYFASRSNAEITTEIKDYALQDHPTIGYITYEELRSGFAELNGKKVKTAPISSLN
FT                   MAREIADVLKHWISQGAFLLTEPVAYFHEPRIVKKLPQELEGKPLTKDDPTCVDCGLCT
FT                   SVCPTGALKLINAKLAFTKEACTKCGLCSDICPVGVRLPFDEQR"
FT   gene            16255..17007
FT                   /locus_tag="COPRO5265_0017"
FT   CDS_pept        16255..17007
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0017"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF04040"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17710"
FT                   /db_xref="InterPro:IPR003374"
FT                   /db_xref="InterPro:IPR007183"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y6J2"
FT                   /protein_id="ACI17710.1"
FT                   /translation="MNNARRFYRSWHKGRFHSFSVGYKETDLWIGVDKTYEEMPEATLQ
FT                   FITRLRQQLEDYIKQNPVFLTSFKPVNDPIAVGIVRKMLDAAELAHVGPMAAVAGAVAD
FT                   QVGSFLSYEFGCREVIVENGGDLFVKVQQPIVVSIFAGNSPLSGRIGLEVPAGNYGICT
FT                   SSGTVGPSISFGKADAVTMVARSGALADAFATYYGNQIRQPSDVRSILNSPLHPEVDTL
FT                   LVIIGNTMGTVGKHQLRILEGGGNDESY"
FT   gene            16994..17950
FT                   /locus_tag="COPRO5265_0018"
FT   CDS_pept        16994..17950
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0018"
FT                   /product="5,10-methylenetetrahydrofolate reductase"
FT                   /note="identified by match to protein family HMM PF02219"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17057"
FT                   /db_xref="GOA:B5Y6J3"
FT                   /db_xref="InterPro:IPR003171"
FT                   /db_xref="InterPro:IPR029041"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y6J3"
FT                   /protein_id="ACI17057.1"
FT                   /translation="MKVTDKIKQGRIISIEVLPPNRGHSAEDIFKAVDELITDYPISFI
FT                   NVTRHAAETTYVELEDGIIVKVPKVKRPGTVGLTAALMKRYSVDVVPHVLCRGMNKFEL
FT                   EDLLIDLYLIGVQNVFAIRGEYENAEGESKQENNKDYHTYAVDLVQQIAHMNKGHYLYQ
FT                   KESTMSTDFCIGVAGYPEKHFEAPNLEEDMKHLKEKVEAGANYIITQMVFDFDVYKDFV
FT                   ERARSIGINVPIIPGIKPVVSLKSIYSIPRKFFVNIPHAFLEKMQEAKSSKEEFEVGTA
FT                   FMASLVEKLLSWGAPGLHLFTMGKSKSAKALLQAVWR"
FT   gene            17980..19014
FT                   /gene="asd"
FT                   /locus_tag="COPRO5265_0019"
FT   CDS_pept        17980..19014
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="asd"
FT                   /locus_tag="COPRO5265_0019"
FT                   /product="aspartate-semialdehyde dehydrogenase"
FT                   /EC_number="1.2.1.11"
FT                   /note="identified by match to protein family HMM PF01118;
FT                   match to protein family HMM PF02774; match to protein
FT                   family HMM TIGR00978"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17237"
FT                   /db_xref="GOA:B5Y6J4"
FT                   /db_xref="InterPro:IPR000534"
FT                   /db_xref="InterPro:IPR005676"
FT                   /db_xref="InterPro:IPR012280"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y6J4"
FT                   /protein_id="ACI17237.1"
FT                   /translation="MKKRKVAILGATGLVGQRFIQLLENHPYFQISTLAASQNSAGKTY
FT                   KEAVTWRLNTAMPDSISDMLIEECRPTFHCDYVFSALPSSVAGPIEDMFVNAGYTVFSN
FT                   AACHRMDANVPLVVPEVNWQHLSLTRYQTTPGVIITNPNCSTVGLVMALKPVADLFGLE
FT                   EVNVVTMQALSGAGYPGVSSLDIVDNVIPHINGEEQKLTSEPLKILGNYNEHEGAIDFA
FT                   PFKVYAQCNRVPVVDGHLLSVSVKTKEKVSITALIDAINNFQPLKGFNLPSAPEKPLIY
FT                   LPQSDAPQPRLHRNLGGGMTVSMGQLVQYSDRSLRFLALVHNTIRGAAGCAILNAEMYE
FT                   AMNG"
FT   gene            19186..19395
FT                   /locus_tag="COPRO5265_0020"
FT   CDS_pept        19186..19395
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0020"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18194"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y6J5"
FT                   /protein_id="ACI18194.1"
FT                   /translation="MPNVRQSKSRVPDVFGAQDFIFFSHELKKFNNFAATTHKQSIFSS
FT                   FISFCPSELFYRLDAAKVVLWWTK"
FT   gene            19383..19922
FT                   /locus_tag="COPRO5265_0021"
FT   CDS_pept        19383..19922
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0021"
FT                   /product="RNA polymerase sigma-E factor, putative"
FT                   /note="identified by match to protein family HMM PF04542;
FT                   match to protein family HMM PF04545; match to protein
FT                   family HMM PF08281; match to protein family HMM TIGR02937"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17365"
FT                   /db_xref="GOA:B5Y6J6"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y6J6"
FT                   /protein_id="ACI17365.1"
FT                   /translation="MDEIKLIDRIKHGDRRALDTLIKAYYQNIFAYFYYHTQNREISMD
FT                   LTQEVFVKMVASIETYENRGKFRSWLFTIAANHLRNHWKYESRHEEYEFEEESENDITS
FT                   SLENVTDSAELLNALSRIPTDQRDCIVLKYYYGFTSREIAEMLKVKEPTVKARIRYGLN
FT                   KLSILLKGEETDGEEQ"
FT   gene            19906..20667
FT                   /locus_tag="COPRO5265_0023"
FT   CDS_pept        19906..20667
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0023"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ACI16783"
FT                   /db_xref="GOA:B5Y6J7"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y6J7"
FT                   /protein_id="ACI16783.1"
FT                   /translation="MEKSSNEDKHIEQLFKSVNIPQIPEQQIESVVQIAADYLPVERKR
FT                   INLWDIAILQLTTTSIVFWAACAAFMAITVLSISSAKSSLSAVGIFVAGAPVPLLLSLL
FT                   EVMTTRTPAVVELEKACKYNANQLYVVKIMIGTVLNVALLALVTTFTSQNLITPLRMFL
FT                   TGSTMMFFIGFLALLVATKFGQSLPVMGILAGWIIASAMLFENRHELAMMLLNIRLFPL
FT                   LIILGVSTMLFIFSLHAFSHQLTTLDLGGTC"
FT   gene            complement(20289..20420)
FT                   /locus_tag="COPRO5265_0022"
FT   CDS_pept        complement(20289..20420)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0022"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17637"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y6J8"
FT                   /protein_id="ACI17637.1"
FT                   /translation="MKNIIVEPVRNILKGVIKFCDVKVVTKANNATFNTVPIMIFTT"
FT   gene            20667..21536
FT                   /locus_tag="COPRO5265_0024"
FT   CDS_pept        20667..21536
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0024"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ACI16775"
FT                   /db_xref="GOA:B5Y6J9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y6J9"
FT                   /protein_id="ACI16775.1"
FT                   /translation="MRLRTQNLTKNFGNRCAVDHVSLNFERGVYGLLGPNGAGKTTLMR
FT                   MMVGVLPPSSGKVTLDGVTIGELGAKYRDILGYMPQEVGYYRDFTAKRFLQYLGALKGL
FT                   DPKYANRRIDELLDLVGLADVKNKKLGQFSGGMIRRIGIAQALLNDPKILILDEPTAGL
FT                   DPNERIRFKNILSELSEERIVILSTHIVSDVQSIAGQVILLKEGKVVNCDTTENLRHMV
FT                   EGKVWLATVTHRELNELKRQFPIGNVLQRDDHFEIRIVSDSKPLQNATAVEPSLEDVFI
FT                   YVFGGQQE"
FT   gene            21533..22711
FT                   /locus_tag="COPRO5265_0025"
FT   CDS_pept        21533..22711
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0025"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17576"
FT                   /db_xref="GOA:B5Y6K0"
FT                   /db_xref="InterPro:IPR032688"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y6K0"
FT                   /protein_id="ACI17576.1"
FT                   /translation="MSLVGVEFKKIISKRYVWVLTLLLALFYAYLILNIADNFSVVYSK
FT                   RALQPVFQEIMDAAYDPQVQAYVIKNEFNVTFDELQPLISPRIAQTIEQYQGKIYKGYD
FT                   VEKQLKDEAALRIESLVERNVTLNKRIQELKNEPDTPLNRYLLQQYTNMPKMEPNLTRW
FT                   DDWIDINNSMLPLLIAFVVILGVAGVYTGEYTSKMHGILLTTKNGRSELFWSKLLASCL
FT                   FAAIVVIIFQALAALLYMHVYGLPFKNTPINSLTSFYRMPNTMWALQFYFCQLAGSLLG
FT                   AIVLTAVTLCISSFCRSNLVSFFLSSIYFAIGALYSLNVEGQYISSMRTIFADVSTFSL
FT                   MSLTDVLGNGKVFIVGNSAIPTIRLTLITQAVIFAVAILLTYVFYNRKEIIA"
FT   gene            22708..23544
FT                   /locus_tag="COPRO5265_0026"
FT   CDS_pept        22708..23544
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0026"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ACI16867"
FT                   /db_xref="GOA:B5Y6K1"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y6K1"
FT                   /protein_id="ACI16867.1"
FT                   /translation="MSAKGGTYQHLMMAELKILLNSHWTLIVLTVYVLFTCGVYFSLNF
FT                   RQTWLQVLDGNLFTTMINLYLPTFLFIAVLLNAAPIFAGDKKNGMEELADTCFYGKTFR
FT                   KKAKIEATTFYTILITAAGFLVTAAISLASKTPLDLGSKAFETANLDISMSNGMFYLFC
FT                   FAMVVLGLIAVASAVVLISSRSDDVIVPLATGILIYGVELALYLKPLVRILWDVNLLKL
FT                   LRPYTMLSVSLYFDSTIKALAANVIAFILLSVALFLLTFADGSEIRAKRALSSQSS"
FT   gene            23671..24123
FT                   /gene="ptsN"
FT                   /locus_tag="COPRO5265_0027"
FT   CDS_pept        23671..24123
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ptsN"
FT                   /locus_tag="COPRO5265_0027"
FT                   /product="PtsN protein"
FT                   /note="identified by match to protein family HMM PF00359"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17353"
FT                   /db_xref="GOA:B5Y6K2"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y6K2"
FT                   /protein_id="ACI17353.1"
FT                   /translation="MLENILTEKAIRLKAQAKDWQEAVRMGGELLVNAGFAKPSYIEAM
FT                   VETVKQLGPYSVIAPGIAMPHARPEAGVIKPGLSLVTLATPVEFGNKENDPVDIVVSFC
FT                   ATDNTSHIQMLAELAQLLGSDEAVTTIRNAKEVSEVTQLIKVFQFS"
FT   gene            24140..25417
FT                   /locus_tag="COPRO5265_0028"
FT   CDS_pept        24140..25417
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0028"
FT                   /product="putative sugar-specific permease, SgaT/UlaA
FT                   superfamily"
FT                   /note="identified by match to protein family HMM PF04215"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18185"
FT                   /db_xref="GOA:B5Y6K3"
FT                   /db_xref="InterPro:IPR004703"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y6K3"
FT                   /protein_id="ACI18185.1"
FT                   /translation="MAAFINFLVNNIFNQVPILIGIVAMIGLILQIKPVEEVISGTIKA
FT                   VVGILIMLAGTDLFTAGLSSFQTIVSSAFGITAPVAANTLDNFTANFGSIAVSIMALGF
FT                   LIHLILVRLFNTGFVYLTGHLMWWISLVITASFLEVFPTMNQGWLIVVGAILIALYWTL
FT                   QPRIIHKYMKKVTKSDDVGYGHTSSSVAYLAASLGGYIGKPEESTENIKIPQRLSFMND
FT                   ITVGTAFIIGIILLIAVFFADRAVVVELAGNLNFVVWAILQGLRFAAGITILLYGVRLF
FT                   LGEIVPAFRGISQKLIPGARPALDVPVVFPYAPTAVLVGFISSTIVFLILMVIFGVTGY
FT                   ATIVPSMIMLFFPGAGAAIFGNATGGWKGAVLGGAVNGLFLAFGQAITWPMLSNTAPEL
FT                   AVLADPDWYIITWIIVGISSLIKSLM"
FT   gene            25440..25739
FT                   /gene="sgaB1"
FT                   /locus_tag="COPRO5265_0029"
FT   CDS_pept        25440..25739
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sgaB1"
FT                   /locus_tag="COPRO5265_0029"
FT                   /product="pentitol phosphotransferase enzyme II, B
FT                   component"
FT                   /EC_number="2.7.1.69"
FT                   /note="identified by match to protein family HMM PF02302"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18036"
FT                   /db_xref="GOA:B5Y6K4"
FT                   /db_xref="InterPro:IPR003501"
FT                   /db_xref="InterPro:IPR013011"
FT                   /db_xref="InterPro:IPR036095"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y6K4"
FT                   /protein_id="ACI18036.1"
FT                   /translation="MANKLKVVAACGVGMGSSLILKMNVEDVLKELNVPATVEHSDIGS
FT                   LVGSNYDIVVVQTFYADQVKNYGKTVVGVDDFFNKEKLKEKLQEALKILGVIEE"
FT   gene            26217..28316
FT                   /locus_tag="COPRO5265_0030"
FT   CDS_pept        26217..28316
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0030"
FT                   /product="PAS/PAC sensor signal transduction histidine
FT                   kinase"
FT                   /note="identified by match to protein family HMM PF00512;
FT                   match to protein family HMM PF00989; match to protein
FT                   family HMM PF02518; match to protein family HMM PF08447;
FT                   match to protein family HMM PF08448; match to protein
FT                   family HMM TIGR00229"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17143"
FT                   /db_xref="GOA:B5Y6K5"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR031621"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y6K5"
FT                   /protein_id="ACI17143.1"
FT                   /translation="MNTLQLITALASFSAFLVYVFLMWFVLNLNQKELLNKLCALTIAS
FT                   FAVWSFSSTFLHSATSLHTAKLWTNVSSIGWCSFPVFAFWFYAAFSNHDKLLKSRSFIA
FT                   MCLFLAAFFTYQQWKGNLIVDLVRQPYGWSNVWAISPVSIGFSMYYILFVVGCMYFALD
FT                   FERKTKSAREKKQARIFYVSALASLVLGTMTDVALPMLGIGAIPPLADVFILLWAVGLV
FT                   YAIKRYGFMGLTLATAAEDILSTVADSLMLVGLDSRIVLANRKVHDLLGYKGEELKGKD
FT                   IVSIVSDIEITAIVESGGVYSNETTFLTKSGKQVPVLVSASVVRDREEEVAGIVLTALD
FT                   ISKRKQMEQELRASEEKYRTLVDHALVGIGIHQDNRIVFANQRMATMFGYTLEELIGLP
FT                   IADLLHPEERSLVLARVNGTDPQPPESNTYETRLLKKDGSFFYALVSNSLITYNDRVAT
FT                   LFTISDITDTKARKELEEANRELEAFSYSVSHDLRAPLRSIDGFSQMLLEDYADKLDDQ
FT                   GRDYLKRIRAATQRMSQLINDLLTLSRISRADMHFEELNLTAMAEDIAAELKQSQPERD
FT                   VEFIIEPNVKAYGDSHLLRIVLENLLRNAWKFTSKHKSAIIEFGVKEHDGKTVYFVRDN
FT                   GAGFDMAYVDKLFVPFQRLHEQDEFEGTGIGLATVQRIVHRHGGTVWAEGEVEKGATFY
FT                   FTLRE"
FT   gene            28328..28774
FT                   /locus_tag="COPRO5265_0031"
FT   CDS_pept        28328..28774
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0031"
FT                   /product="response regulator"
FT                   /note="identified by match to protein family HMM PF00072"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18100"
FT                   /db_xref="GOA:B5Y6K6"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y6K6"
FT                   /protein_id="ACI18100.1"
FT                   /translation="MHRKFVLLVEDSPDDVELILRALSRSDTTVEVVVAHDGVEALNFL
FT                   FGTGAYAGRNINVMPTVVFLDLKLPRINGFEVLERIRSDERTKLLPVVILTSSNEEKDL
FT                   IRSYELGANSYVCKTVDFTEFSNAIRQLGSYWLFLNESPMKENE"
FT   gene            28775..30136
FT                   /locus_tag="COPRO5265_0032"
FT   CDS_pept        28775..30136
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0032"
FT                   /product="sensory box protein"
FT                   /note="identified by match to protein family HMM PF00072;
FT                   match to protein family HMM PF00989; match to protein
FT                   family HMM PF01966; match to protein family HMM PF08448;
FT                   match to protein family HMM PF08668; match to protein
FT                   family HMM TIGR00229"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17274"
FT                   /db_xref="GOA:B5Y6K7"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR037522"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y6K7"
FT                   /protein_id="ACI17274.1"
FT                   /translation="MSIRLRVLFVEDWEDDVLLIVRELRRAGYDVSFRKVDTPEEMRNA
FT                   LSNEEWDIILSDYVMPHFTTAEALNILKETGLDIPFIIVSGAIGEQTAVELMKAGAHDF
FT                   VMKDSLAKLGPVVQRELRDADTRRERRQAQERLKESEEGYRLLFQSSPNVIAQVDSEGR
FT                   FLIANMAMIRSLGFSSEKEVIGKTLHDLMPQDVANYRLKMVRKACNEARIQVFEDQRQG
FT                   RWFQNIFVPIEAPEVGEMTVQIIAMDITEKKKTEEQLERSFVDLAETVSRAMVSRDPYT
FT                   ATHQRNVAELSRLVGKKMGLDENRLKGLYIGGLLHDIGKISIPESLLNKPGQLTEEEWN
FT                   LVRTHAKRGYEILKDANFPWPVAEMALHHHERLDGSGYPDGLSGDELSLEVRILSACDA
FT                   AEAMIAYRPYRPAKSIQETIDELESGKGEKYDATVADILLQIIREGKFDFNSCL"
FT   gene            complement(30290..30397)
FT                   /locus_tag="COPRO5265_0033"
FT   CDS_pept        complement(30290..30397)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0033"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ACI16929"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y6K8"
FT                   /protein_id="ACI16929.1"
FT                   /translation="MASEETMGFRGVKVLLAAEQRSLTASTVDRIKVTS"
FT   gene            30731..31921
FT                   /gene="trpB"
FT                   /locus_tag="COPRO5265_0034"
FT   CDS_pept        30731..31921
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trpB"
FT                   /locus_tag="COPRO5265_0034"
FT                   /product="tryptophan synthase, beta subunit"
FT                   /EC_number="4.2.1.20"
FT                   /note="identified by match to protein family HMM PF00291;
FT                   match to protein family HMM TIGR00263"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17967"
FT                   /db_xref="GOA:B5Y6K9"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR006653"
FT                   /db_xref="InterPro:IPR006654"
FT                   /db_xref="InterPro:IPR023026"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y6K9"
FT                   /protein_id="ACI17967.1"
FT                   /translation="MITNKKAKFGEFGGQYVPEAVMQALIELENEFNRAKNDEQFLEEY
FT                   HYYLREYDGRPTPLYYAENLTRTLGGAKIYLKREDLNHTGAHKINNALGQVLLAKRMGK
FT                   KRIIAETGAGQHGVATATVAALFGMECEIFMGAEDVQRQRLNVFRMELLGAKVRSVTSG
FT                   SSTLKDAVNEAIKDWVEHIDSTFYLIGSAVGPHPYPLMVREFQKVIGEEAREQILQKEG
FT                   RLPDYVLACVGGGSNAIGIFYPFVQDTQVRLIGVEAAGKGLDTNKHAATFNRGTVGIIH
FT                   GMKTYLLQSPDGEITEPYSVAAGLDYPGVGPEHSYLKDIGRAKYESATDEEALAAFELL
FT                   SRVEGIIPALESSHALAYAIKLAPKLSKDQIIIVNLSGRGDKDVQQVAKMKGIEEI"
FT   gene            31947..32771
FT                   /gene="trpA"
FT                   /locus_tag="COPRO5265_0035"
FT   CDS_pept        31947..32771
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trpA"
FT                   /locus_tag="COPRO5265_0035"
FT                   /product="tryptophan synthase, alpha subunit"
FT                   /EC_number="4.2.1.20"
FT                   /note="identified by match to protein family HMM PF00290;
FT                   match to protein family HMM TIGR00262"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17605"
FT                   /db_xref="GOA:B5Y6L0"
FT                   /db_xref="InterPro:IPR002028"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y6L0"
FT                   /protein_id="ACI17605.1"
FT                   /translation="MENKNTRIQKAFEEINRERRKVLIAYITAGYPSLQSLGPIVKALE
FT                   DGGANMVQIGIPFLDPVGDAPVVQILSKKAIENGFTMEKFFRALSKLREETTLPLILRA
FT                   YYTTIFGYGEDRFVQACKEASVDAVVVPDLPLEESGILKSKLDAIGVPLVPIVVPAPQE
FT                   RIKAIVASGGGFVYLMMGPAENETAFVNQLNDFAKQVKQITNLPLCLGIELRDPILAKK
FT                   LTKDADNIDSILVGDVLMETVRHACETNEFCHLTDELARIVEDFSTSLVLRR"
FT   gene            32878..33495
FT                   /locus_tag="COPRO5265_0036"
FT   CDS_pept        32878..33495
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0036"
FT                   /product="dithiol-disulfide isomerase"
FT                   /note="identified by match to protein family HMM PF01323"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ACI16967"
FT                   /db_xref="GOA:B5Y6L1"
FT                   /db_xref="InterPro:IPR001853"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y6L1"
FT                   /protein_id="ACI16967.1"
FT                   /translation="MEIEFFHDVLCAWCYALSPRLRRLTEEFPDIKVIHRGFPLAPEPN
FT                   DIVQMFGSKEKGKRDILQHWKAANMNDDEHRINAELMEQRDFDYPYSTPALLACKAAEL
FT                   QGGQAMHWNYFDKVQEAHLTLCRNIADFDVLTDIARELSLDVEKFSADLRGEQVKYLLR
FT                   LDIDRALELGVEATPTLVANDGMLTGAVPYDSLKRWYVKVRQ"
FT   gene            complement(33594..34484)
FT                   /locus_tag="COPRO5265_0037"
FT   CDS_pept        complement(33594..34484)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0037"
FT                   /product="putative phosphotriesterase"
FT                   /note="identified by match to protein family HMM PF02126"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17748"
FT                   /db_xref="GOA:B5Y6L2"
FT                   /db_xref="InterPro:IPR001559"
FT                   /db_xref="InterPro:IPR017947"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y6L2"
FT                   /protein_id="ACI17748.1"
FT                   /translation="MESVLGNITALGKTLAHEHLTINLSFNKSDDSNLNDDLAMLEDLK
FT                   DLKAAGVDTIIDVTNIGMGRNIERMRKLSIQSGMNVIASTGYYKSPYLPSEVEQLSVEQ
FT                   LCSIMELEITKGIDGTEIKAALIGEIGTSDQMTDSEKKVFEAAALAHLRTGVPIYTHTT
FT                   LGKLGIEQIEFLINNGVNPAKVVIGHLDLNPDMEYYKRVADYGCYMGFDTVGKISYQPD
FT                   EIRAKNIAALVKLGFGNSILLSLDITRKSHLKSYGGYGHVYLFEKFIPMLYEQGLTSQD
FT                   VDRLLIDNPSAWFLQ"
FT   gene            complement(34496..35776)
FT                   /locus_tag="COPRO5265_0038"
FT   CDS_pept        complement(34496..35776)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0038"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17090"
FT                   /db_xref="GOA:B5Y6L3"
FT                   /db_xref="InterPro:IPR019733"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y6L3"
FT                   /protein_id="ACI17090.1"
FT                   /translation="MNIVIIAAIGALAALLAQRGIAVFNDGLRPIMPEYLEGRMTKAEL
FT                   AATSFALSFGLVIGFGIPVSIGAAILLVHSILLGTDIIGTWSPKGNTGSLIAAIIGALY
FT                   GVGLLLGLQWIVNVFKSLPVNVFDAMGAVGTPVTLAFAAFPALAVALQHGVSKGIITLS
FT                   ISALVRVLIVRFSPFVIGGVSISLNPDGMAMLAGMIVLLIYAAQEKATEGTGLAALFSD
FT                   RVARIKSNVWVLGLMGALVAAATAMHLLAGDPISLNLVKAGNYTDAALAALARAIGFVP
FT                   LVGTTAIATGVYGPVGMTFIFAAALFVNNPIIAAVLGFVIIFAEVYLLGAIAGFLDKFP
FT                   GIRKSADNIRSSMSQLLEIALLVGGINAGNAMLPGLGMLLVIGIYLLNEAAGRPIVHMA
FT                   VGPVGAIIVGILVNILAVIGLYIPPTI"
FT   gene            35837..36325
FT                   /locus_tag="COPRO5265_0039"
FT   CDS_pept        35837..36325
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0039"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17080"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y6L4"
FT                   /protein_id="ACI17080.1"
FT                   /translation="MVVCESKSNFPLLYRIYHLLLFWRPSSHGDSWSNCHMKNMLVIKQ
FT                   NLIPASPGEPLPYNTGFGLTERLYELLLKASKDMRTTMSEVIRMALNYVIFDEKQIKQL
FT                   REKKEENDKLACWRTVNLNELQAKKITELSTKYGISKSKIINMSIGIFLKQIYNRDAL"
FT   gene            36326..36595
FT                   /locus_tag="COPRO5265_0040"
FT   CDS_pept        36326..36595
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0040"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17184"
FT                   /db_xref="InterPro:IPR012854"
FT                   /db_xref="InterPro:IPR036582"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y6L5"
FT                   /protein_id="ACI17184.1"
FT                   /translation="MRDRASKYAITAIVIFFFLLSLQLPVLAAAPKIIIDGTELKIDAN
FT                   PVVVDGRTLVPLRGIFEALGAIISWDGNTKTITAQKICGEHRKQ"
FT   gene            36885..37751
FT                   /locus_tag="COPRO5265_0041"
FT   CDS_pept        36885..37751
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0041"
FT                   /product="tyrosine recombinase XerD"
FT                   /note="identified by match to protein family HMM PF00589;
FT                   match to protein family HMM PF02899"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18077"
FT                   /db_xref="GOA:B5Y6L6"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y6L6"
FT                   /protein_id="ACI18077.1"
FT                   /translation="MLELYHEYLVKKGKSPHTIKNYISDLMQFQKWFEESTGEQFSPGK
FT                   ITEIDVRSYRSYLINIRQLKPSSIKRKLEAIRKFLDWTVKQDIISKNPAKEVEAPASVT
FT                   LPPRSLSEKEFLRLRRSFYKEGNERDIAIFEVLANTGIRVSELCSLKLSDVQISERKGK
FT                   LIVRYGKGQKYREVPLNSDARKALNEYLKSRADENNERLFLGERGPLTPSGVFRIIKRY
FT                   ARDAGVEVSPHQLRHTFARRLLQSGADIVTVQQILGHANLNTTAVYLKPDYAEQEEAVE
FT                   KISKLHL"
FT   gene            37765..38361
FT                   /locus_tag="COPRO5265_0042"
FT   CDS_pept        37765..38361
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0042"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17333"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y6L7"
FT                   /protein_id="ACI17333.1"
FT                   /translation="MLHLQLYFERFCRKCKKRIAVLVHDYGTINSIDEADQKLGNLNIP
FT                   VMPIRCPQCGGEDWPEYALAHDATRNVTFQRIAIGTEDLPIVGGSVPYAHVRSPEEQAE
FT                   LERGLAKLKDFFSEREGKFWDEYCRWAVERWNEALKWLADIEWRKAYKELGIGIGANSG
FT                   PAAYRKDAEKRFITQEEKERFWRTANSHLVYFELL"
FT   gene            38401..38949
FT                   /locus_tag="COPRO5265_0043"
FT   CDS_pept        38401..38949
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0043"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17501"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y6L8"
FT                   /protein_id="ACI17501.1"
FT                   /translation="MYGRERITWLLLNLPLPEELERYRTEKLAAVIPKKSSGPQAVLWE
FT                   RIKQLGDELTRQRRRAENLAKQLFEEHAEKARLSEELHVLRKEIEQLKNNSQSATRNID
FT                   DVLRIKRLKTLISELREENTKLRRQLEELGIKEVQDIEGEYEERNDEAVEAVGKTQDIE
FT                   EDVLGRIRNKNVAVYGRVG"
FT   gene            39043..39192
FT                   /locus_tag="COPRO5265_0044"
FT   CDS_pept        39043..39192
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0044"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18011"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y6L9"
FT                   /protein_id="ACI18011.1"
FT                   /translation="MLTRLCSHEVMWAAKEYVADTGKPIAFSRASGVEGIVREVYKLLT
FT                   EKEE"
FT   gene            39589..40935
FT                   /locus_tag="COPRO5265_0045"
FT   CDS_pept        39589..40935
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0045"
FT                   /product="chitin synthase"
FT                   /note="identified by match to protein family HMM PF00535"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ACI16970"
FT                   /db_xref="GOA:B5Y6M0"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y6M0"
FT                   /protein_id="ACI16970.1"
FT                   /translation="METRLNTETKLPPSYKTVYIPVIYKFFIAQSIAFTWMIFSIRISI
FT                   PWLKDLSSVVGLPLAVFIIAFIAYIPGYLVAFVAVSLLLDRQPPFKEKNPDLHVTILIA
FT                   ARNEAAKIRNTLKYIANQDYNGKIDVIIVDNNSTDGTLEAAQKAANEYGLNCTFLFEPK
FT                   AGKSYALNTGLKAIKTEYFMTLDADTLLHKKAVNNIVARILSSPSDVCAVAGHVLARNS
FT                   RDNILTRMQEWDYFLGIASLKRMQGLYQGTLVAQGAFSLYKTDVVREVGGWDDVIGEDI
FT                   VLTWKFFEKGYRVFFEPLAIAFTEVPNRFKHFTRQRSRWTRGMLEGLKKAGPWKQERFL
FT                   AIFLLGIDILIPLIDLAFTIFWIPGLVLAFFGKYYIVGPYTLLVLPLNVLVTVIMYSFQ
FT                   KNIFDALGLRVRRNRIGYTFYLLFYQIIHSPISVMGYIQEIFKLERVWK"
FT   gene            complement(41206..41310)
FT                   /locus_tag="COPRO5265_0046"
FT   CDS_pept        complement(41206..41310)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0046"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17242"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y6M1"
FT                   /protein_id="ACI17242.1"
FT                   /translation="MACFPFVSFSFLIVNLPQITEKFFFITPYRNDKN"
FT   gene            41493..42797
FT                   /locus_tag="COPRO5265_0047"
FT   CDS_pept        41493..42797
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0047"
FT                   /product="RmuC domain protein"
FT                   /note="identified by match to protein family HMM PF02646"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18062"
FT                   /db_xref="InterPro:IPR003798"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y6M2"
FT                   /protein_id="ACI18062.1"
FT                   /translation="MIIALLQIAIYVAVTKRREDPELIKFLTGLEDNQKQLESLIKDGM
FT                   KSSKEEMTNLVANLANMITTNISEMNSTITKNISEMGISQQNLIKNFSDTVSSLADKTE
FT                   ERLNRMRDTIEAKLKEIQDENSSKLEQMRQTVDEKLQSTLNARISESFKLVSERLEQVH
FT                   SGLGEVQSLVNDVGDLKKVLSNIKTRGILGEDQLEAIIEDILVPGQYEKNVIVRPGSRE
FT                   VVEFAVKIPVENGGNGSYMWLPIDAKFPMEDFERLIDAEERCDTAECERLRKELENRLK
FT                   QCAKDIRDKYIDPPNTTDFAIMFLPAESLFAEALRKPGFIEVLQRECRVLITGPTTLSA
FT                   VLNSLRQGFKIFAIEKKAEEVWKLLGAVKTEVGKFGDLLEKVNKKLQEAQNVIEDASRK
FT                   TRTIDRKLRNVEEISPEETAELLALSPSSPDDDAF"
FT   gene            42800..42937
FT                   /locus_tag="COPRO5265_0048"
FT   CDS_pept        42800..42937
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0048"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17412"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y6M3"
FT                   /protein_id="ACI17412.1"
FT                   /translation="MKKEIIKHLKLLILLNAFDGIVTHIGVSAGYIEEWNSKTPRKWAQ
FT                   "
FT   gene            43210..44091
FT                   /locus_tag="COPRO5265_0049"
FT   CDS_pept        43210..44091
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0049"
FT                   /product="prophage LambdaCh01, nuclease domain protein"
FT                   /note="identified by match to protein family HMM PF00565"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17414"
FT                   /db_xref="GOA:B5Y6M4"
FT                   /db_xref="InterPro:IPR002071"
FT                   /db_xref="InterPro:IPR004026"
FT                   /db_xref="InterPro:IPR016071"
FT                   /db_xref="InterPro:IPR035437"
FT                   /db_xref="InterPro:IPR035451"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y6M4"
FT                   /protein_id="ACI17414.1"
FT                   /translation="MKKLIAVSVMLILIAGLLAACGNEAAPTPPAAGKTAEAASNAQHV
FT                   EAVSSSGSKQPKQEQQPTVEKPAAGDKIEQVTSTENEKAEEGIELIKAKVTKAVDGDTV
FT                   YVKLESDKEEKVRFIGVDTPESTTKVEPYGKEATAYTKSKLLNKDVWLELDVQERDKYG
FT                   RLLAYVWLSPPTKESDEEIRTKMFNAVLLLEGYAQVMTVPPNVKYAEYFRKYQQEAMEK
FT                   SAGLWGLEVKEEKPAFSQAVSASYIGNKNSKKFHLPDCQWTEKIAPGNRVYFKSRDEAI
FT                   KAGYEPCKVCKP"
FT   gene            44218..45033
FT                   /locus_tag="COPRO5265_0050"
FT   CDS_pept        44218..45033
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0050"
FT                   /product="ymh, putative"
FT                   /note="identified by match to protein family HMM TIGR02391"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18226"
FT                   /db_xref="InterPro:IPR012654"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y6M5"
FT                   /protein_id="ACI18226.1"
FT                   /translation="MGTSDENKTLKLFSLSALEKLADIVADYHTGSGITELFRKAGFPE
FT                   IRHDGSTKRWFVYQALQQVHQQHYGPYNVLKVIEALCNPEEFIGKPQVQQQVLEKVNEI
FT                   LRFYDLFVGEDGKVRRTSETETALTTRLLEGRRFDERGFHPEIRKHARQLFLEGYYFHA
FT                   VLECCKALEKFVREKSGINKHGAELMSAALNLNNGPLKLNSQRTESERNEQEGVMHLCI
FT                   GLMRAIRNPASHEPALDWTITREDALDLLSLISYLFRQIEQAVYFRIRN"
FT   gene            45168..45797
FT                   /locus_tag="COPRO5265_0051"
FT   CDS_pept        45168..45797
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0051"
FT                   /product="N-6 DNA methylase"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ACI16902"
FT                   /db_xref="GOA:B5Y6M6"
FT                   /db_xref="InterPro:IPR022749"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR038333"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y6M6"
FT                   /protein_id="ACI16902.1"
FT                   /translation="MATNTLDLPTLENWLWEAACKIRGPVDAPKFKDYILPLIFLKRLS
FT                   DVFEDEVNHLAEEFGSTDVAWKLVEEAHQHGQPLVRFYLPPEARWDVIRQKTTGLGEYL
FT                   TDVMRAVARENPKLHGVIDVVDFNATAAGQRIIDDPPLAELIQVLSKYRLGLKDVEPDI
FT                   LGRAYEYLLRKFAEGWLGAAGSVVALVLMAGIIYTLYTNSLKREKP"
FT   gene            45822..46712
FT                   /gene="fimA"
FT                   /locus_tag="COPRO5265_0052"
FT   CDS_pept        45822..46712
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fimA"
FT                   /locus_tag="COPRO5265_0052"
FT                   /product="major pilin protein FimA"
FT                   /note="identified by match to protein family HMM PF06267;
FT                   match to protein family HMM PF08823"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17737"
FT                   /db_xref="InterPro:IPR010430"
FT                   /db_xref="InterPro:IPR014927"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR036365"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y6M7"
FT                   /protein_id="ACI17737.1"
FT                   /translation="MKSVVSQMRNISTFSIVARDPKTGELGIAVQSKFLAVGAVVPWAK
FT                   AGVGAIATQAAANLDYGELGLKLLKKGYSPQAVLDALLALDDGREDRQVGIVDANGNSV
FT                   TYTGENCFPWAGGIAGQDFACQGNILVSEATVNALKETFLSTEGPLAKRLVTALDAAQD
FT                   AGGDRRGRQSAALLVVKEKGSYGGYNDRYIDLRVDDHPDPIKELIRLLDLYNMYFSKTT
FT                   EGEKVKVTPEIVSSMQEALRNLGYYDGPVSGAFDEKTKNAYKNFCEFENFEERLCEGNF
FT                   VDKRVIEFLLNKGKA"
FT   gene            46922..47743
FT                   /locus_tag="COPRO5265_0053"
FT   CDS_pept        46922..47743
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0053"
FT                   /product="oxidoreductase"
FT                   /EC_number="1.-.-.-"
FT                   /note="identified by match to protein family HMM PF00248"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17750"
FT                   /db_xref="GOA:B5Y6M8"
FT                   /db_xref="InterPro:IPR018170"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y6M8"
FT                   /protein_id="ACI17750.1"
FT                   /translation="MSVLTETYVLHNGVKIPKIGFGTWQIPNGEVAYNSVSYALEVGYR
FT                   HVDTAYVYGNEESVGKAIRESGIPRDQIFVTSKLPADVKTYDGTLDYFERTLRNLNMDY
FT                   LDLYLIHWPWPWNEKGKDYKKENIEVWHAMEELYKSGRIRAIGVSNFDVEYLQVLMDNC
FT                   SVKPMVNQIRFFIGNTQEEITQFCQQNGILVEAYSPLATGRLIENDTIKKIADKYNKTV
FT                   AQICIRYVIQRNALPLPKSTTPSRIKENADVDFEISPEDMEYLNSLKDTVE"
FT   gene            47961..48530
FT                   /locus_tag="COPRO5265_0054"
FT   CDS_pept        47961..48530
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0054"
FT                   /product="serine acetyltransferase (SAT)"
FT                   /EC_number="2.3.1.30"
FT                   /note="identified by match to protein family HMM PF00132"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17185"
FT                   /db_xref="GOA:B5Y6M9"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005881"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR042122"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y6M9"
FT                   /protein_id="ACI17185.1"
FT                   /translation="MRLYILGTELKKARNALKEDRQALLKSDPSIETPADIRFHAGYRS
FT                   LRLYRYAHAFYVAGFRNVSAFIHFISRVLYAVDIHPAAEIEPGVVVDHGMGVVIGSTAK
FT                   VGSGTVIYHGVTLGAKNITTGKRHPQVGKNVFIGAGATLLGAINVGDGARIGAGSVVVE
FT                   DVPPYSTVVGVPAKVVKQDCVKEVVA"
FT   gene            48527..49396
FT                   /locus_tag="COPRO5265_0055"
FT   CDS_pept        48527..49396
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0055"
FT                   /product="cysteine synthase (O-acetylserine sulfhydrylase)
FT                   (O-acetylserine (Thiol)-lyase) (CSase)
FT                   (Superoxide-inducible protein 11)(SOI11)"
FT                   /EC_number="2.5.1.47"
FT                   /note="identified by match to protein family HMM PF00291"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17540"
FT                   /db_xref="GOA:B5Y6N0"
FT                   /db_xref="InterPro:IPR001216"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y6N0"
FT                   /protein_id="ACI17540.1"
FT                   /translation="MIGIMETPLVCIEPYGIYAKLERFNPTGSIKDRPAYFMLVHALKE
FT                   NLIQPGGTLVEPTSGNTGISLAALGSQVGIKVILTMPASVTPERVKLAQSYGAEVILTP
FT                   AEKGIPGAIEKAKQLQEKHHAYIPDQFNNPFNVLAHELTTGPEILKQTNWEVDAFVAGV
FT                   GSGGTISGVGRALRRVLGNRVKIIAVEPAESPVLSGGKGGSHIIQGIGAGFIPTIFDKD
FT                   LVDEIITVRGNEALEGVKMLSAKGYSVGISSGANFIAALRIKEKYNLAHVVTVFPDDGL
FT                   KYLSTIAY"
FT   gene            49711..50361
FT                   /locus_tag="COPRO5265_0056"
FT   CDS_pept        49711..50361
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0056"
FT                   /product="redoxin superfamily"
FT                   /note="identified by match to protein family HMM PF00578;
FT                   match to protein family HMM PF08534"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ACI16939"
FT                   /db_xref="GOA:B5Y6N1"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR019479"
FT                   /db_xref="InterPro:IPR022915"
FT                   /db_xref="InterPro:IPR024706"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y6N1"
FT                   /protein_id="ACI16939.1"
FT                   /translation="MFEEQTRMPLIGDKFPELEVKTTFGPMKLPDDFNGKWVVFFSHPG
FT                   DFTPVCTTEFVAFQKRFDEFKALNTELIGLSVDQVPSHIKWVQWIKDNLGVEIQFPIIA
FT                   DELGRIAKALGLIHPAKGTNTVRAVYIVDPKGIIRAILYYPQEIGRNIDEIIRMIKAFQ
FT                   TADANHVAIPANWPNNELMGDEVIIPLPPDIKGAEERMNQPNCYDWWLCHKKI"
FT   gene            50337..52427
FT                   /gene="pcrA"
FT                   /locus_tag="COPRO5265_0057"
FT   CDS_pept        50337..52427
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pcrA"
FT                   /locus_tag="COPRO5265_0057"
FT                   /product="ATP-dependent DNA helicase PcrA"
FT                   /EC_number="3.6.1.-"
FT                   /note="identified by match to protein family HMM PF00580"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18121"
FT                   /db_xref="GOA:B5Y6N2"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR013986"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y6N2"
FT                   /protein_id="ACI18121.1"
FT                   /translation="MALPQENLIPPSPSHNHLTLSLRSHIGGFFIYNEDVDSVDLSKLN
FT                   EAQKQAVTAPPKPLAIIAGPGSGKTRVLTYRALFAVKEWHLPPERILAITFTNKAADEL
FT                   KERLGRLIPEGDRIFAATMHSFAARMLRYFAPYAGISQNFVIYDDDDSKGLIEDILKQM
FT                   NMDTKRFRPNDVLNHISAAKARMFDCNTFPEFIRQRYGSWGYYFDTVHQVFMTYERLKE
FT                   QSQALDFDDLIMVLAQRMEDRPELREMIAGLFDLVMVDEFQDTNFAQYQMLLYMTNPHY
FT                   SGMNNVTIVGDPDQSIYGFRAAEYYNIKRFIDDYNPEVVFLDLNYRSNRTIVDSASALI
FT                   NDSPSALFERKLESIKGAGNKLILRRPFDDADAAITAAFEVQRLHKMGIPYEEIAVLMR
FT                   TRALTARVEREFATRNIQYHIIGGVPFFARREIKDILAYLRLSRNAMDRVSLKRILTMK
FT                   KRGFGTASLEKLFNFAEENKLTLLEAMKAAVESLLFKKLSMNDYLESLYTLIQTIQEIA
FT                   EPSQAIYLVMEQENLLDHFRSISKSEEEYIERTENVKQLISIAEESADMDDFLQRSALG
FT                   TRENNGGVEGVAISTVHGVKGLEFQAVILYYVTDGFFPHSLSVTTAEKEEERRLLYVAM
FT                   TRAKEHLIFYVPYKQPWGNGFEQMARPSPFLRSIPKELWDGKPNEIESLYAPYSPQQKW
FT                   SE"
FT   gene            complement(52620..52910)
FT                   /locus_tag="COPRO5265_0058"
FT   CDS_pept        complement(52620..52910)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0058"
FT                   /product="molybdopterin converting factor subunit 1"
FT                   /note="identified by match to protein family HMM PF02597;
FT                   match to protein family HMM TIGR01687"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17493"
FT                   /db_xref="InterPro:IPR003749"
FT                   /db_xref="InterPro:IPR010038"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR016155"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y6N3"
FT                   /protein_id="ACI17493.1"
FT                   /translation="MQLSEATMLVNVLYFGHLREATLKEKETLEVPSEATLATLIELLE
FT                   QKYGPEYRNAMDAIKGLRILIDGRDSSILGGTDAPLKEGCTVVFLPPIAGG"
FT   gene            complement(52897..54741)
FT                   /locus_tag="COPRO5265_0059"
FT   CDS_pept        complement(52897..54741)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0059"
FT                   /product="tungsten-containing aldehyde ferredoxin
FT                   oxidoreductase"
FT                   /EC_number="1.2.7.5"
FT                   /note="identified by match to protein family HMM PF01314;
FT                   match to protein family HMM PF02730"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17507"
FT                   /db_xref="GOA:B5Y6N4"
FT                   /db_xref="InterPro:IPR001203"
FT                   /db_xref="InterPro:IPR013983"
FT                   /db_xref="InterPro:IPR013984"
FT                   /db_xref="InterPro:IPR013985"
FT                   /db_xref="InterPro:IPR036021"
FT                   /db_xref="InterPro:IPR036503"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y6N4"
FT                   /protein_id="ACI17507.1"
FT                   /translation="MQGGYMNRILRVDLSNRTWTTEELDEKLVRDYIGGRGFGAKFLYD
FT                   DLKPGIDPLGEENEIIFIAGPLAATGAQSCARFEIYFKSPQTGGYFQSSGGGFFAPEMK
FT                   FAGYDAIIIKGKSEKPVYLWIHDDKVEFKDASYLWGLGLADTEQLIREELNDPYVRVAA
FT                   IGPAGENLVKYAGVFSDRRAAARGGGGAVMGSKNLKGVAVRGHQKVPIANNEAFQQALK
FT                   AQVGAYKGNPMYEMMHTTGTQASELTAVLGMYPWKNFREAPGPEWEKLQASEFNKLRVR
FT                   KMGCQNCMIRCSQITKVWDGPYKGVWSEGPEYETLWSFSGPIGKAEIGLTVLADRLCDD
FT                   LGMDTISAGQSIGFAYELYEKGIITKEDTDGLELVYGNIEPVPRLIEMIARREGFGNVL
FT                   AEGTKRMAEKYNQGSEYYAIQVKGLELPAYDPRGAKAHGLNLATSPLGADHNYGYGSQE
FT                   LFGVPIPHPVDRFAVEGKGEITKFNQDWAAFTETGILCTFASLMTGPDIFSQLLYGATG
FT                   VEEFADPNYMWVVGERIVNLERMFNAREGFTREDDRMPERIVKDPLPYGPSAGQVFEQD
FT                   ELLDQYYEARGWDKVTGIPKAEKLRELGLDFTLDYAAQ"
FT   gene            complement(54914..56242)
FT                   /locus_tag="COPRO5265_0060"
FT   CDS_pept        complement(54914..56242)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0060"
FT                   /product="TldD/PmbA family protein, putative"
FT                   /note="identified by match to protein family HMM PF01523"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17954"
FT                   /db_xref="GOA:B5Y6N5"
FT                   /db_xref="InterPro:IPR002510"
FT                   /db_xref="InterPro:IPR035068"
FT                   /db_xref="InterPro:IPR036059"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y6N5"
FT                   /protein_id="ACI17954.1"
FT                   /translation="MMDDALSHMVEKLVNNGKADKTLVVAQAEENLLTRFAVNRIHQHV
FT                   RQETLNVTVVVEKDKKVGIAGTSSLKPEEADALLNKALQNAELSSGESTLELAETGEQQ
FT                   FDMKSRFVEDLIEAHDERARIVANMIERGEKAQADAFGVLNATREKVIIRNSAGTHLQW
FT                   EGSVGLVKAMYMKGQGSGYQIGQFNNPGNFIWEQLAEKALQKCLDSQHPEPLEPGKYTV
FT                   ILEPLAVGTLLGEMASFSFNARAAYQGHSYIWQHRGEQLFPKFMTIYDWGLDDLTALRL
FT                   PMDFEGYLKKPVQFIEGGEAKDVVFDSRFAKILNHPNTGHALPPEAMSYSPIPLNVIML
FT                   PGQKSMDQLIAETEHGIIVTMLNYVRSYLDPLTVLATGITRNGTFLIEDGKVTKALNNT
FT                   RFLQSFVEALQNTTDIGSELMMVGEEFGSFTAPALKIEKFNFM"
FT   gene            complement(56242..57651)
FT                   /locus_tag="COPRO5265_0061"
FT   CDS_pept        complement(56242..57651)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0061"
FT                   /product="LmbIH"
FT                   /note="identified by match to protein family HMM PF01523"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17744"
FT                   /db_xref="GOA:B5Y6N6"
FT                   /db_xref="InterPro:IPR002510"
FT                   /db_xref="InterPro:IPR035068"
FT                   /db_xref="InterPro:IPR036059"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y6N6"
FT                   /protein_id="ACI17744.1"
FT                   /translation="MQKALDQGASYADARRVRRRTENIFVRDGKLEQVGLEETEGYNLR
FT                   VLVDGSFGFAASYDFDKPEKVVSDAVGIARASANVNKKKIEWLHQPPVSGHYEGPMEID
FT                   PFTVPLDKKVSLLLEADKVMATKPQLKHREHFLQFWEEEKEFFSSEGSYVTQHYVESGG
FT                   QIQCTAMEGTQMQVKSYPNSFGDFRKAGWEFIEEMDFVHHAEEVADLAVALLTAPNLPQ
FT                   GVANIIILGPQLSLQVHESVGHATELDRVLGYEASYAGTSFATLDNLGKLQYGSPAMNI
FT                   TSDPTLPYGLGSFGWDDEGTPAHQVYLIKEGLLVDYLSDRETSAQIGHSSSGASRGDGW
FT                   WSLPIVRMTNVNLLPGDKTLEELMDMAGEGFVFDINKNWSIDDKRLNFHFGSEAAWEIK
FT                   NGKKGRLYKNPSYWGITPEFWNSLVAVAGPQEWRVWGLPNCGKGEPGQVMRVAHGTAPA
FT                   LFKNIKVGGNE"
FT   gene            57624..59255
FT                   /gene="dnaA"
FT                   /locus_tag="COPRO5265_0062"
FT   CDS_pept        57624..59255
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaA"
FT                   /locus_tag="COPRO5265_0062"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /note="identified by match to protein family HMM PF00308;
FT                   match to protein family HMM PF08299; match to protein
FT                   family HMM TIGR00362"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17082"
FT                   /db_xref="GOA:B5Y6N7"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y6N7"
FT                   /protein_id="ACI17082.1"
FT                   /translation="MLLGLKLSALNLLGNLSIETHLLIYTAIIYTVYLRKNVFLRNPKN
FT                   MFHLCLQQFFLEMFHVEHGKGCWNFFVGFPQSPVENVDNFLVSCGYVIEFSTGGVENMD
FT                   PKELWKRFLLEIQKYVSKPAFEMWFKDSAIDSLSEDKVTISVSSDTAKDYIEENYMPIV
FT                   KEALRRITGMALEVEVIVQKKNTPDVFSDNPVKKGKPKSLIRLNPRYTFDEFVVGDSNR
FT                   LAYAGARAVAENPGKRFNPLFIWGGVGLGKTHLLHAIGNYLLQQQEPDMQVLYITAEEF
FT                   TNEMVESIKKNSPEDFRAHYRTVDVLLIDDIQFIAGKEATQTEFFHTFNTLYQAGKQIV
FT                   ITSDHPPQELTLLEDRLRSRFQQGLTVDIQRPDFETRVAILERKAQKEGLDVPSEVIEF
FT                   IAHAVATNIRELEGALTKVTALATLQNVPMTLGLAKQALGDVNTNQSAVLNAQTIAEQV
FT                   ASYFGMTLEDLKSSKRNQDLVMPRQIAMYLIRQYTDMSYPEIAAFFNKKDHTTVMYAIT
FT                   KIKDAQLNNVSIRHYVNDIKKRLNLL"
FT   gene            complement(59304..59441)
FT                   /locus_tag="COPRO5265_0063"
FT   CDS_pept        complement(59304..59441)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0063"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18133"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y6N8"
FT                   /protein_id="ACI18133.1"
FT                   /translation="MWKTLTKRAYKGCAYCGKPVDYFPQYAPENGIIKTYPQHPQFFFC
FT                   "
FT   gene            complement(59535..60299)
FT                   /locus_tag="COPRO5265_0064"
FT   CDS_pept        complement(59535..60299)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0064"
FT                   /product="ZIP zinc transporter family protein"
FT                   /note="identified by match to protein family HMM PF02535"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17000"
FT                   /db_xref="GOA:B5Y6N9"
FT                   /db_xref="InterPro:IPR003689"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y6N9"
FT                   /protein_id="ACI17000.1"
FT                   /translation="MGILIPFIGTSAGALSVLLMKKEPKPSLQNFLLGFSAGVMIAASV
FT                   WSLLLPSIEMSEQFGRFAWLPAAVGFLFGIFFLLFLDNVIPHLHLDQQSPEGPRSNLQR
FT                   VTMLVLAVTLHNIPEGMAVGVLFASALQGSAQTSFAAAYVLSLGIALQNIPEGAIISLP
FT                   LRAEGLPLSKSVIYGILSGIVEPVAAVITLLLTNVVVSILPYLLAFAAGAMIYVVVEEL
FT                   IPESQTGPHSNVSTIGVAIGFVIMMILDVALG"
FT   gene            complement(60358..60459)
FT                   /locus_tag="COPRO5265_0065"
FT   CDS_pept        complement(60358..60459)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0065"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17602"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y6P0"
FT                   /protein_id="ACI17602.1"
FT                   /translation="MGTMQLAYSDFALTRCKVVLLFAHGWRTIKRCL"
FT   gene            60595..61680
FT                   /gene="dnaN"
FT                   /locus_tag="COPRO5265_0066"
FT   CDS_pept        60595..61680
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaN"
FT                   /locus_tag="COPRO5265_0066"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="identified by match to protein family HMM PF00712;
FT                   match to protein family HMM PF02767; match to protein
FT                   family HMM PF02768; match to protein family HMM TIGR00663"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ACI16896"
FT                   /db_xref="GOA:B5Y6P1"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y6P1"
FT                   /protein_id="ACI16896.1"
FT                   /translation="MPIILRKEELIQSLEAVLRHVPKKTTQPVLYNILLEATDTALKIT
FT                   GTDMKSALSYKIALEAAEELRTTVPAKFFSDFVKKAPGSEVQLEVGENYLSISSGSASL
FT                   KLSTLPPEEYPELEVLQGNTFTVDAATLKKAVDAVKKNVSKGELRNPVLEGILLDGSEG
FT                   MLIAVGTDGHRLAACKTDLQVTETACLPADVLSDVCDTLVNTGSTAYITFGDGEVAFEN
FT                   DVIYAVIRTLEGQFPPWRSVIPKTVETTVRLSKKTMGDVLDRAGMLAKTYDDAVRLTLE
FT                   DGSLTISAEVPELGSFVESIPVDKEGPDLKIACNYAYLQDVLSGIDEDNVVFGLTSPLH
FT                   PIVIRPVESENYVGLVMPMKL"
FT   gene            61681..61914
FT                   /locus_tag="COPRO5265_0067"
FT   CDS_pept        61681..61914
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0067"
FT                   /product="conserved domain protein"
FT                   /note="identified by match to protein family HMM PF01479"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17789"
FT                   /db_xref="GOA:B5Y6P2"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y6P2"
FT                   /protein_id="ACI17789.1"
FT                   /translation="MSREAIVIMIELQQFLKIVLNVTGGEAKHIIQDGLVCVNGVVETR
FT                   RSRKLAQEDVVEVNLEEVAGEKFKVSDFIKGQ"
FT   gene            62194..63627
FT                   /gene="norM"
FT                   /locus_tag="COPRO5265_0068"
FT   CDS_pept        62194..63627
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="norM"
FT                   /locus_tag="COPRO5265_0068"
FT                   /product="Na+-driven multidrug efflux pump"
FT                   /note="identified by match to protein family HMM PF01554;
FT                   match to protein family HMM TIGR00797"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17142"
FT                   /db_xref="GOA:B5Y6P3"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y6P3"
FT                   /protein_id="ACI17142.1"
FT                   /translation="MPQENSGDCNNTITTDAEVPTKTTSDGISIEELIKDPKLINKRVW
FT                   QLAWPAMVELLLSTLFSMVDMIMVGRISYQALTAVGLTNHPTMLALAVFQALNVGSTAL
FT                   VARFIGSGDIKNAKATVRQSMVLVTILGIVVSIAGYLLSPAIITFMRAEPDVYPMSVTY
FT                   LQIVSLGWLFTTISLNVGAILRGSGDTMTPMRYNLLSNLLNVVGNYVLIFGKFGFPAMG
FT                   VAGAALSTTLCRGVAAFLALRAIFNKNRNIGVSLKDDYRIDKNLLERLISIGLPSAMEQ
FT                   FLLRLGQVFFSRAVAGLGTAVYAAHQTAINISSLTFTPGQAFGMAATTMVGQSLGAKHP
FT                   DVAEKAGLVARRMGLIIALAIAIVLFFFGYDVALLYVDDPEVARAAANALKILAIMQPM
FT                   QSTQFILAGALRGAGDTRWPLYSTAIGIWGIRVVLVHVFIAMGMGLMGAWVAQLCDQAF
FT                   RAVFIYTRYKSGAWKHSKV"
FT   gene            63754..65376
FT                   /locus_tag="COPRO5265_0069"
FT   CDS_pept        63754..65376
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0069"
FT                   /product="maltose ABC transporter, periplasmic
FT                   maltose-binding protein"
FT                   /note="identified by match to protein family HMM PF01547;
FT                   match to protein family HMM PF07833"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17924"
FT                   /db_xref="GOA:B5Y6P4"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="InterPro:IPR006060"
FT                   /db_xref="InterPro:IPR012854"
FT                   /db_xref="InterPro:IPR036582"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y6P4"
FT                   /protein_id="ACI17924.1"
FT                   /translation="MKKTLSMLVMVALLLGFATVLPTTAQTNKLLELYIGDTTAYVNAA
FT                   SVKLDSPPVIQNSRTLVPVRFISEQMGAKVTWNDVKRQVTIAQGTKTIILTINSNKVLV
FT                   NGKTVTIDVPAKIINSRTMVPVRFVSEQLGYKVKWDPVSYRVLVSNFDTAMPVNKNVKG
FT                   TITVWHGWGLGTAEADALDKIIAEFQKAYPNVIVNQVPVDFNNLQNKFLTAAPQGQGPD
FT                   IVIGPHDWLGQFAKAGLIDPISISELVLRANYLTTAVNGVSYAGKVYGLPESVKSDALF
FT                   YNKDFVKTLPTSINDLLNAHQKYPVPGGSPLVFNAGDFYHESWLHFGMGGGVFNGTNYK
FT                   DVSPIKNAGAVKAFQALVDMKNKSVMPSSLPDYGTSMSLFTNNKAAFFITGPWEYANLK
FT                   KALGDKMGVMVIPGGKPFVTIESTMLSKYAKNKPAALEFMKFFTGATLGQSNFDAAAYL
FT                   GKQIGHVPAAVNAYSDTSIANDPIIKVFSAQAAKGVPIPNAPEMASVWSAMNQILPTVY
FT                   QGKLSPQEAANQAYQQITEQIGK"
FT   gene            65513..66433
FT                   /locus_tag="COPRO5265_0070"
FT   CDS_pept        65513..66433
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0070"
FT                   /product="maltose transport system permease protein MalF"
FT                   /note="identified by match to protein family HMM PF00528"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17788"
FT                   /db_xref="GOA:B5Y6P5"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y6P5"
FT                   /protein_id="ACI17788.1"
FT                   /translation="MSKVREWLTAYGFIAPAMIAIMLVSVYPLLFGVSIAFTDMSVFNY
FT                   LSQEYKFIGFSNFSNMLHDPEIWILTYRTIIWTVINVFLHVSLGIVFAMLLSKPWLKLK
FT                   PIFRLILILPWAIPSFISIQVWHAMFNEQFGALNQLLQMVGLNPIPWLSNPTWAFVAVV
FT                   LTNVWLGVPFMMLIALGGLNSIPEEIQEAAYVDGASPWQTTRYITLPLLLRTMVPAIVL
FT                   GIIWTFNKFDVIYLITQGGPQTVVNLAGQQKVMGATDLLITKIYKTAFQYPNSWGMAAA
FT                   MGYLVFLVLLLLSLLNLQIQNLVKE"
FT   gene            66440..67309
FT                   /gene="malG"
FT                   /locus_tag="COPRO5265_0071"
FT   CDS_pept        66440..67309
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="malG"
FT                   /locus_tag="COPRO5265_0071"
FT                   /product="ABC-type Maltose/ Maltodextrin permease"
FT                   /note="identified by match to protein family HMM PF00528"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18103"
FT                   /db_xref="GOA:B5Y6P6"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y6P6"
FT                   /protein_id="ACI18103.1"
FT                   /translation="MALKQKPSRFEVFYTYALIIVACIAVLFPIYWIFTTSLRPFDILA
FT                   TPKLELWPEGATLSNYINIFKDQNFYTAFINSIKISVVATLLGVILATLAAYAFSRFEF
FT                   PGKGPFYYYYIISQMFPSVVGLIPLFVIFLRIGLLSEEPFLGIPKVHWALIIIYGAGGL
FT                   AFSVWNMKGFFDAIPKELDEAAMIDGAGSFTIFWRIILPLATPGIAITALFIFMGAWLE
FT                   FVTAMTFLSNPKLYTLPLWINLSITNPFGIPWAKFAAASLVIAVPVTLLFLFLQRYLLS
FT                   GLLRGAIK"
FT   gene            67377..67481
FT                   /locus_tag="COPRO5265_0072"
FT   CDS_pept        67377..67481
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0072"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17449"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y6P7"
FT                   /protein_id="ACI17449.1"
FT                   /translation="MKYCEEVERSDSEEVCKFIGGCGTVPGADASRAS"
FT   gene            67462..72345
FT                   /locus_tag="COPRO5265_0073"
FT   CDS_pept        67462..72345
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0073"
FT                   /product="amylopullulanase (Alpha-amylase/pullulanase)"
FT                   /EC_number="3.2.1.1"
FT                   /EC_number="3.2.1.41"
FT                   /note="identified by match to protein family HMM PF00128;
FT                   match to protein family HMM PF07833"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17347"
FT                   /db_xref="GOA:B5Y6P8"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR012854"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR019248"
FT                   /db_xref="InterPro:IPR036582"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y6P8"
FT                   /protein_id="ACI17347.1"
FT                   /translation="MPVGLVRAQEEPVLTVGDHSVPFLYRDGYYVASATVTPEVKKFTA
FT                   SGGTLPAHEQEISVVGERLLVVNYHDGAFNYKLLPLKSDGVVLEDVKLIRYPEGAVPAG
FT                   TEVTFYVYTPRRDVSKVVLTLTDRGLSDDQAPTSGKPKAVKDIELTKVAESNDGFYDVW
FT                   SYKFTPEEVTWYQYVAYAYDGSKKRQVGEGRLTVYDPDFTTPDWLKNAVIYQIFPDRFK
FT                   NGNPENDVTEEGQKFTFHDDYFDEDFTLPGDYMGQLIQGANWADPVTSWATVTMTDGSK
FT                   KCGYVDSYRFYGGDLEGIIEELDYLKSLGVTAIYLNPIFPSETTHRYDPASYFGVDPRL
FT                   GDAETFKKLTEEAAKRGIKIINDITPDHSGDDSLYFDVKGAYSTVGAHESQESPFFDWY
FT                   TFTEWPDKWQGWAGFSAMPIINVLNPKVQEFFLTGEKNVMKYWHELGSSGWRVDVAMQV
FT                   PMGFTRQMRKALKALDPDNVMIAEVWDHYDQVIPMVLGDSFDSAMNYRVRSLLIGDWDN
FT                   DHAGTNPKFQGFFLKKEMTQEDFWQNYLQMKNDYPREAFYAMMNLVDSHDAARPLYYLT
FT                   NTWDDKAKDAMKALSFFLYTIPGAPTTFYGDEAGATNEGEFGCNKDRPITDDPFMRVPF
FT                   PWGKEDTNLQEWYKNLGAVRNEYSFLRTGEIQPLAVEGSDRVIAYLRYDENGTALALFN
FT                   GSDETATVSVDVGYYFKEDAALKGVIGEDMKLEGGILTLTLKPFETRLAVTTDSVSKAD
FT                   QIDLKGAVDGQKVTLTFSGNTVVEKRDLTTGEVTTLEAKDGLEDVARAGHKYIYTVSVL
FT                   EDGLKVAEGTYTAEIAGQEEVEPPIVAEEEEEPEVPSAVLTPVVIEDPEGDDYGPGYYT
FT                   YPTDPVFKDGDFDLLKFELGLYEGSYTATYTVGNLDDAWGSTIGLSKATYFLFIDNKAD
FT                   EGTTQGIEGLNISFAENFKWDVALQIEGWESKVYKVSSGEINAANAADLGVEIKGTEGA
FT                   PGQVVVYIPKDVVGELTAESKIMVMVAGQDGYGVNRIRQVTPEAQQWRFGGGNEEGTAP
FT                   AVIDMIVPEGMKQEEILDYKTKAVAIPGVSLKPWIQVPSVAVLTPVVIEDPEGDDYGPG
FT                   YYTYPTDPVFKEGDFDLLKFEFGLYEGSYTATYTVGNLDNVWASGNGLSKATYFLFIDN
FT                   KADEGTTQGIEGLNISFAENFKWDIAFQIEGWESKVYQVSSGEISAANAADLSVEIKGI
FT                   EGAPGQVVVDIPKEVVGELTADSKIMVMVAGQDGYGVNRIRQVAPEAQQWRFGGGNEAG
FT                   TAPAVIDMIVPEGMKQEEILDYKTKAVTIPGVSLKPFFVSEGEERLTILTPQDGAVFNT
FT                   MQVDITVKALDANLKQVTIGEKTFDVVEGENTLTGVALPNEGENVIEINDTTGRVLASV
FT                   KVIRDTVPPQIEILSPEEKDLLTERLVAVTAKTEPRVKVQLELLAPGNLAADPVVTNAD
FT                   AEGNVKVDAAFRAFVGLNIMKVTVTDSAGNSAVAYRLFAYDRPHTAILTIGSKQMDVNV
FT                   DTYELDVAPYIKNGYTMVPLRFVAEAFGAEVGWDDGTKTVDIDFAGHHIKVVIGSAEAV
FT                   VDDETVTMPLPAEIVNSRTMVPVRFISEAFGFTVKWDGAARTVTITYP"
FT   gene            complement(72454..73266)
FT                   /locus_tag="COPRO5265_0074"
FT   CDS_pept        complement(72454..73266)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0074"
FT                   /product="nucleotide-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ACI16807"
FT                   /db_xref="GOA:B5Y6P9"
FT                   /db_xref="InterPro:IPR000808"
FT                   /db_xref="InterPro:IPR019591"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033756"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y6P9"
FT                   /protein_id="ACI16807.1"
FT                   /translation="MSENKGNMPLGADNSLTPSEDSEMSHVIAVVSGKGGVGKSTVTAL
FT                   LAVELAKRGYKVGILDADLTGASIPYLFGLQGLLKVTEKGLLEPMKTAQFGIKVVSIAL
FT                   VMENPEMAVIWRGPLLSKAIQQFWTDVDWGELDYLLVDMPPGTSDVPLTVMQMLPLDGV
FT                   VVVTSPQDMARSVVKKAYHMANQLQVPVLGLVENMSYVTCPHCGERFSIFGQKPLTEAA
FT                   QEFNVQVCVELPVDPQLAELTDQGNIEQITVATSSSLKELVDALETLN"
FT   gene            73362..74567
FT                   /locus_tag="COPRO5265_0075"
FT   CDS_pept        73362..74567
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0075"
FT                   /product="anion ABC transporter, anion-binding protein"
FT                   /note="identified by match to protein family HMM PF07833"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18144"
FT                   /db_xref="InterPro:IPR012854"
FT                   /db_xref="InterPro:IPR024370"
FT                   /db_xref="InterPro:IPR036582"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y6Q0"
FT                   /protein_id="ACI18144.1"
FT                   /translation="MRKNWVKIVVLCMTVMAVLLTSSPMVANAQEQTKGTIIMATTTSF
FT                   RDSGLADVLIKEMEKVSGYKINLVAQGSGAAIQMLLRGDAQIGITHAPDSEVQLLEAGW
FT                   IRMPIMTNYFYLVGPKNDPAGVKGKTLTQAFKVIYDKQYPFVTRNDNSGTDVKEKNIWK
FT                   SLGLDANTFGSWYIKTQAGMLNSLQIANEKGAYILTDQSTWIKNKGQLTNLDFITTSGE
FT                   GLNIYSFFFKDPQYKVLADYLKTPEAQAFMRQYYFDPITENTPITTPALTASTVQLAIG
FT                   FKVMPINGLGATGKPYQLDAPPYIKNGRTMVPIRAVTEPFGAKVDWDGATRTVIISFQG
FT                   HTVKMTIGSNVATVDGARVTMDVAPEIINSRTFVPARFVSESLGFTVRWNDKTKTVTIT
FT                   YP"
FT   gene            74798..75544
FT                   /locus_tag="COPRO5265_0076"
FT   CDS_pept        74798..75544
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0076"
FT                   /product="anion ABC transporter, anion-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17968"
FT                   /db_xref="InterPro:IPR024370"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y6Q1"
FT                   /protein_id="ACI17968.1"
FT                   /translation="MKAFSHSESGNEASSWKGETRGRIVLVATTSFRDSGLADVLVKEM
FT                   EKISGYKIDLASKGSGTAIQMLLRGDAQIGITHAPDLEQALVDAGWTRMPFMKNYFCLV
FT                   GPKDDPAGVKDKSLLEAFQIIHDRQLPFVNRNDNSGTDMKERRIWGSLGLDPNTFGDWY
FT                   VKTQAGMLTSLLLANEKHAYILTDQSTWMNNKDKLTNLDLITALEEGENIYSFFFREPQ
FT                   YKVLADYLKTPEARGFIKQYYFDTVE"
FT   gene            75584..76216
FT                   /locus_tag="COPRO5265_0077"
FT   CDS_pept        75584..76216
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0077"
FT                   /product="permease component of tungstate ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17846"
FT                   /db_xref="GOA:B5Y6Q2"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y6Q2"
FT                   /protein_id="ACI17846.1"
FT                   /translation="MLQITAELIWRTLVFTVATTALACVMALLVGTIYASLVRSPWSHL
FT                   SFWRAMSSVPPVLIGLLVYLLFSRQGPLGFLRWLFTPKALVVAQFLLALPMAISLCLQH
FT                   RVSLPRDMEEFIDVNLPKKRLNAMLLHLRGGLVNIGFLTWGRIMGEVGAATLSGGAIVG
FT                   YTSTLSTEIMYRTNLGQFGNAIALGIVLLLISLIPSVILEVTSRAQR"
FT   gene            76203..76790
FT                   /locus_tag="COPRO5265_0078"
FT   CDS_pept        76203..76790
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0078"
FT                   /product="phosphate import ATP-binding protein PstB 2
FT                   (Phosphate-transporting ATPase 2) (ABC phosphate
FT                   transporter 2)"
FT                   /EC_number="3.6.3.27"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17290"
FT                   /db_xref="GOA:B5Y6Q3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y6Q3"
FT                   /protein_id="ACI17290.1"
FT                   /translation="MLSANVHFEIAGKRYHIQLELDNGLYLVMGPNGSGKTTFLRVLLG
FT                   LHPYEGRVNMDKPVGYVPQHYQPLSASVEDNLRLFGVRTLPPGSPLEGKRRLSAMKLSG
FT                   GEKAVLGLTQAMALEPKTFLVDEITAHLDQPSTIMVENILKEYSKQAVVFLVTHQWDTL
FT                   LRLKVPTMLFLNNNAELLDADKAYNRLLETLK"
FT   gene            76883..77782
FT                   /locus_tag="COPRO5265_0079"
FT   CDS_pept        76883..77782
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0079"
FT                   /product="copper amine oxidase N-domain family"
FT                   /note="identified by match to protein family HMM PF07833"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18156"
FT                   /db_xref="InterPro:IPR012854"
FT                   /db_xref="InterPro:IPR036582"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y6Q4"
FT                   /protein_id="ACI18156.1"
FT                   /translation="MRNKFFVPKILLLVLVLFIGCFFPFNLNIINNNLVYAQSEFFFAP
FT                   LALKKLEVTAFPLAVTENKESQINLTLRDVTTASTPAVIAPDSQVTVIVGSYITTATVG
FT                   DGGVARITLPPEVVTGGRLVAVVIVPGYQRMVFSLVVRPSKSEAVLPRDEEGRLVVELR
FT                   IGSFLCRVNDRAVRLPVAPYIKEGRTMVPVRFFTEVLGYTVDYDFSDPAMKKVMIYTPD
FT                   SLPNTAVRENQQAKKATPFITLFIDQTTVIIGGISVDVDSAPELVRGTTMVPLRFVAQT
FT                   LGFYVEWKDPVVKLISTF"
FT   gene            78005..83560
FT                   /locus_tag="COPRO5265_0081"
FT   CDS_pept        78005..83560
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0081"
FT                   /product="protease"
FT                   /note="identified by match to protein family HMM PF00082;
FT                   match to protein family HMM PF02225; match to protein
FT                   family HMM PF06280"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ACI16946"
FT                   /db_xref="GOA:B5Y6Q5"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR003137"
FT                   /db_xref="InterPro:IPR010435"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR015500"
FT                   /db_xref="InterPro:IPR022398"
FT                   /db_xref="InterPro:IPR022409"
FT                   /db_xref="InterPro:IPR023827"
FT                   /db_xref="InterPro:IPR023828"
FT                   /db_xref="InterPro:IPR036852"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y6Q5"
FT                   /protein_id="ACI16946.1"
FT                   /translation="MVSNVKKTISLILALVLIVTVLPLNVFAETPSASNAVNFGDLDQV
FT                   KDQVIETIKNNAEKANVPVDTVDIGGGFVISKDVYEGIKALGGKAKVIVEVNQASFFDS
FT                   WDTNLNAFKNEADKVHAEALNQVKSAVPNFVKQYDLYATLNGFTGVVTLDQLKDILSLA
FT                   GKGRIAQVYISKPYHVDTVGEPISYESMQEIGVTPDMVNSAPLIGAPEAWNLGYTGAGT
FT                   YVAVIDTGIDYTHENFGGYSSFPNAKIPYGYDFADGDNDPMDHNGHGTHVSGTIGGIGK
FT                   AKFKDKDGNLVPLKGVAPDAKIIICKVFSDYGPYAYSADIVAAIEYLIQLKQNGVNVVA
FT                   ANMSLGSDKGFDDPTDPEQKAIKNGYLAGITFAISAGNEAYFEYALGPNYIGANAEGKY
FT                   TSYIKDPARVGAPGASRYAITVAAVNNQGTVLQGQKLSFNNDYVMYLTSSESPDPVAVF
FT                   KKQPITIVDTNSLLCEVPQGDFKGKVLLGDRGTCTFEVKVNNARAAGASGVIIGNNDAD
FT                   ASLVSMALGSAAGTIPAVFIGGPDKLKLRSAISAAGGSLQGVFSDEIATGYAATNPNGM
FT                   ASFTSWGPAPNMAFKPTVAAPGVAIFSSTPGNQYATMQGTSMAAPHVAGAIAVIKQAHP
FT                   DWTPEQIKQALVNTAEPISKYSPRVQGEGRINVAKAVKNNVFITYNNQPYGELGALTGN
FT                   KTITLTITNKGSTTYTANITGYVTTSLEQIVYGNQGATYTVGSISTPASVTVNPGATKT
FT                   IHVTIQPSTSWSNVFIEGRLLFTSSDGTRVFPFLGYFGNWSLYSDKDTINGDSKWPDNN
FT                   NIIDLPWWNADTWEGLTGVYYPYGGRLYYIGRKGGQFEPKALAISAGSDYSTWNDSLVV
FT                   GLGMLRNARALTIYVLDSAGKVVKTIVSENFVRAAVNSSDSTTAGLRTGWSKLWEWDGT
FT                   DRNGNFVPEGQYTIRIVAMPDPLISDEANLLPTQVMDIPVKVDKTPPTIEVSRLENAVT
FT                   SSQDRDGSVIVPTASVFSLVVTGTDESSILTYYFGEEWIPAGSDPLNTAIIELPVLETV
FT                   RQISGTTDVDDGTILAFEIDADDGAGNITYPDNTITVNFAYDNPHTALELENFEAIADG
FT                   KYLKVGFDVLNAPGATYQMTIKDGNGSVVHTATGVVTGLDTVSHQEVKYEITKGGQYTV
FT                   ELTVTDIYGNSASEDGTVSFLSPIISILPDVTFMVVKQGTSTGIAVSVEGTASTGTVSL
FT                   NRITVEDGEVKTTVVKAVAFDGRTFNDTEFIDSTLDAGRYQVNVEVESMFGQVFANSRR
FT                   VVIDGHAPALDDVKVVSDVGSITYKSEFSDNTVDVSVRTDEDTTGQLILKISDDYTYFD
FT                   VYLDDDHIGGWGDTGVGGEGTFFVPVNLDIGLEDTYELRLLDEAGNESTYTINLRVMSK
FT                   MITDVKLEVEGQEIYPEHGGTYTVISAPPVSGTLTFGLSEDYEIESVSVMVNETEVATE
FT                   SPATLTFTQAGEYTIQIRAEDNLGEKETFEFTLEVIEDRPPEIQNVTLESAGRVLELAD
FT                   GGEYEITLPLPVEGVLTFEASDDDEVASISVKLNGEEVATESPATLTFEEAGEYAIEIT
FT                   AVDSAGQITTFTSTLRVIEDVPAIIENVMLVIDDETIEPVNGGEYEITLPLPAEGLLTF
FT                   DVSDDVDVASTSVKLNGTEVGNSSPVTLNFTAAGTYVVQIVAVDSAGQTSTFEFTLNVV
FT                   EEIISTSFELKLEAGLNYFGLPIYVDKTLGEILPGAKVYRRSGTSWVLATSEKPMAYAV
FT                   YRVSLTEAKTVELVGEPFEPSSFTLKRNTSNYISIPQMSPVNANDLFGGALTSISVITT
FT                   GGTMVKVTDGVMLPGKAYVVVVSKDVTINLPSLMPR"
FT   gene            complement(79705..79857)
FT                   /locus_tag="COPRO5265_0080"
FT   CDS_pept        complement(79705..79857)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0080"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17631"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y6Q6"
FT                   /protein_id="ACI17631.1"
FT                   /translation="MDVPCMVAYWLPGVEENMATPGAATVGLNAILGAGPQEVKLAIPL
FT                   GLVAA"
FT   gene            83962..86745
FT                   /locus_tag="COPRO5265_0082"
FT   CDS_pept        83962..86745
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0082"
FT                   /product="copper amine oxidase N-domain family"
FT                   /note="identified by match to protein family HMM PF07833"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18122"
FT                   /db_xref="InterPro:IPR008964"
FT                   /db_xref="InterPro:IPR012854"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR036582"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y6Q7"
FT                   /protein_id="ACI18122.1"
FT                   /translation="MKGMKKLFALFAVLALALTLTPVLTANAAVPVYSMTVKEPVWTTE
FT                   KALGIDLDGGGLSEDPLLKVDGTIGGVTGLDVNNFDFSAASVFYIEPSYNNFTMYVFYN
FT                   DITVLDDGVYALTYDVDGDLTADVSADIPIRLFKVTTKAAVPAEVTSGDKVTISGTVTP
FT                   LDESLGLTVHDYYVAVWREGIVDEPAKYTEISPTGTFELTFNAYGNVGTDYYLTVQTGG
FT                   NYNEAPYYTITVKKLADVTVALTPDTIVAGVDNDVTLQLFVGDVELGNHVVTGTIALGS
FT                   ETATFAGITGARGRIKATGVNFSSVGVADVTVKVSGPDYYGTGTAKLNVSTSEEYGLAV
FT                   KWPTTWKIGEVNTVEFSTPYAGYTVHSVKVKVSGPVKENGEALTGGNSIDVTPLGYGEL
FT                   TLQVEAVLVGTPTQVISKTFSTTIPGYVASVDPEELVRGATQTLTVVVKDAYGNPVNNA
FT                   LVQFISPVNSGDPIAKVNGRTESVNNGTYKLEIVGSKIAKADANSYVEVFSGTKLQAKV
FT                   FVEIARSTGINITLDKSEIVLGPKTTLTVTVASPEALNNAKVKLVDADGENTGVLAYTF
FT                   TGAATVQKVTLPVNTMPEEAGVYQVVVESVNYVGSATLTFIEPVITATPAEILANSSNV
FT                   VTFTSENVDDLRSITQVTATGAVKSITAKIAEDAITATIVTTAEKGTVKVTFKFNSGYE
FT                   HEVKLSSVYGKLTVENATVAFGTKVLTFKPVDAAGATLAAGTDVKINLLGNEYNGSVAA
FT                   DGSVSILIPELPMGTYSVLVKVAGYQDATFSLVVAEAEPEFKTVIELAPGMDIYTVNGE
FT                   TKFWDATPYIKDGRTLVPIRHLAEAIGFKADWDFSDPANKMVFIYTAEQDPEKDKEHPF
FT                   ILLIIGQPTAMVSGNLVALDVAPEILNGRTMVPLRFVVETLGYKVEWLGGTIRLMK"
FT   gene            86871..87242
FT                   /locus_tag="COPRO5265_0083"
FT   CDS_pept        86871..87242
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0083"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM TIGR02058"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17474"
FT                   /db_xref="InterPro:IPR011719"
FT                   /db_xref="InterPro:IPR037103"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y6Q8"
FT                   /protein_id="ACI17474.1"
FT                   /translation="MAWHKLFIEMGMGVDQHGQNPTRACQKAVKDAVHRVCMPSLVEGG
FT                   LLSGCKVKLTVDLAVPGAGTVDISQVREALPLSMDADIVVQEGGLKAKGVAMEELGDKS
FT                   DDMFIAVAAITVWVSCGEE"
FT   misc_binding    87302..87404
FT                   /bound_moiety="guanine and/or adenine"
FT                   /note="Purine riboswitch"
FT   gene            87611..88933
FT                   /locus_tag="COPRO5265_0085"
FT   CDS_pept        87611..88933
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0085"
FT                   /product="xanthine/uracil permease family"
FT                   /note="identified by match to protein family HMM PF00860"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17746"
FT                   /db_xref="GOA:B5Y6Q9"
FT                   /db_xref="InterPro:IPR006043"
FT                   /db_xref="InterPro:IPR026033"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y6Q9"
FT                   /protein_id="ACI17746.1"
FT                   /translation="MIKWLEKHFDFESHGANWTDEIIAGLTTFITMAYILFVNPNILGA
FT                   AGMPKGAVLMATAIGAGISTVMMGLYAKLPFALAPGMGLNAYFAYSVCQGMGLPWQVAL
FT                   GAVFIDGVIFLLLSVTPVRRWIVQAIPLSIKLAASVGIGLFIAFIGMINSGIVVKNDAT
FT                   LVGLGSVTRPETLLALVGLIIIVVLMALRVKGNILLGILITTFIGVFVKGSSGVPITNF
FT                   TGSVVALPNWGELSQTFGAMDVVGALKWGFVSIVFTFTFVDMFDTLGTIAGLAAKLNIL
FT                   KEDGSFEGADRALVTDAVGTMVGAVAGTSTVTTYVESAAGIAEGGKTGATALVTGILFL
FT                   LSLFLWPLAEVVPSAATAPALIVVGFLMMEPILKIDFSELTEAIPAFITMIAMPFTYSI
FT                   ANGLIFGILSYVIMKLFTGKIKEIHPVLAVLALVFVVYLVY"
FT   gene            89160..89381
FT                   /locus_tag="COPRO5265_0086"
FT   CDS_pept        89160..89381
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0086"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ACI16903"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y6R0"
FT                   /protein_id="ACI16903.1"
FT                   /translation="MQHTFVVEYFPYNAESSNVVEEALKLPYVVEAKEGRLIMVTVEAD
FT                   SYEEGRQRAEEVGKKVFGEGNIRVRRAQ"
FT   gene            89619..90668
FT                   /locus_tag="COPRO5265_0087"
FT   CDS_pept        89619..90668
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0087"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17531"
FT                   /db_xref="GOA:B5Y6R1"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y6R1"
FT                   /protein_id="ACI17531.1"
FT                   /translation="MDFKCPQHKGWSWGSLLLLEVAGLFLLQRRPLLSVILVVIPALLL
FT                   LWEENGYVNWSRLFSFTRCQNLVLKKMPEQKEAEEKENTAEQDYSVPHVIFVVNVDSRV
FT                   EGLWDRFDPEGVGRTAWLNLSLMLASFTSVLSFYFPIRFWLYLGLALSVVLLLEMVDFI
FT                   YQGLFRRFYPGALDNGSGMLVLKQISDLLDNVPHWMLFVDGGNVSGAGIDAFKRRYKLP
FT                   RNVLFITLERPGAGTVAVARRHGLWSAVGMPKQVVAFLTKEAGINNFTDFSYRRSLGAF
FT                   LNFRGCASLSVVGQLRGKEESQLMLTDTIECISDKNIQEAGALVLRLVNMIEQPEDNES
FT                   GSGNTTDSN"
FT   gene            90613..91860
FT                   /locus_tag="COPRO5265_0088"
FT   CDS_pept        90613..91860
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0088"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ACI16866"
FT                   /db_xref="GOA:B5Y6R2"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y6R2"
FT                   /protein_id="ACI16866.1"
FT                   /translation="MSNQKTTNPALETQQTPIRRYLEEFTLLTFAFYPWYGRLADTITP
FT                   SKSYWFDILYFVCVFAVIDYRHIRWEKVMRFAPFMLVYFWSSAINGVPLLIFKETLRRV
FT                   VGPFGIMLFASAVDWDYAKLRRLLIYITISGLLMGGVAGYQVLTKQAPQSEWLDTELDT
FT                   DRTIIRVWSIFSIPTYYSIFVDISILVALGLLLTSSGWFERFVWGLSFLGFLLAQLLTY
FT                   ARGGLLASAFGLFVALAVESLVWACVAAAAAVIGALTIPQLRDRLLTAFTWAYVQESSQ
FT                   PGGRIYQWGRALENVGILGGFKGIRQLLIGTGPGTFGTQSSINLGLHGALRIDSAYYAI
FT                   MAEYGLLGVVSFVYFVVSTLLEGLKKVLNTEDKRVKLLLACVLGAVSAWAFHGLTDNVF
FT                   DYFYVLSWVFPLAMVL"
FT   gene            92033..94027
FT                   /locus_tag="COPRO5265_0089"
FT   CDS_pept        92033..94027
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0089"
FT                   /product="methyl-accepting chemotaxis protein"
FT                   /note="identified by match to protein family HMM PF00015;
FT                   match to protein family HMM PF00672"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17725"
FT                   /db_xref="GOA:B5Y6R3"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR033479"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y6R3"
FT                   /protein_id="ACI17725.1"
FT                   /translation="MSNQSLRVKITVVMVVLVFITALGLGGIEAYRISGDFENLVGQQL
FT                   KTQTESDSRAIWDFLKNYGNLASYLANTNQVIMAASTDDVMVQSDVRMLFDAIRKQYPD
FT                   ILNVYAASNTGLVIMEPMTSLPPEYDATSTVWYQRAMANPTDFVVVEPYNEPVNQTQVI
FT                   TVAKAIYSMGDYVGVVGIDIEASKIASQMLAFTNNISKYLLNRDGVIILSGSGAFVSSG
FT                   TDLSKEVFWKDMKSAATKGNMVNYTLKGAKRIGFVKQLPNGWYFLTAMPASVISAPVRS
FT                   VINTTILVGLGVLLLTVILGYFAVQNVFLKPLMELRGAIEAIASGDLTVRAPVRGKDEL
FT                   GRMAQGVNNMVESLNALIAAAAQTADRVNESAGSLAATSQETSASVEELTAQSNEVATN
FT                   AEMAYHAIEDFAGGVEQVSGTAQSIAADAQLLAAEVSNVKDNAQEGAQSLEQVAEVVDI
FT                   ANKNTDKTSVIMEQLAKDASSISNIVETIEQIAEQTNLLALNAAIEAARAGEAGRGFAV
FT                   VADEIRKLAEKSQEATQSIADILGGIQNRTAEASGSMKNTLNVVKSAYERTKQAQQKFS
FT                   AILDSVGKIASTAEGFAASAEELSASTEELNAAVDNAVEPVRSIAEQVRQFSDALKQQS
FT                   QGVYQIAQEISSLEQLAEQLKEEVDKFKI"
FT   gene            94560..95213
FT                   /locus_tag="COPRO5265_0090"
FT   CDS_pept        94560..95213
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0090"
FT                   /product="L-ribulose 5-phosphate 4-epimerase"
FT                   /EC_number="5.1.3.4"
FT                   /note="identified by match to protein family HMM PF00596"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17127"
FT                   /db_xref="GOA:B5Y6R4"
FT                   /db_xref="InterPro:IPR001303"
FT                   /db_xref="InterPro:IPR036409"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y6R4"
FT                   /protein_id="ACI17127.1"
FT                   /translation="MNHREQLARQTLADVMKKLYSRGLISVYGGNASMVLSDDNALLIT
FT                   PSGFNKESLKEEDLVKVDFASGKVLGEGKPSSELRTHLAIYGANKEAKAVVHAHPTTLV
FT                   GVCTAGYDFGVYTPEQALLVGKPMVINFCMGEELAERMSALAGTCQAVVVKNHGVFAWG
FT                   PTIMEAYAKIEILEEAAKMVVAGNVIMGGLGVSSISDEQVLDILKNYRPSHKSQ"
FT   gene            95273..96820
FT                   /locus_tag="COPRO5265_0091"
FT   CDS_pept        95273..96820
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0091"
FT                   /product="oligopeptide ABC transporter (binding protein),
FT                   putative"
FT                   /note="identified by match to protein family HMM PF00496"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17284"
FT                   /db_xref="GOA:B5Y6R5"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y6R5"
FT                   /protein_id="ACI17284.1"
FT                   /translation="MKNRRSYLWLGAVVAILLFLSAYLLVNARSSTLAYALSDDAVNMD
FT                   PLEATDINSWNVMSQIYEGLMKFRPSSLEVEPCLASYYEVSDDGLVFTFYLQKNVQFQD
FT                   GAPFDADAVIWNARRGMEKADTSYYASLVWGSVKDVQKLGSHVVRFTLKESRADFLTNL
FT                   ALPFGGSMVSPNATDLKNNPIGTGPYRLANWVRNKAITLEYNRNWWQGKLTDGVGFKSV
FT                   RYLVVDDPEEAVNLLRQGKVHILSYVPPELVESLNAEANVRLVETQLLATSFLGFNTKS
FT                   AVLADARVRQSLLFLLDQDYLIKHVYSGFALRSQGPLPPALEKEIGCRYLSPNYEVGVR
FT                   LLREAGYSKERPLNLTVEVPLEPRDYMPSGGVKLGEGLKEVYESTGLVKVTFVYKPFES
FT                   LLSDLMEGKATEAFVLGWSSDNGRADNMLTPLFHSKSPLNFFKYENPLVDKYLEEAQTE
FT                   LDENKREKLYREICDILLEDTPAAFLPIPISFKALDERLKGYNVNPINIEQLYFVRY"
FT   gene            96841..97248
FT                   /locus_tag="COPRO5265_0092"
FT   CDS_pept        96841..97248
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0092"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18112"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y6R6"
FT                   /protein_id="ACI18112.1"
FT                   /translation="MKIMAEYVIKEIDFENLENISVGWDESAYDDVDIMLIKSFILNEL
FT                   EREYGEGTHIEVYSLGDLIEKMENLIGEPVSPEDLPFDQVARLMDRFFGKAVKFFVDEE
FT                   GNLFIALLVDLLPTSSDFMTTLWRFWSNNDK"
FT   gene            97298..97741
FT                   /locus_tag="COPRO5265_0093"
FT   CDS_pept        97298..97741
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0093"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17567"
FT                   /db_xref="InterPro:IPR025480"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y6R7"
FT                   /protein_id="ACI17567.1"
FT                   /translation="MWFIALVLVAVLVLAAWYLHSGTNRGLTAKTAVAVVRADDVAYEV
FT                   ASAPKPGDLLLDRYNKPYFEVVTATYMPFMYRTQNEHGNVVYSPDPQRYTMFVTVKTIA
FT                   PFYDDVPVMAKQRIVVGRSLTLEGPNWAVYGRVTQLTITPVEK"
FT   gene            complement(97774..98685)
FT                   /locus_tag="COPRO5265_0094"
FT   CDS_pept        complement(97774..98685)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0094"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF00781;
FT                   match to protein family HMM TIGR00147"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ACI16965"
FT                   /db_xref="GOA:B5Y6R8"
FT                   /db_xref="InterPro:IPR001206"
FT                   /db_xref="InterPro:IPR005218"
FT                   /db_xref="InterPro:IPR016064"
FT                   /db_xref="InterPro:IPR017438"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y6R8"
FT                   /protein_id="ACI16965.1"
FT                   /translation="MIKNIGIVLNPTAGRGKAGRIFPQVLSMLHEAGIKTLVEITEFPG
FT                   QATELAVRLAKNGVDAVVSAGGDGTVNEVLNGLVQLDFPVPMGALGIGTGNDFLKSAGT
FT                   AKDLTKQVDVIKLGQTRLIDLMRITYCDFEGKTAVRYSVNDFGVGFPAKVSFRVNNMKG
FT                   ALKGAWSYAAAVVTEIRLNKPVHLKLETPEGSFKGFYNMLFAMIGQYVGGGIKIAPMAV
FT                   VDDGYMDVLFVEQLTRWETLKLLPKAFKGTHLPHPKVTHIKTRELSVNDTQELVYVQGE
FT                   VIGFTPAHIELLHQKVPFLWPS"
FT   gene            complement(98657..99472)
FT                   /locus_tag="COPRO5265_0095"
FT   CDS_pept        complement(98657..99472)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0095"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF02649;
FT                   match to protein family HMM TIGR00294"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18177"
FT                   /db_xref="GOA:B5Y6R9"
FT                   /db_xref="InterPro:IPR003801"
FT                   /db_xref="InterPro:IPR022838"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5Y6R9"
FT                   /protein_id="ACI18177.1"
FT                   /translation="MRDVQSERDPRNVPLDYVGIENVRLPITVRTKEGGKQPTVGTFSI
FT                   GVDFPHSFRGTHMSRFMEVLYQHLEEISQTRLRVTLEDIKERLKATKAMIEVAFPFAIK
FT                   KSTPVTKLETVMYVDASFKAELNSTRGYVVTSTVTVPVHSLCPCSRDISEFGAHNQRVD
FT                   VTVSWQGDLWIEDVIALVESSASQPLYPLLKRPDEKYVTEKAYLNPKFVEDIAKDLFLK
FT                   LDPLSPCFRIKVVSYESIHPHNAVAIKEKRAEVSESSVRSNDQEHRDCT"
FT   gene            complement(99478..99861)
FT                   /locus_tag="COPRO5265_0096"
FT   CDS_pept        complement(99478..99861)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0096"
FT                   /product="6-pyruvoyl-tetrahydropterin synthase"
FT                   /note="identified by match to protein family HMM PF01242;
FT                   match to protein family HMM TIGR03367"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17344"
FT                   /db_xref="GOA:B5Y6S0"
FT                   /db_xref="InterPro:IPR007115"
FT                   /db_xref="InterPro:IPR038418"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y6S0"
FT                   /protein_id="ACI17344.1"
FT                   /translation="MNVCVTKAFTFDAAHNLTNYKGKCEALHGHTYRLEVTVCGTPNEL
FT                   ENGLLMDFGDLKDLVNKEVLSKLDHSYLNDHFEQPSTELVAMWVFETLKPHVEKLGLVL
FT                   TSVKLFETATSWVEIKADASRGD"
FT   gene            complement(99915..100169)
FT                   /locus_tag="COPRO5265_0097"
FT   CDS_pept        complement(99915..100169)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0097"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17519"
FT                   /db_xref="GOA:B5Y6S1"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y6S1"
FT                   /protein_id="ACI17519.1"
FT                   /translation="MDDLDFIDLISVADYSEEWEKKKKPIQKKIRRYYLLHEVGMKGLF
FT                   LSAAGAVLLLQYTPYSYLLTFPQWLARFITSMLLPALGL"
FT   gene            complement(100177..100617)
FT                   /locus_tag="COPRO5265_0098"
FT   CDS_pept        complement(100177..100617)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0098"
FT                   /product="DNA-directed RNA polymerase ECF-type sigma
FT                   factor"
FT                   /note="identified by match to protein family HMM PF04542;
FT                   match to protein family HMM PF04545; match to protein
FT                   family HMM PF08281; match to protein family HMM TIGR02937"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18013"
FT                   /db_xref="GOA:B5Y6S2"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y6S2"
FT                   /protein_id="ACI18013.1"
FT                   /translation="MMNEVERAFELYGKRLYAYMRRLGLSEVEAEDGVQEVFIRAMRSS
FT                   IDWSSPKGYLFKIAHNWAMDVLRSRMPLIDEEEGYELSAGKDHFEDVHLLLQSLKEEER
FT                   SVLLLLYQEGLSYHEVAELIGKPENTIKSIVHRAKAKLRKEV"
FT   gene            complement(100614..101693)
FT                   /locus_tag="COPRO5265_0099"
FT   CDS_pept        complement(100614..101693)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0099"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17188"
FT                   /db_xref="GOA:B5Y6S3"
FT                   /db_xref="InterPro:IPR025164"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y6S3"
FT                   /protein_id="ACI17188.1"
FT                   /translation="MLFVQSLLGLFRVRLSTAQLFGLILVIGGVLWILYVLPYSPLQEY
FT                   VAHSALPDPWYLLGGLLITYGVRYLMPAPTKDIVAALLCVAVVIGGFYIFKTLTPPQPQ
FT                   WQGQQQQQQQQQGSGYNDTPARKGNRPFPAPLKIYGLRSTPLEALTWAEEETSSALSFH
FT                   LDFGSLYVGQQPSKEYGFGTYQYVFRKTASGVYELTPQSGREGNGALFLGSQVASVDIA
FT                   ASYGSLYVEITQPMNSILVDSRMGDITIDSAAQIESIILRSYAGNINLALNEHVKDITV
FT                   DSRAGNINVSTSTVVDLITVRASAGNLNLTVPQGVKVEVENVGGAGRFNNDSDPQGYNG
FT                   TMKLHLDMKMGNVDIRQLP"
FT   gene            101675..101797
FT                   /locus_tag="COPRO5265_0101"
FT   CDS_pept        101675..101797
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0101"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17569"
FT                   /db_xref="GOA:B5Y6S4"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y6S4"
FT                   /protein_id="ACI17569.1"
FT                   /translation="MIVQKAPVTKQEKSLQKTGLLSSSLFIRSFALALCLVVAY"
FT   gene            complement(101747..102283)
FT                   /gene="pspC"
FT                   /locus_tag="COPRO5265_0100"
FT   CDS_pept        complement(101747..102283)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pspC"
FT                   /locus_tag="COPRO5265_0100"
FT                   /product="putative stress-responsive transcriptional
FT                   regulator"
FT                   /note="identified by match to protein family HMM PF04024"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17803"
FT                   /db_xref="GOA:B5Y6S5"
FT                   /db_xref="InterPro:IPR007168"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y6S5"
FT                   /protein_id="ACI17803.1"
FT                   /translation="MGNNSGGSKKLYRSRKNRIIGGVLGGLAEYLQVDVVLLRIIYLLL
FT                   MFFGNFTFFTILYIIGWVIIPEQPKVSATLDGTSVEGYVEDVYSQYASSTAEEPGAEQH
FT                   VSGKVVFGAILLVVGAVILFKNLSSYAIITIPRWMMPYFELARALALPVLLIVIGLVLL
FT                   ISHNQTQRQSKGADK"
FT   gene            complement(102273..102482)
FT                   /locus_tag="COPRO5265_0102"
FT   CDS_pept        complement(102273..102482)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0102"
FT                   /product="PspC domain protein"
FT                   /note="identified by match to protein family HMM PF04024"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ACI16951"
FT                   /db_xref="GOA:B5Y6S6"
FT                   /db_xref="InterPro:IPR007168"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y6S6"
FT                   /protein_id="ACI16951.1"
FT                   /translation="MKKLYRSRTDKVLGGVIGGFRAYFNWDVDTNLLRLITAALTLILP
FT                   LLVALYIIAWIIIPLEPEGESYGQ"
FT   gene            102587..102943
FT                   /locus_tag="COPRO5265_0104"
FT   CDS_pept        102587..102943
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0104"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18255"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y6S7"
FT                   /protein_id="ACI18255.1"
FT                   /translation="MKWWEVDFERIKESEEFKKLTGVWLELKLGYLVFHVPVNLFYLSY
FT                   VLAKSSGKEQITYTLTGGFVLQIALSDVERVLSHIEKGEKPFSLNLVIDGKKREVVATP
FT                   VKVPPSSDANTLES"
FT   gene            complement(102891..103265)
FT                   /locus_tag="COPRO5265_0103"
FT   CDS_pept        complement(102891..103265)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0103"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17350"
FT                   /db_xref="GOA:B5Y6S8"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y6S8"
FT                   /protein_id="ACI17350.1"
FT                   /translation="MTEKQKAGMKVYYYVASFVLLMFVLFYASNLVSQLSGILVQPPLS
FT                   PIRINYEDAKAQLLWEKYGPAGGGSVTPEEVKEFVIQRELQYRKVALRHNYSIAGRNAI
FT                   YLLIMIPVYWHHWKVALSLE"
FT   gene            complement(103288..103656)
FT                   /locus_tag="COPRO5265_0105"
FT   CDS_pept        complement(103288..103656)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0105"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18101"
FT                   /db_xref="GOA:B5Y6S9"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y6S9"
FT                   /protein_id="ACI18101.1"
FT                   /translation="MEQITVKQAYFYTVSFILLMMMLYSLNGLVWQVIGIVAPPPLILG
FT                   QWDYEDAKGQLLWEKYGVTENTTVAPQEVQAFVKEQREKNRQFQIYSWYQGAARNVISL
FT                   VVCFPVFWYHWKVARRLE"
FT   gene            complement(103684..104052)
FT                   /locus_tag="COPRO5265_0107"
FT   CDS_pept        complement(103684..104052)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0107"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17599"
FT                   /db_xref="GOA:B5Y6T0"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y6T0"
FT                   /protein_id="ACI17599.1"
FT                   /translation="MQNWTAKKVYFYAVSLVLLLLILFNVGSLLWQLVQITILPPLTAG
FT                   TWNYEDAKRQLLWEKYGTTENVTVTPEEVQTFIDQKEKESQRLTLYYNWQVVAKNALYL
FT                   AVIVPLYWYHWKIARTLE"
FT   gene            complement(104090..104344)
FT                   /locus_tag="COPRO5265_0108"
FT   CDS_pept        complement(104090..104344)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0108"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17135"
FT                   /db_xref="GOA:B5Y6T1"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y6T1"
FT                   /protein_id="ACI17135.1"
FT                   /translation="MHGWTVKKVYFYALSFILLAFIIYNVGQIVWRLSEIIVPPPILDL
FT                   ESRKVNTYSNWRMMGENIVYLAVCFPVFWYHWKVARSLE"
FT   gene            104117..104302
FT                   /locus_tag="COPRO5265_0109"
FT   CDS_pept        104117..104302
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0109"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17824"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y6T2"
FT                   /protein_id="ACI17824.1"
FT                   /translation="MVPEYGEAHCQIDYVFSHHSPVRISVDFSAFEIQDRRWNNYLGKP
FT                   PHNLANVVDDEGKKYE"
FT   gene            104515..105318
FT                   /locus_tag="COPRO5265_0110"
FT   CDS_pept        104515..105318
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0110"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ACI16806"
FT                   /db_xref="GOA:B5Y6T3"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y6T3"
FT                   /protein_id="ACI16806.1"
FT                   /translation="MTLIEVLISLALLSVLMVVVLFTSTWLFTFVKNRLIALPNYVIGL
FT                   SRAYSAVYLNAQDIQLSATYSVDKNLPSVTLYKKSGSDLVSNTVNFKELIRAEALSTAT
FT                   SATVTLEVQTASVSIQQPADNKFLLLLYLSIPSSDGRRFDNTVVIKKLVNAAPVPESFT
FT                   RNGNNVIVDLYYPALGFGVRPTGSSDLQLVTDTSTITTVIDSSGVRSTATAMLTGTTTK
FT                   LGPNVYQALFIESTATQPEFITLPPLIGVDGTPCEDVTVKVVASP"
FT   gene            105315..105791
FT                   /locus_tag="COPRO5265_0111"
FT   CDS_pept        105315..105791
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0111"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17314"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y6T4"
FT                   /protein_id="ACI17314.1"
FT                   /translation="MKKGIALITVLAFVLILSLLMVPLYVSVLGMTSTLRSIQVLPAKH
FT                   EAFAAGLNVVRVLIVNAQDMETSTTIELAQGPIVVTASLARSFDSDLSLQDEIDCEGTA
FT                   SPVVKMRMCSAVNYWDVTVHFKDNYVLTGTAVQYVMFQPDKDYVYLLDFKEKRE"
FT   gene            105797..107185
FT                   /locus_tag="COPRO5265_0112"
FT   CDS_pept        105797..107185
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0112"
FT                   /product="prokaryotic N-methylation motif domain protein"
FT                   /note="identified by match to protein family HMM PF07963;
FT                   match to protein family HMM TIGR02532"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17781"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y6T5"
FT                   /protein_id="ACI17781.1"
FT                   /translation="MRRKMKGFTLLEVVIALVIVAILAAGTLPALSNINKQSFQTEIDL
FT                   NLPSVGQAALNGQSSATSLYADLTDTTTRSVSLLTNELVKHSATVSSKGYTYAIDTLYA
FT                   DVGVGLGSLGAGSPFKEGDTASHEDTSTTPVIITPTTTHTEPTLGSANLLDWEVCSDKD
FT                   NQNEDEHTYGPGYVQVNSNGDGFIDYGLTFPVQSSASDDNYVIVAIPGNTKLQKSCDKD
FT                   CKHVDWSFVAFLNKTTTSSIENKVCKPKSNENGIAKLLSTSTSIQETELTATESGQGNG
FT                   GSYYFPNGTASTASIIYKYKFVAKIEKKLYWSMHFVIKFMDGTPLQNQWVRIYIPNSSG
FT                   EVTTEIPAVIGEETATTTTYGRAKIPVSYDAPSGLLAWDSITFDLSENASVTVKVKTDS
FT                   MSDSEAYVFHATGPASQIKISLRQYNLPPEDLSITFYIAPIDNTKPATVNNVQVSYWTA
FT                   ATSP"
FT   gene            107299..107721
FT                   /locus_tag="COPRO5265_0114"
FT   CDS_pept        107299..107721
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0114"
FT                   /product="chemotaxis protein"
FT                   /note="identified by match to protein family HMM PF01584"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18153"
FT                   /db_xref="GOA:B5Y6T6"
FT                   /db_xref="InterPro:IPR002545"
FT                   /db_xref="InterPro:IPR036061"
FT                   /db_xref="InterPro:IPR039315"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y6T6"
FT                   /protein_id="ACI18153.1"
FT                   /translation="MRYITYDLGERVYASELLSVKEIVLKEELRSIPGAQPWLLGVMAL
FT                   RGQLLPVIDLGFRLQGRPSQGDKVLVLDSERPVGFLVDDVRNIEDVGELKPLPLELPDN
FT                   VKRFLVGSFFHGGDIVLVLDLKKVLTEQELSEVTAP"
FT   gene            complement(107708..110869)
FT                   /locus_tag="COPRO5265_0113"
FT   CDS_pept        complement(107708..110869)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0113"
FT                   /product="ggdef domain protein"
FT                   /note="identified by match to protein family HMM PF00990;
FT                   match to protein family HMM TIGR00254"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17160"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y6T7"
FT                   /protein_id="ACI17160.1"
FT                   /translation="MWYDEKLSQVLGSIIRNRLGVWGQHGSGKTFLLKGLRRRLERSFY
FT                   IHIHSFRMPLGELYWSILSSNWDQATRLDEKSWSTFLRYISADEVPVSLAVKPNYLVDT
FT                   QAINRDILLSTLTLLEEFRIKALLLDQLDPTELDDSVKYVLRELPKEGIIIVATSTSTD
FT                   VFKELGYPVVPMRDPEHEREDALQQFIEVWNDLSYSDAQKLVEMSRGNLFNAQLLKEQH
FT                   AESLQQIVAMEKEKNPKLFSALAHLCAGDLWFSPLSKRIVEEIILESEYSLLDSPLIIE
FT                   EEPQYRFLSPEVKDTVWQMSGLDKNHVHVWWAKELSKLNMPTYWTRIAHLFANGKEKRS
FT                   EAFALLMASRKEYSYPQAAFILEKALELFPELNGAKRKLANIYYSQGKYKEALSILEQI
FT                   KSPTLFDQAYKVRLYVLLGMDEEARKLGDFLLNHIENVSSFYWPGMLSDLAPYIIDTIN
FT                   EPRKMYDYYVRLASSHVRVPILHWGAFLNAVGVSLEYSLKYEDAVELYQESIKVLQGTP
FT                   RLEIFARPVINEVAIKTILSGTKTILESKESLENLIPTLSSVGQQGFWQTLLTSLQEFM
FT                   SRGTLQKYIRELEETTRVLLSSTYRHSGYMTLAEHYISVLDFNLAEWFLILASKNATLE
FT                   VEELNTKILWTYLRLLEGREVEKGDIASLLSRCMEHVDEGIDTAALVSVLLMVHWNPIP
FT                   TQLLGQLPSTPLGESLKMLAISPDNCSNAFRYMLRLWRRWERLSMSNLGIVIFKSVCEN
FT                   TDKTMLKTMADWILQEVRALDYPQLTSFWQKTYQSIAAVSQWSSLLSWHLNLQEITNVQ
FT                   QLAGALSYIFQSYFGHDYFAKIESGTLNLEVGDHRIAKRSQNFIEKGSVIHIRVWYSTL
FT                   NDPLAPQVLDLLSYSLEELNTKLFGMQDSLTGLFNRTYGNQRLTEEWELYLRGGPQFSI
FT                   LFLDLDGFKQVNDSFGHEMGDKVLMEFSKLLRSSLRATDVAIRWGGDEFLVILPDTDEE
FT                   EAATISRRLSNQISSCITSLGKPVTASIGASSVSEVNSVEQLVDLADQRTYLAKTRKKN
FT                   HIMEQ"
FT   gene            complement(110962..112140)
FT                   /locus_tag="COPRO5265_0115"
FT   CDS_pept        complement(110962..112140)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0115"
FT                   /product="beta-N-Acetylglucosaminidase"
FT                   /note="identified by match to protein family HMM PF00933"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18200"
FT                   /db_xref="GOA:B5Y6T8"
FT                   /db_xref="InterPro:IPR001764"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR036962"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y6T8"
FT                   /protein_id="ACI18200.1"
FT                   /translation="MTPTQSGTDVTPTTAVNQNTQNDVIDSIIANMDLQEKIGQMFIVS
FT                   FTGTNVSADLITLVHDYHVGGVILFSENIQDDKQLLALLNGIKALNEGNKLPILISTDQ
FT                   EGGRISRLPSRATKFPSNLIIGKRNSATLSYQIGSILGTEMKAYGFNMDFAPVLDVVTN
FT                   PQNKVIGDRSFGSNPDLVSTLGVATMKGISSSGVIPVVKHFPGHGDTSVDSHQELPVSN
FT                   ATLPHLRSFELLPFEKAIQNGASVVMVAHIKFANVDPSGLPASLSEVFISDILRNELGF
FT                   SGVVITDDLHMEAITKHYSVGDAAIKAVQAGADMVLICHSLDEQKQAINALVHAVKTGQ
FT                   ISEERINESIKRIAMLKRHYDLTDEPSSIAAVLSEVGTEEHADVAKEASVAP"
FT   gene            111408..111551
FT                   /locus_tag="COPRO5265_0116"
FT   CDS_pept        111408..111551
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0116"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17532"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y6T9"
FT                   /protein_id="ACI17532.1"
FT                   /translation="MHRSVLPSRKAKVQRSEGEAVLRWKLVVPDVNPPMYHRAPENVLP
FT                   LV"
FT   gene            112481..113938
FT                   /gene="guaB"
FT                   /locus_tag="COPRO5265_0117"
FT   CDS_pept        112481..113938
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="guaB"
FT                   /locus_tag="COPRO5265_0117"
FT                   /product="inosine-5'-monophosphate dehydrogenase"
FT                   /EC_number="1.1.1.205"
FT                   /note="identified by match to protein family HMM PF00478;
FT                   match to protein family HMM PF00571; match to protein
FT                   family HMM PF03060; match to protein family HMM TIGR01302"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17044"
FT                   /db_xref="GOA:B5Y6U0"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR001093"
FT                   /db_xref="InterPro:IPR005990"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR015875"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y6U0"
FT                   /protein_id="ACI17044.1"
FT                   /translation="MPSSYYEESLTFDDVLLVPQYSEVLPKDVDISTKLTKDVTLNIPL
FT                   ISAAMDTVTEARLAIALAREGGIGIIHKNMSIDRQAEEVDKVKRSEFGIIYKPVVLGPK
FT                   ATLADALALMEHYHISGIPITVEGKLVGIITNRDIRFEDDFTQLIEDVMTKKNLVTAPV
FT                   GTSLEEARQILKAHKIEKLPLVDEEGYLKGLITIKDLEKRSQYPNAAKDSKGRLLVGAA
FT                   LGVGKEMMDRAKALADADVDVLVVDSAHGNSKNVVEAVKKVKNKFPHVAVVAGNVATPD
FT                   GVRNLVEAGADCVKIGIGPGSICTTRVIAGIGVPQLSAVLKCAEEGAKLGVPVIADGGI
FT                   RFSGDIVKALAAGAYTVMIGSLFAGTEESPGEKEIYQGRIYKTYRGMGSLAAMKQGSAD
FT                   RYSQEDASKFVPEGVEGRVPYKGSVHDVVFQLCGGIRSGMGYVGAVSIEDLQKKAKFVK
FT                   ITNAGLRESHPHDVQITRESPNYTLEE"
FT   gene            113946..115481
FT                   /locus_tag="COPRO5265_0118"
FT   CDS_pept        113946..115481
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0118"
FT                   /product="GMP synthase [glutamine-hydrolyzing]
FT                   (Glutamineamidotransferase) (GMP synthetase)"
FT                   /EC_number="6.3.5.2"
FT                   /note="identified by match to protein family HMM PF00117;
FT                   match to protein family HMM PF00958; match to protein
FT                   family HMM TIGR00884; match to protein family HMM
FT                   TIGR00888"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17722"
FT                   /db_xref="GOA:B5Y6U1"
FT                   /db_xref="InterPro:IPR001674"
FT                   /db_xref="InterPro:IPR004739"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR022310"
FT                   /db_xref="InterPro:IPR022955"
FT                   /db_xref="InterPro:IPR025777"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y6U1"
FT                   /protein_id="ACI17722.1"
FT                   /translation="MKREGVAVIDFGGQYAHLISRRIRDLGVYAEIVPYWRWQEVLDDP
FT                   LVKAVVLSGGPASVYDENAPQLPVEFFSNVTKPVLGICYGAQLMAHLLGGKVGPAPGGE
FT                   YGRTKLVVKNSEPLFTGTPTAQDVWMSHGDQVVELPSGFEVSASTEHCRLAAFQKEPLF
FT                   FAVQFHPEVAHTQFGNALLKNFVFGVAKAEVNWNITDYVSEAIREIRETVGENGMVLGA
FT                   LSGGVDSAVAAVLTHRALGCGRLQCLYIDTGLQRAEDEAHVRNLSKHLGLKIKVVDAKE
FT                   RFLKALEGVIDPEQKRKIIGNLFIQVFEEEARNLGHFDFLLQGTLYPDVIESGEGSASV
FT                   IKSHHNVGGLPQSLGLKLLEPLRWLYKDEVRNMGRWLGIPEDFLMRHPFPGPGLAVRTI
FT                   GPVKEEYLDILRRAHSVLERVLKEEGVYNELWQAFPVFTGVKSVGVKGDARHYGWVLAV
FT                   RMVQSVDAMTADWYKAPPELLDKIASSLISEIPEISRVVYDITSKPPGTIEWE"
FT   gene            complement(116024..116503)
FT                   /locus_tag="COPRO5265_0119"
FT   CDS_pept        complement(116024..116503)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0119"
FT                   /product="rubrerythrin-related protein"
FT                   /note="identified by match to protein family HMM PF02915"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17361"
FT                   /db_xref="GOA:B5Y6U2"
FT                   /db_xref="InterPro:IPR003251"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y6U2"
FT                   /protein_id="ACI17361.1"
FT                   /translation="MENKEMTAKEALSYAIHAEIEANEFYLEWSINTNDPAAKKELQEL
FT                   ADWEAQHRDQLTNIYESRFSEKFQRNPNVTVEPALKVKADEFKDVYNVLRIASTAYLTE
FT                   LTSAEFYSDMAKKFADDEELSKTFSDLADMEKSHMQLMLKRYLRLKEDLSGPLML"
FT   gene            complement(116510..116914)
FT                   /locus_tag="COPRO5265_0120"
FT   CDS_pept        complement(116510..116914)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0120"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17912"
FT                   /db_xref="GOA:B5Y6U3"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y6U3"
FT                   /protein_id="ACI17912.1"
FT                   /translation="MSKYEGRRASEDDVVDLAQWAPYPPNRRTSFIQSLLNYVRVPYTR
FT                   VVVVEKEGALVAFALLWLKHSAVTQTITAEIKDLVLKEPSDREALQVLLDTCEQTVKNM
FT                   GASEIELYCESLDLHEFGYNTFSSFWRKGV"
FT   gene            complement(116922..117980)
FT                   /locus_tag="COPRO5265_0121"
FT   CDS_pept        complement(116922..117980)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0121"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17552"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y6U4"
FT                   /protein_id="ACI17552.1"
FT                   /translation="MRWISLVLIVVLLLGGGYFYWQRVESSKVVYVFLPEVPSATIVPW
FT                   TAITPADRTVLYNTRRTLFKYGKPSANDASWEEQAVPDLALSATSTDNIHWTISLKSDI
FT                   ITATQIISVWSETLKNGDPTVVGKLFYYIEGGQSYKNNTGPFRGLVAETPSTLRVVTAF
FT                   PLNLPLLLVDPVFSMSVTTNTTYEGGVLFRGQTQIIFTNEPEKADIAWLESGTGNFTGT
FT                   FDYAVSSTVLPTVSSTLGCLHLPLVDLSGVQILTPTVFYVPPQRPPEGKVSLYPWQLDY
FT                   PSEEAFKLGLAVLLNDPTVASATQSLSELMDKNHIYVANPQCFNLKMSSRIKNLETHLD
FT                   ILDFTEMTKKVW"
FT   gene            complement(117967..118464)
FT                   /locus_tag="COPRO5265_0122"
FT   CDS_pept        complement(117967..118464)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0122"
FT                   /product="Appr-1-p processing enzyme family protein"
FT                   /note="identified by match to protein family HMM PF01661"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18171"
FT                   /db_xref="InterPro:IPR002589"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y6U5"
FT                   /protein_id="ACI18171.1"
FT                   /translation="MKVFLFKGDLTTLDVDAVVNAANGIGPMGGGVAYAIKKVGGHEIE
FT                   QEAIKRCQEEGPFKPGQVYVTTGGSRWKYVIHAVTMMYPAEPADYDSAGEALAKAIKKA
FT                   VDLGVTSVAVPALGMGVGGLEPRALAQVYANVFKRLKDEPLNIVVSAFDKTFLMELISA
FT                   LD"
FT   gene            118486..118857
FT                   /locus_tag="COPRO5265_0123"
FT   CDS_pept        118486..118857
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0123"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17849"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y6U6"
FT                   /protein_id="ACI17849.1"
FT                   /translation="MGISYAEVLIALVLTLLAGLLLLGASGDAQTIHTYVKERNVASSI
FT                   MYEQLYNAPWYSETATSFVVHSGNVDYGVTRSVSLGCSSFGASAQQIPNCESNFKETTV
FT                   TVHWKDYSITGTRVSRLLP"
FT   gene            118869..119102
FT                   /locus_tag="COPRO5265_0124"
FT   CDS_pept        118869..119102
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0124"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17040"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y6U7"
FT                   /protein_id="ACI17040.1"
FT                   /translation="MALSASSFLLLLLFSYINVASLQLNKAGKTINNPTPLHTLLTEQR
FT                   TPLERQIFGPQRFVYDATPNQRVDYEWEILTR"
FT   gene            119077..120297
FT                   /locus_tag="COPRO5265_0126"
FT   CDS_pept        119077..120297
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0126"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17734"
FT                   /db_xref="GOA:B5Y6U8"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y6U8"
FT                   /protein_id="ACI17734.1"
FT                   /translation="MNGKYLPGSAVLFSVMLVCSMVLVTLSASAFSVVHERMLEEKALA
FT                   RLRIEECLDVAEHMYNTKNGEKLSFFNGCSFLWSEEAVAVQYEDMERTFPVEWVPSFVV
FT                   NASSTFSMDYGSRLLGDVAAEKFYFYGSSKLLSCGRPCWTESLWQPAIDEGNMYVSSTR
FT                   RTIVFVGWRGMKTTYEKDSFYYAGEGTKTGAPGYEYSNLMFQTSSHCYYTSYDHCVEGK
FT                   GIKITQFDDGMKQLLPSVVLWKRIPEAKPVEQFQKIYNCTGSAIVVGDGKALTLQTSTL
FT                   TLVYEQDLKVISGTQTATVPFLNSFFQECNVEVGSGYYGELLLGAKNVAVKDSQINRLN
FT                   VQSEKYITVNGSNLDNVTLSGEEVELSDSQFSGQISAKVVRAKGSSILRRALQNEGSPP
FT                   LLVRIIH"
FT   gene            complement(120287..121711)
FT                   /locus_tag="COPRO5265_0125"
FT   CDS_pept        complement(120287..121711)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0125"
FT                   /product="aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
FT                   subunit B (Asp/Glu-ADT subunit B)"
FT                   /EC_number="6.3.5.-"
FT                   /note="identified by match to protein family HMM PF01162;
FT                   match to protein family HMM PF02637; match to protein
FT                   family HMM PF02934; match to protein family HMM TIGR00133"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17034"
FT                   /db_xref="GOA:B5Y6U9"
FT                   /db_xref="InterPro:IPR003789"
FT                   /db_xref="InterPro:IPR004413"
FT                   /db_xref="InterPro:IPR006075"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR017958"
FT                   /db_xref="InterPro:IPR017959"
FT                   /db_xref="InterPro:IPR018027"
FT                   /db_xref="InterPro:IPR023168"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5Y6U9"
FT                   /protein_id="ACI17034.1"
FT                   /translation="MNFKFVAGLEIHVQLNTKTKMFCSCPTEGPDIPNTRVCPVCLGYP
FT                   GTLPVLNREAVVMAIALGKALHGHINNISRFHRKNYFYPDLPKGYQITQGDVPIIENAY
FT                   LELSTGKKIPIKRIHLEEDAAKSVHVSSTGRLSGAEETLLDFNRSGIPLIEIVTDPVFE
FT                   SPEEAALFVEELQATLRYLGISNAQMELGQLRCDVNVSVELDGKEGTRVEIKNLNSIRA
FT                   IRQALSYEYNRHVDAYKRGEIIPQETLAFDEKTNQTPPMRTKQTSEDYRYFPEPDLPPL
FT                   VLTSDLFEEADKYSGSFLEAYKNALQWIGKESEARTLALNKDQYLMYATFAKEGFDTKL
FT                   LTRIITIDLPNILSEVGKGWNEINQSYISAILNLQQRGEITAAVAKDLLWQAARDIDPI
FT                   KYAQEHQLLGKKDLDLEQVISEVLEQNPDAVEKYKKGNVNVVSFLLGQVMKKTKGTADP
FT                   GETRKLLEERLTKLSE"
FT   gene            complement(121708..123102)
FT                   /locus_tag="COPRO5265_0127"
FT   CDS_pept        complement(121708..123102)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0127"
FT                   /product="glutamyl-tRNA(Gln) amidotransferase subunit A
FT                   (Glu-ADTsubunit A)"
FT                   /EC_number="6.3.5.-"
FT                   /note="identified by match to protein family HMM PF01425;
FT                   match to protein family HMM TIGR00132"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ACI16904"
FT                   /db_xref="GOA:B5Y6V0"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="InterPro:IPR004412"
FT                   /db_xref="InterPro:IPR020556"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y6V0"
FT                   /protein_id="ACI16904.1"
FT                   /translation="MNIKEVFTKRQNGEITFKGLMQKTIEKLEQDKELHAFLYLKHPSE
FT                   LIREAEEADKAWEKGVRRPLQGIPVAVKDNICVSSMPCTCASKVLQDFVAPYDATVVKK
FT                   LKESGAIIVGKTNLDEFAMGSSSENSAFGPTKNPLDLSRSPGGSSGGSAAAVAADMCMV
FT                   ALGSDTGGSVRQPAAFTGIIGFKPSYGAISRYGLVAFASSLDQIGILAKTPEDVLLTSF
FT                   VLFGKDHLDSTTTDVFMDFSPKASEVRRIGLVKEIDISAVDPQVKEGYELFVKQLSKDF
FT                   DVVEVSIPHWEEALAAYYFIAPAEASSNLARYDGVRYGTMVEEETYWDTVRETRNLLGE
FT                   EVKRRILLGSFALSAGFKDALYEKANYLRRWLVLEFAQAFKDVDFLLTPTTPTLPFKLG
FT                   EVKDPLQLYKADLFTTPANLAYLPAVSVPFKATGEPLPVGLQFIAPFGQDYKLLSFIRE
FT                   LGVKSI"
FT   gene            complement(123108..123401)
FT                   /locus_tag="COPRO5265_0128"
FT   CDS_pept        complement(123108..123401)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0128"
FT                   /product="glutamyl-tRNA(Gln) amidotransferase subunit C
FT                   (Glu-ADTsubunit C)"
FT                   /EC_number="6.3.5.-"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17550"
FT                   /db_xref="GOA:B5Y6V1"
FT                   /db_xref="InterPro:IPR036113"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y6V1"
FT                   /protein_id="ACI17550.1"
FT                   /translation="MFNISPETLKHLEELAQLELPLGLEEKMLQDLNHILSTFEVISVV
FT                   EKPPESGVEQSAFLRADQPLPYTDASRLFDPSRLKNGFLRVKPVLEDKEEEG"
FT   gene            complement(123586..125976)
FT                   /locus_tag="COPRO5265_0129"
FT   CDS_pept        complement(123586..125976)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0129"
FT                   /product="bacterial extracellular solute-binding protein,
FT                   family 5"
FT                   /note="identified by match to protein family HMM PF00395;
FT                   match to protein family HMM PF00496"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18220"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR001119"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y6V2"
FT                   /protein_id="ACI18220.1"
FT                   /translation="MLVASSFVGFSPVNAANFSDVPKTHQYYKYITKLADAGIVKGRSA
FT                   TQYAPDATLNRAELATLLVNLKKLPLETSKQYFKDVPKGTWYYGYVNAAAKAGLVTGYE
FT                   DGTYRPNNPVTRAELAVVGLRGLGVTQATIDQYAKNPIYLSSDESKYTNYWAKGWLTAA
FT                   IMPRYQVLSWRQPGRLIAADKAATRGEAAYTIYKMKWPVKKGGQLYIVEEQEPATLFSA
FT                   LDSMAAMTQVLALIMDGEQGSDWRGNWWPQMGRWVPTTENGKQVIYEKPQKITLQDGTQ
FT                   VDIYMRYDFGLRPGLKWSDGQPITADDFIFGTLLYLAKDMPVPGLDPYDSVARIEKLDD
FT                   YTIRVYFTAVDKENPYNVYAKYGLPLYPKHWFEQNVLKTTVTYPKTIDFVLKHDEEMTY
FT                   LSDVSYTLPRNLKEVMDKNVEAIVNSSYNTKPMHTGPYKITNWVQKGYMEFVPDPNYFL
FT                   GPGLFDKVVFAFRSAESGLAELLRGQPDVAVMGVINTQNAKTLSANSNFLKQYKLNSIP
FT                   SVFWEHFTVNFDDPNNLPDAPKPGVAYTHPFLSDNRVRQALSYAINRQDISNRVYYGMR
FT                   PLAYYHVLPGSAFDEPSLKNVFIYDPGKADTLLKQAGLTKGTDGVYAKGGKKLSLLAQT
FT                   TNRTDRINTLQIIQQQYKQVGINLSMQPLNSSDFFNTVLPHRTFEIGLFAWGQSSILEP
FT                   GGTTLYMSRYIPSKSNGYQGQNYSGFRNAEADALMNKWTSFDMTERTKAYKDFGRLYFG
FT                   VYMPEMPIVWHDQHDAVKLNIEGYDLGLDVAAHTWNIAWWYRE"
FT   gene            complement(126135..128525)
FT                   /locus_tag="COPRO5265_0130"
FT   CDS_pept        complement(126135..128525)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0130"
FT                   /product="bacterial extracellular solute-binding protein,
FT                   family 5"
FT                   /note="identified by match to protein family HMM PF00395;
FT                   match to protein family HMM PF00496"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17393"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR001119"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y6V3"
FT                   /protein_id="ACI17393.1"
FT                   /translation="MLVASSFVGFSPVNAANFSDVPASHQYHKYITKLADAGIVKGRSA
FT                   TQYAPDATLTRAELATLLVNLKKLPLETSKQYFKDVPKGTWYYGYVNAAAKAGLVAGYG
FT                   DGTYRPNNPVTRAELAVVGLRGLGVTQATIDQYAKNPIYLSSDESKYTNYWAKGWLTAA
FT                   IMPRYQVLSWRQPGRLIAADKAATRGEAAYTIYKMKWPVKKGGQLYIIQSEEPATLFNA
FT                   LDSMAAMNQILALVQDAEQGSDWRGNWWPQLGRWVPTTENGKQVIYEKPQTITLQDGTK
FT                   VPIYMRYDFSLRPGLKWSDGQPITADDFIFGTLLYLAKDMPVPGLDPYDSVARIEKLDN
FT                   YTIRVYFTAVDKNNPYNVYAKYGLPLYPKHWFEKNVLKTTVTYPKTVDFVLKHDAKMQY
FT                   QSDVSYTLPRNLKEVIDKNVEAIVNSSYNTKPMHTGPYKITNWVQKGYMEFAPDPNYFL
FT                   GPGLFDKVIIAFRSVESGLAELLRGQPDLAIMGVINTQNAKTLAANSSFLKQYKLNSVT
FT                   SVFWQHFTVNFDDPKNLPKDPKPGVAYTHPFLSDNRVRQALSYAMNRQDISNRIYYGMR
FT                   PLCYNFVLPGTPYDEPSVKNVFTYDPAKANTLLQQAGFKKGSDGIYAKGNNKLSLLANM
FT                   GNSTDPIRVVQLVQQQYKQVGINLNMQALDAGPLFNTVLPHRQFEIALFSWGQSSILEP
FT                   GGNTLYQSSYIPSEANGYQGQNYSGFRNAQADALIAKWNSFNTSERTKAYKDFTKNYWS
FT                   VYMPEIPILWTDQHDAVKQNIEGYDLGLDVAAHTWNIAWWYRE"
FT   gene            complement(128694..130757)
FT                   /locus_tag="COPRO5265_0131"
FT   CDS_pept        complement(128694..130757)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0131"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18145"
FT                   /db_xref="InterPro:IPR011047"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y6V4"
FT                   /protein_id="ACI18145.1"
FT                   /translation="MVKGGSLSKKVLSSLLIIALLTLCCPWFVSENSKAAAATYLYPKT
FT                   LATDGEKLYVATDQGLLVWNGKVFSEVKPPHLPSVKITTVNADPSTSLIVGTDNGAAYP
FT                   FRQSYWRVVTTGDGLPASSVTAAANCKNQIFIGTPNGLAVYTKNSTNRPIIYQYPELPH
FT                   NNVTSLVCSGDQAFVGTMSGIMRITGNNAYYISPVSTTKMLVSGGKLWVASSQGLFQFD
FT                   LQGRLLKRWDVNSGLYSSNIKALAASEDSVYVYDGKNIVRIGDMKKFPVSVTIYDMVYM
FT                   KGQFFLATPNGLFSTYDFLDYVNVFKAQSYLQDAFYSGTHLVELRNNIVLIDGRPANIS
FT                   GVVKAYQGDWVTVVTSNQVYLVNPSSLSRYTVKSDAFFEIAPHSIQSAYYCASSGMLYL
FT                   ASYGQLYAIHRTSGTFQKTAIPLYGIKSLWSDGKFVYLLADRGWIIADSWGKVIRSGTW
FT                   NFYVRDVTFSDKLIFIATDQGVKYGSSLWSGFRNYASLDALRLFSPANSKNLWASTTKG
FT                   LVKMGTEPIYYNWGNGLLALPDNMLSDTSSLKLFIGGKIYQWQPSHMVDWLGSIGKEEA
FT                   SKLQAAGILAGFHGKTYPTKTLTYQELAVFYARLKDIRPSNVSTNARADTWAKPYIAAL
FT                   EQKGFRLDLDYRLNAQRNIVQNWIPELSYLFRDSGALTRQKAVSSLYSLLPY"
FT   gene            complement(130750..132750)
FT                   /gene="ligA"
FT                   /locus_tag="COPRO5265_0132"
FT   CDS_pept        complement(130750..132750)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ligA"
FT                   /locus_tag="COPRO5265_0132"
FT                   /product="DNA ligase, NAD-dependent"
FT                   /EC_number="6.5.1.2"
FT                   /note="identified by match to protein family HMM PF00533;
FT                   match to protein family HMM PF00633; match to protein
FT                   family HMM PF01653; match to protein family HMM PF03120;
FT                   match to protein family HMM TIGR00575"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17456"
FT                   /db_xref="GOA:B5Y6V5"
FT                   /db_xref="InterPro:IPR001357"
FT                   /db_xref="InterPro:IPR001679"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR004150"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013839"
FT                   /db_xref="InterPro:IPR013840"
FT                   /db_xref="InterPro:IPR018239"
FT                   /db_xref="InterPro:IPR033136"
FT                   /db_xref="InterPro:IPR036420"
FT                   /db_xref="InterPro:IPR041663"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5Y6V5"
FT                   /protein_id="ACI17456.1"
FT                   /translation="MTREEAKKRIERLRELIEYHNYRYYVLDSPEISDEEYDKLYRELV
FT                   TLEKQFPEFITPDSPTQRVGAPPAKEFATVTHEVPMLSLDNAFTEDEIKAFDQRVRSAL
FT                   NQQHVEYFCEHKLDGLAVSLLYENGLFVRGSTRGNGYVGEDVTANLKTIKTIPLRLKGE
FT                   NIPPVVEIRGEAFMMLRDFEALNEQRQALGQPLFANPRNAAAGSIRQLDSSITAQRKLY
FT                   FMPYGFGLVQGMDFETQERFLKQCQEWGFRINEHNRKASSIEEALEFIRYWTEHRVELP
FT                   FPADGVVIKVNNLRYWDILGTTAHAPRYAIAYKFPAEEKETKLKDVVFQVGRTGIITPV
FT                   AMLEPVVLDGATVSRATLHNFDIVRQLDVRKGDVVKLKRAGMVIPEIIGVAAEKRTGKE
FT                   EQIEPPTTCPVCGGPTEWDGAYLKCVNITCPAQLKGHLLHWASRDAMDIDGLGESIIEN
FT                   LVDMGLVKNIADLYKLSVQDLLTLPRLAQRSATKLYENIQRSKDRPFFRVLYGLGIPRV
FT                   GLKTAQMLAEHFGSINALLNATMDELTSIEGIGTDTAETILKALQSPQVHELIDQLKTL
FT                   GLKMEQESIEGPLKGLTFVFTGTLTSMSRGDAAKLVQSLGGKVASSVSKNVDYVVVGED
FT                   PGSKLDKAQKLGLTIIDEEAFLKMVKREHNG"
FT   gene            complement(132828..133307)
FT                   /locus_tag="COPRO5265_0133"
FT   CDS_pept        complement(132828..133307)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0133"
FT                   /product="SAM radical enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17908"
FT                   /db_xref="InterPro:IPR018768"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y6V6"
FT                   /protein_id="ACI17908.1"
FT                   /translation="MAHAGLTIFFRKVDASAWLSYKDYVRHISYGLIRANLPLLYTEGF
FT                   QERILLQTPSALPLGVSSLGEPFFIPTKEPLKIRAEELQPFFSSHEMPVLVLSYKLEPY
FT                   LSVFQTPKGVLKLQLEKQGLKKVLDEQQLKPWEATKVGIEIISSGQTINLKALTD"
FT   gene            complement(133289..135076)
FT                   /locus_tag="COPRO5265_0134"
FT   CDS_pept        complement(133289..135076)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0134"
FT                   /product="radical SAM domain protein"
FT                   /note="identified by match to protein family HMM PF04055"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17281"
FT                   /db_xref="GOA:B5Y6V7"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y6V7"
FT                   /protein_id="ACI17281.1"
FT                   /translation="MTSPSHCYFECYTFNMSMLSNAELYSVEKPSRYLGGEFNSIVKDW
FT                   EKTLYKVALLYPDLYEVGMSYHGMQLFYFLINQEEDLLAERVFTPAIDTIKLLREKNLP
FT                   LWSLENKRPLYEFDVIAVHFLTELGATNVLETLSLGQVPLMSSERTNNDPYVIAGGPAI
FT                   SNPSFFEPFLDAVFIGEADDVIDELVRFLAKAKQQCADRRETLSELAKVFPGIYVPALR
FT                   NTAKEHHVIRESIFYPTKFIVPNVEAVQERAVVELARGCTRGCHFCHASSYYRPVRETP
FT                   PHEVVELVKSIKQTTGFTEVGLLSLSTFDYSKLSEVVDLLSGEHLSMSLPSLRLDSLDT
FT                   DLLKKVDPTRHLTLTFAPEAGSDQLRKKLNKPFSNEEILQAVDLLSKSGWSKFKFYFMV
FT                   GLPEETEKDVLDIVSLLNEADTIAFKNNRRSRIHATVASFVPKPFTPFQWERQISPEET
FT                   LEKYTLIQKHLKKQIDVSFRNPWFSLLEGVLSRSDSKVADLVLLAWKEGAIFDTSEQYG
FT                   QHFLWQSAWEKLGMDPMEYLRARDIEEPLPWDHIKVGPSKDFLLLQREKSRKGLLTPDC
FT                   RMSCLGCGVCGGDLWPTLA"
FT   gene            134390..134503
FT                   /locus_tag="COPRO5265_0135"
FT   CDS_pept        134390..134503
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0135"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17513"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y6V8"
FT                   /protein_id="ACI17513.1"
FT                   /translation="MMLLSGVSKRWYIDARKNFGELRQRFSSIGTLLLSLC"
FT   gene            135176..135277
FT                   /locus_tag="COPRO5265_0136"
FT   CDS_pept        135176..135277
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0136"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ACI16863"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y6V9"
FT                   /protein_id="ACI16863.1"
FT                   /translation="MKLETAPPATFAKGRQTLAEVKLNGLCWEATQG"
FT   gene            135246..137045
FT                   /locus_tag="COPRO5265_0137"
FT   CDS_pept        135246..137045
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0137"
FT                   /product="tungsten-containing aldehyde ferredoxin
FT                   oxidoreductase"
FT                   /EC_number="1.2.7.5"
FT                   /note="identified by match to protein family HMM PF01314;
FT                   match to protein family HMM PF02730"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17757"
FT                   /db_xref="GOA:B5Y6W0"
FT                   /db_xref="InterPro:IPR001203"
FT                   /db_xref="InterPro:IPR013983"
FT                   /db_xref="InterPro:IPR013984"
FT                   /db_xref="InterPro:IPR013985"
FT                   /db_xref="InterPro:IPR036021"
FT                   /db_xref="InterPro:IPR036503"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y6W0"
FT                   /protein_id="ACI17757.1"
FT                   /translation="MGYAGKLLRVNLSTGEIKTEQLDFALSRMFLGGRGLASKILYDEI
FT                   DPKVDPLSPENKIIFAAGPLTGTNAPTGGRYMVITKGPLTGTIASSNSGGFFGAELKFA
FT                   GYDMVIFEGKSDKPVYLSIHDEEVQLKDATQLWGKDVFETTDILANEFGDGKARVSCIG
FT                   PAGENLVKFAGVMNDKHRAAGRTGVGAVMGSKNLKAIVVRGSGRPKPSSPDFMEVVRQK
FT                   INIIKQNPVTGEGLPALGTKVLDNIINQSGAYPTRNFQESVFERTHEVSGEALVEKKYL
FT                   KKNTACFACPIGCGRVITLPNGIDSEGPEYEAGWAYGADCGVDDLIAICEANHLCNKYG
FT                   IDPISAGSTIACAMELYEKGYLPKEDLNKGPEPIFGSSEAIVYYTKAIAFREGLGDKLA
FT                   EGSKRLSEMYGHPEFAMHVKGQELPAYDPRGVQGHGLQYATSNRGGCHVRGYMISPEVL
FT                   GIPEKLDPQELNGKPEWVKTFQDLTAVIDSAGLCLFTSFALTADDYRDLVNADTGFNYT
FT                   TEELMKVGERVWNLERLFNLKAGFTKADDTLPKRLLEQPVAEGPNKGAVHHLSELLPLY
FT                   YQARGWNEDGVPTPEKLSELGLE"
FT   gene            137047..137325
FT                   /locus_tag="COPRO5265_0139"
FT   CDS_pept        137047..137325
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0139"
FT                   /product="MoaD family protein"
FT                   /note="identified by match to protein family HMM PF02597"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17989"
FT                   /db_xref="GOA:B5Y6W1"
FT                   /db_xref="InterPro:IPR003749"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR015221"
FT                   /db_xref="InterPro:IPR016155"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y6W1"
FT                   /protein_id="ACI17989.1"
FT                   /translation="MKLEVEFFATLRLKLPKPTYEVDMPEGSTVKDLMRELDRITGQPV
FT                   SEELFRGDEVIPGTVLLLNGKNILHLNGIHTPLEPGKVAVFPPVAGG"
FT   gene            complement(137268..138542)
FT                   /locus_tag="COPRO5265_0138"
FT   CDS_pept        complement(137268..138542)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0138"
FT                   /product="small GTP-binding protein domain"
FT                   /note="identified by match to protein family HMM PF01926;
FT                   match to protein family HMM PF08477; match to protein
FT                   family HMM TIGR00231; match to protein family HMM
FT                   TIGR00650"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ACI16916"
FT                   /db_xref="GOA:B5Y6W2"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR023873"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040644"
FT                   /db_xref="InterPro:IPR041606"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y6W2"
FT                   /protein_id="ACI16916.1"
FT                   /translation="MTSLNEGLIPHTAFRKHIAIVGRRNVGKSSLINAIAGQDIALVSD
FT                   VPGTTTDPVYKTLEVKPLGPVTLIDTPGLDDEGLLGQKRVERAKRALYKADAAILVVDD
FT                   KPGAFEDFIVSLLRNLSIPFVIAVNKSDVTEDTKTLVKDYEPFNVPVVKVAAAQGKNIS
FT                   ELIQVLSSLLPDEEEKPLVAHLLGQNKTAVLVIPVDKAAPKGRLIMPQVEAIRDIIDHG
FT                   GIAVVTRPPELKETLEKLQYNVDLVVTDSQVIIDVDKVVPPQIPLTTFSILEAANKSDL
FT                   TLFLEGINALQKLHDGDCVAVVEACSHVPTCDDIGRVKIPRWIEEKLHIKLQYKFFAGK
FT                   EFPEASSLQGCKLIIHCGGCVLTRNMFMRRMQLAKRLDLPVVNYGMLISYLHGSLEKAI
FT                   KPLLAFSYPPATGGNTATLPGSSGV"
FT   gene            complement(138539..139585)
FT                   /locus_tag="COPRO5265_0140"
FT   CDS_pept        complement(138539..139585)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0140"
FT                   /product="radical SAM domain protein"
FT                   /note="identified by match to protein family HMM PF04055"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18009"
FT                   /db_xref="GOA:B5Y6W3"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010722"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR024021"
FT                   /db_xref="InterPro:IPR034422"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y6W3"
FT                   /protein_id="ACI18009.1"
FT                   /translation="MYEDILTRILNHPDSVTLEQVAFVLSNEELTPKLFAKADEVRRKY
FT                   LGTEVFLRGIIEFSNYCSSNCLYCGIRAQNKHVHRYRMTPQEIVDRAQIISAQGIKTVV
FT                   LQSGEDPFYTKETLGDIISAIQSLGLTITLSLGERSFDEYSYWKALGADRYLMRHETAD
FT                   EELYEKLHPGDKLENRKAHLLELKRLGYEVGAGSMVGLPGQDDFALAKDILFTYELDAD
FT                   MIGIGPFIPHPDTPLRDAPQGTLEKTLKMVALTRLFLPDANIPATTALGSIHPQGRQMA
FT                   LKCGANVIMPNFTPSPYRAEYVLYPNKICVMENDVACGECTKALVKSAGYTVSLSHGYR
FT                   KRRIKEQQ"
FT   gene            complement(139801..141231)
FT                   /locus_tag="COPRO5265_0141"
FT   CDS_pept        complement(139801..141231)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0141"
FT                   /product="thiamine biosynthesis enzyme"
FT                   /note="identified by match to protein family HMM PF04055;
FT                   match to protein family HMM PF06968"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18115"
FT                   /db_xref="GOA:B5Y6W4"
FT                   /db_xref="InterPro:IPR010722"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR024007"
FT                   /db_xref="InterPro:IPR034428"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y6W4"
FT                   /protein_id="ACI18115.1"
FT                   /translation="MANGIKIANTLSESDTECFIPHQEIFDLLEKTRNPDPAEVRDILA
FT                   KAMNKERLLPRETATLLNTEDPELVEEIFQTAKKLKQQVYGNRIVLFAPLYVGNECING
FT                   CLYCGFRVENKELIRKTLTDEELEQELYALTSRGHKRLIVVFGEHPMYSPEYIAGVIRK
FT                   IYAFKNGPGEIRRLNVNAAPQTVDGYKIIKEAGIGTFQIFQETYHLPTYKKLHPHGPKS
FT                   SYTYRLYGLDRAMVAGIDDVGIGALFGLYDWKFEVMGLMYHTQHLEERFGVGPHTISFP
FT                   RMEPAVNTPMAENPPYKVSDYDFKRLIAIIRLSVPYTGMILTAREKPEIRREALEMGVS
FT                   QIDAGSSIGIGSYSASDPEEVKKSQFLLGDTRPLDEVIYELASHGYIPSFCTSCYRAGR
FT                   TGQHFMEFAIPGFVKNFCTPNALLTFEEYLMDYASPKTKEIGEALIEQELMQMPENRRS
FT                   MVKGLLERVKNHEHDVRL"
FT   gene            complement(141249..141491)
FT                   /locus_tag="COPRO5265_0142"
FT   CDS_pept        complement(141249..141491)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0142"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17247"
FT                   /db_xref="InterPro:IPR023860"
FT                   /db_xref="InterPro:IPR027271"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y6W5"
FT                   /protein_id="ACI17247.1"
FT                   /translation="MERFYIVNIIINNREKAYKQVNELLHDFAEDIRLRVGYPLPEENA
FT                   AIILLVVKANNDVLGSLTGKLGQLESVQVKTLPLK"
FT   gene            141744..142814
FT                   /locus_tag="COPRO5265_0143"
FT   CDS_pept        141744..142814
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0143"
FT                   /product="tungsten-containing aldehyde ferredoxin
FT                   oxidoreductase cofactor-modifying protein"
FT                   /note="identified by match to protein family HMM PF04055"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ACI16810"
FT                   /db_xref="GOA:B5Y6W6"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR023885"
FT                   /db_xref="InterPro:IPR027604"
FT                   /db_xref="InterPro:IPR034391"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y6W6"
FT                   /protein_id="ACI16810.1"
FT                   /translation="MSVEYYLGDAKVLIEPKSLKRIYVELSRACNLACAMCFRHTYEDH
FT                   TRALMDEKTVQKMLQEVVNSPAEEVIIGGIGEPLMHPLWKNVVKELKNAYKRVTITTNG
FT                   TLINREVAEFLVDQRVDEVYISVESSPLGHNNVENTFAVGDLITELKQRKNKMRPILSA
FT                   EVVLTKSSLVEDLELMKKLSRHGIRYVLINNLLPTAPELDKEVLYVKDRASDLRFKLSS
FT                   ELYARVGVEYPEFCIKTERLCRFVERNSLVIAADGSVCPCYRFLHDGSERVFGREKALH
FT                   SHGFGNINEDSLMNIWNSSDYTIFRFKVRYALYPSCGDCFLRDGCSFLWDDKADCWGNM
FT                   PSCGDCLWYRQIILCP"
FT   gene            142853..144091
FT                   /gene="ahcY"
FT                   /locus_tag="COPRO5265_0144"
FT   CDS_pept        142853..144091
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ahcY"
FT                   /locus_tag="COPRO5265_0144"
FT                   /product="adenosylhomocysteinase"
FT                   /EC_number="3.3.1.1"
FT                   /note="identified by match to protein family HMM PF00670;
FT                   match to protein family HMM PF02826; match to protein
FT                   family HMM PF05221; match to protein family HMM PF07991;
FT                   match to protein family HMM TIGR00936"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17466"
FT                   /db_xref="GOA:B5Y6W7"
FT                   /db_xref="InterPro:IPR000043"
FT                   /db_xref="InterPro:IPR015878"
FT                   /db_xref="InterPro:IPR020082"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR042172"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y6W7"
FT                   /protein_id="ACI17466.1"
FT                   /translation="MSEVKNPALYGDGLVKIDWVKRFMPVCGELEKAYAKEKPFQGLTI
FT                   AMCIHLEAKTARLALLLRDAGAKVVVTGSNPLSTQDDVAAALEHEGLEVFAWRGETSEE
FT                   YERNLQCLLSFNPDLILDDGFDLTTMLVERFPQKVGKVIGVTEETTTGLIRARNMAKAG
FT                   KLPFPVMAVNDARVKHLFDNRYGTGESSVYSFMHNTNLLIGGKTFVVAGFGFVGRGIAE
FT                   KLRGLGAKVIVTEVDPVKALEAHAEGFTVMSMDEACQVGEVFITATGNTGVIREEHFLK
FT                   MKDGAILGNAGHFNVEVDVEALEKLAQDTYEARPNIMGYRMPNGKVLFLIAEGRLMNLA
FT                   AGQGHPAEIMDLSFAAQFLSLKYLMDSKGTLQPQVLLVPAEIDEEVARIKLGSLGIKID
FT                   QLSRSQEEYLNRW"
FT   gene            complement(144102..144557)
FT                   /gene="bcp"
FT                   /locus_tag="COPRO5265_0145"
FT   CDS_pept        complement(144102..144557)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bcp"
FT                   /locus_tag="COPRO5265_0145"
FT                   /product="bacterioferritin comigratory protein"
FT                   /EC_number="1.11.1.-"
FT                   /note="identified by match to protein family HMM PF00578;
FT                   match to protein family HMM PF08534"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17794"
FT                   /db_xref="GOA:B5Y6W8"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR024706"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y6W8"
FT                   /protein_id="ACI17794.1"
FT                   /translation="MEHWQEIELVDLDGRSVRISDFQGWKVLYFYPKAMTSGCTMEAED
FT                   FSRLYEDFKTLGVTVIGVSTDNVERLKKFKEKVGIPFVLLSDPNHALAEALGVWKEKNM
FT                   YGKKTMGIERSTFVINPDNQIIKEWRKVKVAGHAQEVFDHIKEFMKN"
FT   gene            144543..147722
FT                   /locus_tag="COPRO5265_0146"
FT   CDS_pept        144543..147722
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0146"
FT                   /product="ggdef domain protein"
FT                   /note="identified by match to protein family HMM PF00990;
FT                   match to protein family HMM TIGR00254"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17120"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y6W9"
FT                   /protein_id="ACI17120.1"
FT                   /translation="MPMFHFCHLTFELCLFAFLDYNFIMFQEWEGLLQNTKGIVFIDIP
FT                   TGKGRTYTLKQLKKVCKVKSLYSLYYSPLTGVGQLFFDLLNGVREDFLEEFPEHGPVIR
FT                   RYLHHRFYPALSSFKPYRPLTVSQEQTLLLSAMVDLVRASGIKYWFIDDWLQDDYNYLF
FT                   SVVLPELVAATDITVVVVGDAFPREWAETVLENSSLDAFFGDDCLAKYCRTFGFSEQDI
FT                   EKMISETEGNWHELLFLCQTRATNLSDALKRAMSALPEQACDLLNGFAVMAERNSAFIK
FT                   DILLGEQRDYSALEKLEQLHLVFWESPLYRFPSPRVRELVRERIPQSEQKAILESVTDA
FT                   MAKVGYSDYWGRIATRYRTWGKRKKEAFALLMELREKKGTAEVMKTIDRLDQLGVNGPG
FT                   YRRLKSLCQYWTNNLQGAVETLKALKNPNLVDLANLIRFLSYSGQIAEADRLASGLLRD
FT                   REVICNSLFFPRIAGDLSLPFVLKGRYREGLELLEQFLEVIVGKPYLREHLGVYYNSLG
FT                   VLLAYNGRLYASYDALQRGLEVMGSLEGSEVHLRLLINLSDTALELEGPSASFKYVNAA
FT                   FRSTAPCNLALRAVALSNYCATYFQFMGLPKEALEELISLMPEADTKTRFDVGEVVVGT
FT                   YWLSGMGNLAKSVLTMMSAENDEQHFRYAVFQAALGLCSWSEESFPSIGLSSSFPLYPV
FT                   MWLYKENPEKLKGLSLFSSDRPIVLFFRALRQRDTVENLMAFAVRAEHGWYLADAMFIY
FT                   ELLASLVEGEEKAAFLEEALRLATLLGFSEKARLLRKQIHELNIPLVHSMNLQMLEKSL
FT                   LSLPLEQATISGFIKYLGNILSHFYEDFFLSISWGEEIYRTGRERVSGFAIDMCLPPFW
FT                   GTFVVKNGNVADALVLKAVLLSVERVWGIRYGTNDALTGLFNRNFGLEVLNRLWSDYER
FT                   SGRSFSVIFMDVDNLKNINDTLGHPVGDQVLREVAFGLKKHLRQSDFAVRWGGDEFLVI
FT                   LLQSDEQGAQKVAERIEMELANSPMPVGLSYGIVEAKEVLTLEELLRTSDARMYLQKRS
FT                   KKTRKGEDERT"
FT   gene            complement(147754..149049)
FT                   /gene="trmE"
FT                   /locus_tag="COPRO5265_0147"
FT   CDS_pept        complement(147754..149049)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trmE"
FT                   /locus_tag="COPRO5265_0147"
FT                   /product="tRNA modification GTPase TrmE"
FT                   /note="identified by match to protein family HMM PF01926;
FT                   match to protein family HMM PF08477; match to protein
FT                   family HMM TIGR00231; match to protein family HMM
FT                   TIGR00450; match to protein family HMM TIGR00650"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ACI16789"
FT                   /db_xref="GOA:B5Y6X0"
FT                   /db_xref="InterPro:IPR004520"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR018948"
FT                   /db_xref="InterPro:IPR025867"
FT                   /db_xref="InterPro:IPR027266"
FT                   /db_xref="InterPro:IPR027368"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031168"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y6X0"
FT                   /protein_id="ACI16789.1"
FT                   /translation="MEPIVALATPWGVGALHVIRISGDASKNTVEAFLDKPLQKPRHAS
FT                   LRYFSSEKVEDQVVAIWYSEPHSYTGEEMVEIMCHGNPAIAELIIETLLDAGMKPAQPG
FT                   EFTFRAFLNGKMDLTQAEAVNDLILARSTELLKAGENTLKGKLSDRIASLRNKVLNVLA
FT                   FLQAAMDFPEDVEESSIEEQLREILVETEDLIESAKTAEILRKGISLVIAGRPNVGKSS
FT                   LMNALVGMERSIVSQIPGTTRDYIEQYTVLGKIPVNVVDTAGLRHTDDPIEQEGVKLAL
FT                   RRIEEADLVIFLYDASTGWTDEDKQMFNLIQEEKTIVVGNKIDKGKGNEQHPKAYFVSA
FT                   KEKTGIDRIIEAIHQLMNITEPPKLLVSQRQMGLLEKTLGDVHDALEHLSVYAEVAADD
FT                   LFSALRNLTTLIDGDVEEDLLSTVFSNFCIGK"
FT   gene            complement(149111..150022)
FT                   /locus_tag="COPRO5265_0148"
FT   CDS_pept        complement(149111..150022)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0148"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17799"
FT                   /db_xref="GOA:B5Y6X1"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y6X1"
FT                   /protein_id="ACI17799.1"
FT                   /translation="MSSKKKKILFRLIVLSVLMCVVLPLSVHAALVIGNEFGFGTYVGY
FT                   WKSQADTVAPPGYLMDFTQYGGQTSVFTTLSTGEVFFGDFTLKGKLWYPLVAAGSDVYI
FT                   APGSEGEIPVILMGSRVVNQSTATLQTMALVGNDVLYYILRPFSVIAKYGVLGFLVLGL
FT                   IWGLLSDSTPGFSISWGSILSAILGAVFLFAVYAFVDLASSLFFNSALNALDSYTGLLL
FT                   TVLWAALWIAFWIIIIRMVGYGTSTLRKTVSTPWFWIVLAVVSYFWYPAALVVLVALAA
FT                   LGSSQWFSNFLESQVSFGRSNS"
FT   gene            complement(150044..151558)
FT                   /locus_tag="COPRO5265_0149"
FT   CDS_pept        complement(150044..151558)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0149"
FT                   /product="RNA-metabolising metallo-beta-lactamase"
FT                   /note="identified by match to protein family HMM PF00753;
FT                   match to protein family HMM PF07521"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17481"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR011108"
FT                   /db_xref="InterPro:IPR022712"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y6X2"
FT                   /protein_id="ACI17481.1"
FT                   /translation="MELTFLGAAQEVTGSSYLLESDNAKLLIDFGMFQGKEEDWNYQPL
FT                   DIKAKEVNALLLTHAHLDHSGRIPVLVKNGFRGPIFATPPTIELTKLLWEDTVKLMKEE
FT                   KERLDRKRRRQDKPPVELLFDEDDINEASKLFVPLPWNQTERFKEFQFTFRPSGHILGA
FT                   SSIEVNAENIKLVFSGDLGPQDTVLEPPPYIFEYADYVVIESTYGDRQHKDIRETRAEF
FT                   KNALSAAIRDRSKVLIPTFVVDRAQRIIYELYLLLTQEMPELATMPMFFDSPLGNKITA
FT                   VYSSYPEYLLPHLAEFFQGMDQEKLGIQYIDTPEQSKKLNNLDHALIMAGSGMCTGGRI
FT                   LHHLKHGLWNPKNHLIFVGYQAAGTLGRSIVDGARNVKIMGEDIAVRAQIHTINGFSSH
FT                   ADAKDLLSWAKNFQPDTTFLITHGEPRPAKSLAVSLGNMGYHSVIPARRQSVTLRPRKE
FT                   RIAIPPPEAYTIGQKIDNFVAKYPHKRKLVERVLTALLESLEDSEA"
FT   gene            complement(151852..153528)
FT                   /locus_tag="COPRO5265_0150"
FT   CDS_pept        complement(151852..153528)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0150"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17638"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y6X3"
FT                   /protein_id="ACI17638.1"
FT                   /translation="MKSKKLIALTAIVALAFLPLNANAAPTVSDYENVYVIQNSEGEVK
FT                   KVIAVDWLRVEGEGPFSILDPIDGGASPQILIGDATITHSDMGLTIQGQSSGVADVFYR
FT                   TDLQKELPFSLKLNVLINGKAAKLSDLEQATGSVEIGVEFFNYYKQGDIYLPWLVNISV
FT                   TLDGPSVKDVTVSSGNVNYVGSKAMATLMMQAVGEKTTATISYEAMKKSSPSLSISVVP
FT                   TLMAIELPDMSNLKDMSKALEGIAKGIDGYSEALTKMANSVQTDLDLSSLENVTLLLDA
FT                   YGQILSQMYQQLNPQQIAMLPKAAEGLIALEQPLQQTASALDQLGTLVSAYTELASQSL
FT                   AINQQVSNALTMQPELPGKEQLLQLMGQQQLLLQAMTQGATLPTGFIPPLSTLKQSLTQ
FT                   LSQGSRQMAQALQQTASQMGMLKDLSNGLLAMRNTLGIMVNGGTVQGKQLPPIAQVSSQ
FT                   LKTGISTMQRELSQGMLDLKTALNTLVKGGTINGQTIPPMSELSKGLREISKGANQAYE
FT                   TFSSQSQNLDKAKELADSYNSFSGLPTGATGKVMFIIKIED"
FT   gene            complement(153525..155498)
FT                   /locus_tag="COPRO5265_0151"
FT   CDS_pept        complement(153525..155498)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0151"
FT                   /product="mmpl family"
FT                   /note="identified by match to protein family HMM PF03176"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17978"
FT                   /db_xref="GOA:B5Y6X4"
FT                   /db_xref="InterPro:IPR000731"
FT                   /db_xref="InterPro:IPR004869"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y6X4"
FT                   /protein_id="ACI17978.1"
FT                   /translation="MYLILAVLSFFAMQNRAMNYDITSALPKDVPSIEAMQILSDQMQV
FT                   GESITIYWKDGTLKDVAAAVEKIKQIPKVVNVSWLGTVVDPATPEELYPEEASNWVKGN
FT                   NFNVVIQTTATTGEVSQITNELKSFLPSNAHIISSDVQLEEVEEYFSGKPMLYFGLGLL
FT                   FVFLFLLFYFDKPLTPILIVVSMAVGVLLNLGISGLLHQSTFYLVTIIVEVLQLAVSYD
FT                   YALFLYHRYEEERKTRPDSESMEIALVATIKAISLSALTTVAGFFALTFATLTISQDIG
FT                   WLLLRGVALSFLVSITLLPALLLTFEGKLTWKTLNLENIVANIAASVEKAVTPLFAVLL
FT                   IVLILGFWGGSRTEITYANDVFIPSQLTSMKVQQEYQKEFQNYDTWMVLLDKNSNYTQA
FT                   LQAINKLSLVQNVLNPATMLDQAIPQEMLPSSVLSSFSNDQYVYAVVNTKVKPDTPEAE
FT                   ELRKEIENILASLPGKNYITGLSIAIDDIKRISMEDNTKTSWLTLLFIFVILLVGFRNV
FT                   WLSLVLILVIEAAVQLNLWAAGWFQAVTFMVPITLSTVQLGSTIDYAVLSATRFEEAVR
FT                   KGAENPLDVTIRGASPSIFVSAGTFFLMSLPSAILSDIPGLTQIMGGLARGALISGLIA
FT                   VFLLPTVFKVFQHILFGRSVKA"
FT   gene            complement(155644..156987)
FT                   /locus_tag="COPRO5265_0152"
FT   CDS_pept        complement(155644..156987)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0152"
FT                   /product="mate efflux family protein"
FT                   /note="identified by match to protein family HMM PF01554;
FT                   match to protein family HMM TIGR00797"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17510"
FT                   /db_xref="GOA:B5Y6X5"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y6X5"
FT                   /protein_id="ACI17510.1"
FT                   /translation="MLQGDPKKVIWSMSLPNMLGSLLSNALPAIELALIADLGTNAIAA
FT                   VGIVGMLVSLIYVYNEVWGTGSVIVMANYLGKKEYEKARLALKETTYGKFFGALILVLL
FT                   CLPFLEPLLRVLGAKPQIMLHAKGYALPYLLGIPFSMAGYSSYTFFRATGQTIWAMWFM
FT                   LLQTALNIALDFFLILGFWIFPKLNLAGAGWAFLISWVVSDIAAFMFIATPRYELPTNI
FT                   SRHVRFTEVGAEVFRVGFYAGLSNLSTVAVSVITQRIINAVSIPVFAAYQVFNRIVQIP
FT                   NTVVSSISLMSTPIMAQNVGAKLHDRVKAFVDYCLEIGVYLLGVFAIICLIFPGSLLSL
FT                   FRVKDPTLVPLAVLALRIMAFVPLMSYTTSIFISYFQAYNNTKLPFILNSLAQWLFYAP
FT                   MLYLLLMVLSVSPSTAFWVSSANTFLVLVLHWYYYRAHRKLIKTHFFD"
FT   gene            157309..157887
FT                   /locus_tag="COPRO5265_0153"
FT   CDS_pept        157309..157887
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0153"
FT                   /product="Xaa-Pro dipeptidase"
FT                   /EC_number="3.4.13.9"
FT                   /note="identified by match to protein family HMM PF01205"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17118"
FT                   /db_xref="GOA:B5Y6X6"
FT                   /db_xref="InterPro:IPR001498"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020569"
FT                   /db_xref="InterPro:IPR023582"
FT                   /db_xref="InterPro:IPR036956"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y6X6"
FT                   /protein_id="ACI17118.1"
FT                   /translation="MASYREVIKRSEFIGYAKAVFTEQEVHEFLQQVKLEHPKATHWVW
FT                   AYKIEEIMFSSDAGEPSGSAGLPVLNAIRSSGLDYVMVVVVRYFGGVLLGIKGLIDAYN
FT                   SVARKTLELANKGKVVRQRYVTMELSYEVYGKLYEDLARLVSEPDIRFQEQVIMCGWVD
FT                   MARKEELEHLVAQRGMSLQWGQDERTMVA"
FT   gene            complement(157892..158422)
FT                   /locus_tag="COPRO5265_0154"
FT   CDS_pept        complement(157892..158422)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0154"
FT                   /product="chromate transport protein"
FT                   /note="identified by match to protein family HMM PF02417"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17787"
FT                   /db_xref="GOA:B5Y6X7"
FT                   /db_xref="InterPro:IPR003370"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y6X7"
FT                   /protein_id="ACI17787.1"
FT                   /translation="MDILLELAKAFLQIGVFSFGGGYAIVALIRYVVVNQYAWLTDLEF
FT                   LDVLAISQITPGPIAINTATFVGYLMGGVWGSIVATFSSIAVPFLLVYSMSSLLTRVNP
FT                   VYLDMFFDNITPLTFGLVIAATLSILSSSITDYYGVGIFLFALLLKQKTKLNSALILLL
FT                   SGLLGEVLYLLVK"
FT   gene            complement(158380..158937)
FT                   /locus_tag="COPRO5265_0155"
FT   CDS_pept        complement(158380..158937)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0155"
FT                   /product="chromate transport protein"
FT                   /note="identified by match to protein family HMM PF02417"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18204"
FT                   /db_xref="GOA:B5Y6X8"
FT                   /db_xref="InterPro:IPR003370"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y6X8"
FT                   /protein_id="ACI18204.1"
FT                   /translation="MNFSLLNLFLVFIKVGTLTIGGGYVMVPIFLEEIVNRRHWISEEE
FT                   FFRVLSIAQVFPGPIAVNLAVASGYQLAGFAGSIIAALGATLPSLVIILIIAIFFKQAY
FT                   ALWWVQGLFFGLRPAVAALMVAAVWQLFTKRHWKVPSLILVLVITLIIFALGINPAWVI
FT                   LVYLGGLLTWIFYWNWQKRSYK"
FT   gene            158976..159644
FT                   /locus_tag="COPRO5265_0156"
FT   CDS_pept        158976..159644
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0156"
FT                   /product="cytochrome C biogenesis protein transmembrane
FT                   region"
FT                   /note="identified by match to protein family HMM PF02683"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17355"
FT                   /db_xref="GOA:B5Y6X9"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y6X9"
FT                   /protein_id="ACI17355.1"
FT                   /translation="MFVDKISLWVVVSAALADSVNPCEIGILTMALLHIIFAYGKEKVL
FT                   RIGLMFSLGVAISYFFYGIFIAHVFRYIASIRIIVGVAAILLAIPRMIYALRGEELKLT
FT                   PTPLRPLVAGYLRKGSVWYALVGGLLAGFVLMPCSSGPYYVILTLLSHDIVTVRLKAYV
FT                   WLALYNAIVVLPLVVITLAAHFLMDVTKVKEYKDKLVPLLEWASSLILLALGLYVLTQM
FT                   "
FT   gene            159694..160536
FT                   /locus_tag="COPRO5265_0157"
FT   CDS_pept        159694..160536
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0157"
FT                   /product="hypothetical conserved protein"
FT                   /note="identified by match to protein family HMM PF00892"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17994"
FT                   /db_xref="GOA:B5Y6Y0"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y6Y0"
FT                   /protein_id="ACI17994.1"
FT                   /translation="MEKSWQALLGGVLFYSVSSLLVKATTSPPVTIAFYRVFIATLVVT
FT                   PFWVGDFFRWWKRNFSFPLIVATFGLTLDFVLWFYSLRFTTVAHATFIVNMAPLWVGMM
FT                   SSVFLREPMNIKGWLGIVLGVSGAAVMTLQPSAMQIHAGDLMALGASFGLALYITMTRM
FT                   SSRNIDSSSVLTYSIFFFTCIWLAFAAVLLDQGFVIKGQDFPFVLALALGPQLGGNTLI
FT                   NYALRSLPASTVSVALLGEPVIATVFSYFLFSEPLSWHVVVGGALICLALYATSINTK"
FT   gene            160678..161928
FT                   /locus_tag="COPRO5265_0158"
FT   CDS_pept        160678..161928
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0158"
FT                   /product="NAD-specific glutamate dehydrogenase (NAD-GDH)"
FT                   /EC_number="1.4.1.2"
FT                   /note="identified by match to protein family HMM PF00208;
FT                   match to protein family HMM PF02812"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ACI16974"
FT                   /db_xref="GOA:B5Y6Y1"
FT                   /db_xref="InterPro:IPR006095"
FT                   /db_xref="InterPro:IPR006096"
FT                   /db_xref="InterPro:IPR006097"
FT                   /db_xref="InterPro:IPR014362"
FT                   /db_xref="InterPro:IPR033524"
FT                   /db_xref="InterPro:IPR033922"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y6Y1"
FT                   /protein_id="ACI16974.1"
FT                   /translation="MSTESLNPLVNAQKQIKAACDLLGLDPAVYEMLKEPMRVLEVSIP
FT                   VRMDDGSLRVFKGWRSQHNDALGPTKGGIRFHQNVNLDEVKALSMWMTFKCGVLGLPYG
FT                   GGKGGVCVDPTKLSKRELEQLSRGYIRAIATIVGPELDIPAPDVGTNAEIMAWMVDEYS
FT                   KIKGYNSFGVITGKPLILGGSKGRTDATGYGVALTAREGAKRLGMDFNKCTVALQGFGN
FT                   VGSYSGLYLHRLGGKVIAVTDVFGGIYNKDGIDIEKLMEHVKKTGSVVNFPGTTSINNE
FT                   QLLSLDVDILALCALENQITADNADTIKAKMIVEGANGPVTPEADKILDSKGIFVCPDI
FT                   LTNAGGVMVSYFEWVQNLTNLYWSEEEVKQRQEEGMVEAFKAVYDLAQQYKVNMRTAAY
FT                   MISIKRVYEAMKARGWV"
FT   gene            161955..162056
FT                   /locus_tag="COPRO5265_0159"
FT   CDS_pept        161955..162056
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0159"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17837"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y6Y2"
FT                   /protein_id="ACI17837.1"
FT                   /translation="MYLRANAEENALTQTKAYVMLQEESFSPLEGGS"
FT   gene            162162..163205
FT                   /gene="glyA1"
FT                   /locus_tag="COPRO5265_0160"
FT   CDS_pept        162162..163205
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glyA1"
FT                   /locus_tag="COPRO5265_0160"
FT                   /product="serine hydroxymethyltransferase"
FT                   /EC_number="2.1.2.1"
FT                   /note="identified by match to protein family HMM PF00155;
FT                   match to protein family HMM PF00266; match to protein
FT                   family HMM PF00464; match to protein family HMM PF01212"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ACI16795"
FT                   /db_xref="GOA:B5Y6Y3"
FT                   /db_xref="InterPro:IPR001597"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR023603"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y6Y3"
FT                   /protein_id="ACI16795.1"
FT                   /translation="MSNLGFIDLRSDTVTLPTEEMRRAMAEAEVGDDVYGEDPTIQRLE
FT                   RLAAEIMGKEAALFVPSGTMGNQVSVMTHTQRGDEVIMEAESHVYYYEVGAMAVLSGVQ
FT                   ARPVPGRRGVMDPDDVRRAIRERGNIHFPRTSLVVLENTHNRGGGKVLPLDNVKAISDI
FT                   AHSNGLSVHMDGARIFNAQVASGIPASEYAKYADSVMFCLSKGLCAPVGSMVVGRKDFI
FT                   DRARKNRKMLGGGMRQAGILAAAGIIALTKMVDRLQEDHDNAKLLAVKLQELGYGVNPE
FT                   EVETNMVVVDVTPTGKDVHTVEKELKTRGVLANANSPKTLRLVTHYGVTSDDAIKAVEV
FT                   FADIIRQ"
FT   gene            complement(163341..164288)
FT                   /locus_tag="COPRO5265_0161"
FT   CDS_pept        complement(163341..164288)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0161"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ACI16961"
FT                   /db_xref="GOA:B5Y6Y4"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR038740"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y6Y4"
FT                   /protein_id="ACI16961.1"
FT                   /translation="MFFAKLITGMAKFEIVENHPKWDQFVEKLECPSPFANSSFLKLVD
FT                   TCYDGQSFTLSVVSSGNIFMGAALRKVGRHIRPAPPMTYMPLIYDKLSHRTLLDAQIAL
FT                   GEYLKKNFSVIHYISATSFFQDVRGFQREGFGMQVLYTALSDLKDFDIMKVEQKQRNII
FT                   YKAQRENIAVEETRDMEPLWDIYISTFDRKSIEPPYSKDFFMALPELGEKIRIYTAKKD
FT                   DGRLVGFAAILLQGKCAYYYVSGNTHEGLSLGASPLLMFTILENLKKEGYSYFDWCAIN
FT                   LPRLANFKLSFGSKAVPYFALYYEPKWLRMLKAR"
FT   gene            complement(164424..165074)
FT                   /locus_tag="COPRO5265_0162"
FT   CDS_pept        complement(164424..165074)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0162"
FT                   /product="conserved protein"
FT                   /note="identified by match to protein family HMM PF00149"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17498"
FT                   /db_xref="GOA:B5Y6Y5"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y6Y5"
FT                   /protein_id="ACI17498.1"
FT                   /translation="MLIAASSDIHSPKYIRLFIDSIRNLPVPDLFLLAGDLVLRGAAGA
FT                   FDLIHEEVRQNWEDVPVVAIFGNEEFENTKRKLKREYSDIIWLDDEQVQVKGVDIFGTT
FT                   GVLDEPTAWQSKAVPGITKIYENRMEKIETFASKHPNSILLTHYAVGTYTIDPVPNPLQ
FT                   LTSEKLLQSLLDLPITVIHGHCHYAPQWMYKEENLTIYNVALPLHRGIVLLNV"
FT   gene            165171..166412
FT                   /gene="proP1"
FT                   /locus_tag="COPRO5265_0163"
FT   CDS_pept        165171..166412
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="proP1"
FT                   /locus_tag="COPRO5265_0163"
FT                   /product="permeases of the major facilitator superfamily"
FT                   /note="identified by match to protein family HMM PF05977;
FT                   match to protein family HMM PF07690"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17979"
FT                   /db_xref="GOA:B5Y6Y6"
FT                   /db_xref="InterPro:IPR010290"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y6Y6"
FT                   /protein_id="ACI17979.1"
FT                   /translation="MNEKWLDRLYRTFPALSYRNFRLFWFGQAVSLIGTWIQNVGQGWL
FT                   VLELTNNSAYMLGIVTMLQTLPVLLLSLVAGAFVERFPKRNVLLVTQSCFGILAAVLAT
FT                   LTLFGVVKYWHVLVLATLLGLTNTFDMPARQALYAEIVDKKDLTSAISMNSMIFNLARI
FT                   VGPSVAAFLIAALGIAICFYLNALSFVAVIAGLYMMDISHIHLQPSGRSAMKDIMAGLK
FT                   YVRTRPSIMFPLIMMGTLSLLAMNFNILVPTLAKVQLNIGVTGYGTLMTFMGLGAFLIS
FT                   LYLSAVGSRGGINHIYWFGAYGLSLSLLALSISRSAFFAELSLFLSGICMQAFNTLSNT
FT                   AIQINSEDEFRGRVMSLYSLMFVGVAPFGSYFSGWIAQNLGVNWAFGISGVLSLILVMV
FT                   ISIFWSASLKRQPI"
FT   gene            166464..166904
FT                   /gene="mgsA"
FT                   /locus_tag="COPRO5265_0165"
FT   CDS_pept        166464..166904
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mgsA"
FT                   /locus_tag="COPRO5265_0165"
FT                   /product="methylglyoxal synthase"
FT                   /EC_number="4.2.3.3"
FT                   /note="identified by match to protein family HMM PF02142;
FT                   match to protein family HMM TIGR00160"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17297"
FT                   /db_xref="GOA:B5Y6Y7"
FT                   /db_xref="InterPro:IPR004363"
FT                   /db_xref="InterPro:IPR011607"
FT                   /db_xref="InterPro:IPR018148"
FT                   /db_xref="InterPro:IPR036914"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y6Y7"
FT                   /protein_id="ACI17297.1"
FT                   /translation="MNEVEIVEMDEVKRIALIAHDNRKQDLLDWASYNVETLKKHKLYA
FT                   TWGTGTLLEEKLGLEVIKFKPGPLGGDQEVGSLIANNGVDILVFFWDPLEPMPHDPDVK
FT                   ALLRIAVVWNVVVVSDKATADFVVSSPFFEKKYPRLVRKYEY"
FT   gene            complement(166901..168082)
FT                   /locus_tag="COPRO5265_0164"
FT   CDS_pept        complement(166901..168082)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0164"
FT                   /product="nitric oxide reductase (Type A flavoprotein FprA)
FT                   (FMNprotein fprA) (Flavoprotein A)"
FT                   /EC_number="1.-.-.-"
FT                   /note="identified by match to protein family HMM PF00753"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17406"
FT                   /db_xref="GOA:B5Y6Y8"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR016440"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y6Y8"
FT                   /protein_id="ACI17406.1"
FT                   /translation="MNPRKVTDGVFFVGAPDWDRRLFDALIPLPEGTSYNAYLITGQEK
FT                   TALIDTVDPTKWEVLKAYLEKVNNIDYVVIQHVEQDHSGSLPMVLEKYPNAVVIANSKA
FT                   KELILTHLHVPEEKIQVIEDGDKLDLGGLTLQFIFAPWVHWPETMLTYLPERKLLFTCD
FT                   FLGSHLATSSLFIEDERLVYLGAKRYYAEIMSPFRNLIKGHLEKIKKLDIDMIAPSHGP
FT                   IYQNPDFIIEAYEEWISDQPKNIVLLPWISMHGSTQAMVEYLTSKLVEKGVEVQPYDIS
FT                   KADLGELTMATVDAATIILAAPTILTNMHPMAELVAYWVSILRPKAKAYGFIGSYGWGG
FT                   KTLETVKSLFSGIKADFFEPVLVKGLPTQTDYEALDKLADAIVEKHRVLGLLP"
FT   gene            168241..169617
FT                   /locus_tag="COPRO5265_0166"
FT   CDS_pept        168241..169617
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0166"
FT                   /product="phosphomannomutase/phosphoglucomutase (PMM /PGM)"
FT                   /EC_number="5.4.2.8"
FT                   /EC_number="5.4.2.2"
FT                   /note="identified by match to protein family HMM PF00408;
FT                   match to protein family HMM PF02878; match to protein
FT                   family HMM PF02879; match to protein family HMM PF02880"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18075"
FT                   /db_xref="GOA:B5Y6Y9"
FT                   /db_xref="InterPro:IPR005841"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR016066"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y6Y9"
FT                   /protein_id="ACI18075.1"
FT                   /translation="MNINRDMFREYDIRGVADQDLTIDAAFGIAKAFAKYAKERGYSEM
FT                   FVGADNRKSSPKLREAVIDALTQSGVHVYDLGTVITPLFYHACVTKGVGAGIMVTASHN
FT                   PPQYNGFKLFLGESTLYGDQIQVIADMVEQNDFVSGRGSIESYDHKEEYFKDLLERIGT
FT                   TLPLQVGVDCGNGTASLFAPELLARAGAQVEPLYCDSDPNFPHHQPDPVKAENMQDLKK
FT                   LVLDKKLDLGLGFDGDGDRLGVVDDKGNILFGDVLMILFWREILIKRDPKTVKAIVEVK
FT                   CSEALVEELKRMGAEVVMYKTGHSLIKAKMRELGSPFAGEMSGHMFFADEYYGYDDALY
FT                   SALRLLRLIKESGKKLSDLVSTIPVYHASPEIRLEFSDEKKFQLVEFVKSYFAGKGYPL
FT                   VDVDGVRVYIKSGWGLVRASNTGPEIIVRYEAKNPEDLEAIRQELEEALAAGGFKTTLP
FT                   "
FT   gene            169718..170662
FT                   /locus_tag="COPRO5265_0167"
FT   CDS_pept        169718..170662
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0167"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17983"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y6Z0"
FT                   /protein_id="ACI17983.1"
FT                   /translation="MKKLLAIAAVIVLLAAIFPAVTLAAQGNGVGLKLNNRMTTASAPL
FT                   TATPLSTEQLEKAYQIVASALSTTTTNLKNLEEKYDIGLGAIIKAQAVVTATTAVTLDK
FT                   VLSYMTEHKLIEGLNYFGVDLDKFKTSLQTLEDRIRAELEKAGINIPGLRGLANGLGLG
FT                   NKWGPGNMGTATPLTSAQLDKVYQVVATALGTSTTNLDNLREKYDVGLVEIIKAQAIVT
FT                   STTGVTLDQVLSYTADHTLIQALSNFGVSQDKFETALKTLTDKISAELEKQGLPIPGWL
FT                   THALKKDFDKGKGPGFENQGKGPSFENHKGRCK"
FT   gene            complement(170700..172658)
FT                   /locus_tag="COPRO5265_0168"
FT   CDS_pept        complement(170700..172658)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0168"
FT                   /product="cadmium, zinc and cobalt-transporting ATPase,
FT                   putative"
FT                   /EC_number="3.6.3.3"
FT                   /EC_number="3.6.3.5"
FT                   /note="identified by match to protein family HMM PF00122;
FT                   match to protein family HMM PF00702; match to protein
FT                   family HMM TIGR01494; match to protein family HMM
FT                   TIGR01525"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17326"
FT                   /db_xref="GOA:B5Y6Z1"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y6Z1"
FT                   /protein_id="ACI17326.1"
FT                   /translation="MRTTLTATQLKCPKCAVHIEEEIKKKNLARDLVIDVPTGIISVEA
FT                   DEEQLIQIKRLLSQAGLYHEEHEERTERFITISGLVLFAIGFAAIRLSPPVGITFLVVS
FT                   SIINGYPRVHELVHNLSVGVLDIFDENLLMLLGGTGGFIAGAYVEAAMVFNLYALAEII
FT                   EESVKKKAQEGLRSILTDIPDSAMLIKEQQLVAVEVEQLKAGDHIRFTAGDTVPVDVVL
FT                   LSPALVDESVITGESAPVNHEPGDMVLSGSKLLTPCDAEVLRPLQESNLAQVQKTIAQT
FT                   LSRKSAFRSWMERFTNVYSPLVLISAVAVFLFGLLSGNAFSVAVYRSSVLLLIACPCSL
FT                   LLASPSAVSAAVSTLARQGVLVRNTDALEKLPQVGTVIFDKTGTITTGRMKITEAQISD
FT                   EHLALVASVESYFKHPVADAIVAYAAEKNIVLKEAKVRQNGNVITGEIENHQVELTMKD
FT                   LLQVKVDGMDVGFFKVEEELRDEAPWVIQRLKDQGYKIIILSGDQHEKVETLARQLKVD
FT                   EYYANMTPEGKQAFVKELEKREHCLMVGDGLNDALALSEAHVSVALPDRRIKTIVETAD
FT                   FILSGTLTPLVNLPSYAQSYTSTVKTNVGLSLGIKVAIFTTSLLGYVALPLAVVADEGT
FT                   ALLVLLNSLRLTSRASH"
FT   gene            complement(172660..172977)
FT                   /locus_tag="COPRO5265_0169"
FT   CDS_pept        complement(172660..172977)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0169"
FT                   /product="transcriptional regulator, ArsR family"
FT                   /note="identified by match to protein family HMM PF01022"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17003"
FT                   /db_xref="GOA:B5Y6Z2"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR012318"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y6Z2"
FT                   /protein_id="ACI17003.1"
FT                   /translation="MSDYSNEQLLKDEMLVCNLADFFDIFGDTSRIKILLALHDKSLPV
FT                   SSIAELTGLSASAVSHHLSLLRGRRVVKVERKGKYRVYELDDDHVSSVLKMAISHIQEV
FT                   K"
FT   gene            173098..174519
FT                   /locus_tag="COPRO5265_0170"
FT   CDS_pept        173098..174519
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0170"
FT                   /product="Ser/Thr protein phosphatase family protein"
FT                   /note="identified by match to protein family HMM PF00149"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17839"
FT                   /db_xref="GOA:B5Y6Z3"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="InterPro:IPR039331"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y6Z3"
FT                   /protein_id="ACI17839.1"
FT                   /translation="MSQRKNKIGRGTLILSLTSFLFFLVLAIWAFSQHGTWGLYNWNHD
FT                   YRRLLNIIIGLGFLVPAVALILWLLRGVVSRTWFKVGSWILNIVSVVVIVVCIGIVFYV
FT                   VVPAYSLLSSTEPKLLVEPSTGIYGIPNLYVYFRTETPTVVVGAWGTGDNLQGFGDSKP
FT                   VKEHLFHFTDLQPGTEYHYVIDNRMGLTFSTPPLAKTGTLVTFAVASDFHYGGSDANSD
FT                   ERTQILRNISEDPNVNLFFMNGDIVDLGMVNGYWSEFFSDVSENMTKPVALVLGNHDTL
FT                   IGGLYHFRNYFYGADGVKIDSGNELYHRIDVGNVHFLVLEVLWGTEEFTPEQKKWLEDQ
FT                   LSSIPQEDWVIPISHCFYYSSGDVETGRVWADHEDTTRLISPLFEKYNVDLVISGHNHH
FT                   MELLEKDGVTYVLDGVAGGNTTGPRPIKSDYSKWFYGDSRGYLEVTVKQNEAELLFKNV
FT                   DGEVIQQFTVTQNTQ"
FT   gene            174603..175079
FT                   /locus_tag="COPRO5265_0171"
FT   CDS_pept        174603..175079
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0171"
FT                   /product="HymD protein"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17585"
FT                   /db_xref="GOA:B5Y6Z4"
FT                   /db_xref="InterPro:IPR024529"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y6Z4"
FT                   /protein_id="ACI17585.1"
FT                   /translation="MSVQFITRTAILLALTMIFQSFRAPQLVTGTLVNGMLLISAGYVG
FT                   MWSGVIIGLFTPVLAFLFGIMKFPPMIPFIMIGNALYVLVFSGMKNKPVGMVLGSLVKF
FT                   LWLSASVYYMLPLFGVKAPAVLVEMFTFPQLATAVMGGILALLVLSLLKKSLLE"
FT   gene            175092..175463
FT                   /locus_tag="COPRO5265_0172"
FT   CDS_pept        175092..175463
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0172"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17489"
FT                   /db_xref="GOA:B5Y6Z5"
FT                   /db_xref="InterPro:IPR028979"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y6Z5"
FT                   /protein_id="ACI17489.1"
FT                   /translation="MKLYEVKEILDAEVLSGEDKLDQEVFGACGADLMSDVLAWKGDKG
FT                   VLLTGLTNPQVVRTAEVVGDVKCIVFVRGKRPSTETVELAKEAGIVLMRCKYPMFVACG
FT                   LLFSRGLVPDEYGEISRIL"
FT   gene            175432..175884
FT                   /gene="rsbW"
FT                   /locus_tag="COPRO5265_0173"
FT   CDS_pept        175432..175884
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rsbW"
FT                   /locus_tag="COPRO5265_0173"
FT                   /product="anti-sigma regulatory factor (Ser/Thr protein
FT                   kinase)"
FT                   /note="identified by match to protein family HMM PF02518"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18000"
FT                   /db_xref="GOA:B5Y6Z6"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y6Z6"
FT                   /protein_id="ACI18000.1"
FT                   /translation="MNMEKLAASYRLEYDVKAKDYVRGGEVSSALRAVLKQLSLPPELV
FT                   RRCCVACYEAEMNIIIHSLGGHLQIDIYPDRLVMVAEDSGPGIEDLNKAMEEGYSTAPE
FT                   EAREMGFGAGMGLPNIKANTDRLDITTGPEGTKLIMEVLFVGKDGQ"
FT   gene            175874..177226
FT                   /gene="napF"
FT                   /locus_tag="COPRO5265_0174"
FT   CDS_pept        175874..177226
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="napF"
FT                   /locus_tag="COPRO5265_0174"
FT                   /product="ferredoxin 2"
FT                   /note="identified by match to protein family HMM PF00037;
FT                   match to protein family HMM PF02906; match to protein
FT                   family HMM PF04060"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17152"
FT                   /db_xref="GOA:B5Y6Z7"
FT                   /db_xref="InterPro:IPR004108"
FT                   /db_xref="InterPro:IPR007202"
FT                   /db_xref="InterPro:IPR009016"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y6Z7"
FT                   /protein_id="ACI17152.1"
FT                   /translation="MANNAGVYYHSVTLDEEKCKGCTNCIKRCPAEAIRVRNGKARIID
FT                   QLCIDCGECIRACPNHAKVAVTDSWDLMNDFKYRIALPAPSLYGQFKNVDVDNVLTALL
FT                   EIGFDDVFEVALGADIVSKLTRQALMENRLRRPVISSSCPAVVRLVQIRFPSLLDNVLD
FT                   LCTPMEVAATLAKDEAVRKTGLKREEIGTFFISPCGAKVTSVRKPIGTDKTDVDGVLSL
FT                   ASVYSAIADKVKKVQPMPLSKASMIGIGWAKSGGEAAGTLLENYIYVDGIQNVIKVLEE
FT                   VELGKMEDLDFLEAMACVGGCVGGPLTVENNFVAQQRIKKLTEKWQKDRNNNKVPAKDE
FT                   EQGIYNKMELGRARWKKPLERSDAMELSSDIAEALSMMQRIDEVLATLPGLDCGSCGAP
FT                   TCRTLAEDIVKGLATEYDCVFILKNRIKSLAQELSTLAGKIPPVMGEGKES"
FT   gene            177233..177577
FT                   /locus_tag="COPRO5265_0175"
FT   CDS_pept        177233..177577
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0175"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17939"
FT                   /db_xref="GOA:B5Y6Z8"
FT                   /db_xref="InterPro:IPR010766"
FT                   /db_xref="InterPro:IPR028979"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y6Z8"
FT                   /protein_id="ACI17939.1"
FT                   /translation="MNVKLRVRDLLENGFQLVAGDDGLENPIEGVYICDLLSWVMAKSK
FT                   PKNAWITIQSHVNIVAVALMVEQSCIIVSEGVEVEKEAVERANEEAMPILSFPGTSYEA
FT                   AIKLYQLLSR"
FT   gene            177578..178291
FT                   /locus_tag="COPRO5265_0176"
FT   CDS_pept        177578..178291
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0176"
FT                   /product="PHP domain, putative"
FT                   /EC_number="3.1.3.-"
FT                   /note="identified by match to protein family HMM PF02811"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17515"
FT                   /db_xref="GOA:B5Y6Z9"
FT                   /db_xref="InterPro:IPR003141"
FT                   /db_xref="InterPro:IPR004013"
FT                   /db_xref="InterPro:IPR016195"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y6Z9"
FT                   /protein_id="ACI17515.1"
FT                   /translation="MRLYYDLHIHSALSPCASDDMTPNNIVNMCLLKGLDIIAVTDHNS
FT                   VRNVEAVVNLAQRKGLVVVPGMEVQTKEEVHVLCYFYTLDHCYDFQAKWEDSLPKIENR
FT                   REYFGNQLILDEDDELIGEYPYLLLTSSYFGVEDVFRLIRDRGVAVFAHVDRPSYSVLS
FT                   NLGFIPDMDGVATLEISGAVSPQQFLMQHPTLGKYRILQSSDAHYLGDIMERVNYVELT
FT                   SPSVEALLKHLSGFA"
FT   gene            178434..178952
FT                   /locus_tag="COPRO5265_0177"
FT   CDS_pept        178434..178952
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0177"
FT                   /product="Fe-hydrogenase gamma subunit"
FT                   /note="identified by match to protein family HMM PF01257"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18120"
FT                   /db_xref="GOA:B5Y700"
FT                   /db_xref="InterPro:IPR002023"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR041921"
FT                   /db_xref="InterPro:IPR042128"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y700"
FT                   /protein_id="ACI18120.1"
FT                   /translation="MEQLYELFGIDRVEEFRAKLEELKKVPGSMISILNEAQEMFGYIP
FT                   FQVQELISKETGVPLTEIFGIVTFYSRFSIVPAGKYKISLCLGTACYVRGSGQILEKLK
FT                   ENLGINEGETTSDGMFSLEAARCLGACALAPVMMINGEVYGRLTPDEAVKVIQRIKKQD
FT                   LSQAAAEVE"
FT   gene            178965..179558
FT                   /gene="baeS"
FT                   /locus_tag="COPRO5265_0178"
FT   CDS_pept        178965..179558
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="baeS"
FT                   /locus_tag="COPRO5265_0178"
FT                   /product="sensory transduction histidine kinase"
FT                   /note="identified by match to protein family HMM PF02518"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ACI16865"
FT                   /db_xref="GOA:B5Y701"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y701"
FT                   /protein_id="ACI16865.1"
FT                   /translation="MKELALYVLDLAQNSVVAGAKHITIDITADVKADHLLIRIVDDGK
FT                   GMSPHLVERVTDPFFTSRKERRFGLGIPFFKDLVEQCGGTLTIKSKEGEGTIIEGKLKL
FT                   SSVDLVPLGDMGSTIVSLLVSNPELNLVYRFTLNDYSFTFDSAQIREVLQGVNITEPSV
FT                   LNWIKDYVNEGSIEILPNINISKKEGAKKDYEAD"
FT   gene            179545..179925
FT                   /locus_tag="COPRO5265_0179"
FT   CDS_pept        179545..179925
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0179"
FT                   /product="ferredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17857"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y702"
FT                   /protein_id="ACI17857.1"
FT                   /translation="MKQIKTLEDLQKIREEALRKVNIRSDRSGTRITVGMATCGIAAGA
FT                   RPVMMAILDELEKRNVTGVTVVETGCIGLCKFEPIVEVYVPGHEKVTYIKMDPDKARQV
FT                   VVEHVINGHPIREWTLESAELE"
FT   gene            179951..181741
FT                   /gene="nuoF"
FT                   /locus_tag="COPRO5265_0180"
FT   CDS_pept        179951..181741
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nuoF"
FT                   /locus_tag="COPRO5265_0180"
FT                   /product="NADH:ubiquinone oxidoreductase, nadh-binding (51
FT                   kd) subunit"
FT                   /note="identified by match to protein family HMM PF00037;
FT                   match to protein family HMM PF01512"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17085"
FT                   /db_xref="GOA:B5Y703"
FT                   /db_xref="InterPro:IPR001949"
FT                   /db_xref="InterPro:IPR011538"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR019554"
FT                   /db_xref="InterPro:IPR019575"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR037207"
FT                   /db_xref="InterPro:IPR037225"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y703"
FT                   /protein_id="ACI17085.1"
FT                   /translation="MLYRSHVMVCGGTGCTSSGSDNVAAAFVNEIKKAGLDKEVAVIRT
FT                   GCFGLCELGPVVVIYPEGVFYSKMKPEYVPEIVEEHLLKGRPVTKYLFGETVTEKEIKP
FT                   LEETTFYKKQMRVALRNCGIIDPEDIEEAIAMGAYEALGKVLTTMTPEQVIDEMKKSGL
FT                   RGRGGGGFPTGLKWEFAYKQKETPKYVVCNADEGDPGAFMDRSIMEGDPHSVLEGMAIA
FT                   GYAIGANHGVIYVRAEYPLAVKRLQIAIKQAREYGLLGDNIFGTDFSFDVEIRFGAGAF
FT                   VCGEETALLNSVMGRRGEPRPRPPYPAVKGLWNKPTIINNVETFANVPVIISNGAEWFS
FT                   SIGTEKSKGTKVFALTGKVNRTGLIEVPMGTTLREIIFDIGGGIPDGKRFKAVQIGGPS
FT                   GGCIPEEHLDTVIDYDSLISLGAMMGSGGLVVMDEDTCMVNVAKFFLEFIVDESCGKCA
FT                   PCRIGTKRMLEILDKITSGKGEPEDIDRLEKLATTIKDTALCGLGQTAPNAVLSTLRYF
FT                   RNEYEAHINQKKCPAGVCQALLSYTIVADKCKGCGLCARNCPVNAISGELKQPHVINQE
FT                   ACIKCGTCFEKCPFGAIVKQ"
FT   gene            181760..183505
FT                   /locus_tag="COPRO5265_0181"
FT   CDS_pept        181760..183505
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0181"
FT                   /product="hydrogenase"
FT                   /note="identified by match to protein family HMM PF00037;
FT                   match to protein family HMM PF00111; match to protein
FT                   family HMM PF02256; match to protein family HMM PF02906;
FT                   match to protein family HMM TIGR02512"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17295"
FT                   /db_xref="GOA:B5Y704"
FT                   /db_xref="InterPro:IPR000283"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR003149"
FT                   /db_xref="InterPro:IPR004108"
FT                   /db_xref="InterPro:IPR009016"
FT                   /db_xref="InterPro:IPR013352"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR019574"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR036991"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y704"
FT                   /protein_id="ACI17295.1"
FT                   /translation="MDKVTVTIDGITLEVPSNYTVLQACREAGIDIPTLCYAEVINEIG
FT                   SCRLCVVEVDGVRNLPASCIYPVQNGMNIRTNTPRVREARRVNLELILSNHDRSCLTCI
FT                   RNTKCELQDLAERFGITDIEFQGENVNYPLDDASPAIVRNPNKCVLCRRCIAECQEVQN
FT                   VFAIGAVNRGFDTLVSAPFYVSLNDSPCISCGQCITACPTGALYEKDHIQRVYRALADK
FT                   RKHVVVQTAPAVRVALGEEFGMPVGSIVTGKMVAALRRLGFEVVFDTDFGADLTIMEEG
FT                   SELIERLKYGGKLPMITSCSPGWINFCEKYYPDFVENLSTCKSPHMMLGALIKTYYAEK
FT                   MGWNPEDVYVVSVMPCTAKKVEIERPENMHDGLQDVDAVLTTRELARMIKEAGIDFVNL
FT                   PDEEFDQPLGMSTGAAVIFGATGGVMEAALRTVSEIVEGKPLDKIDFEEVRGLDGVREA
FT                   TVTVDGLDLKLAIVNGTGNAKKLLDKIRSGEAEYHFIEIMGCPGGCITGGGQPIHHPNE
FT                   MAEVRKLRAAAIYQADKNLPLRKSHENPAIKQIYEEYLGHPLGEKSHHLLHTHYSSKPL
FT                   YKVTR"
FT   gene            complement(183566..184936)
FT                   /locus_tag="COPRO5265_0182"
FT   CDS_pept        complement(183566..184936)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0182"
FT                   /product="Gnt-II system L-idonate transporter (L-Ido
FT                   transporter)"
FT                   /note="identified by match to protein family HMM PF02447;
FT                   match to protein family HMM PF03600; match to protein
FT                   family HMM PF06808; match to protein family HMM TIGR00791"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17993"
FT                   /db_xref="GOA:B5Y705"
FT                   /db_xref="InterPro:IPR003474"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y705"
FT                   /protein_id="ACI17993.1"
FT                   /translation="MSGPQMIFGLVVGIAVLIFLILRTKIHPFLALIISASLTGIIGGM
FT                   NPPDVIKSITNGFGSTLASIGIVIGFGVMMGRILEISGAAQRMAYTFLKIFGKGREELA
FT                   MALTGYVVSIPIFCDSGFVILSPIAKALSRTTKKSVISIGVALAVGLVATHHAVPPTPG
FT                   PLGVAGIFQVDVGLMILWGLVFAIPITIVGVLYAKWLGNRIYQIPTSDGMGWTRNKKEA
FT                   EHIQKLEVENNDQKELPSVLSSFAPIVVPIILILLNTVLTAMKLTSPVVNYILFFGSPV
FT                   IAVGIGLIIAIYTLVPKMDRTQVIKLMEEGVSSAGIIILITGAGGSLGQVLRDSGAGDY
FT                   VAKLIAGTGLPAILLPFFVATLVRLVQGSGTVAMITSASITAPILATMNVNPVLAAQAA
FT                   CLGAMVFSYFNDSYFWVVNRLLGVEDVKEQIMTWSVPTTLGWATALVMLLIANLILA"
FT   gene            complement(184995..186008)
FT                   /gene="pdxA"
FT                   /locus_tag="COPRO5265_0183"
FT   CDS_pept        complement(184995..186008)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pdxA"
FT                   /locus_tag="COPRO5265_0183"
FT                   /product="4-hydroxythreonine-4-phosphate dehydrogenase"
FT                   /EC_number="1.1.1.262"
FT                   /note="identified by match to protein family HMM PF04166;
FT                   match to protein family HMM TIGR00557"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17477"
FT                   /db_xref="GOA:B5Y706"
FT                   /db_xref="InterPro:IPR005255"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y706"
FT                   /protein_id="ACI17477.1"
FT                   /translation="MRKIIAIPLGDVAGIGPEIVVKSLNDREIYDTCKPLVIGHSIPLQ
FT                   KAMKVSGVALEINRIDNPEEGLYRHGTVDLIELDCPGIENIEFGKIQKEAGLFAYSFIE
FT                   RSVELALHNKVSALATTPINKEALKAAGIPYIGHTEMLADLCGVSNPLTMFQVKNLRVF
FT                   FFTRHLSLLEAIKSIKEKELYEHITMDIKALQSLGIEKPKLAVAALNPHAGEHGLFGRE
FT                   EMEEIEPAVKKAQEQGLNVVGPVPADSVFYKALQGEYDAVLSLYHDQGHIATKMVDFER
FT                   TISLTLGLPFLRTSVDHGTAFDIAGKGIATSTSMEEAIRLAAAYASVYKYDLLSSG"
FT   gene            complement(186013..187272)
FT                   /locus_tag="COPRO5265_0184"
FT   CDS_pept        complement(186013..187272)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0184"
FT                   /product="conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18127"
FT                   /db_xref="InterPro:IPR010737"
FT                   /db_xref="InterPro:IPR031475"
FT                   /db_xref="InterPro:IPR037051"
FT                   /db_xref="InterPro:IPR042213"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y707"
FT                   /protein_id="ACI18127.1"
FT                   /translation="MLEVAIIADDFTGANATGILLKKKGLKVTTLLKPNSNIDQVNAEV
FT                   ISISTNSRSIDPKEAYKRVYEATKTVIKSTPYVAKRIDSTLRGNLGAEIDAVLDAAGEG
FT                   YRAAVVPVYPKSGRVCVGGYLLVNGTPLQLTEVAKDPKCPIRSSNVKELISSQTKRSIA
FT                   NITLDIVAGGRKAISDAFFQVKEDIVVFDAVTDDDIENIASALSSQEKIICVDPGPFTA
FT                   AFIEQKMGFQKQDGIFLILGSVSELTTAQLNYLLKRKEAYICKISVPEILTNEEAAIKK
FT                   ALEVLIQHYKPGLIMGISTKGDASDVLDLQSYSIKAQCDPEEISNRINETLSRIAYTFV
FT                   KDKPFSGIYITGGDTALAFFDVLGINEFTVESEVLPLAVHGTAKVNDRLYNVVTKGGLV
FT                   GNVEALYDIVNYLESLMKGE"
FT   gene            complement(187278..188039)
FT                   /locus_tag="COPRO5265_0185"
FT   CDS_pept        complement(187278..188039)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0185"
FT                   /product="transcriptional regulator, DeoR family"
FT                   /note="identified by match to protein family HMM PF00455;
FT                   match to protein family HMM PF08220; match to protein
FT                   family HMM PF08279"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ACI16844"
FT                   /db_xref="GOA:B5Y708"
FT                   /db_xref="InterPro:IPR001034"
FT                   /db_xref="InterPro:IPR014036"
FT                   /db_xref="InterPro:IPR018356"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y708"
FT                   /protein_id="ACI16844.1"
FT                   /translation="MLTYERRRVVLDLLKKEGKVEVNKLAQQLNVSPMTIRRDLDALSQ
FT                   QGLALRTRGGAVSPNINYELSLEEKMVSNAEVKNRIGERAATLIEENESVLLDAGTTCL
FT                   ALARYIQNMRLTVITSDVRIAFELYRSPTIKLIILGGIVQTNVGAVTGSFAEEMIESLT
FT                   VDKAFIGTSAVDNGLFLSTPTLEKASLKRKFIKNANTSILLADSSKFGRSSLFKICHLE
FT                   QFDLVITDDHLEEFFVQEMDSVGINYDLVEG"
FT   gene            188196..189455
FT                   /locus_tag="COPRO5265_0186"
FT   CDS_pept        188196..189455
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0186"
FT                   /product="secernin 2"
FT                   /note="identified by match to protein family HMM PF03577"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17854"
FT                   /db_xref="GOA:B5Y709"
FT                   /db_xref="InterPro:IPR005322"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y709"
FT                   /protein_id="ACI17854.1"
FT                   /translation="MCDTFYVRSHKDTGSTAFFAKNSDRDPNEPQCMVFVPKGSISEPG
FT                   TYVKLPPYKVKYDVWLSRPSWMWGAEIGVNSKEVCIGNEATFNKLPVEKSGVLGMDYLR
FT                   MALEQASTAFEAMNIIIENTQHFGQGGDGGYEHPLYYHNSYLLVDPKEAYVLETVGKYY
FT                   AFKKLEGSYNISNKLSLTDDFDGISPELEGKVKSFQAYFTNRLVTHFAGAPHRERRGRE
FT                   LLNTLVPNVVNVMAVLQDRSTGAVCSMRNINMIGGGFVSSQTTASLVYDYQRKILWYTE
FT                   GPDPELQLFKPLSFNVPDSVENEELQLQQGVNRWKWNNLLFRAALKDYAVNKDKTYPLR
FT                   LESQRKLLETSVEQLRADKLLEQVWSINQEYLKEALEKIEKGSMKGSWQFRRYWAAENR
FT                   MLIAKETDPAFKSLLKQYLL"
FT   gene            189700..191157
FT                   /locus_tag="COPRO5265_0187"
FT   CDS_pept        189700..191157
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0187"
FT                   /product="copper amine oxidase N-domain family"
FT                   /note="identified by match to protein family HMM PF07833"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17145"
FT                   /db_xref="InterPro:IPR012854"
FT                   /db_xref="InterPro:IPR018711"
FT                   /db_xref="InterPro:IPR036582"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y710"
FT                   /protein_id="ACI17145.1"
FT                   /translation="MLVIAIMLLPACLSPVDAYIGNGIGGQDIAIYIGGQKLSFDTPPL
FT                   NKEGRIFVPIRYIAEYFGGEVEWDPENQIVNVRNGSSFVSLQIGFKFAGVNGAVKVLDV
FT                   APFIYNGRTYVPLRFISEALGKEVRWDDQNRVVYIETGVESYTTTVAVSTGTATVNVVK
FT                   VFLNDPTIKLEIVNAQDQIGVLEPFESMVKRKNPLAAINGTFFQVADTSLPMEPAANLV
FT                   INGRIEHLGTPEKYASTFAFTQDNQVDIANVKMKLQGEYTYIPNPELERLYTQGWYIGT
FT                   INRTMWGENSIRVFTPLRGATTRLNVDGINVIVRNGEVVEQVTGTNVPIPPDGYVIHLG
FT                   GTEVRFKDRFEVGTRLSYRDIYDVRNSSNPEMWQEGVIWGTLSAGPRLITNGEITLDPA
FT                   SELLDIPKITGQPLTRSALGITQNNELLMVTVSKCTIQDLATIMKDLGAYNAMNLDGGA
FT                   STSLYANGKFLATPTRKISNALMVLPR"
FT   gene            191391..191495
FT                   /locus_tag="COPRO5265_0189"
FT   CDS_pept        191391..191495
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0189"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17634"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y711"
FT                   /protein_id="ACI17634.1"
FT                   /translation="MKEKKSRPVEKEESKVFYDPVSDTYYELYNYPLV"
FT   gene            complement(191492..192349)
FT                   /locus_tag="COPRO5265_0188"
FT   CDS_pept        complement(191492..192349)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0188"
FT                   /product="permease, drug/metabolite transporter (DMT)
FT                   superfamily, putative"
FT                   /note="identified by match to protein family HMM PF00892"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ACI16959"
FT                   /db_xref="GOA:B5Y712"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y712"
FT                   /protein_id="ACI16959.1"
FT                   /translation="MSRKSQDTLGYIYLIATTFFWGTTFVFSKEVLNYLDPFSYLFWRY
FT                   VIAFIPLIPFIRIRKKDMLDGFWLSITNAIALITQFVALTTINASTAAFIVSLSIPLTP
FT                   LLEMLWLKKRQSSTVTLGQIVSVVGFLALSYVPGEKFSVSIGAFLMLISALAYTVQFVL
FT                   IPTLHIENQLNTSAYMIGFTALWSLPFTRSFSIPRGVLSPLLYLALVATTLTIWLQLQG
FT                   QKNVSATTAAYIFAFEPIFAYLFAHFTVGENLTTFGNIGALLIFLSALLVQYGEYRTSK
FT                   ANGS"
FT   gene            192484..192969
FT                   /gene="purE"
FT                   /locus_tag="COPRO5265_0190"
FT   CDS_pept        192484..192969
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purE"
FT                   /locus_tag="COPRO5265_0190"
FT                   /product="phosphoribosylaminoimidazole carboxylase,
FT                   catalytic subunit"
FT                   /EC_number="4.1.1.21"
FT                   /note="identified by match to protein family HMM PF00731;
FT                   match to protein family HMM TIGR01162"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17421"
FT                   /db_xref="GOA:B5Y713"
FT                   /db_xref="InterPro:IPR000031"
FT                   /db_xref="InterPro:IPR024694"
FT                   /db_xref="InterPro:IPR033747"
FT                   /db_xref="InterPro:IPR035893"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y713"
FT                   /protein_id="ACI17421.1"
FT                   /translation="MSNSSIDGIGRVAIVVGSKSDIPIIEKCTTVLDQLGVSWQLKVLS
FT                   AHRTPFETQQFAVSADENYDVIIAAAGKAAHLPGVIASYTLLPVIGLPIKSSALGGLDS
FT                   LLSMVQMPKGVPVATVGINEAENAALLACHILSLKYEALRETLKEYRRNMAEDVLRG"
FT   gene            192993..193703
FT                   /gene="purC"
FT                   /locus_tag="COPRO5265_0191"
FT   CDS_pept        192993..193703
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purC"
FT                   /locus_tag="COPRO5265_0191"
FT                   /product="phosphoribosylaminoimidazole-succinocarboxamide
FT                   synthase"
FT                   /EC_number="6.3.2.6"
FT                   /note="identified by match to protein family HMM PF01259;
FT                   match to protein family HMM TIGR00081"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17914"
FT                   /db_xref="GOA:B5Y714"
FT                   /db_xref="InterPro:IPR001636"
FT                   /db_xref="InterPro:IPR018236"
FT                   /db_xref="InterPro:IPR028923"
FT                   /db_xref="InterPro:IPR033934"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5Y714"
FT                   /protein_id="ACI17914.1"
FT                   /translation="MEKLDLLYEGKAKRVYKTDDPRYYIIEYKDEATAFDGKKKGIIQG
FT                   KGTVNNKVSAVFFQLLEENGVPTHFVELLSPTEMLVKRVEIIPLEVIVRNYAAGSISRR
FT                   LGLEEGIKFDQPIVEFCYKNDELGDPMVNNYHILAMKLANEEEINALTQQALRINQILS
FT                   QFLLGKNIILVDFKLEFGRTDEGDIVLADEISPDTCRFWDSATMEKLDKDRFRRDMGGV
FT                   EEAYMEIARRLGCV"
FT   gene            193705..193956
FT                   /gene="purS"
FT                   /locus_tag="COPRO5265_0192"
FT   CDS_pept        193705..193956
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purS"
FT                   /locus_tag="COPRO5265_0192"
FT                   /product="phosphoribosylformylglycinamidine synthase, PurS
FT                   protein"
FT                   /note="identified by match to protein family HMM PF02700;
FT                   match to protein family HMM TIGR00302"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17248"
FT                   /db_xref="GOA:B5Y715"
FT                   /db_xref="InterPro:IPR003850"
FT                   /db_xref="InterPro:IPR036604"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y715"
FT                   /protein_id="ACI17248.1"
FT                   /translation="MAQARVYVTLKKGILDPQGEAVKNALHTLGYGNIDEVRVGKYVVL
FT                   TLQDSSDSEALKNTVEEICKKVLTNPVIEDFSFEIVEG"
FT   gene            193962..194639
FT                   /gene="purQ"
FT                   /locus_tag="COPRO5265_0193"
FT   CDS_pept        193962..194639
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purQ"
FT                   /locus_tag="COPRO5265_0193"
FT                   /product="phosphoribosylformylglycinamidine synthase I"
FT                   /EC_number="6.3.5.3"
FT                   /note="identified by match to protein family HMM PF01965;
FT                   match to protein family HMM PF07685; match to protein
FT                   family HMM TIGR01737"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17804"
FT                   /db_xref="GOA:B5Y716"
FT                   /db_xref="InterPro:IPR010075"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y716"
FT                   /protein_id="ACI17804.1"
FT                   /translation="MKTFGIIVLPGSNCDSDCFYAVRDYLNQDAQYVWHEERNLDKYDV
FT                   LMIPGGFSYGDYLRPGALARFSPAVDALVKEAEKGKLVVGICNGFQVLTELGLLPGALM
FT                   RNKNLKFICKYVDVQVENAHTPFTSRLKMGQTIKLPVAHKDGNYYVDEDTLQQLKKNGQ
FT                   VVLRYSEDVNGSVDRIAAVTNRQGNVVGMMPHPERACDPLLGSSDGMYILGSMLDHLLK
FT                   GGF"
FT   gene            194646..196862
FT                   /gene="purL"
FT                   /locus_tag="COPRO5265_0194"
FT   CDS_pept        194646..196862
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purL"
FT                   /locus_tag="COPRO5265_0194"
FT                   /product="phosphoribosylformylglycinamidine synthase II"
FT                   /EC_number="6.3.5.3"
FT                   /note="identified by match to protein family HMM PF00586;
FT                   match to protein family HMM PF02769; match to protein
FT                   family HMM TIGR01736"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17009"
FT                   /db_xref="GOA:B5Y717"
FT                   /db_xref="InterPro:IPR010074"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="InterPro:IPR041609"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y717"
FT                   /protein_id="ACI17009.1"
FT                   /translation="MENSNTTPLWRTLGLTDLEYEQIVSGLGREPNFTELAMFSVMWSE
FT                   HCAYKNSKPLLKMLPSKGQRVMQGPGENAGVLDIGDGLALVMKIESHNHPSAVEPYQGA
FT                   ATGVGGIVRDIFAMGARPVVLMDSLRFGSLGEGRTNYLFEQVVAGISDYGNCIGVPTVG
FT                   GEIYFQDCYQKSPLVNALCAGIVEQDKMQTGKASGVGSPVLIVGATTGRDGIGGASFAS
FT                   QELGEDAEEKLPSVQVGDPFMEKLLIEACLEAYETGFVVAVQDMGAAGITSSASEMAAR
FT                   GEVGMELNLDCVPLRAEGMAAHEILISESQERMLLVVEKGKEDQIKQIMEKWGLHAAIM
FT                   GRVTDDGWLRVCYHGEVVAQLPAQLLAEGAPQYIREGIPSEHLKDIQDLDVTALQPPAD
FT                   LECTLLELLKSPNIASKAWVFEQYDHMVRTDTVVRPGSDAAVVRIKGKHQALAFTTDCN
FT                   ATYCFLDPYEGAKAAVVEAARNLSMVGAEPIGITDCLNFGNPEDPAVYWQMQRCIEGIR
FT                   DACQVLNIPVVSGNVSLYNETELGPIFPTPVIGCAGLIPDVSRVCTMGLKDDGDVVLVL
FT                   GEDKGELGGSEYLQVQYGLVKGKPPVVDLEKEKALQELVRKLIWEGLLKSAHDISEGGL
FT                   AVALAECALCGERGVEVDLTTSLRPDAALFSESQARAVVSLSPQNLEAVLKLAQDYEVP
FT                   AAVLGNVGGESLLIRVNGEEVADVPLIQCAEHYWRGLEWAMKGI"
FT   gene            196811..198253
FT                   /gene="purF"
FT                   /locus_tag="COPRO5265_0195"
FT   CDS_pept        196811..198253
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purF"
FT                   /locus_tag="COPRO5265_0195"
FT                   /product="amidophosphoribosyltransferase"
FT                   /EC_number="2.4.2.14"
FT                   /note="identified by match to protein family HMM PF00156;
FT                   match to protein family HMM PF00310; match to protein
FT                   family HMM TIGR01134"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ACI16895"
FT                   /db_xref="GOA:B5Y718"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005854"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR035584"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y718"
FT                   /protein_id="ACI16895.1"
FT                   /translation="MRGALLAGIGMGYEGHLMKEDCGVFGVVLDNPEASVYIYYGLQSL
FT                   QHRGEESAGIAVYDGSETHVQKGMGLVSEVFDRIKVKSLKGNAGIGHVRYSTTGAPSLF
FT                   NAQPLVAHLRGHSIAVAHNGNLINAQQLRDSLEKEGRIFQTTSDTEIIMHLMAKNLHKG
FT                   FENALLEVMKSIKGSYALLVLFDNTLAGVRDPNGIRPLCLGKNEVGYFLSSESCALDVV
FT                   NAQLVRDIEPGEIVLIDGVDSSQLRSVKAESEAVNPMHCVFEYIYFARPDSVIDGASVY
FT                   LARMEMGRQLAKEAPVDAHWVVPVPDSGNSAARGYAVESGIPSVDGLIKNKYVGRTFIA
FT                   PEQSMREASLRVKLNVLKELVKGKSVVLVDDSIVRGTTMRRLVRLLKEAGAKEVHLRIS
FT                   SPPIIMPCYFGIDMPTRKQLISAQMSPEEVRKLVDADSLHFLSLEGLIKSVGMSSLCTG
FT                   CLNGNYPMDVPKEGNKYLFEKK"
FT   gene            198267..199283
FT                   /gene="purM"
FT                   /locus_tag="COPRO5265_0196"
FT   CDS_pept        198267..199283
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purM"
FT                   /locus_tag="COPRO5265_0196"
FT                   /product="phosphoribosylformylglycinamidine cyclo-ligase"
FT                   /EC_number="6.3.3.1"
FT                   /note="identified by match to protein family HMM PF00586;
FT                   match to protein family HMM PF02769; match to protein
FT                   family HMM TIGR00878"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17838"
FT                   /db_xref="GOA:B5Y719"
FT                   /db_xref="InterPro:IPR004733"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y719"
FT                   /protein_id="ACI17838.1"
FT                   /translation="MKYEDAGVNISKADFFIEKIKPLAQATLTDFVLEGIGPFASLVEL
FT                   KGYKNPVLVSGTDGVGTKLKIAFMMNKHDTVGIDLVAMCVNDVITTGAKPLFFLDYFAC
FT                   GKLDENIGVDVIKGIAQGCTMAKCALVGGETAEMPSFYPEGEYDLAGFCVGVAEKEELL
FT                   NPETVSVGDAVIGLASSGLHSNGYSLVRKIFFEQHHFSVNDQLPELGKTLGEELLTPTL
FT                   IYVRALELLQGLPIKAAAHITGGGLLENVPRVLPEGTAVKLHGDAWFVPPIFKLIQQLG
FT                   NVDLVEMYRTFNMGIGMVLIVPEERANDCVNKINSSGDFNAQIIGEVVAGERQVILP"
FT   gene            199280..199927
FT                   /gene="purN"
FT                   /locus_tag="COPRO5265_0197"
FT   CDS_pept        199280..199927
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purN"
FT                   /locus_tag="COPRO5265_0197"
FT                   /product="phosphoribosylglycinamide formyltransferase"
FT                   /EC_number="2.1.2.2"
FT                   /note="identified by match to protein family HMM PF00551;
FT                   match to protein family HMM TIGR00639"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18251"
FT                   /db_xref="GOA:B5Y720"
FT                   /db_xref="InterPro:IPR001555"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR004607"
FT                   /db_xref="InterPro:IPR004810"
FT                   /db_xref="InterPro:IPR036477"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y720"
FT                   /protein_id="ACI18251.1"
FT                   /translation="MNIVVLVSGRGTDLQSIIDATQEGWLKVNIQAVISDKEDAYALER
FT                   AKQHGIPTYVLSKKVLKSEFQEALLNLLTMLSPDLVVLAGFLTILGPQVVERFPQKIIN
FT                   IHPALLPSFCGKGFYGMKVHEAVYESGVKYTGCTVHFVDAGVDAGPIILQEVVKVDDDD
FT                   TPETIAEKVLEVEHRLLPTAIKLISEGRVVLEGRRVRILPASSEGSEGRNEV"
FT   gene            199896..200018
FT                   /locus_tag="COPRO5265_0198"
FT   CDS_pept        199896..200018
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0198"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17608"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y721"
FT                   /protein_id="ACI17608.1"
FT                   /translation="MKAQKEETRCESDEKEESTHKRVKKRRCGGVCQGTARTWF"
FT   gene            199933..201465
FT                   /gene="purH"
FT                   /locus_tag="COPRO5265_0199"
FT   CDS_pept        199933..201465
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purH"
FT                   /locus_tag="COPRO5265_0199"
FT                   /product="bifunctional purine biosynthesis protein PurH"
FT                   /EC_number="2.1.2.3"
FT                   /EC_number="3.5.4.10"
FT                   /note="identified by match to protein family HMM PF01808;
FT                   match to protein family HMM PF02142; match to protein
FT                   family HMM TIGR00355"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17821"
FT                   /db_xref="GOA:B5Y722"
FT                   /db_xref="InterPro:IPR002695"
FT                   /db_xref="InterPro:IPR011607"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR024051"
FT                   /db_xref="InterPro:IPR036914"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y722"
FT                   /protein_id="ACI17821.1"
FT                   /translation="MKKRKALISVSRKEGVVEFARELQGLGFEIISTGGTYGLLKESGV
FT                   DAVKVSDITGFPEILDGRVKTLHPAIHAGILANRNNADHMAQLALFNIEPIDLVVVNLY
FT                   PFKETVLDEDATMGDAVENIDIGGPTLIRAAAKNWESVTVLVDPQDYADVLDELRDSGS
FT                   TSLSTRFRLAAKAFRHTAYYDAVISSYFSRGAKVLFPDEIVLPFEKVQELRYGENPHQK
FT                   GAFYKDPLSKTGLANYVQLQGKELSFNNLHDVNAVLEILQEFYGVHCAVAVKHANPCGV
FT                   GVGENLFEAYQKAYEGDPVSIYGGIVGVNDTLDEVTALEMSKQFLEVIVAPEFTPEALD
FT                   VLQKKKNLRLLKVNLSTASGFDIKRVEGGVLLQDKDLQDLDEKELTVVTNKAPTPEEMA
FT                   DLRFAWKVVKHLSSNAIALAKNGGTIGLGAGQVNRVGAVEIAIKQAGEKARGAVLASDG
FT                   FFPFSDSVELAAKAGITAIIQPGGSKRDQECIDAANSYNIAMVFTHIRHFRH"
FT   gene            201501..202760
FT                   /gene="purD"
FT                   /locus_tag="COPRO5265_0200"
FT   CDS_pept        201501..202760
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purD"
FT                   /locus_tag="COPRO5265_0200"
FT                   /product="phosphoribosylamine--glycine ligase"
FT                   /EC_number="6.3.4.13"
FT                   /note="identified by match to protein family HMM PF01071;
FT                   match to protein family HMM PF02843; match to protein
FT                   family HMM PF02844; match to protein family HMM TIGR00877"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ACI16980"
FT                   /db_xref="GOA:B5Y723"
FT                   /db_xref="InterPro:IPR000115"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR020559"
FT                   /db_xref="InterPro:IPR020560"
FT                   /db_xref="InterPro:IPR020561"
FT                   /db_xref="InterPro:IPR020562"
FT                   /db_xref="InterPro:IPR037123"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y723"
FT                   /protein_id="ACI16980.1"
FT                   /translation="MNVLVIGGGGREHVLVYKLKQSPLVQKIYCAPGNAGIAQIAELVN
FT                   VAPTDVEKLRSFALEKSIDLTVVGPEIPLMAGIVDGFKEAGLTIFGPSKAAALLEGSKV
FT                   FAKNLMKRCHVPTAQFEVFSSLDDAVNYVKTRQRPLVVKADGLAQGKGVVIAQSTEEAV
FT                   QALESLMEERVFGSAGEKVVVEELLQGPEASVFALCNGADAVILGTAMDYKRAFDGDQG
FT                   PNTGGMGSISPHPLIDRAMEEDILETIIKPVLRGLMEEGIPYTGVLYAGLMLTQEGPKV
FT                   LEFNVRFGDPETQAMMPLLESDLAQLLMSTCIGNLSAVQVQWKQEKCVCVVAASKGYPG
FT                   HYQTGFPINGLGNVRDALVFHAGTTFDATGNVVTSGGRVLSVVATGKSYEEARQKAYKE
FT                   MEKISFPGMFYRKDIASGFD"
FT   gene            complement(202853..203275)
FT                   /locus_tag="COPRO5265_0201"
FT   CDS_pept        complement(202853..203275)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0201"
FT                   /product="molybdopterin-guanine dinucleotide biosynthesis
FT                   protein B, putative"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18050"
FT                   /db_xref="InterPro:IPR004435"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y724"
FT                   /protein_id="ACI18050.1"
FT                   /translation="MITFSVFGRKHSGKTTVCQELIDVLSKKGTVGYEKRTHTTIKLDQ
FT                   HLQMAHQTLWSVVRDSENLQLITTKAPVNLPPVDFLVVEGYIPDVPNILCVKDPYDLEA
FT                   ITPFTLAAVSLSGIPNTKRPDELKNVINSYLERQKS"
FT   gene            complement(203272..203820)
FT                   /locus_tag="COPRO5265_0202"
FT   CDS_pept        complement(203272..203820)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0202"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17218"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y725"
FT                   /protein_id="ACI17218.1"
FT                   /translation="MKGIVEGIARGREKKHEVIGFPILFTARWLHVITQDNFDAYIPRT
FT                   FSGRTWLVNTVDGQPTLGVFVMDNKPMYWLKQVKYVESIYLDKEPTEQIPPPNMEPKQF
FT                   SKGKLTFTGVPLSLLAPLVGKQLWWVQSSDGLERVITEHQLENWILTEQRELINLNTKA
FT                   GSWIKNVLRFCGEKGYISL"
FT   gene            complement(203825..204646)
FT                   /locus_tag="COPRO5265_0203"
FT   CDS_pept        complement(203825..204646)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0203"
FT                   /product="D-aminopeptidase superfamily"
FT                   /note="identified by match to protein family HMM PF04951"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17420"
FT                   /db_xref="GOA:B5Y726"
FT                   /db_xref="InterPro:IPR007035"
FT                   /db_xref="InterPro:IPR027476"
FT                   /db_xref="InterPro:IPR036177"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y726"
FT                   /protein_id="ACI17420.1"
FT                   /translation="MRLFVSVDYEGIWGVPSWEFMKTEEAKQLLHKELNVLLKSIEEVD
FT                   ANAYVLMVDSHSRGDNICRSMLETSSVKLDLISGYPRPNYMMTGIDNSFDGVMFVGYHT
FT                   KAGGWGAMDHSYSSSTIYRVLINGKEVGESTINGFLAHYHGVPVILVSGSEELEEEIKE
FT                   NLPEAVFHATNKTWSRFSAQSYHDALMTLAEKVHQALQNAKQLKDSSITKIGEATFTVE
FT                   FLNRLAADVTSELPFVKRLSSRTIEFTMSDYDQAFHAFQAIVFMASSAMRL"
FT   gene            complement(204703..205728)
FT                   /locus_tag="COPRO5265_0204"
FT   CDS_pept        complement(204703..205728)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0204"
FT                   /product="conserved protein"
FT                   /note="identified by match to protein family HMM PF02568"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17998"
FT                   /db_xref="GOA:B5Y727"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020536"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y727"
FT                   /protein_id="ACI17998.1"
FT                   /translation="MTQGTSQTNPIRAIALLSGGLDSMLAAKLILDQGIEVIGISFESP
FT                   FFNADRARTAAKQLAIPLITWDITDELIKVLKNPKHGFGRFFNPCIDCHALMVKKALEL
FT                   LPSLQAQFIITGEVLYQRPKSQKMGGLMAVAKDSGAQDLILRPLSAKLLPPTKPEREGW
FT                   VNRSLLLDIQGRSRQRQLELAQTLGINDYPMPAGGCLLTDISVTRRLQKIFQYWKDDID
FT                   RPFLELAKVGRHFWTGSDLIVVARNEQESYSLRALMKVWDYKVELTDVPGPTTLVRSRG
FT                   KLTEEVLELSALLTARYSKARTLPLVKVKAENYLFLHTQKLQVKPSALTETMERMNAEQ
FT                   L"
FT   gene            205943..206539
FT                   /locus_tag="COPRO5265_0205"
FT   CDS_pept        205943..206539
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0205"
FT                   /product="transcriptional regulator, TetR family, putative"
FT                   /note="identified by match to protein family HMM PF00440"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17008"
FT                   /db_xref="GOA:B5Y728"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y728"
FT                   /protein_id="ACI17008.1"
FT                   /translation="MTIMVKRSNDELRAEIVGSAKRLFQQYGYKKTTVSDIAKAMGKVK
FT                   SAIYYYFPDKESLLRAVIDEEIGKLIRSIKDAVGRASTPEEKLRAYALIRSLEIRRLST
FT                   EYARFQEEYDQLFPLVKEIHERYDHFERDTLEGILEVGMELGHFNKTDSEVLADTILLW
FT                   LKGLEAQLSSFGSEEALKEAVEHLVNVLLFGIKVR"
FT   gene            206547..207542
FT                   /locus_tag="COPRO5265_0206"
FT   CDS_pept        206547..207542
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0206"
FT                   /product="putative dihydroflavonol 4-reductase"
FT                   /note="identified by match to protein family HMM PF00106;
FT                   match to protein family HMM PF01073; match to protein
FT                   family HMM PF01370; match to protein family HMM PF02719;
FT                   match to protein family HMM PF04321; match to protein
FT                   family HMM PF05368; match to protein family HMM PF07993;
FT                   match to protein family HMM PF08659"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17624"
FT                   /db_xref="GOA:B5Y729"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y729"
FT                   /protein_id="ACI17624.1"
FT                   /translation="MLVAVTGATGLVGNNVVRFFLKLGFDILAVVHPEEGLQSLEGLSV
FT                   RVVRADITNPEQIKEALKGAEAVVHAAGLVSITEASKDKLEAVNVEGTKNVIEACKANG
FT                   VKKLIYISSIHALPADEEGPIRETKDLSVNRVQGAYAKTKVKATLLAFQAAKDGLWTVV
FT                   LHPTGIVGPYDFRTSIVGKLIINALSGKLKWYVSGGYDFVDARDVAKATYLALEKGKCG
FT                   ENYIVAGDYISMKDFLEQCFKTAGKPFNLKEIPYGLALAVSPFMEWYEVSKGKEPQMSI
FT                   YALKTLRSKSDIDSSKIREELGFEPMPMTQTVKDLTNWYLSRMKEAEIRR"
FT   gene            207570..207824
FT                   /locus_tag="COPRO5265_0207"
FT   CDS_pept        207570..207824
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0207"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18024"
FT                   /db_xref="InterPro:IPR021377"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y730"
FT                   /protein_id="ACI18024.1"
FT                   /translation="MGGGENSMRKGVVDSFEDNGELVVIELEDKTTIAVPKDKFICEVH
FT                   VNDVVYETESGMWQVDREETKSKLEEVQNLMDELWEKEE"
FT   gene            207824..209077
FT                   /locus_tag="COPRO5265_0208"
FT   CDS_pept        207824..209077
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0208"
FT                   /product="late competence protein"
FT                   /note="identified by match to protein family HMM PF00753"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17175"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR001322"
FT                   /db_xref="InterPro:IPR035681"
FT                   /db_xref="InterPro:IPR036415"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y731"
FT                   /protein_id="ACI17175.1"
FT                   /translation="MLGNSKNAKLLAASFFLLLLIGLTAYSFTFTAQHSSDLVVSHIDV
FT                   GQGLSVLVQFPNGTAMLYDAGPNKSAETIVNYLKSHSVSKIDALILSHPDSDHIGAADE
FT                   VIESFTIGSFYMPKVAHSTQSYLDVLSAAKAKELTIKTAKKGVTISLDPEVKVTMWGPV
FT                   KEYDLDDTNNWSAVVSITYGSTSFLLTGDAGQEAENDMINTGVVEPQTVLQVGHHGSKY
FT                   STSTEFLSAVTPTYAVISVGENSYGHPSEETLSRLQSYNVHVFRTDKQGTVVATSDGKT
FT                   ITWNVEPISWEDSSQASPTTSQTDSASTATPNQEALPKVVIISKDLKEEIVVIQNNDAV
FT                   DIDMSGWSLVSVKGDQVFTFPEGFRLGKGKTVTITSGFKAYEDSPSVLKWTSSTIWNND
FT                   GDPAELLDDKGRLVSSLP"
FT   gene            complement(209196..209291)
FT                   /locus_tag="COPRO5265_1600"
FT   tRNA            complement(209196..209291)
FT                   /locus_tag="COPRO5265_1600"
FT                   /product="tRNA-Sec"
FT   gene            209373..210539
FT                   /locus_tag="COPRO5265_0210"
FT   CDS_pept        209373..210539
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0210"
FT                   /product="cysteine desulfurase family protein"
FT                   /note="identified by match to protein family HMM PF00266;
FT                   match to protein family HMM PF01041; match to protein
FT                   family HMM PF01053; match to protein family HMM PF01212;
FT                   match to protein family HMM TIGR01977"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17047"
FT                   /db_xref="GOA:B5Y732"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR010969"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR016454"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y732"
FT                   /protein_id="ACI17047.1"
FT                   /translation="MRETFDRKIIYLDNAATSWPKPEAVYEAVDHAMRYSGNASRSGHR
FT                   LALEADRLLYQTRKLLASFFNVQDPAQVVFTKNCTEALNVALKGLLKVGDHVITTSMEH
FT                   NSVLRPLSRLQRSGVEVTVLQANKEGYVTPKQIAEAIRGNTKLIAVTHASNVVGTIMPV
FT                   ADIGKVAHDHGVLFLVDAAQTAGVLPIDMEQCFIDVLCVPGHKSLMGPSGTGALLVREG
FT                   IVVEPLIEGGTGSLSESIEQPSFMPDRLESGTLNVVGIAGLKAGLEFIMGKGLSNIRQH
FT                   EQKLTKMLLEGLSELDNVTVYGPKDVERMVGVVSAVVKGVDPARVSALLDQEYGIATRP
FT                   GLHCAPLAHKSIGTFETGTVRFSVGFFNTLEDIEETIRAMKHIVKEYG"
FT   gene            210563..211192
FT                   /locus_tag="COPRO5265_0211"
FT   CDS_pept        210563..211192
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0211"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF01206;
FT                   match to protein family HMM TIGR03527"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18088"
FT                   /db_xref="InterPro:IPR001455"
FT                   /db_xref="InterPro:IPR003787"
FT                   /db_xref="InterPro:IPR019870"
FT                   /db_xref="InterPro:IPR027396"
FT                   /db_xref="InterPro:IPR036868"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y733"
FT                   /protein_id="ACI18088.1"
FT                   /translation="MENDNNIIVDARGKACPTPVIMTKKAVESAPGKTVTVIVDNEVAK
FT                   ENVSKFAASISYDVAVESREGLYYLTLTPPGGVAQPVTMENQPDVMKCESTLESQTYVV
FT                   VVTTDTFGQGDSTLGKLLMKNYIYALKELDNKPSSIIFLNRGVFLTTEGSEVINDLKEL
FT                   EKIGVEIISCGTCLDYYNLKEKLQVGSVGNMYTIAEKMSKSRAVVL"
FT   gene            211204..211554
FT                   /locus_tag="COPRO5265_0212"
FT   CDS_pept        211204..211554
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0212"
FT                   /product="GrdX protein"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17534"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y734"
FT                   /protein_id="ACI17534.1"
FT                   /translation="MVVTNNKKVLETYPNQVQFIEGSVLDVFLQCEQLLKEGYDLVTHP
FT                   LSGNLQVSKTPFKSVVLERSNENVQPKSLELIRLCIEKVKEGQPISYPDAVLEDFAFLD
FT                   LELIKEPLEELL"
FT   gene            complement(211585..212730)
FT                   /locus_tag="COPRO5265_0213"
FT   CDS_pept        complement(211585..212730)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0213"
FT                   /product="glycerate kinase"
FT                   /EC_number="2.7.1.31"
FT                   /note="identified by match to protein family HMM PF02595;
FT                   match to protein family HMM TIGR00045"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ACI16950"
FT                   /db_xref="GOA:B5Y735"
FT                   /db_xref="InterPro:IPR004381"
FT                   /db_xref="InterPro:IPR018193"
FT                   /db_xref="InterPro:IPR018197"
FT                   /db_xref="InterPro:IPR036129"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y735"
FT                   /protein_id="ACI16950.1"
FT                   /translation="MKILVAPDSYKGSLSSKQVCQAIEEGLLKACQGVFEVVKVPIADG
FT                   GEGTVDAFLSALGGQLIELTVTGPLGKPVHSFYGILPDGTAVIEMAAASGLSLVPTHQR
FT                   NPLVTTTYGTGQLIMNALDRGCSRFIVGIGGSATNDAGVGMLQALGIKFLDDAGKEVPC
FT                   GGGNLDKVATIDLKGMDSRLKNAQFIVACDVDNPLCGENGASAVYGPQKGATPDMVKLL
FT                   DRNLSHLADVVASVLGEDHRNDPGAGAAGGLGFAFKTFLDAQMRPGIDVVMEATHMDTL
FT                   AAQSDIIITGEGRTDYQTAQFGKAPSGVAKLGKRMGKPVLLISGALGEGYQELFNQGVI
FT                   AAFSIANGPVSLQEAMENAYSLLVDIAQNIGRLLVALTKEG"
FT   gene            complement(212749..214131)
FT                   /locus_tag="COPRO5265_0214"
FT   CDS_pept        complement(212749..214131)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0214"
FT                   /product="GntP family permease"
FT                   /note="identified by match to protein family HMM PF02447;
FT                   match to protein family HMM PF03600"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17766"
FT                   /db_xref="GOA:B5Y736"
FT                   /db_xref="InterPro:IPR003474"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y736"
FT                   /protein_id="ACI17766.1"
FT                   /translation="MTPEQVAEMKQVMVHGPLLLVFLVLVILFIVYSTSKWKLHPFLAL
FT                   LFSAYGFAFLAGMPFKYIGTVIASGFGNLMTNIGLVIVFGTIIGTIIEKSGAALRMADS
FT                   ILRIVGEKRSALAMSIIGYVTSIPVFCDSGFVILSPLNKALAKRAGIPLATMAVALSTG
FT                   LYATHTLVPPTPGPIAAAGNVGADLGLVIIVGLIVAIPAALVGLWWANRIGKNIIIEGT
FT                   ENQMSYDELKKQYKKLPNVWLSFAPIVVPIVLIALSSVVSFTKYTGFGSAFIGFLGTPV
FT                   NALMVGVLLSFFLLPNLSEETLNGWVGKGLLDSANILLITGAGGSLGAVLSNSPISDYI
FT                   KTLATGNVAGIGAIILLFVISALLKTAQGSSTVALVTTSSMMAPMLPQLGITTPLQLAL
FT                   AVMAIGAGAMTVSHVNDSYFWVVSQFSGMKVTDAYKAQTMGTLLEGLATIITTIILFAL
FT                   FA"
FT   gene            214321..215097
FT                   /gene="glpR"
FT                   /locus_tag="COPRO5265_0215"
FT   CDS_pept        214321..215097
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glpR"
FT                   /locus_tag="COPRO5265_0215"
FT                   /product="transcriptional regulator of sugar metabolism"
FT                   /note="identified by match to protein family HMM PF00455;
FT                   match to protein family HMM PF01022; match to protein
FT                   family HMM PF08220; match to protein family HMM PF08279"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17102"
FT                   /db_xref="GOA:B5Y737"
FT                   /db_xref="InterPro:IPR001034"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR014036"
FT                   /db_xref="InterPro:IPR018356"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y737"
FT                   /protein_id="ACI17102.1"
FT                   /translation="MVLVGERRQKILEVVSSGKAVTVEELSRILDVSPSTVRRDLRFLE
FT                   SKGLLYRTHGGAMPPVLSSYEPSLVEKESSMVEEKEAIGKYAASLIEEGDTVVIDAGTT
FT                   TIHIVRSLMVNKAKIVTNFLKAALEVPYKPDIEVLLTGGNLRFSTQALVGPVAENFLQH
FT                   IRVDKAFIGTNGVTLEGFSTPNVLEAATKRAMVKCAEKVFVVSDSTKFGKESFVRFADI
FT                   DEVDCIITDWHLADEEVKSYREAGLEVIRVKEGGTI"
FT   gene            215094..216017
FT                   /gene="pfkB"
FT                   /locus_tag="COPRO5265_0216"
FT   CDS_pept        215094..216017
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pfkB"
FT                   /locus_tag="COPRO5265_0216"
FT                   /product="1-phosphofructokinase"
FT                   /EC_number="2.7.1.56"
FT                   /note="identified by match to protein family HMM PF00294;
FT                   match to protein family HMM TIGR03168"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17212"
FT                   /db_xref="GOA:B5Y738"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR017583"
FT                   /db_xref="InterPro:IPR022463"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y738"
FT                   /protein_id="ACI17212.1"
FT                   /translation="MNNGVATVTLNPAIDHTIYVNTFTPNTLNRAEAVEYHIGGKGINV
FT                   SKVLSTLGQPSVALGFLGRNALYFEEELKAASIETDFVQVSGRTRTNIKVIDKSNLGCT
FT                   EINEPGPYIDTASWEKLVKKVTSWAAKCEYVVIAGSLPPGVPHDSYKFLIQEAKKQGAK
FT                   TVLDADGEALKRGLQAMPFMIKPNIHELEGLTGKQLSGSKQELLSVCRELLLAGISVVV
FT                   VSMGSEGSIYASQEGIYRVYPLNLEVKNTVGAGDAMVAGLIHGMSKGLQAEKLAAFGAA
FT                   VSACQIVDDFGRLEEFSKQIRVERWV"
FT   gene            216053..216475
FT                   /locus_tag="COPRO5265_0217"
FT   CDS_pept        216053..216475
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0217"
FT                   /product="iiabc fructose/xylitol-pts"
FT                   /note="identified by match to protein family HMM PF00359;
FT                   match to protein family HMM TIGR00848"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18107"
FT                   /db_xref="GOA:B5Y739"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR004715"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y739"
FT                   /protein_id="ACI18107.1"
FT                   /translation="MKFDMEAREKRQAILELAQLMWEHGYVEDLQGLVDATMAREAEYS
FT                   TGIGMGVGIPHAKSPLVKQPVVAFGKSSKGIEFDSFDGEPVYLVFLIAVPEKSDKEHLN
FT                   ILSMLSRALMHEEVREALMGASTPEEVVNAFQINDD"
FT   gene            216552..217940
FT                   /locus_tag="COPRO5265_0218"
FT   CDS_pept        216552..217940
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0218"
FT                   /product="pts system fructose-specific eiibbc component
FT                   (eiibbc-fru)"
FT                   /EC_number="2.7.1.69"
FT                   /note="identified by match to protein family HMM PF02378;
FT                   match to protein family HMM PF02379; match to protein
FT                   family HMM TIGR00829; match to protein family HMM
FT                   TIGR01427"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17646"
FT                   /db_xref="GOA:B5Y740"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="InterPro:IPR003353"
FT                   /db_xref="InterPro:IPR003501"
FT                   /db_xref="InterPro:IPR006327"
FT                   /db_xref="InterPro:IPR013011"
FT                   /db_xref="InterPro:IPR013014"
FT                   /db_xref="InterPro:IPR036095"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y740"
FT                   /protein_id="ACI17646.1"
FT                   /translation="MKMVAVTACPTGIAHTYMAAESLEKAARELGVEIKVETEGSVGAE
FT                   NALTPEDIASADVVIIAAATQVPKDRFAGKPILEVPIQDAIKNGKAVIERAMKLEKPAQ
FT                   MDYVQQVQKTKEEKSEARTGVYKHLMTGVSYMLPFVVAGGILIALSFAFGIHAADVEGS
FT                   LAWALMKIGGGTAFALMVPVLAGYISYSIADRPGLAPGMIGGMLATSLGAGFLGGIVAG
FT                   FLAGYITQWLKSVIKLPKSLQGLMPVLVLPLLSTAAVGLLMIYVIGTPVASLMNALTSW
FT                   LTGMSEANAVVLGLILGLMMALDMGGPVNKAAYTFAVGLLGSQIYSPMAAVMAAGMTPP
FT                   LALALATVLAKNKFTREEVEAGKVAWILGASFITEGAIPFAAADPLRVIPSIMVGSAVT
FT                   GALSMAFGCQLMAPHGGVFVFFIPGVITNLPMYIVSILAGTVVSALLLVMLKPSVRPVQ
FT                   AAAQ"
FT   gene            218155..219084
FT                   /gene="trxB1"
FT                   /locus_tag="COPRO5265_0219"
FT   CDS_pept        218155..219084
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trxB1"
FT                   /locus_tag="COPRO5265_0219"
FT                   /product="thioredoxin-disulfide reductase"
FT                   /EC_number="1.8.1.9"
FT                   /note="identified by match to protein family HMM PF00070;
FT                   match to protein family HMM PF01266; match to protein
FT                   family HMM PF03486; match to protein family HMM PF07992;
FT                   match to protein family HMM TIGR01292"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17570"
FT                   /db_xref="GOA:B5Y741"
FT                   /db_xref="InterPro:IPR005982"
FT                   /db_xref="InterPro:IPR008255"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y741"
FT                   /protein_id="ACI17570.1"
FT                   /translation="MPDLYDCLIIGAGPAGLSAAIYAGRARLSTIVFEKKQVGGQAALT
FT                   WGLENYPGSVEDPTGPKITARMREQAEYFGALIKHEEVKSVDLSGKVKKVVTNKGTYEG
FT                   KTVILAPGASHIRLGIPGEEKFTGKGVSYCATCDADFFTDLDVVVIGGGDSGLQEGLYL
FT                   TKYCNSVTIVEMLPELRASKILQERAANNPKVKILTHTAVESIEGEDLVEKVVLKDTQT
FT                   GERTELQVQGVFVFAGMKPDTELFKGLVDMDEKGYIKTDEYMRTNVPGVFAAGDCRVKW
FT                   LRQVVTAAADGAQAAVAAERYVDENFSD"
FT   gene            219098..219415
FT                   /gene="trxA"
FT                   /locus_tag="COPRO5265_0220"
FT   CDS_pept        219098..219415
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trxA"
FT                   /locus_tag="COPRO5265_0220"
FT                   /product="thiol-disulfide isomerase"
FT                   /note="identified by match to protein family HMM PF00085"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17566"
FT                   /db_xref="GOA:B5Y742"
FT                   /db_xref="InterPro:IPR005746"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y742"
FT                   /protein_id="ACI17566.1"
FT                   /translation="MVEVTAQNFEQEVKSETDKLVLVDFWSEKCEKCMALMPEVEELEK
FT                   KYADKVKFAKVDAAKDRRFCWSLKVMSLPTFQLYKNGEKVDEITQDVTVDKIEEMINKY
FT                   L"
FT   gene            219436..220722
FT                   /locus_tag="COPRO5265_0221"
FT   CDS_pept        219436..220722
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0221"
FT                   /product="glycine reductase complex component B subunits
FT                   alpha and beta (Selenoprotein PB alpha/beta)"
FT                   /EC_number="1.21.4.2"
FT                   /note="identified by match to protein family HMM PF09338"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ACI16898"
FT                   /db_xref="GOA:B5Y743"
FT                   /db_xref="InterPro:IPR015417"
FT                   /db_xref="InterPro:IPR016585"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y743"
FT                   /protein_id="ACI16898.1"
FT                   /translation="MKLELGNIFIKDVIFSNETKVVDGVLHVNKEAIIEALMQDPRLAK
FT                   VDIDLAKPGEEVRIIPVKDVIEPRVKVSGPGGVFPGFISKVSTVGSGRTHVLKNTAVVT
FT                   TGTIVGFQEGIIDMSGEGAKYTPFSKTLNIVVVCEPVEGLPKHEHEEVVRLAGLRAAAL
FT                   IGEAGRNVEPDEVKVYETLPLFESVKKYPDLPRVGYVYQLQSQGLLHDTYVYGVDAKRI
FT                   LPTFMYPTEPMDGAIVSGNCVSACDKNPTYVHQNNPIIEDLYERHGKDYNFVGVIITNE
FT                   NVTLADKERSSDYTAKLVEYLGLDAVIINEEGFGNPDTDLIMNCKKISEKGIKTVLVTD
FT                   EYAGRDGQSQSLADVDKTADAVVSVGNANEIVHLPPMKKVIGDPKAANVIAGGFEGALA
FT                   PDGSITVELQAITASTSEVGFGTLAAKGY"
FT   gene            220749..220874
FT                   /locus_tag="COPRO5265_0222"
FT   CDS_pept        220749..220874
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0222"
FT                   /product="glycine/sarcosine/betaine reductase complex
FT                   component A1 (Selenoprotein PA 1) (Thioredoxinreductase
FT                   complex A 1)"
FT                   /EC_number="1.21.4.2"
FT                   /EC_number="1.21.4.3"
FT                   /EC_number="1.21.4.4"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17371"
FT                   /db_xref="GOA:B5Y744"
FT                   /db_xref="InterPro:IPR006812"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y744"
FT                   /protein_id="ACI17371.1"
FT                   /translation="MLEGKKVIIVGERDGVPGPAIEECIKTAGAEVVFSTTECSV"
FT   gene            220890..221213
FT                   /locus_tag="COPRO5265_0223"
FT   CDS_pept        220890..221213
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0223"
FT                   /product="glycine/sarcosine/betaine reductase complex
FT                   component A1 (Selenoprotein PA 1) (Thioredoxinreductase
FT                   complex A 1)"
FT                   /EC_number="1.21.4.2"
FT                   /EC_number="1.21.4.3"
FT                   /EC_number="1.21.4.4"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18238"
FT                   /db_xref="GOA:B5Y745"
FT                   /db_xref="InterPro:IPR006812"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y745"
FT                   /protein_id="ACI18238.1"
FT                   /translation="MDLEVQGRIKEIAEKYGPENVVVILGNSDPDGASIFAETVTNGDP
FT                   SFAGPLAGVALGLPVYHIIEPEIKQEIDPQVYEEQVGIVEMVLDVDAITNAVKSIREQY
FT                   SKF"
FT   gene            221280..222587
FT                   /locus_tag="COPRO5265_0224"
FT   CDS_pept        221280..222587
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /transl_except=(pos:222321..222323,aa:Sec)
FT                   /locus_tag="COPRO5265_0224"
FT                   /product="glycine reductase complex component B subunit
FT                   gamma (Selenoprotein PB gamma)"
FT                   /EC_number="1.21.4.2"
FT                   /note="Selenoprotein. identified by match to protein family
FT                   HMM PF07355; match to protein family HMM TIGR01917; match
FT                   to protein family HMM TIGR01918"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18064"
FT                   /db_xref="GOA:B5Y746"
FT                   /db_xref="InterPro:IPR010186"
FT                   /db_xref="InterPro:IPR010187"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y746"
FT                   /protein_id="ACI18064.1"
FT                   /translation="MLKVVHYINQFFGQIGGEDKADTPPLVKEGPVGPGLALQQALGDQ
FT                   GKVVATIICGDSYFNEHVDEALAEVLRMVEQYQPDLFVAGPAFFAGRYGIACATVCKAV
FT                   QEKFGIPVVTGMYPENPGVDLCKKDVYVVKTGDSAAQMKDAITKMVKLALKMVNKEEIG
FT                   TPEEEGYIPRGIRKNYFAQERGSKRAVDMLVKKLKGEPYTTELPMPEFDRVPPAPAVKD
FT                   LSKALVALVTSGGIVPKGNPDHIESSSASKFGKYDLEGIQALSPETHQTAHGGYDPVYA
FT                   NEDPNRVLPVDVMRELEKEGKIGKLHRYYYATVGNGTPVAKAQQYGQAIAKELKDAGVQ
FT                   AVILTSTUGTCTRCGATMVKELERAGLPTVHICTIVPISKTVGANRIVPAVAIPHPLGN
FT                   PELSKEDEKALRRKILEKALEALQTDIDTQTVFEWQ"
FT   gene            complement(222720..222836)
FT                   /locus_tag="COPRO5265_0226"
FT   CDS_pept        complement(222720..222836)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0226"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17883"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y747"
FT                   /protein_id="ACI17883.1"
FT                   /translation="MNVVPASVIMFGVCTSTKLVPLTTGFIAQTPFLAVFFL"
FT   gene            222838..224301
FT                   /locus_tag="COPRO5265_0227"
FT   CDS_pept        222838..224301
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0227"
FT                   /product="glycine/sarcosine/betaine reductase complex
FT                   component C subunit beta (Protein PC beta)"
FT                   /EC_number="1.21.4.2"
FT                   /EC_number="1.21.4.3"
FT                   /EC_number="1.21.4.4"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17062"
FT                   /db_xref="GOA:B5Y748"
FT                   /db_xref="InterPro:IPR013751"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y748"
FT                   /protein_id="ACI17062.1"
FT                   /translation="MEKAENKNTEFLQRAPEFVRSYEQCVGYPPNQVFIGNMNPEELEN
FT                   IPQPWYEHLTEAKRFGKFGEIMPEDEFYGLMQIADVFDLVWLEESFAQQIKEKLSKHPL
FT                   LDEKDLSKLKGKPLAEIEKHIEDEGIPLKLDGKVVGCVRKAHEMDETLAAHVMLENLAT
FT                   KASAILALKHLLRNTNMDPGAIEYIIECSEEACGDMNQRGGGNFAKAIGEIVGTVNATG
FT                   SDVRGFCAGPAHAILHAASMVASGVFKNVAVVAGGATAKLGMNAKEHVKKGVPLLEDVL
FT                   GGFAVLISENDGVSPEIRLDSIGVHTVGTGSSPQQVMGALTVKPLEKLGLNLQDVDKYA
FT                   PEMQNPEVTEPAGAGDVPKSNYKMIAALAVKRGEITKENMDDFIRKHGMPGFAPTQGHI
FT                   PSGVPIMGYAREKILEGKLSRVMVIGKGSLFLSRMTNQFDGVSFLIENNKGKEEEKLAE
FT                   VKAGEEEQLRKLLADVLRDVANRLRNEEV"
FT   gene            224309..225448
FT                   /gene="plsX1"
FT                   /locus_tag="COPRO5265_0228"
FT   CDS_pept        224309..225448
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="plsX1"
FT                   /locus_tag="COPRO5265_0228"
FT                   /product="fatty acid/phospholipid synthesis protein PlsX"
FT                   /note="identified by match to protein family HMM PF02504"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17136"
FT                   /db_xref="GOA:B5Y749"
FT                   /db_xref="InterPro:IPR003664"
FT                   /db_xref="InterPro:IPR012116"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y749"
FT                   /protein_id="ACI17136.1"
FT                   /translation="MDRNLMADILEQVADFLEKGEYRKKVRVGITTLGSEHGTEEIIRG
FT                   AELAQKLYDDVEVVLIGAKGNSSLHCYEAETLEGCHCLMEELLDKHEIDACVTMHYNFP
FT                   LGVSTVGRLITPAKGKEILLATTTGTAAADRVEAMVKNAVYGNIVAKALGIKEPTVGIL
FT                   NVDGARQVERVLNQLKERGYPIKFAQSLREDGGVVMRGNDLLAASCDVMVTDTLTGNLL
FT                   VKILSAFTTGGDYESIGFGYGPGIGEGYDRIIMILSRASGAPVAANAIKFAADLVKGNL
FT                   KEVARAEFEMLNRIGWKDLLSKKEKAPAAELQEVKMPDPKPVAEEISGIDVLELEDMVK
FT                   LLWSHGIYAESGMGCTGPVIRVSEEDLEEAMKLLQEAMQ"
FT   gene            225633..226544
FT                   /gene="selD"
FT                   /locus_tag="COPRO5265_0229"
FT   CDS_pept        225633..226544
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="selD"
FT                   /locus_tag="COPRO5265_0229"
FT                   /product="selenide, water dikinase"
FT                   /EC_number="2.7.9.3"
FT                   /note="identified by match to protein family HMM PF02769;
FT                   match to protein family HMM TIGR00476"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17594"
FT                   /db_xref="GOA:B5Y750"
FT                   /db_xref="InterPro:IPR004536"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR023061"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y750"
FT                   /protein_id="ACI17594.1"
FT                   /translation="MGLGTNEDAAVYRIPEGMAVIHTLDFFTPVVDDPYDFGQIAAANA
FT                   LSDIYAMGGEPMFALNVVCWPSCYMDLLERTLKGGWDKVKEAGAVVTGGHSIDDDEPKY
FT                   GLSVIGYVKPHAIVRNSTARVGDVLVLTKPLGTGVINTAIKGDLCPPEVAARAVQVMKA
FT                   LNKEASRLMVELQTSACTDITGFGFLGHAYEMASGSGVTLVIHRNAVPIIEGAVELAQM
FT                   GLIPAGTYRNKDYLKGKVALSCPEDAMTDLLFDPQTSGGLLIAMAEDKAATFVSELKEK
FT                   FHIEAHIVGHVIAREDVDIKVI"
FT   gene            226606..228015
FT                   /gene="selA"
FT                   /locus_tag="COPRO5265_0230"
FT   CDS_pept        226606..228015
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="selA"
FT                   /locus_tag="COPRO5265_0230"
FT                   /product="L-seryl-tRNA selenium transferase"
FT                   /EC_number="2.9.1.1"
FT                   /note="identified by match to protein family HMM PF01053;
FT                   match to protein family HMM PF03841; match to protein
FT                   family HMM TIGR00474"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17379"
FT                   /db_xref="GOA:B5Y751"
FT                   /db_xref="InterPro:IPR004534"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR018319"
FT                   /db_xref="InterPro:IPR025862"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y751"
FT                   /protein_id="ACI17379.1"
FT                   /translation="MATEKENTDSQNLFRLLPSVDEFLKLPQVVKFAETRSHSSLVNAV
FT                   RVVLDKWRQGISEGKIHSVDTDALVDDLRKLLHELDLRSLRRVVNGTGIIVHTNLGRSL
FT                   LPSSLEQQLKEVAFHYNTLEYDVEEGERGSRYVHVEGLLRELLGVEGALVVNNNAAAVL
FT                   LALNTLAKGKEVIVSRGELIEIGGSFRIPDVMTQSGAILKEVGTTNRTRVEDYTGAIGE
FT                   NTGLLFKAHTSNYRIIGFTQEVDVGTLARIGKSHNVPTMMDLGSGVMVDLALQGIDHEP
FT                   TVQEVVNAGVDIVTFSGDKLLGGPQAGIIVGKKAFIDAMKKNPLTRALRVDKLCLTMLE
FT                   GTLRIYRDGNPMEMIPTLHMMAMPMEQLEERANRLNDMLSTIKDVNCCVVQVNSAPGGG
FT                   SLPGQQLPSFGVSVEVGSMSEVELERRLRQRDIPIISRIVENKVILDVRTLLDEDFQVI
FT                   FDALQDIVSCV"
FT   gene            228012..229877
FT                   /gene="selB"
FT                   /locus_tag="COPRO5265_0232"
FT   CDS_pept        228012..229877
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="selB"
FT                   /locus_tag="COPRO5265_0232"
FT                   /product="selenocysteine-specific translation elongation
FT                   factor"
FT                   /note="identified by match to protein family HMM PF00009;
FT                   match to protein family HMM PF03144; match to protein
FT                   family HMM PF09106; match to protein family HMM PF09107;
FT                   match to protein family HMM TIGR00231; match to protein
FT                   family HMM TIGR00475"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17671"
FT                   /db_xref="GOA:B5Y752"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004535"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR015190"
FT                   /db_xref="InterPro:IPR015191"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y752"
FT                   /protein_id="ACI17671.1"
FT                   /translation="MKNVIIGTAGHIDHGKTTLIKALTGKDTDRLKEEKLRGMTTDLGF
FT                   AYLDLPSGIRAGIIDVPGHEKFIKNMLAGAHGIDIVMMVIAADEGIMPQTEEHLQIISL
FT                   LDVKKGIVVLTKCDLVDDEWLTLVEEEVREALKGTVLENAPFVPVSSTTGKGLDKLVAE
FT                   LDNLAQSIEERSHDGIFRMPIDRVFTVQGHGTVVTGTMISGTLKVGDEVVVYPKMLSSR
FT                   VRSIQVYGEPVEAAYAGQRTAVNLSNVKVEELDRGDVIAPKGALVPSRVLDVKLILLNN
FT                   VKPLKNRSRIRFYVGASEVMGRVVLLDRDELSAGESCYAQMQLESFVCVLYGDRFVLRS
FT                   YSPMETIGGGVVLVPNARKHKRYKDQIIDELQNIEHKGKTFQVEKAIYESGVAWTLDEL
FT                   AKKFGVVEEVLAASENLVKVHYGTSAYVYHKQRYEKLKEEVRRLLEDYHKRFPLKDGMP
FT                   KEELKEKVLREAKSKQFDVMLWLMEQDGLIQAREQVVWLKGFTATLSPKDQQIRERILK
FT                   ELSVSHFKPLKEEEILKSTSEAPVLHFLVKTGDVVKLPSGEYLAGAAVEEAKALLVDYL
FT                   KEHGQITLGAFRDMLGVSRRDALALLEYFDAVRVTKRSGDTRVLA"
FT   gene            complement(229874..230218)
FT                   /locus_tag="COPRO5265_0231"
FT   CDS_pept        complement(229874..230218)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0231"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18207"
FT                   /db_xref="InterPro:IPR021778"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y753"
FT                   /protein_id="ACI18207.1"
FT                   /translation="MHNYIDKGQKRRQGWTNIGGVFYNLEQHSTSGYYLITFPSVHHAM
FT                   AFEDKARNGPLVFQLIPVPREISSSCGVAAKVQHITKEELLQLLREYNLSFSGVYFYAD
FT                   DGFSKPQRVL"
FT   gene            230308..231174
FT                   /locus_tag="COPRO5265_0233"
FT   CDS_pept        230308..231174
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0233"
FT                   /product="hydrolase, HAD superfamily"
FT                   /note="identified by match to protein family HMM PF00702;
FT                   match to protein family HMM PF05116; match to protein
FT                   family HMM PF08282; match to protein family HMM TIGR00099;
FT                   match to protein family HMM TIGR01484"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17392"
FT                   /db_xref="GOA:B5Y754"
FT                   /db_xref="InterPro:IPR000150"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y754"
FT                   /protein_id="ACI17392.1"
FT                   /translation="MLQSKGGEKSLIKLVLIDIDGTLVRDDKTLPAENEEAIKEALQSG
FT                   VLVTLVTGRNYGAAKEIIDKLQLDVPVVLQNGAFIYRPYSGEVIRKVGLTGDVAKRVIH
FT                   LCRQEGTFYILYRDFLMQKDMLIDQDYDGPFSMYLKRNAVRLDRVEDVTSFISGEVAEV
FT                   ALLGNEDRILRVLRQLGDGDNFTVIKSLTREDEAFYEIFGPKVGKGEALNYLCQHFGVS
FT                   PEEVMFIGDAYNDIDIMPLVGFPVAMGNAVEEVKKFAKAVTKSNNEGGVAWAIRHFVLS
FT                   PKGDFTR"
FT   gene            complement(231181..231273)
FT                   /locus_tag="COPRO5265_0234"
FT   CDS_pept        complement(231181..231273)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0234"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18048"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y755"
FT                   /protein_id="ACI18048.1"
FT                   /translation="MEKLIDHMLFLLMIRNPPPIPVPIIDVKGL"
FT   gene            231251..231841
FT                   /locus_tag="COPRO5265_0235"
FT   CDS_pept        231251..231841
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0235"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17201"
FT                   /db_xref="GOA:B5Y756"
FT                   /db_xref="InterPro:IPR024529"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y756"
FT                   /protein_id="ACI17201.1"
FT                   /translation="MWSISFSTPVLVLIPVAVGINYVGKLFAQLLKLPLWLDSIGTVIA
FT                   SMLSGPIVGSISGAINNIIYGLTMDPISFVYALTSVAIGLTVGIMAYKGRINNLWRAVV
FT                   VGLVVALVAAVVSTPLNVIFWGGQTGNVWGDALYAYLIAHGVPVWLSSFLDELVVDLPD
FT                   KVATVIIAFLIFASLPKRLVQMYEGEEALEKLD"
FT   gene            231855..232631
FT                   /locus_tag="COPRO5265_0236"
FT   CDS_pept        231855..232631
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0236"
FT                   /product="cobalt ABC transporter permease protein"
FT                   /note="identified by match to protein family HMM PF02361"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17039"
FT                   /db_xref="GOA:B5Y757"
FT                   /db_xref="InterPro:IPR003339"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y757"
FT                   /protein_id="ACI17039.1"
FT                   /translation="MARVLSLYVETNTFVQRLDPMVKLLYILVAVLISFVILPFRWVGA
FT                   AFIVLSCLALLYARVFARVVPLLGFSFLILISIVIIQGLFMPGNKTPAINILGLTFYKE
FT                   GLLYALTLCIRVLDVLLAFALLVLTTRPSDLIQSLVKRGLSPRFGYVLSSALQVIPQMM
FT                   SQVGSIMDAQRSRGLETEGNLWTRLKAFLPLIGPVVMSSLLETRERAMALEVRGFSASG
FT                   KKTFLYERESSTLDRVLQWTLIVVLILSIAARFMLV"
FT   gene            232574..233479
FT                   /locus_tag="COPRO5265_0237"
FT   CDS_pept        232574..233479
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0237"
FT                   /product="cobalt import ATP-binding protein CbiO 1"
FT                   /EC_number="3.6.3.-"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17827"
FT                   /db_xref="GOA:B5Y758"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y758"
FT                   /protein_id="ACI17827.1"
FT                   /translation="MDSNCCAHFVHCSEVYAGMKAVVVENLKYRYPSTERLALSGVSFE
FT                   VEQGEFIGIIGKNLAGKSTLCEALVGLVPHFYKGAYGGRVVVDGVEVLSSSVSELARHI
FT                   GIVFQNPFTQITAAKLTVYEEVAFGLENLGFQREEMVKRIDYVLKLLGLYAYKDRNPFE
FT                   LSGGQMQRLAIASIIAMKPSIIVLDEPTSQLDPLGSEEVFKAVQSLSKEGITIIMVEQK
FT                   MEKIAQYADKIILLHEGHLVDFGVPEEVFSRPDLESYGVEPPVFTSIAKKLGIKDNNTG
FT                   LYPVTLEQMRRLMIGEPHRS"
FT   gene            233460..234284
FT                   /locus_tag="COPRO5265_0238"
FT   CDS_pept        233460..234284
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0238"
FT                   /product="cobalt import ATP-binding protein CbiO"
FT                   /EC_number="3.6.3.-"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ACI16777"
FT                   /db_xref="GOA:B5Y759"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y759"
FT                   /protein_id="ACI16777.1"
FT                   /translation="MNLIEVDNVSFAYTEGIPVLKNVTFSLNNGSVAIIGQNGSGKTTL
FT                   VKLLKALLKPISGDIFINGINTKETTAAKLARTVGLVFQNPNDQIFKNKVLDEVMFGPL
FT                   NIGQSMEEARENAIKALETVSLVDKKEENPYDLSLSERKLVSIASILSMDTDIVILDEP
FT                   TIAQDYLGKAKIRSIVHELVQRGKLVITITHDMDFVGECFQRVIVLSEGQLLLDGPARE
FT                   VFSKEDVLRSANLEPPYVAQLSKTTGYQGVLLSVEEFVAYYRSAMEDWERRS"
FT   gene            234284..234379
FT                   /locus_tag="COPRO5265_0240"
FT   CDS_pept        234284..234379
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0240"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17171"
FT                   /db_xref="GOA:B5Y760"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y760"
FT                   /protein_id="ACI17171.1"
FT                   /translation="MAKQKRFVLSLLVILVQTACLVVRVLKLDGV"
FT   gene            complement(234344..235162)
FT                   /locus_tag="COPRO5265_0239"
FT   CDS_pept        complement(234344..235162)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0239"
FT                   /product="probable histidinol-phosphatase (HolPase),
FT                   putative"
FT                   /EC_number="3.1.3.15"
FT                   /note="identified by match to protein family HMM PF02811;
FT                   match to protein family HMM TIGR01856"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17622"
FT                   /db_xref="GOA:B5Y761"
FT                   /db_xref="InterPro:IPR003141"
FT                   /db_xref="InterPro:IPR004013"
FT                   /db_xref="InterPro:IPR010140"
FT                   /db_xref="InterPro:IPR016195"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y761"
FT                   /protein_id="ACI17622.1"
FT                   /translation="MISTDLHLHSLWSPDGQEPLSHIFSECAAKNLTHIAITDHLDLHD
FT                   PSGDEGVKDLDRYLADIEYTGRNFPTMEILKGLEAGVNKDNLQETESLIAPHKFDVILL
FT                   SIHVFNKINVAKPLPYLDSVSFIKAYLEETLFCVTHMEQYQVLAHLDYPARYTAFTLQD
FT                   YVQNADLVEKVLRTLIERRKALELNTARLDKSENFKIMQWILQQYTNLGGYMVTVGSDA
FT                   HKLEAIGRNFDRAEQLLSLVGLDKLTVFEDTRPKLISWTSYSVKLQDPNY"
FT   gene            complement(235159..236073)
FT                   /locus_tag="COPRO5265_0241"
FT   CDS_pept        complement(235159..236073)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0241"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17941"
FT                   /db_xref="GOA:B5Y762"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y762"
FT                   /protein_id="ACI17941.1"
FT                   /translation="MVLWYNSLSAMSSKKPKKQQQQSKKNKSKQQKGLQLWARIAIVVL
FT                   VIAALFFISYAHLIPLLFASEDRLPANYALNLKILNDVEPAEDEERNYINVEDENKCVD
FT                   MSYAVQRDNTRSWILFQGGLPSELGVKYTLSSETQTSTGEQWTPVTMSMSNIRTSVDFS
FT                   ACALENGGQLKDTLLVATAAAKVATFFGVLEESGGTTEIVLNAPPQVTFDLPSVVTPTF
FT                   SFTVTATDGPYSKPTKITVSALIPQPNGTYLENNLYTTPEDKKYDGPVTVSAHLEPGNY
FT                   VIQVAASDNMYNVRTVTKEISVK"
FT   gene            complement(236057..236734)
FT                   /locus_tag="COPRO5265_0242"
FT   CDS_pept        complement(236057..236734)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0242"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF04474"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17028"
FT                   /db_xref="GOA:B5Y763"
FT                   /db_xref="InterPro:IPR007563"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y763"
FT                   /protein_id="ACI17028.1"
FT                   /translation="MLGVYVNTLAVLAGAFAGLVFIKPLQTYRHVITESVGVLVLALGI
FT                   YGIKDMNSPAIVLISLLVGGLIGAVMDIEGHLGRLTQSLQQRFQGQQITEGFVYATTLF
FT                   VVGPMTIIGSINAGLMKDYSILFLKSVMDGFSAAALSAAYGIGVFLSALAVLIVQGAIA
FT                   LFSAQLSFLQLPMYVNDFSAVGNLLIAMIGLRMLGIKEIKVGNYLPALLIQIFLAWLVG
FT                   ALV"
FT   gene            236836..236946
FT                   /locus_tag="COPRO5265_0244"
FT   CDS_pept        236836..236946
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0244"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17723"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y764"
FT                   /protein_id="ACI17723.1"
FT                   /translation="MAIWKCSVCGYEKEGKCKPKKCPECGSTGTFEKKEG"
FT   gene            complement(236943..238526)
FT                   /locus_tag="COPRO5265_0243"
FT   CDS_pept        complement(236943..238526)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0243"
FT                   /product="peptidase, M28 family"
FT                   /EC_number="3.4.-.-"
FT                   /note="identified by match to protein family HMM PF04389"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17526"
FT                   /db_xref="GOA:B5Y765"
FT                   /db_xref="InterPro:IPR007484"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y765"
FT                   /protein_id="ACI17526.1"
FT                   /translation="MDPAKKVWGLLSSMDRLQGTAGLIEAAEIISQEASNLELDVVART
FT                   YQYDGKETIMGLTMPLGWELTDGYCELVSPHKELLCSTQEHTLAVVPYSPGGTAEGSLV
FT                   IPLPDWSNTTGKIVLTDEEPLVALYKASEKGALGVIWYQERDIDAYTYRGLFLNESHLR
FT                   ELKMIPMVQVKPSISRKLKRLLNSQNNVEAHLEVKSSFKVEKMPVVEARLNPSEKANIV
FT                   LTAHYCHVGPGSDDNASGSAGLIRVAERLVKNPPRNFGVIFLWVPEHYGTVQWLEKDAT
FT                   LPMEANINLDMIGASQLLSNSAINLNHNPWPLLHPSDAYMWFYLQQLANHPSNMLKVAE
FT                   QGYGLGSDHAPFTLKGIPGIMPITWPDRYYHSSSDYLDKTDWNVFEMITDAVVMTINAL
FT                   DKPEENIVKGWAHHIYGTELAKNPSGAEILAYFLNSRLNTDFETSWRPSQAASPFKPVM
FT                   PLQNRQISNFLKARTYKEKQNNLDILLAETIILSKSMGVHDIEAVLKAELGVFDQELYQ
FT                   EATKEFLEKL"
FT   gene            238582..239769
FT                   /locus_tag="COPRO5265_0245"
FT   CDS_pept        238582..239769
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0245"
FT                   /product="IFN-gamma-induced"
FT                   /note="identified by match to protein family HMM PF01966"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17025"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y766"
FT                   /protein_id="ACI17025.1"
FT                   /translation="MRPLVAKVIRDPLYGDIRLNFLEAAIMDHVAFQRLRRITQLAGAP
FT                   FVYPAAVHTRFSHSLGTMNVAKLYADALELSPEDYLITALCALLHDVGHGPFSHCFEDA
FT                   ASSWLGMNHEQLGMSIMQLIGSTLLDQCSAKLLQGLERESHIYGFDNARDYVQWAFEET
FT                   ISAVKNEDYRAHIVDGPMGADRLDFITRDAYFTGVSAFNTVDIFRLTGNALLMDGQLVY
FT                   RAKVVDNIYGLTLGRFLMYKNVYYHKTSRAAELMMQLMITEAIEEGLLDGYRSVKEFSN
FT                   LDEPTLLGLVKIKGGKSAQIYDQLLRRKLWKVVEERIVKAEQQSQILEELYLLHAPCHI
FT                   DVPEKLSLISPMDRGEVLILDEKGVVMPLSHYEEKTGYSLLQQEMNVFVRVYKEV"
FT   gene            239777..240997
FT                   /locus_tag="COPRO5265_0246"
FT   CDS_pept        239777..240997
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0246"
FT                   /product="succinyl-diaminopimelate desuccinylase"
FT                   /note="identified by match to protein family HMM PF01546;
FT                   match to protein family HMM PF07687; match to protein
FT                   family HMM TIGR01910"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17306"
FT                   /db_xref="GOA:B5Y767"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR010182"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y767"
FT                   /protein_id="ACI17306.1"
FT                   /translation="MKDLEELVKSYEQEMVETLSKLVSIKAVNVRSGEGQSEWDRVKFL
FT                   EPILKEMGLDTKVVVAPDPLVPEGRPNLLAVLPGKDTSRTLWFIGHLDTVPAGDPSLWS
FT                   HDPFEAHVEDGKIYGRGAEDNGQAVITSLFAVKALIEAGIKPNVNIGLAFVADEETGSE
FT                   YGIIYLIQQGIFKSTDMAVVPDSGDSEGSFIEVAEKSMMWLKFKVMGKQTHASMPGSGI
FT                   NAHKIGMMFALSVDEALHDNFSDRDELFEPPFSTFEITKKEANVENINTIPGSDVFYMD
FT                   MRILPDENLDDILRIIDEIRTYFEYEYKVRIQLEIIQRSDAPAPTDPEHPLVKTLASVI
FT                   KETRGIEPKVGGIGGGTCAAPLRRVGIPSVVWATIDELAHQPDEYAKIENLTKDALVFA
FT                   KLMSRME"
FT   gene            241012..241977
FT                   /gene="fba"
FT                   /locus_tag="COPRO5265_0247"
FT   CDS_pept        241012..241977
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fba"
FT                   /locus_tag="COPRO5265_0247"
FT                   /product="fructose-1,6-bisphosphate aldolase, class II"
FT                   /EC_number="4.1.2.13"
FT                   /note="identified by match to protein family HMM PF01116;
FT                   match to protein family HMM TIGR00167; match to protein
FT                   family HMM TIGR01859"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17084"
FT                   /db_xref="GOA:B5Y768"
FT                   /db_xref="InterPro:IPR000771"
FT                   /db_xref="InterPro:IPR011289"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y768"
FT                   /protein_id="ACI17084.1"
FT                   /translation="MYDERRLIQLPYAKTKDILSKAHNEGYGVGAFNVNDLEFIQAIVK
FT                   AAVMENSPAIIEASEGALKYAGDGDVEKGAFILADMVRRYADAVSVPISLHLDHGHDLK
FT                   HIMAAIKAGFTSVMIDASDKPLEENIRITRQIVEVAHAAGVAVEAELGRLMGIEDNVAS
FT                   AESVLVDPDEAKRFVTETQVDFLAPAVGTSHGAFKFKGEAKIDYERISKVKELTQLPLV
FT                   LHGASGVPAQWVELAEKYGADLSGAKGVPDEVLQEAVKRGINKVNTDTDLRIAFLAGLR
FT                   KHLAENPKEFDPRKYFGEAKDFVTEVVRDRMKMLGSSGKA"
FT   gene            complement(242063..242356)
FT                   /locus_tag="COPRO5265_0248"
FT   CDS_pept        complement(242063..242356)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0248"
FT                   /product="hypothetical membrane spanning protein"
FT                   /note="identified by match to protein family HMM PF03779"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17503"
FT                   /db_xref="GOA:B5Y769"
FT                   /db_xref="InterPro:IPR005530"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y769"
FT                   /protein_id="ACI17503.1"
FT                   /translation="MQWLVGLLGIWYLLSPWIFKAASAAMWNGIIVGIIVAICAYMFPA
FT                   EKSWQKWLGVLMGIWAIIAAFFLTQGAGYMWNNIIVGILMAIAGFAALGGNQ"
FT   gene            complement(242461..243354)
FT                   /locus_tag="COPRO5265_0249"
FT   CDS_pept        complement(242461..243354)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0249"
FT                   /product="enoyl-(acyl-carrier-protein) reductase II"
FT                   /note="identified by match to protein family HMM PF03060"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18157"
FT                   /db_xref="GOA:B5Y770"
FT                   /db_xref="InterPro:IPR004136"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y770"
FT                   /protein_id="ACI18157.1"
FT                   /translation="MISLEELLSIEYPIIQGGMARVAKAPLVAAVSEAGGLGVLGGAAM
FT                   TPEELRDQIREVRRNTSKPFGVNLMLQSEFWQDQIKVVLEEKPPVITTGAGNPSSFMKT
FT                   LKEKGIKILPLVGSANQALLLEKAGADGVIAEGKESGGHIGDVTTIVLVNAVLKSVTNI
FT                   PVIAAGGIVDKDSYRAMRAMGAAGVQMGTRFVASEEAPISSAYKDVVLKANERSTVEVG
FT                   RRFKHAVRIWRNQLAQKLIEAEYNGDEETFSNLMLGALIRAVEGDLENGAFMMGQSAGL
FT                   IKEILPVKDIIKSIAA"
FT   gene            complement(243354..243815)
FT                   /locus_tag="COPRO5265_0250"
FT   CDS_pept        complement(243354..243815)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0250"
FT                   /product="(3R)-hydroxymyristoyl-[acyl-carrier-protein]
FT                   dehydratase ((3R)-hydroxymyristoyl ACP dehydrase)"
FT                   /EC_number="4.2.1.-"
FT                   /note="identified by match to protein family HMM PF07977"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ACI16894"
FT                   /db_xref="GOA:B5Y771"
FT                   /db_xref="InterPro:IPR013114"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y771"
FT                   /protein_id="ACI16894.1"
FT                   /translation="MDSWRCWFGCGRTTSSRRCLALEEKVIPLPHRWPFLFVDSFKAEG
FT                   NMCEAQYYVDPNLPFFQGHFPGYPIFPGVLHVEAMAQTLGLLVKTPGLPLLARIEQAKF
FT                   MQPIFPGDNITIKAKLENEKAGFYFGSGQIFKGDTLVSEAKIVFKVAVE"
FT   gene            complement(243737..244045)
FT                   /locus_tag="COPRO5265_0251"
FT   CDS_pept        complement(243737..244045)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0251"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17538"
FT                   /db_xref="GOA:B5Y772"
FT                   /db_xref="InterPro:IPR027383"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y772"
FT                   /protein_id="ACI17538.1"
FT                   /translation="MECKEVVELIPAYVKGELTRNQMNEVSEHLQNCNSCYEEAEKWEE
FT                   LFAELRSLVSYTHKPEKKVAQLTRGKTSSLTPWIVGGVGLGVGVLLAAGGALLWRKK"
FT   gene            complement(243972..244544)
FT                   /locus_tag="COPRO5265_0252"
FT   CDS_pept        complement(243972..244544)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0252"
FT                   /product="RNA polymerase ECF-type sigma factor"
FT                   /note="identified by match to protein family HMM PF04542;
FT                   match to protein family HMM PF04545; match to protein
FT                   family HMM PF08281; match to protein family HMM TIGR02937"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ACI16944"
FT                   /db_xref="GOA:B5Y773"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y773"
FT                   /protein_id="ACI16944.1"
FT                   /translation="MKVEHVLIEKVKRGDPKAFQELFSRFERDIYTLAYRLLGNREDAE
FT                   DVTQEVAWILWSKIKSFRNESSLSTWLYRVTANTALQLLRKKRKIIYVEPSAHTAEDMH
FT                   LMLEMAVMDLPENQRTLIVLRDIYNFPMKEIARMLDISEENVRVQLHRARKALRKRLEG
FT                   GENGGMQRSSGTNTSLRKGRADEKSNE"
FT   gene            complement(244534..245754)
FT                   /gene="fabF"
FT                   /locus_tag="COPRO5265_0253"
FT   CDS_pept        complement(244534..245754)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fabF"
FT                   /locus_tag="COPRO5265_0253"
FT                   /product="3-oxoacyl-[acyl-carrier-protein] synthase 2"
FT                   /EC_number="2.3.1.41"
FT                   /note="identified by match to protein family HMM PF00109;
FT                   match to protein family HMM PF02801; match to protein
FT                   family HMM TIGR03150"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17584"
FT                   /db_xref="GOA:B5Y774"
FT                   /db_xref="InterPro:IPR000794"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR017568"
FT                   /db_xref="InterPro:IPR018201"
FT                   /db_xref="InterPro:IPR020841"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y774"
FT                   /protein_id="ACI17584.1"
FT                   /translation="MKRIVITGVGVVTPFGVGLQTFKEGIFAGRNGIKPITRYSDLPVK
FT                   YAGEVDFDPLQYFDKKDVKRLDRFTQFALVAAREAIEAAQLKDVDPYTVGVVFASGMGG
FT                   LEYLESQIVNLYTKGQRTVSPFTVPASIINIAAANIAIEHGFHGPTFAPTTACAASLDA
FT                   IGQGYTLLQQEEDLNAVLVGGSEASITPLGITSFHNMKALSPLNEPTASRPFDKRHSGF
FT                   VMGEGAGALVLESLEHALKRGAKPLAEVVAYAATCDAYHVTAPDPSAEPQAIAIEKALK
FT                   RAGITPAQIDYVCAHGTSTPLNDVIETKAIKQALGDHAYEIPVSSVKSMIGHLLGASGA
FT                   VETVATVLALQEQMVPPTINFQEPAEECDLYYVPNKGEKRTINYALKESLGFGGHNSVL
FT                   VLRRYEG"
FT   gene            complement(245751..245966)
FT                   /locus_tag="COPRO5265_0254"
FT   CDS_pept        complement(245751..245966)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0254"
FT                   /product="acyl carrier protein (ACP)"
FT                   /note="identified by match to protein family HMM PF00550"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17105"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y775"
FT                   /protein_id="ACI17105.1"
FT                   /translation="MMEMVKSLLEENGYPTEGLTEETSFESLGVDSLGLVDLTLSLEQK
FT                   GYTIPEEKLSEIKTVGDLLRVLGGNA"
FT   gene            complement(246030..246704)
FT                   /locus_tag="COPRO5265_0255"
FT   CDS_pept        complement(246030..246704)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0255"
FT                   /product="3-oxoacyl-[acyl-carrier-protein] reductase
FT                   (3-ketoacyl-acyl carrier protein reductase)"
FT                   /EC_number="1.1.1.100"
FT                   /note="identified by match to protein family HMM PF00106;
FT                   match to protein family HMM PF08659"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17758"
FT                   /db_xref="GOA:B5Y776"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y776"
FT                   /protein_id="ACI17758.1"
FT                   /translation="MNWQLCEKTFAIVGSGDIGKATAQALEQEGAKAILLSRKSQHYLD
FT                   VTDEESFKQYGSWSKILDGLVYTAGITVDKPVGLLTLADWQRVIETNLTGAFLTAKHFY
FT                   MALKPNSSVVFLSSIVAQWGNIGQAAYSSSKAGLEALMKTLAKEWARKGIRVNAIAPGL
FT                   VNTKMTTELPQMVVDGFTQHTLLKRLAEPEEVANVICFLLSPLSSFMTGQVIYVDGGFF
FT                   TA"
FT   gene            complement(246685..247524)
FT                   /locus_tag="COPRO5265_0256"
FT   CDS_pept        complement(246685..247524)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0256"
FT                   /product="malonyl CoA-acyl carrier protein transacylase"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17030"
FT                   /db_xref="GOA:B5Y777"
FT                   /db_xref="InterPro:IPR001227"
FT                   /db_xref="InterPro:IPR014043"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="InterPro:IPR020801"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y777"
FT                   /protein_id="ACI17030.1"
FT                   /translation="MQKMAHLFPGQGIQKVGMGKYFSRTVENLLMAEDPKLLEVAWVGP
FT                   QEELNKTINAQPTITLMQVSLAEDLDKPDLAVGHSLGEYAALWEAGVWNLQSLYKVVKA
FT                   RGYYMQELCPDGWLIALRDRESADFVVNAFKGRVFYSNINSQRQVLVGGIIEDLPAVEA
FT                   TLKEERIAYKRIQGNKPFHTPYLEKASKAFYEFLLTVEGKDPEFDVYLNIADDVVTNYG
FT                   EIVKLLAESLAKPVDWTRTVAFLESRNFDILVEINLEPLLAKLTGQKVVLVHELATL"
FT   gene            complement(247570..248412)
FT                   /locus_tag="COPRO5265_0257"
FT   CDS_pept        complement(247570..248412)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0257"
FT                   /product="malonyl CoA-acyl carrier protein transacylase,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17657"
FT                   /db_xref="GOA:B5Y778"
FT                   /db_xref="InterPro:IPR001227"
FT                   /db_xref="InterPro:IPR014043"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="InterPro:IPR016036"
FT                   /db_xref="InterPro:IPR020801"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y778"
FT                   /protein_id="ACI17657.1"
FT                   /translation="MATKIAHAYPGQGAQFPEMGKYLSRKALQIATESFQKLITALEKQ
FT                   DKEILTETEFVQPAVYLVEASLMEKLPSPSLVLGHSSGEYAALVEARVWDVRTGFEIIR
FT                   ARGHFSASFAPKGFMVQIPSNSRQQVLGEFKSVYLAAINSEDRVVVAGVEADWKKLKEF
FT                   LEENHVEYTLLHVSAPFHTPYMEKAAQRLRSFLEINPGKMPAISVYLNALKRVVQSYDD
FT                   VIEGLTLGLTKPINWLETQEYLKRSEISTLVEVYPRPYLSKFTSFPTYNVSEFYHLTL"
FT   gene            248481..249242
FT                   /gene="moeB"
FT                   /locus_tag="COPRO5265_0258"
FT   CDS_pept        248481..249242
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="moeB"
FT                   /locus_tag="COPRO5265_0258"
FT                   /product="molybdopterin biosynthesis"
FT                   /note="identified by match to protein family HMM PF00899;
FT                   match to protein family HMM PF05237"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ACI16827"
FT                   /db_xref="GOA:B5Y779"
FT                   /db_xref="InterPro:IPR000594"
FT                   /db_xref="InterPro:IPR035985"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y779"
FT                   /protein_id="ACI16827.1"
FT                   /translation="MNERYVVQEKFPPLGVEGQKLLRKSSVVLVGVGGLGTFIAQYLVR
FT                   AGVGRLRLIDFDVVELSNLQRQILYDEGDVGKSKAQCAYTHLRRINSEVILEPVEDKLT
FT                   GQNAESLLTGFDVIMDGTDNYQARFVMNDVAKKNGIPFAFGSVAGAYGMSKMFLPDEKI
FT                   CLRDVVGDSLDVSNAPTAATGGLISPILGVVTAFMATETIKVLTGALDKVERRLMVFDL
FT                   WQNQWSQLYIAENPQCEVCSGKRYPALEGDF"
FT   gene            249297..250490
FT                   /locus_tag="COPRO5265_0259"
FT   CDS_pept        249297..250490
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0259"
FT                   /product="hypothetical sugar symporter"
FT                   /note="identified by match to protein family HMM PF07690"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18244"
FT                   /db_xref="GOA:B5Y780"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y780"
FT                   /protein_id="ACI18244.1"
FT                   /translation="MGISVILSLYEADVPVMLEETFSLSNLATGLVINIDAFFAVAFMP
FT                   IVTAYSDIVRTRTGRRLPFFLTAMPLMAFFFALSALIPMVLGSSTCSLLVFILMLILTN
FT                   VFLGVAKGPFMALMCDVTEPRERSVAYGFLNFMGGLGSILVYLGIGHISSYNRFAGFAM
FT                   ASAVALLCASVVGSYVKEVPRVSPLVNSGSWWHEVQTIMNPKYTGLWLELFGVFLWFMA
FT                   VSGIEVFYVVFVAMESGFPEAIAETLAKLNLGIMSSAFAFFAVPAGWLGARFGSKRVMI
FT                   LGLLLTGFAVSGIMSAGSPVTSRGYFAIAGVGMAMVGINSYPAVMDMAKPTQNGTFTAF
FT                   YLFASQIAYLISAPLIGFASDLVGSRSVVFELTLVFVFLALVFMVFAKTEKIREDVQ"
FT   gene            250664..251905
FT                   /locus_tag="COPRO5265_0260"
FT   CDS_pept        250664..251905
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0260"
FT                   /product="sucrose transport protein"
FT                   /note="identified by match to protein family HMM PF07690"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17386"
FT                   /db_xref="GOA:B5Y781"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y781"
FT                   /protein_id="ACI17386.1"
FT                   /translation="MKIDYKKLFLLGFGFMGISVVWALYNADVPVILQSQFGMSNFATG
FT                   WIMNIDNIFAVTLIPIIAAYSDKVSTKIGRRMPFIITGMPLMAVFFALVPWIPLFFGTS
FT                   TTGLVIFMITVIVMNISAAVSRGPVIALMPDIVPPEQRSPANGVINFMGGLGSLLVYFG
FT                   IGRISSQNRPLGFGIAAVITLVAAFVVYKAINEPRDAIYYKSQAEETPWWKNIGSLLNK
FT                   EHKDLWFMLLAIFLWFIAYNAVETFYVVYMSLESGMDPTVAENLAKLNLGVMSLVFMVF
FT                   ALPAGWLANKFGRKRVMSFGLVFMLLAVTGIMFTRNALWLNLLFAMAGVGWAMININSL
FT                   PTVVDMGSLAEVGTFTGLYYFSSQAASIVSPPLIGFISDLAKSKYVMFPYALIFFLLSL
FT                   ICLSNVRKGDIVTK"
FT   gene            252054..252155
FT                   /locus_tag="COPRO5265_0261"
FT   CDS_pept        252054..252155
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0261"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18049"
FT                   /db_xref="GOA:B5Y782"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y782"
FT                   /protein_id="ACI18049.1"
FT                   /translation="MVVANVISPRRCEGVYDLLAYLHMLVVFLRLVE"
FT   gene            252384..253112
FT                   /gene="pepE"
FT                   /locus_tag="COPRO5265_0262"
FT   CDS_pept        252384..253112
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pepE"
FT                   /locus_tag="COPRO5265_0262"
FT                   /product="peptidase E"
FT                   /note="identified by match to protein family HMM PF03575"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17830"
FT                   /db_xref="GOA:B5Y783"
FT                   /db_xref="InterPro:IPR005320"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y783"
FT                   /protein_id="ACI17830.1"
FT                   /translation="MKKVVAIGGGEISKFETLKIDEEIVKLTGKANPKALFIPTASGEP
FT                   EGYCESFDLVYGKTLGCKTDVLFLIKDSLDRTLIEDKILWADLIYVGGGNTKRMMEIWR
FT                   SKGVDKMLIDAYQRGTVLSGLSAGAICWFKYGFSDSLRFQDVETWSYIKVEGLGLFDAI
FT                   LCPHLDEENRREYFEKFMMNFDGTGIGLENGCAIEIIEDTFRIIKSFENAHAYVFKRRR
FT                   DKLFVEEIKNDDYLPFNLLS"
FT   gene            253971..254090
FT                   /locus_tag="COPRO5265_0263"
FT   CDS_pept        253971..254090
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0263"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17056"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y784"
FT                   /protein_id="ACI17056.1"
FT                   /translation="MNEELFALPYIDKQRCLGTEKRLLSKPIRSKFILLPMGF"
FT   gene            254446..256131
FT                   /gene="mdlB1"
FT                   /locus_tag="COPRO5265_0264"
FT   CDS_pept        254446..256131
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mdlB1"
FT                   /locus_tag="COPRO5265_0264"
FT                   /product="ABC-type multidrug/protein/lipid transport
FT                   system, ATPase component"
FT                   /note="identified by match to protein family HMM PF00005;
FT                   match to protein family HMM PF00664"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17697"
FT                   /db_xref="GOA:B5Y785"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y785"
FT                   /protein_id="ACI17697.1"
FT                   /translation="MKKYFFKNKLLLTGNIILTLAESILSVMLAFILANFVDAAVEYDM
FT                   ALLYKTCIIFSLYLISVLIVWYSLRIVRASYIRQMLFDLKNDIFSKVINKEIDQFQKGN
FT                   SASYISTLNNDITILEQDYFKNILTMVALIFSFIIATVAIFKLNFFIAVGVFVISIFLV
FT                   AIPYLFREKISRAKKEFSDSLSDLTVQTNDILSGFEVVKSFNVEKLVEGQYKKYNKKVE
FT                   DNRFFFEKMLALANSLTEFFGYLMFFASLGLGAYLVIKRILEPGLMIAAVQLMNNIVNP
FT                   MIGIIERVNALKGTESIQKKIMDIMEDKEQQEGEFISKTDFNDAIVFENVSFSYGRREE
FT                   PTLKNISFTVKKGEKCAIIGPSGSGKSTIVKLLLKYYNNFEGRILIDGIDIRNIKTEDL
FT                   YNNLISVIHQNVFMFDTSIKNNITLFKEYDEKVIERAISLSGLKEFIEKLPDKENTEVG
FT                   EKGSNLSGGERQRISIARALIKGTPILVSDEPTSSLDKKTALSIENSILSIEGLTALVI
FT                   THNTSEEVLKKYDKIIFVEDGEVVKVGTFDEIFTPASVVLSVVG"
FT   gene            256249..257442
FT                   /locus_tag="COPRO5265_0265"
FT   CDS_pept        256249..257442
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0265"
FT                   /product="conserved protein"
FT                   /note="identified by match to protein family HMM PF07690"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17399"
FT                   /db_xref="GOA:B5Y786"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y786"
FT                   /protein_id="ACI17399.1"
FT                   /translation="MNNTESKNLKRGAFYFIILLGLVSLLADVTYEGARSVTGPYLGLL
FT                   GASSAVVGFAAGFGEMLGYAFRLVSGYWADRTHRYWLLTIVGYALNLLAIPLLAFVGNW
FT                   QVAVLLLILERLGKGLRTPARDVMLSQATKQVGRGFGFGLHEAMDQIGAVAGPVFVSIV
FT                   LARNLGYRDAFLFLGIPAILAMILVVTARFLYPKPQEFEPAYKGIETKGYSKAFWIYLG
FT                   AVALIGAGYIDYPLIGYHLQQNGILQAQFIALLYSLAMGIDALSALVFGAWFDRAGVSV
FT                   VGVSALIAALFSPFAFLLHVWWGPVIGMVLWGIGMGAQESVMRAALAEMIPTERRGVAY
FT                   GFFNTVYGLAWFAGSFVMGIIYGFSPTLMVIVSVTLELLAALLIFVNRHSLEHGHGV"
FT   gene            257444..258421
FT                   /locus_tag="COPRO5265_0267"
FT   CDS_pept        257444..258421
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0267"
FT                   /product="glycerophosphoryl diester phosphodiesterase,
FT                   putative"
FT                   /EC_number="3.1.4.46"
FT                   /note="identified by match to protein family HMM PF03009"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17984"
FT                   /db_xref="GOA:B5Y787"
FT                   /db_xref="InterPro:IPR017946"
FT                   /db_xref="InterPro:IPR030395"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y787"
FT                   /protein_id="ACI17984.1"
FT                   /translation="MKDTTKQFLLLGHRGSSLLWPENTLEAFSKALEAGADGFELDVMV
FT                   TTDGTAVLFHDPNLKRLHGIDVGVEELSYDQLRDLLNGKQQVCTLQEALSLADDYDCWV
FT                   DIEIKTMQWHVVRETVSKFSPKKKIISSFRHDVVSDWAKLDNGRYLFAYIYQHFPKDID
FT                   AYLSEVDLLKPEISFLDERYDGIADRVLPWTVNEKNKIVELKQKAFFGAISDFPNLLEE
FT                   ENQRISQNAGYLISAVKNIEITADGIKLVLVNTLAPVQIKEISSDAEVETSEQLPTWWD
FT                   VGKSLTVVIRGNPSYLLVDTSYTGVMSFPFNQLMKWLQKGINEN"
FT   gene            complement(258395..259066)
FT                   /locus_tag="COPRO5265_0266"
FT   CDS_pept        complement(258395..259066)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0266"
FT                   /product="thermostable monoacylglycerol lipase (mglp)"
FT                   /EC_number="3.1.1.23"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ACI16972"
FT                   /db_xref="GOA:B5Y788"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR012354"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y788"
FT                   /protein_id="ACI16972.1"
FT                   /translation="MSSILLKSRSLGVLLIHGFTSSPEQMLPFAQELNKYGITCLLPRL
FT                   SGHENLPDSLENVKAEDWLQDAEKGFKQLRTEVEHVVIAGHSLGGTLALYLAQHYSKED
FT                   GLVAAGVINPAVRLTPEQRRAITFGRFYEKKLDISMKPFRALRKTIDSVRNDLKHVKVP
FT                   VIIFASSEDELIPHAYQQWLFDRLRTTKFFITLPQEGHSPSPEAAEVIIKTFLVLVDTL
FT                   L"
FT   gene            complement(259063..259785)
FT                   /locus_tag="COPRO5265_0268"
FT   CDS_pept        complement(259063..259785)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0268"
FT                   /product="thermostable monoacylglycerol lipase (mglp)"
FT                   /EC_number="3.1.1.23"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17469"
FT                   /db_xref="GOA:B5Y789"
FT                   /db_xref="InterPro:IPR012354"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y789"
FT                   /protein_id="ACI17469.1"
FT                   /translation="MEEAFFKEGNDVGVLVIHGFTGSPGSMRDLAQFYADQGFTVALPR
FT                   LAGHGTTPEDLEKRKYQEWIEDVEKAYEWLKERTSKRFVTGLSMGGTLTLYMGEKHKDI
FT                   TGLITINAAVRMPNETSMLILGSLGIPRFAKGVGSDIKKGIKEPAYELTPIRATKQLAL
FT                   LLRLVRNNIKDVDQPILIFSSKEDHVVPPENQRWIYENVSSQTKELVTLENSYHVATMD
FT                   YDLELIEQKSLEFIQKLL"
FT   gene            259999..261495
FT                   /gene="glpK"
FT                   /locus_tag="COPRO5265_0269"
FT   CDS_pept        259999..261495
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glpK"
FT                   /locus_tag="COPRO5265_0269"
FT                   /product="glycerol kinase"
FT                   /EC_number="2.7.1.30"
FT                   /note="identified by match to protein family HMM PF00370;
FT                   match to protein family HMM PF02782; match to protein
FT                   family HMM TIGR01311"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18093"
FT                   /db_xref="GOA:B5Y790"
FT                   /db_xref="InterPro:IPR000577"
FT                   /db_xref="InterPro:IPR005999"
FT                   /db_xref="InterPro:IPR018483"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y790"
FT                   /protein_id="ACI18093.1"
FT                   /translation="MEQKKYVLSFDQGTTSSRAMIFDQNGCIVSMAQKEFPQIFPKPGW
FT                   VEHDPEDIWNSQIDVAKEAMLKAGLTAEDIAALGIANQRETTILWDRNTGKPVYNAIVW
FT                   QCRRTAEFCDELKERGWEKPIREKTGLVIDAYFSGTKIKWILDNVPGVRERAEKGEVLF
FT                   GNVDTFLIWRLTGGKVHVTDYTNASRTMIFNIHALDWDDDILQELDIPRAMLPKVCPSS
FT                   HLFGYTDAKLFGGEIPIAGDAGDQQAALFGQACFEPGSAKNTYGTGSFLLVNTGSKPVE
FT                   SKHGLITTVAFGLEDSVCYALEGSIFITGAAVQWLRDGLGIIKVADEVETLARQVEDTA
FT                   GVYFVPAFVGLGAPYWDMYARGMIIGITRGTTACHLARATLEAMAYQTRDVLEAMKSDC
FT                   GFDLKLLRADGGASVDNLLLQIQADVLGLAVQRPVVRETTALGTAYLAGLATGFWHNLE
FT                   EIANIWQLDRTFEPQITAIKREEMYAGWKRAVERARGWTQ"
FT   gene            261453..262943
FT                   /locus_tag="COPRO5265_0270"
FT   CDS_pept        261453..262943
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0270"
FT                   /product="glycerol-3-phosphate dehydrogenase"
FT                   /EC_number="1.1.5.3"
FT                   /note="identified by match to protein family HMM PF01266;
FT                   match to protein family HMM PF04324"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17699"
FT                   /db_xref="GOA:B5Y791"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR007419"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR041854"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y791"
FT                   /protein_id="ACI17699.1"
FT                   /translation="METSSGKSSGMDPIADTTSFDVVIIGAGIVGAAAFRELCKYDLKV
FT                   LLLDSLHDVGGDASRANSAILHGGFDPQPGTLMSIFNKQGVQLWFQWAQDLSIDVEWTG
FT                   SLVLAFNDADIAEITRLYHNGKKVRVPVKFLGRDETLKREPVVNPEVRASLYAPVSGII
FT                   DPFQAVIGLVGNGLKNGGQLMLDTEVTNLRKSPDGYITVQTNHGELRTKVVVNAAGLNA
FT                   HHIMHMAGEDWFSIHPRRGQYFILDKNVGNLVRHVVFRAPTPKGKGVLVSRTTHGNLLI
FT                   GPTAEDLTEPDRRTTAEGLAEVLEGAKHLVPFPYERYAIAQYAGLRAIGSVDDFVVQHS
FT                   KTMEGLVNAAGIKSPGLTAAPGIAQELVKLVADLLPLEEKKNFDPYFEFPPILRELPFA
FT                   DREKLIDEDPAYGHMVCRCELVTEGEIKSVLKMQPAASDLDGIKRRVRATAGRCQGGFC
FT                   TPRIIDILSRELNLSYDQITKFGRNSKLIYGDNRRGDE"
FT   gene            262949..264178
FT                   /locus_tag="COPRO5265_0271"
FT   CDS_pept        262949..264178
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0271"
FT                   /product="sarcosine oxidase alpha subunit"
FT                   /EC_number="1.5.3.1"
FT                   /note="identified by match to protein family HMM PF00070;
FT                   match to protein family HMM PF07992"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ACI16848"
FT                   /db_xref="GOA:B5Y792"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y792"
FT                   /protein_id="ACI16848.1"
FT                   /translation="MAVVGGGPAGMAAAVSAKKAGADHVVIIERAERLGGVLPQCIHSG
FT                   FGVNYYGEDLTGPEFAERLRADVKAANIEVWLNAMVIEAYPDKTLTVSRPEGISSVKPD
FT                   AVIFAVGARERPRGAIAIPGTRPAGVYTAGTAQYMINIQGFEVGKEVFVLGSGDIGLIT
FT                   ARRMALEGAKVHGVAELMPFPGGLARNVQQCLKDFDIPLLLSHTVTEVLGSERVEAVKV
FT                   AEVRNGKAVPNTERVFPVDTLVLSVGLLPEAELLRQIGLRILPYTGSAAVDQFFQTDIP
FT                   GVFVVGNGVGIWDLVDNVAISASIAGARAAKSQGDRSEFAEVSPTDTVRVVIPQRLSLG
FT                   ELEPPRLWFRVACPMPVGVALLTRGEDEVIARKGFAGLKPAEMAEFPLKEEQYRAIKPG
FT                   DKLQLKVAQP"
FT   gene            264175..264561
FT                   /locus_tag="COPRO5265_0272"
FT   CDS_pept        264175..264561
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0272"
FT                   /product="molybdopterin oxidoreductase, 4Fe-4S
FT                   cluster-binding subunit"
FT                   /note="identified by match to protein family HMM PF07892"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17814"
FT                   /db_xref="InterPro:IPR012460"
FT                   /db_xref="InterPro:IPR036593"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y793"
FT                   /protein_id="ACI17814.1"
FT                   /translation="MTEEYEQNKTMAFTCIVCPVGCTLNVTVGEGNNIKVLGNKCPKGA
FT                   EYALREVTNPQRYVQSTVVLLGSKTERRLPVKTDKPVPKDRIFDVVKEIRKVKVNAPVK
FT                   VGDVVLEDVLGLGVNVIATRTVEE"
FT   gene            complement(264635..265300)
FT                   /locus_tag="COPRO5265_0273"
FT   CDS_pept        complement(264635..265300)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0273"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ACI16964"
FT                   /db_xref="GOA:B5Y794"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y794"
FT                   /protein_id="ACI16964.1"
FT                   /translation="MNLPFSCDERVELLTDDRVKLLKEANCKQVYLGVESGDEELRKLV
FT                   LERTISNELLKKGVDRLHDNGIRAFAFNMVGLPGENRQKALSTVKLNASIKVDDSIVSV
FT                   FSPYPSTILYKISVEKGYVKLPIDYTQFTFLDQPNFSKEEVAFFAVYFGFLRRFYRSHG
FT                   ENSGLSRMMDNIILSPKLPIRFLISIGESYMFAWEDIKSYVRMHMPRVFKAAKRVLRR"
FT   gene            complement(265583..265774)
FT                   /gene="rpmB"
FT                   /locus_tag="COPRO5265_0274"
FT   CDS_pept        complement(265583..265774)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmB"
FT                   /locus_tag="COPRO5265_0274"
FT                   /product="ribosomal protein L28"
FT                   /note="identified by match to protein family HMM PF00830;
FT                   match to protein family HMM TIGR00009"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18102"
FT                   /db_xref="GOA:B5Y795"
FT                   /db_xref="InterPro:IPR001383"
FT                   /db_xref="InterPro:IPR026569"
FT                   /db_xref="InterPro:IPR034704"
FT                   /db_xref="InterPro:IPR037147"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5Y795"
FT                   /protein_id="ACI18102.1"
FT                   /translation="MARVCSVCGKGTTFGHNVSHSNRRTNRRWVANLKRVHGRFPDGKV
FT                   RTAYVCVKCLKAGKVEIL"
FT   gene            265900..266226
FT                   /locus_tag="COPRO5265_0275"
FT   CDS_pept        265900..266226
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0275"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17488"
FT                   /db_xref="InterPro:IPR005531"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y796"
FT                   /protein_id="ACI17488.1"
FT                   /translation="MKIRIKAKAIAQYLSKVIKSCYGITSVPKSSLKDYASGLVGLYAY
FT                   DEGVLVRIKDNVVYATVHVVVDPLSPIAAIVKNLRESLDYAFKKLLIKDYEVDVKIHVA
FT                   KERA"
FT   gene            266231..267808
FT                   /locus_tag="COPRO5265_0277"
FT   CDS_pept        266231..267808
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0277"
FT                   /product="DAK2 domain protein"
FT                   /note="identified by match to protein family HMM PF02734;
FT                   match to protein family HMM TIGR03599"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17217"
FT                   /db_xref="GOA:B5Y797"
FT                   /db_xref="InterPro:IPR004007"
FT                   /db_xref="InterPro:IPR019986"
FT                   /db_xref="InterPro:IPR033470"
FT                   /db_xref="InterPro:IPR036117"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y797"
FT                   /protein_id="ACI17217.1"
FT                   /translation="MKDHLTVREFISAFDSGYSLVKQLQDDINALNVYPVPDGDTGINM
FT                   SLTLESVVNEIRKMEEADFSEVGHALIKASLSGARGNSGVILSQILKGFGRVLQSTDGR
FT                   RLTLSNFLLAIVEGKKTSYHAVIKPVEGTILTVIRKISERIETKTYQSFEEALHDVVEV
FT                   GWQTVLETPEMLDVLKKADVVDAGGYGLYVFFEGFRAAVAGETPKPHRVTQRVSETFIS
FT                   ESGYGEYKFCTEAYFKSDNMDFEYAKNFLSSQGDSIVLGQEGGLWHFHVHTNEPFLVLQ
FT                   EMGKFGELIQVKIDNMAAQVEGRFQVEEKPFAVVAVAPSPKWAELFRSIKVDFVVMGGQ
FT                   TMNPSVGQILDGVKHVHSNKVYILPNNPNIILSAEQVRELTDKEVVVIPTKNPAQAAVG
FT                   LSLYFGVEDPLDVFFKQILDHTNFIELTRATKDSHVDGLDVKAGDWLVLWDDQLKAACS
FT                   RWDCVLETLQELTKNSGYTIASIFKGLDAKEQETQTMKELFASLGMEVEEYDMDQPFYP
FT                   YWVLVEKS"
FT   gene            267805..270186
FT                   /gene="recG"
FT                   /locus_tag="COPRO5265_0278"
FT   CDS_pept        267805..270186
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recG"
FT                   /locus_tag="COPRO5265_0278"
FT                   /product="ATP-dependent DNA helicase RecG"
FT                   /EC_number="3.6.1.-"
FT                   /note="identified by match to protein family HMM PF00270;
FT                   match to protein family HMM PF00271; match to protein
FT                   family HMM PF01336; match to protein family HMM TIGR00643"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ACI16800"
FT                   /db_xref="GOA:B5Y798"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR004609"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033454"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y798"
FT                   /protein_id="ACI16800.1"
FT                   /translation="MKSELQNKLSLALKREVDSKFAVTQTEDEWFHYVVVEYLSELRKS
FT                   VNTPLELVQIDELIAEFNRYPLLPLSERKKLCQHLVGLVKKHSKEADEGGAGVQQRPYE
FT                   PAELWEEPVSKLKGVGSKVGASLEKLDVTTVWDLIHYVPMRFVDRSKILKVKQLRTGID
FT                   ATVLGTVVDVKLQKTYRGYRLLTVTLQDDTGRVDLVFFNQEFLARKFRRGQLVMVTGKV
FT                   ESNHGRLQLTNLRSDSFEVLEPGKEILPMIPVYRAGAGTTTNTIRKVIFNALDQYSHKV
FT                   PEIFPYWQEKGFLSYPDAVEKLHRPENQAQFEKARSEIAYREIFVLQVLLALRKKVIGQ
FT                   AQGISFRVERDWIEELERKLPFTLTNAQKRVILEILNDMQKSKPMNRLLQGDVGSGKTV
FT                   VAMFAMFVAAKNGKQSAVMVPTEVLAFQHYMVFSQWAEQFGLRVGLLVGSLSASEKSKV
FT                   KRYLKSGQLDIVVGTHALIQEDTSFKDLGLVIIDEQHRFGVYQRAALISMDKSKQPDVL
FT                   VMSATPIPRTLVLTYYGDLDVSVIDELPPNRKPVKTFWVSEKRRSSVYEAVKRELDEGR
FT                   QAYVVAPLIEESESIEAAAATSLYEELCSTFLKDYKVGLLHGKMNKEEKKNVMDEFRKG
FT                   SLQVLVSTTVIEVGVDVPNATVMVIEGADRFGLSQLHQLRGRVVRSSYQAYCYLIANAK
FT                   TQEAVERLESMVKYSDGFALAEKDLLLRGPGELMGERQHGFSGMRVADLIKDMKMLEPA
FT                   RQDAERLVSEDPNLERPSSSFLRRYLLKEFGDASFLLGVA"
FT   gene            270191..271138
FT                   /locus_tag="COPRO5265_0279"
FT   CDS_pept        270191..271138
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0279"
FT                   /product="histidinol-phosphate aminotransferase"
FT                   /note="identified by match to protein family HMM PF00155"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17380"
FT                   /db_xref="GOA:B5Y799"
FT                   /db_xref="InterPro:IPR001917"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y799"
FT                   /protein_id="ACI17380.1"
FT                   /translation="MVEEESRRLHLNEMQLPLPPALFEGLDLDCVRFYPPEELEEQLRL
FT                   QIADYAGVDPSFVFIYSGIDGLIELMYKVFWDRAFLIHDPAYYVYEHEALRQGISLSKV
FT                   KLRFSKLPSDFSVQAQGKVTVVVNPNNPTGNILMDETLAEKLLSNVELLVVDEAYYEFS
FT                   GVTFAPLLEKWPNLAIFRTFSKAFGLAGARVAYMLAHPKTVGLFSQYSEVYRVSTLSLM
FT                   LAKNALADTSYVTEYVQVVKTQMERLINALSTLHISSRPSVCNFILVDKDFAEFLVSKG
FT                   FKIKFFEKWGRLTVPSPSVTEEVIALAENYRRLT"
FT   gene            271110..271631
FT                   /locus_tag="COPRO5265_0280"
FT   CDS_pept        271110..271631
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0280"
FT                   /product="putative N6-adenine-specific methylase"
FT                   /note="identified by match to protein family HMM PF03602"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17050"
FT                   /db_xref="GOA:B5Y7A0"
FT                   /db_xref="InterPro:IPR004398"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y7A0"
FT                   /protein_id="ACI17050.1"
FT                   /translation="MLKITGGSLKNLSMNPPDVPALRPLPQRERLALFSMLGNVEGSRV
FT                   VDLYAGSGIVAFEFLSRGAVEAVGVENNRKLCQFMRTQAKKWNVNLKVVCEDVFRFLRR
FT                   PLEADYLFMGPPNHKGLVTKTLDALSAIEFTGIVIIQHSSREPLPPSVKVLRSTGKDES
FT                   VVDIVKLILD"
FT   gene            271664..272005
FT                   /locus_tag="COPRO5265_0281"
FT   CDS_pept        271664..272005
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0281"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF04430"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17751"
FT                   /db_xref="InterPro:IPR007523"
FT                   /db_xref="InterPro:IPR036748"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y7A1"
FT                   /protein_id="ACI17751.1"
FT                   /translation="MVSEGLAFGEIVIQGKSYRDDVFLGYGEPQPWQRIEPHQVVLEDV
FT                   QELIPSDVCYVVFGTGFTGRMVVSPVVAEHLHKKGIACVEQKTPQALETYEKLLSKGEK
FT                   AVAFLHLGC"
FT   gene            complement(272030..273502)
FT                   /gene="pckA"
FT                   /locus_tag="COPRO5265_0282"
FT   CDS_pept        complement(272030..273502)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pckA"
FT                   /locus_tag="COPRO5265_0282"
FT                   /product="phosphoenolpyruvate carboxykinase"
FT                   /EC_number="4.1.1.49"
FT                   /note="identified by match to protein family HMM PF01293"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17322"
FT                   /db_xref="GOA:B5Y7A2"
FT                   /db_xref="InterPro:IPR001272"
FT                   /db_xref="InterPro:IPR013035"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y7A2"
FT                   /protein_id="ACI17322.1"
FT                   /translation="MWEKFFTDFSFMENPELSDLRQMAKKDEIPNRYGIPVYHSKIKSR
FT                   SAKFTEYHYEITPDLETLFQEVFQHYQSRKWIKVERNIGQSPENLFRQLYIVPSEYARL
FT                   AFMMTHNNFDPVGQKDPDIYIAAFPDWPDRRILVFPNLHFTMILGSDYYGESKMAGLRM
FT                   AMHIMREERGGIGLHAGSKIYRVKNAQGQLTERGALIFGLSGTGKTTISVNSHNLVAPE
FT                   GVEILQDDINMLTTKGNSYGTEKNFYVKTDSVSSTPELQDACLAEDAILENVYVSPEGE
FT                   IDFDNMSISTNGRAVINRRRIPNTSDRIDLPQVNFFLFNTRRYDIPPVGKLTGPAQAAA
FT                   FFMLGESTITSADDPTRVGETTRVVGFDPFIINKPEKSGNRLYEILSNHPIDVYIVNTG
FT                   KIGGLDGIKITPEVTLKIVENIARGTIKWQYNEDLGYEIPVEVPGLDLSQFDPYKIYGK
FT                   EEYKNMMEALRNDRRKHLQQFPDLYDQIKESI"
FT   gene            complement(273553..274638)
FT                   /locus_tag="COPRO5265_0283"
FT   CDS_pept        complement(273553..274638)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0283"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17960"
FT                   /db_xref="GOA:B5Y7A3"
FT                   /db_xref="InterPro:IPR009015"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y7A3"
FT                   /protein_id="ACI17960.1"
FT                   /translation="MNLAESMKKEATEFFNAHGIALEESQDPEALIVLSGGSEEIAKDF
FT                   LKPGVILIPFGTANGLAASLEIQSYALEQGFNVPLVSELSDNYVKWLSVFENLKQQKAG
FT                   LIGKPSSWLIKSGDYTILNQLQIPYMEIPLEELNSLLQEQESLADEIWDKASSSGIEKE
FT                   EVLKGTKVYTALQKIIDKYQLTAFALRCFDMAVQLKITGCLSLSLFNTKKIPAACEGDV
FT                   ESLVTMMIANQLMGTPGFMINLARKNHPEYTFAHCTIALDLVDSYSLTTHFETGYNVGI
FT                   NGQFHEGVYTAFRMGKDKKYKYFVGETVEKPHVENMCRTQITLRLKQNPFKRSIGNHMV
FT                   LVPGDWSKELALLEEFGWQLI"
FT   gene            complement(274673..275131)
FT                   /locus_tag="COPRO5265_0284"
FT   CDS_pept        complement(274673..275131)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0284"
FT                   /product="small multidrug export protein"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17303"
FT                   /db_xref="GOA:B5Y7A4"
FT                   /db_xref="InterPro:IPR009577"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y7A4"
FT                   /protein_id="ACI17303.1"
FT                   /translation="MNLNKWIYLTLISMSPIVECRGSIPYGLLAGLPVVGVFIVAFFSN
FT                   TLMGIVVYEGVKLLKSWLLRYPKLRNYYENYVRNALKRFKQYETGIAVSLAIFVGIPLP
FT                   GTGAFTGAVVAEALEVKRPLAWASLAAGVLIACTVVTLITWSAMQIAR"
FT   gene            275101..275622
FT                   /locus_tag="COPRO5265_0286"
FT   CDS_pept        275101..275622
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0286"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ACI16941"
FT                   /db_xref="GOA:B5Y7A5"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y7A5"
FT                   /protein_id="ACI16941.1"
FT                   /translation="MLSRSIYSGSQWLLYNTVMVSQVKAFILAVVFALGSFFGYATLGP
FT                   FTDLERQKAFDSYQTLVEDTVREQLERISSFTGEHTVGHDSLVFKGVGYADTDFESYNM
FT                   VLEMKGYVVAKYEIRLVDGNLMCTSTLSSYAAFFKAHDEIKMSSFSLAPAGENSSSCSL
FT                   STFNAARQNH"
FT   gene            complement(275590..276366)
FT                   /locus_tag="COPRO5265_0285"
FT   CDS_pept        complement(275590..276366)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0285"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17981"
FT                   /db_xref="GOA:B5Y7A6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y7A6"
FT                   /protein_id="ACI17981.1"
FT                   /translation="MSAVTLLDVRNLNLTFKEKGKELSVLEDISFTLDEGEFLCLVGPS
FT                   GSGKSTILRIISGILNEYTGEVLYKGEPNPQPNPNVSMVFQSFALIPWLTVQENIELVL
FT                   EARGIAPRQRIRTALRYIDMVGLDSFEDAYPRELSGGMKQRVGIARALAVEPEILLMDE
FT                   PFSALDVLTAADLREQVVNLWLEKRLPLKSVLMVTHNMEEAVFLADRILVLSARPGHII
FT                   GEISVDLPRPRDSRDKAFEEILDKVYSMILSSRIKS"
FT   gene            complement(276366..277865)
FT                   /locus_tag="COPRO5265_0287"
FT   CDS_pept        complement(276366..277865)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0287"
FT                   /product="ABC transporter, permease protein"
FT                   /note="identified by match to protein family HMM PF00528"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17383"
FT                   /db_xref="GOA:B5Y7A7"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y7A7"
FT                   /protein_id="ACI17383.1"
FT                   /translation="MQLISAALWSTYRIFVAYFLSLAFGIFYGVSASSGPRREKIMIAI
FT                   LDILQSVPILGFFPVAIAFFVAVFRGQRIGLELAAIFLIFTSQAWNIAFGVYETVKTLP
FT                   RELVEVGKAFNFSKTFTIQRIYLPAMVPTIVFNSGVSMANGWYFLMASEIITLGSQEVK
FT                   LPGLGSSMMNYLAQGNILGVVMCIGTIVLINALLQVLIFRPLVKWSELFQYNAVGTAPE
FT                   WPTVADVLFDFGKALKVDTVLVKLVSLGTKKLSAVAKYVFYVIGAALVGGLGYLIFWLF
FT                   SPPYPSNILSQIPAALTVTTMRVVAAVVIAVLLALPFVIRSVKNVAAAQNIYSLASILG
FT                   SIPAVVFYPPIVALGGRAYMEPLSILLLLTGSFWYALFNMSKGAMLLPGVLTEMAQVFN
FT                   IKGWLYYKNILIPAILPPLITGALTAWGGAWNASIVAEHVQFGDKVYSIPGIGALLVQS
FT                   TADTKALLLIVLSMTALIVLVNMLFWRPWYSKAAEKYNITE"
FT   gene            complement(277918..278439)
FT                   /locus_tag="COPRO5265_0288"
FT   CDS_pept        complement(277918..278439)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0288"
FT                   /product="ABC transporter ATP-binding protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17060"
FT                   /db_xref="GOA:B5Y7A8"
FT                   /db_xref="InterPro:IPR018632"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y7A8"
FT                   /protein_id="ACI17060.1"
FT                   /translation="MDVPLPKARVSEVLGLLEILDDEGGHVDLYKLGRTLGHDIDELIS
FT                   TIETAQLFNLVEVDNGDVVFTEVGKQFTDQNMEQRKTYISEVLSKLPYMVELLTALAES
FT                   EEHSVDMEYLERIIDGEYSEREVKYFVRNLLDWARFAELIWVDSDEQTIHLETEEDEEN
FT                   NPEQNDQAEE"
FT   gene            278626..279327
FT                   /locus_tag="COPRO5265_0290"
FT   CDS_pept        278626..279327
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0290"
FT                   /product="type IV pilus assembly protein PilZ"
FT                   /note="identified by match to protein family HMM PF07238"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17364"
FT                   /db_xref="GOA:B5Y7A9"
FT                   /db_xref="InterPro:IPR009875"
FT                   /db_xref="InterPro:IPR009926"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y7A9"
FT                   /protein_id="ACI17364.1"
FT                   /translation="MAKRKEPKVGDRGILRVREPGETGVEYYSTRIEDVRDGLIACSQP
FT                   MRGQVYVKILSSPVELTYLKGDSVFSLMCEVIEQGKGDPPLIVLKPISGIYRSDRREYV
FT                   RVPWMLDAELLFVKTFPADVKKFWEDHSHESVRAVILDLSAGGCRLSLAEACMVGEKVL
FT                   IRFTVPEPNPDTFLLPALIKRVEPGSEPGVTNVGLQFVDVKDVIRDKLCRSVFCRQREL
FT                   IKKGFYELEEE"
FT   gene            complement(279306..279653)
FT                   /locus_tag="COPRO5265_0289"
FT   CDS_pept        complement(279306..279653)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0289"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17591"
FT                   /db_xref="GOA:B5Y7B0"
FT                   /db_xref="InterPro:IPR007318"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y7B0"
FT                   /protein_id="ACI17591.1"
FT                   /translation="MLPRKISPVWLVISLVFGFAVSGKESLHPSLVTLGMAFTAFGAYL
FT                   IGKAEEHYVFTKEGKGIYDYVRHPMYLGTSLFLMGVSVAMESVVLWIVALVWTIGALYL
FT                   AWKESHSSSSS"
FT   gene            279693..280799
FT                   /locus_tag="COPRO5265_0291"
FT   CDS_pept        279693..280799
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0291"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18214"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR018708"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y7B1"
FT                   /protein_id="ACI18214.1"
FT                   /translation="MEGVYTKKLTCPVCKSEVYVARLKHGAYTVISRDSDLHPWVNGIN
FT                   PIYYVGAVCENCGYAALESHFEEVPPDEIKKLLPLLAKKRLAGIKGVREERTWEDALYV
FT                   LSSVFEQYEIRNTDPYNLGYVAQNIAWLYREIKDEENEQVWLEKALQYYLKAYESSAQL
FT                   PSTLGEAGLGYLIADLYARLGNYRDALQWASRVVQMPKNRKKVLFDQLSRELWQDLREK
FT                   YKSSSQEERNWRTTLRTDVQRTLQSKGVLTTTMDSLIRNVGLWASGEIVKDLQDLTKED
FT                   IEAVASFEWFNKLIEISSGHKIIGDIQLAKLLSSGQEEPAVYLMPERWPEPPAMVLTDQ
FT                   PLSSGKKILWQGYGFLKGKVRKLFIMEV"
FT   gene            280802..281209
FT                   /locus_tag="COPRO5265_0292"
FT   CDS_pept        280802..281209
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0292"
FT                   /product="chemotaxis protein, putative"
FT                   /note="identified by match to protein family HMM PF01584"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17887"
FT                   /db_xref="GOA:B5Y7B2"
FT                   /db_xref="InterPro:IPR002545"
FT                   /db_xref="InterPro:IPR036061"
FT                   /db_xref="InterPro:IPR039315"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y7B2"
FT                   /protein_id="ACI17887.1"
FT                   /translation="MEEYVVFTLGDRKYAIALSNVVEILLPGSVYPIPNSAANVLGLTN
FT                   IRGNILPVLDIKPLLGERENSSSELRRHVWIRSGNEDIVIVVDKVDGIKRVSEEDVAQP
FT                   PEDLTVGKRIKKVILANNDLILVVDPLDLVG"
FT   gene            281215..283269
FT                   /gene="cheA"
FT                   /locus_tag="COPRO5265_0293"
FT   CDS_pept        281215..283269
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cheA"
FT                   /locus_tag="COPRO5265_0293"
FT                   /product="chemotaxis protein CheA"
FT                   /note="identified by match to protein family HMM PF01584;
FT                   match to protein family HMM PF01627; match to protein
FT                   family HMM PF02518; match to protein family HMM PF02895;
FT                   match to protein family HMM PF07194"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17947"
FT                   /db_xref="GOA:B5Y7B3"
FT                   /db_xref="InterPro:IPR002545"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004105"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR008207"
FT                   /db_xref="InterPro:IPR010808"
FT                   /db_xref="InterPro:IPR035891"
FT                   /db_xref="InterPro:IPR036061"
FT                   /db_xref="InterPro:IPR036641"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR037052"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y7B3"
FT                   /protein_id="ACI17947.1"
FT                   /translation="MDDMNEYLPIFLQESYDYINLLNNNLVLLEQDPSNKQALAEVFRA
FT                   AHTLKGMSATMGFQFLADAAHELESALQIYRDTHEPVDEKAIELGFRVLDYMENQMKRI
FT                   EANESLEPFHVTSSNEVNEKGKKETTLEVTSSFALGAFEEEVVRAALEQGQKAAILEIN
FT                   LEQGVLMKGVRAFMVFKAIEDSGFEAISSQPDAESLEKEEFDLEFRVLVVGSGDLDSLR
FT                   NKILRIAEVASVDVIEIGLNEQAFPSSSNELREQTSTKQSDSGEGTKNPNSSDSLAQAY
FT                   AASAAATAEEVDQQQQKKPIKNYIRVPEEHVNNLMSAISELVLEKAELELAIKTGNEEA
FT                   LWSLYERLSRSINLAQGEITALRMTPLSFVFERFPRMVRDLSRDLQKQVRFIMEGGDTE
FT                   IDRTIIDRLGDPLVHLLRNAVDHGIERPEDRIKAGKDPTGTVRLKAYHEGNNVYIVVED
FT                   DGAGIDTAKVLAKAVERGLVTSDQASFLSQEEIFSFLFLPGFSTSDTVSEISGRGVGMD
FT                   VLKNTVEELGGTVQVRSVLGKGTTVIMRLPLTMAIISALLVKVNGLIFALPLSVVEEIS
FT                   NDVEAVKETPQGNVLLLRGELLPVYSVAGLLNLPDNGQNNHIVVIRNGQKKAALLVAET
FT                   VGKQEIVIKPLKSRFVPRYVDGATLLGDGTIGLVVNTSMLLEGHNNVKR"
FT   gene            283256..283858
FT                   /gene="cheC"
FT                   /locus_tag="COPRO5265_0294"
FT   CDS_pept        283256..283858
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cheC"
FT                   /locus_tag="COPRO5265_0294"
FT                   /product="chemotaxis protein CheC, inhibitor of MCP
FT                   methylation"
FT                   /note="identified by match to protein family HMM PF04509"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ACI16925"
FT                   /db_xref="GOA:B5Y7B4"
FT                   /db_xref="InterPro:IPR007597"
FT                   /db_xref="InterPro:IPR028976"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y7B4"
FT                   /protein_id="ACI16925.1"
FT                   /translation="MSKDDLSNPVILDVLKELANIGTGHAVTALSSMIGKFVGITVPEV
FT                   YLESLGKVANILGDPEEEVAAVYVGYHGELDGGAMVIFDASSTHGLFQALMGSDMDLCD
FT                   PMGLSMIQEVGNILVGSFVSALATFFGSTILAEPPGVAVDMLGAVLNVLLAEVGQHADY
FT                   LIVAKTTISIEDVNIRGWIVDIPTPESFKRITEKLGL"
FT   gene            283864..284334
FT                   /locus_tag="COPRO5265_0295"
FT   CDS_pept        283864..284334
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0295"
FT                   /product="chemoreceptor glutamine deamidase CheD"
FT                   /EC_number="3.5.1.44"
FT                   /note="identified by match to protein family HMM PF03975"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17563"
FT                   /db_xref="GOA:B5Y7B5"
FT                   /db_xref="InterPro:IPR005659"
FT                   /db_xref="InterPro:IPR011324"
FT                   /db_xref="InterPro:IPR038592"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y7B5"
FT                   /protein_id="ACI17563.1"
FT                   /translation="MLNVGIGEIAVLDKPGKIGAIGLGSCVAVAMYDPIAKVGGMVHVL
FT                   LPDSRGQKTELPGKFANTGVPYLLKLMEQKGARKDRIIVKIAGGASLMNVSVGNFGDIG
FT                   KRNIEAVKEQLNALGLRLQGEDTGGNEGRTFILDLATGTFTVKTARSGLRQI"
FT   gene            284337..284936
FT                   /locus_tag="COPRO5265_0296"
FT   CDS_pept        284337..284936
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0296"
FT                   /product="RNA polymerase sigma factor for flagellar operon"
FT                   /note="identified by match to protein family HMM PF04542;
FT                   match to protein family HMM PF04545; match to protein
FT                   family HMM PF08281; match to protein family HMM TIGR02937"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18218"
FT                   /db_xref="GOA:B5Y7B6"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y7B6"
FT                   /protein_id="ACI18218.1"
FT                   /translation="MMVEKGWIIAARKGDDKAREQVLMSLQRVIERQASQLTYYNISLE
FT                   WDDLLAVGLIAANECIDLYNLESEIPFEAFASKVIRNKMVDYLRTTGTFTKSDVAKYKQ
FT                   GQLTLNKEELSLEALIEQGIEEVGEQGIILELEEALNRLDLRHKQVLQFRYVDNLSVKE
FT                   VADILGVSPGRVSQLVNEALDLLREDIGIKFNKGDN"
FT   gene            284936..285619
FT                   /locus_tag="COPRO5265_0297"
FT   CDS_pept        284936..285619
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0297"
FT                   /product="flagellar hook-basal body complex protein,
FT                   putative"
FT                   /note="identified by match to protein family HMM PF06429"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17362"
FT                   /db_xref="InterPro:IPR010930"
FT                   /db_xref="InterPro:IPR037925"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y7B7"
FT                   /protein_id="ACI17362.1"
FT                   /translation="MLRGIYNAVSSNLMLLRAQDVIEDNLLHIQTPGYKQKNFAFTLTE
FT                   QRPIVGLGNVSFGGLLSYPYVSIEQASLEETGRNLDLAVSGGFLAVDANGQRLWASSLR
FT                   MLVDEQGYLVTPEGYRVLGKNGPIKWNENYNVDQQGNILLNDQIVDSFLISDVNVQEVV
FT                   NDRYFVGEQLQSNFRVFQTYLETSNVDEIGQVTALMTILRHYQSNVKVVQAEDAALAKI
FT                   INIMV"
FT   gene            285642..286307
FT                   /locus_tag="COPRO5265_0298"
FT   CDS_pept        285642..286307
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0298"
FT                   /product="flagellar hook protein FlgE"
FT                   /note="identified by match to protein family HMM PF06429"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18014"
FT                   /db_xref="InterPro:IPR010930"
FT                   /db_xref="InterPro:IPR037925"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y7B8"
FT                   /protein_id="ACI18014.1"
FT                   /translation="MVELYGIARAGMRLSVGYLNVAAFNISNVNTEAFKALEPVESSGN
FT                   AHEFPVANGRANIVDNAYLFTVNRDNMGPLSNTSGYALTNPQAYFVITDGTNRWLTRKG
FT                   NFELDRDGNVSLQGFYVMNRDGAVAKATDLYSGNLLLVEADTSQYDRDSIGFVSTGQER
FT                   IINVDEAGLTANALEMSNVDLSAEMVKLIAAQRAYQFSAKAFRNADELIEASINLRGA"
FT   gene            286312..287154
FT                   /locus_tag="COPRO5265_0299"
FT   CDS_pept        286312..287154
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0299"
FT                   /product="conserved protein"
FT                   /note="identified by match to protein family HMM PF01966;
FT                   match to protein family HMM PF08668; match to protein
FT                   family HMM TIGR00277"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17111"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006675"
FT                   /db_xref="InterPro:IPR013976"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y7B9"
FT                   /protein_id="ACI17111.1"
FT                   /translation="MPIPSLDQLIDQVDKVLPVPSVAMQVIKLLDVPDSSVKDVAEVLS
FT                   QDQGLTANVLKLANSAYYGMPRRVTLPMEAVALLGFKTVRSIVWSSVMEVLYSKPLVGY
FT                   KLESGMLWEHSLAAAVIGKYLAKTFKLRDPESFYVSGLLHDVGKLILNIYLPVEFSNII
FT                   ALVEEGKTFAEAERKILGYDHAQVGGIICDKWQLPEVIVEGVKYHHTPKLGSQSSHITH
FT                   LANAMALMLGHGTMGVATMAASLDEEILSLYVPSEDQWFDLLEKAEEQVMLALHASKY"
FT   gene            287200..287472
FT                   /locus_tag="COPRO5265_0300"
FT   CDS_pept        287200..287472
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0300"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17487"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y7C0"
FT                   /protein_id="ACI17487.1"
FT                   /translation="MRIDGSGSIDPKHVELVKRVSERFKLTDAQSVERTDKRMSDIVLA
FT                   RVLQSFKESRVNHLDEVRERSKDNAVDVERIARSLVEKTKEDAEV"
FT   gene            287459..287782
FT                   /locus_tag="COPRO5265_0301"
FT   CDS_pept        287459..287782
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0301"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ACI16826"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y7C1"
FT                   /protein_id="ACI16826.1"
FT                   /translation="MQKSDELELVKKARLLAAELTASYAALRSENVENTSAELEETVRA
FT                   LAERIESYEGQELPKELVDEIVAFVHDLEGLVDLGREVLGFYESLLSPSVQVYGPSGKV
FT                   NKK"
FT   gene            287779..289401
FT                   /gene="flgK"
FT                   /locus_tag="COPRO5265_0302"
FT   CDS_pept        287779..289401
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flgK"
FT                   /locus_tag="COPRO5265_0302"
FT                   /product="flagellar hook-associated protein FlgK"
FT                   /note="identified by match to protein family HMM PF00460;
FT                   match to protein family HMM PF06429; match to protein
FT                   family HMM TIGR02492"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17636"
FT                   /db_xref="GOA:B5Y7C2"
FT                   /db_xref="InterPro:IPR001444"
FT                   /db_xref="InterPro:IPR002371"
FT                   /db_xref="InterPro:IPR010930"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y7C2"
FT                   /protein_id="ACI17636.1"
FT                   /translation="MIWSLEIAKRSLQAQMLALDVTSHNIANVNTPGYSRQEAVFRPTQ
FT                   PYGIVSWLGTINPGQVGTGVQISSIRRLRNDFVDMNYRNVTSESSYYSVKDQVFSILES
FT                   SINEIKDSGLQKALSDFFDAWHEGSVSPEDPTVRRIIVEQSQNLIDAFKYVQNQLVSTR
FT                   SDVDFQIVNSVARINDIGKEIAKLNEQISLSTSQGQQPNDLLDQRDNLLDELSQYVNIQ
FT                   KVALPTGSVSVFIGGLSFVDDRTVNEIKAIDNDRLIDSGEGYKYTEGLATYSVLPGLIQ
FT                   NDKWNESIALGTEDIYNGHVSTLWLTMGNSLVPLDDRHLAGGKLKGLVEMRDDVIAYGE
FT                   EPGRGLLGKINEMAYYFFDKINLMLKQGKDLNGDAYSSNFFNWDVNVVPKNIISAVALD
FT                   PTVVSDPTKLPIGVTGLAGDGSLALLIAQEQNNALETVPEILNSTLWNPSLPGFLKGQS
FT                   VAQSWRTLVAEWSADISRNRAFMEGTNNVKSELTLLRTSESGVNLDEEAVNLIRFQKGY
FT                   AMSARIVSVVDGMLDLIINMGAR"
FT   gene            289412..290473
FT                   /gene="flgL"
FT                   /locus_tag="COPRO5265_0303"
FT   CDS_pept        289412..290473
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flgL"
FT                   /locus_tag="COPRO5265_0303"
FT                   /product="flagellar hook-associated protein 3"
FT                   /note="identified by match to protein family HMM TIGR02550"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ACI16877"
FT                   /db_xref="GOA:B5Y7C3"
FT                   /db_xref="InterPro:IPR001029"
FT                   /db_xref="InterPro:IPR013384"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y7C3"
FT                   /protein_id="ACI16877.1"
FT                   /translation="MRITTAYQYERSVQTLQTVLGKLTQLQDQLSTLKQIQKPSDAPLD
FT                   SALVMNWKAYNAQVERWQNNIKEVENRYSYTEQNLTHIKDLMLNVRDLVIRGGGSDALG
FT                   PEEKMAVSRQLIQQADEMLSSLNAKYAGRFVLANAQVTKPEDPAWKPFKVLIQDSGGNF
FT                   TFVDTITQAEDMVQKDPGSKWMVVFEPKTFDELNDPSRRAVSVEIGNNSTIPQVLAVED
FT                   YFKFSGTVDVNGASYHRMDMFDKLFTFSETLRNGGSLASPDNTGKTALDYTDEILDGLT
FT                   DSIASIGARVQRLGSLDDFYKNVSTNVEALRSSYEDADLARTYVEYTKFHTSYQSLLKV
FT                   IASITPMCLVDYL"
FT   gene            290491..290715
FT                   /gene="csrA"
FT                   /locus_tag="COPRO5265_0304"
FT   CDS_pept        290491..290715
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="csrA"
FT                   /locus_tag="COPRO5265_0304"
FT                   /product="carbon storage regulator"
FT                   /note="identified by match to protein family HMM PF02599"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18059"
FT                   /db_xref="GOA:B5Y7C4"
FT                   /db_xref="InterPro:IPR003751"
FT                   /db_xref="InterPro:IPR036107"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y7C4"
FT                   /protein_id="ACI18059.1"
FT                   /translation="MYILRRKSGEGIRISKDITVYVLGISGNEVKLGIDAPKDIPIIRL
FT                   EILETTANASAVFSEEKLREILKSEDQGT"
FT   gene            290696..292600
FT                   /locus_tag="COPRO5265_0305"
FT   CDS_pept        290696..292600
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0305"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17215"
FT                   /db_xref="GOA:B5Y7C5"
FT                   /db_xref="InterPro:IPR007016"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y7C5"
FT                   /protein_id="ACI17215.1"
FT                   /translation="MKIRELRDFGFFAIKEALLILPIVLSVAVPKTFLGTWGLLYAFTA
FT                   PSAVVLAFSRRTWSSFTYPKAHFLSAMAVLGGIILFRSQTSFFASWAVLLYAILLAVHP
FT                   FFKGMVTAVGNSERSTGAWIRLSALFVGLVIWNLTRFSPYEVKLWILTVPPLVLSLSII
FT                   FAGRNWIFLSGKASFGREFGSMGNPMPASSLLVMALPVVSELTFLGVSTGRYWYLLVLP
FT                   LYAYGFFASAGRGAVFGVLLSVPFIAYLGFQYSPWWLLIGILFFVVAALAARKYLKELW
FT                   QRVVWTFKRGLTKEPRFFLWRDTLYFCVKEPLGSGYDNFRRSFMPYRSKESYLAEPTVH
FT                   YDKVHNVFLEEWAEGTVVAFVLLIVILVELFLKGTLTLKGAIFAVIGDGFFGIYNPANW
FT                   LYLWMLGSLAPLSSVFSVYWLYPCWALVVFAFVLTSLNHMPQVTAGNAHSSRLAGQRDI
FT                   AAQLFNAAYTVFPWCVDYLSEWALLQMALLNEAKLNDDMAVGYHNTFKGLQPYLDRFAS
FT                   NIDDIYSSWLMFCGKYASLRKEGEAIYGRLQQVNPYSFRVRKACAHYLGNVGDWDLAMS
FT                   FLEENINEYPFDADSYYMLVLACYEQHLWSTGRKYLQLWRDRFPNDSRLTELERALGI"
FT   gene            292652..292975
FT                   /gene="fliS"
FT                   /locus_tag="COPRO5265_0306"
FT   CDS_pept        292652..292975
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliS"
FT                   /locus_tag="COPRO5265_0306"
FT                   /product="flagellar protein FliS"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17096"
FT                   /db_xref="GOA:B5Y7C6"
FT                   /db_xref="InterPro:IPR003713"
FT                   /db_xref="InterPro:IPR036584"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y7C6"
FT                   /protein_id="ACI17096.1"
FT                   /translation="MANAYGKARQRFVEQEIMNAPVQKLVLMVYDLIITSLQKGDIFKA
FT                   RSAIKELIDGLDFENGGEVAKNLMSLYEYAYRLIGENQIEEASKVFEELREAWVQAFFP
FT                   NGY"
FT   gene            293066..294121
FT                   /gene="hag"
FT                   /locus_tag="COPRO5265_0307"
FT   CDS_pept        293066..294121
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hag"
FT                   /locus_tag="COPRO5265_0307"
FT                   /product="flagellin protein"
FT                   /note="identified by match to protein family HMM PF00669;
FT                   match to protein family HMM PF00700"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17899"
FT                   /db_xref="GOA:B5Y7C7"
FT                   /db_xref="InterPro:IPR001029"
FT                   /db_xref="InterPro:IPR001492"
FT                   /db_xref="InterPro:IPR042187"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y7C7"
FT                   /protein_id="ACI17899.1"
FT                   /translation="MAQADLSRINSNIGALNALNSLRIIQNDMALRQLRLATGNRITQA
FT                   ADDPAGFRIAVKLNARSRGLSQAVDNIGDARNMLSTAETGLTKIKDLLLTIRDKLVSGA
FT                   NDTLGSEERLAIAQQVREYMHEITRLAHETRWNDIGLLDDSSPAASTTTASTTFYFQTG
FT                   SDANETTIWSRGFKIVTTPFTENDWNVNWTTAAATLEVKLTTAANTASVQTYKVYDSAS
FT                   GSVSASASFSVADVYAAFGVAQQAGIGSASDSTNVSASVNALIKNVDAAIRGVSDWIAG
FT                   IGALSARLDTKAQSVSAMQVNVEASYNRIFNADMAYEQLQLTKAQILQQTAVAMLSQAN
FT                   LAPQQILTLFR"
FT   gene            294205..294603
FT                   /locus_tag="COPRO5265_0308"
FT   CDS_pept        294205..294603
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0308"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ACI16839"
FT                   /db_xref="InterPro:IPR005186"
FT                   /db_xref="InterPro:IPR035924"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y7C8"
FT                   /protein_id="ACI16839.1"
FT                   /translation="MAQDPEEVARISGVRNIGVQGNQMQSFLASDQLKNVTEIPVDINR
FT                   RQVEPTKEEDIESTVNKVKRVVEIINPNIEVRMEHHPAIRDVILGTRLVFYDKEKDKVI
FT                   KEVPTEKALELYAEVLKKLNSLFVDTEI"
FT   gene            294622..296004
FT                   /locus_tag="COPRO5265_0309"
FT   CDS_pept        294622..296004
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0309"
FT                   /product="probable flagellar hook-associated protein 2
FT                   (filament cap protein), putative"
FT                   /note="identified by match to protein family HMM PF07195"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17339"
FT                   /db_xref="GOA:B5Y7C9"
FT                   /db_xref="InterPro:IPR003481"
FT                   /db_xref="InterPro:IPR010809"
FT                   /db_xref="InterPro:IPR040026"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y7C9"
FT                   /protein_id="ACI17339.1"
FT                   /translation="MVNFDPTQVQTNIQKYVDTLLVYDKKKITELENRQSALQQKSSAV
FT                   SQVISLLSSFSSSLSVNFDSLAVRSTNESVAQATASGKISGSVSINVDRLASYQVLDWT
FT                   KLSGSDSSSAFHFDSSSQVSANSFWSSLVGSKFNITFELGDGSSESIEVDLTRFSQDSV
FT                   LSQVLDDFAFQVNAHSSKVRLYKQKLNDGTFILQSSALGSGKNNAIKSVAFGSMIFSNE
FT                   EDLSALDASFTVNGYSYTRSSNTFSDIIPNLTVTLKGIGSTMVTVSSDTSTILQGMSNF
FT                   VQSFKAFSDKLRGLINVDPSNQGALASDASTLRQVLDGIRTRLMSARAVNVDGVEYGFN
FT                   PSLIGISFDEYGTISLDTSKLNNYLSSNVKGQDILRNWWADVSSDIRKYIDKALGSNGT
FT                   IGRLQSNYNSSIKGISDQIKQLNAQMEEKRATLVSQMGVIFNSLYQYQSMFAQMNSYFS
FT                   VS"
FT   gene            296089..296412
FT                   /locus_tag="COPRO5265_0310"
FT   CDS_pept        296089..296412
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0310"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17999"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y7D0"
FT                   /protein_id="ACI17999.1"
FT                   /translation="MEGVDALLKRYSELLDDVIDAISHSDLDKVSKYVLVLQDVITLIA
FT                   QELEEHPEEKHKHADTVKVIHEKQQKIISLLELQAQDLLREVEETTNTYQARKTYEQNK
FT                   GIR"
FT   gene            296387..296614
FT                   /locus_tag="COPRO5265_0311"
FT   CDS_pept        296387..296614
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0311"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17309"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y7D1"
FT                   /protein_id="ACI17309.1"
FT                   /translation="MSKTKAFVSLLLILCSVGLTGCKPKPFSETDISQSKVVLQDVLNA
FT                   FAKNDVNALQGNFVPTATELISTVVEVKNV"
FT   gene            296774..296881
FT                   /locus_tag="COPRO5265_0312"
FT   CDS_pept        296774..296881
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0312"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17858"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y7D2"
FT                   /protein_id="ACI17858.1"
FT                   /translation="MCSHQVEVVFVKYEGKVLVGNLQQQGAPPSCKEVK"
FT   gene            296881..297222
FT                   /locus_tag="COPRO5265_0313"
FT   CDS_pept        296881..297222
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0313"
FT                   /product="flagellar basal-body rod protein FlgB"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17052"
FT                   /db_xref="GOA:B5Y7D3"
FT                   /db_xref="InterPro:IPR006300"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y7D3"
FT                   /protein_id="ACI17052.1"
FT                   /translation="MSVDSLKTMMGIVFQNLQAVQSNLANVDTPGYKRQEVDFQTVFME
FT                   LQNHGELLQPSSNYVKIDNTTSWRLDGNNVDPDKEITTLIETALWYQGITEMLSRHFST
FT                   ARQVLQMLR"
FT   gene            297229..297633
FT                   /gene="flgC"
FT                   /locus_tag="COPRO5265_0314"
FT   CDS_pept        297229..297633
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flgC"
FT                   /locus_tag="COPRO5265_0314"
FT                   /product="flagellar basal-body rod protein FlgC"
FT                   /note="identified by match to protein family HMM PF00460;
FT                   match to protein family HMM TIGR01395"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17724"
FT                   /db_xref="GOA:B5Y7D4"
FT                   /db_xref="InterPro:IPR001444"
FT                   /db_xref="InterPro:IPR006299"
FT                   /db_xref="InterPro:IPR010930"
FT                   /db_xref="InterPro:IPR019776"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y7D4"
FT                   /protein_id="ACI17724.1"
FT                   /translation="MSGFSLLRIAGSALTAQRFRMDVISSNIANLETTRTPEGGPYHRK
FT                   IVSFQSMMVGENQGQGVKVAQLTEDPSERLVYDPSHPDADPETGMVHYPDMDLITELTD
FT                   LMSAQRSFEMNSNAIAIARQVYTKSMEIGR"
FT   gene            297647..297943
FT                   /locus_tag="COPRO5265_0315"
FT   CDS_pept        297647..297943
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0315"
FT                   /product="flagellar hook-basal body complex protein FliE"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ACI16841"
FT                   /db_xref="GOA:B5Y7D5"
FT                   /db_xref="InterPro:IPR001624"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y7D5"
FT                   /protein_id="ACI16841.1"
FT                   /translation="MGIDPVSGFGPIKPISPIDVSKTGETQGATDAFSKLLDQLSAKES
FT                   EQDLYRNAIAQGNMDILPEALVSATEFQVGLLLVTQIRNQLVSAFQEFMRLPL"
FT   gene            297968..299533
FT                   /gene="fliF"
FT                   /locus_tag="COPRO5265_0316"
FT   CDS_pept        297968..299533
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliF"
FT                   /locus_tag="COPRO5265_0316"
FT                   /product="flagellar M-ring protein FliF"
FT                   /note="identified by match to protein family HMM PF01514;
FT                   match to protein family HMM PF08345; match to protein
FT                   family HMM TIGR00206"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17473"
FT                   /db_xref="GOA:B5Y7D6"
FT                   /db_xref="InterPro:IPR000067"
FT                   /db_xref="InterPro:IPR006182"
FT                   /db_xref="InterPro:IPR013556"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y7D6"
FT                   /protein_id="ACI17473.1"
FT                   /translation="MNLENIPVLKDLVNFWKNLEKNQKRNIIVVLVVALVAIGGLVYYL
FT                   NRPQYALLFSDLMPEQAQAIVSQLESQNVRYKLSSDGASIYVPNDKVTSLRLELASSGL
FT                   VGSTKPGYELFDNISNIFLTQEEQQIMYQRALEGELERTISGMPGVKSVSVHLSLPQRS
FT                   LWTVTSTQTAQGAVYLTLKPGYSLSANQVEAIRQLVAHAVEGMSPENVVIAEASTGILA
FT                   GDLAQSGVDKGYLEIKKQLDELYASKIRSFLGQTFGPENIMVSADVDVEVTKQNIQSET
FT                   WGNTATKNVSDTESWSSSSSSGGPVGTATNVPGAIPSYVYTSTGEGPYNYYRQQQINYE
FT                   ISRTISEIVPQEVEIKNVKIAAIVDSSVFKDYAVTASTVESLIASAAGLDNARGDVALV
FT                   TSMPFASLAREKEAQEAQLLAEAQRRARLYSYIAIAVVALLILAMVFILLRRSRRTAPA
FT                   PVPAGAGLGEALGQPRPIISLERPLTPEEEKIKLAMEEIQKALQEHPNDVADLVRMWMQ
FT                   EEWR"
FT   gene            299541..300542
FT                   /gene="fliG"
FT                   /locus_tag="COPRO5265_0317"
FT   CDS_pept        299541..300542
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliG"
FT                   /locus_tag="COPRO5265_0317"
FT                   /product="flagellar motor switch protein FliG"
FT                   /note="identified by match to protein family HMM PF01706;
FT                   match to protein family HMM TIGR00207"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17898"
FT                   /db_xref="GOA:B5Y7D7"
FT                   /db_xref="InterPro:IPR000090"
FT                   /db_xref="InterPro:IPR011002"
FT                   /db_xref="InterPro:IPR023087"
FT                   /db_xref="InterPro:IPR028263"
FT                   /db_xref="InterPro:IPR032779"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y7D7"
FT                   /protein_id="ACI17898.1"
FT                   /translation="MAEKKKISKAAILMIALGRDLAAKIMRQLKEEDAEKLALEISSVT
FT                   DLDERTKANILEEFVNVVKAKEFLGQGGIEYAKDLLERAFGPQKAKEILERLMEAVQVM
FT                   PFEFLRKLDGQQIANLIQNEHPQTIALVMNYLNPDQAAIVFTSLPPNLQAEVAFRMAVL
FT                   ERTSPDIIEAIEEQFRQRFATVAVRGDLTKVNGIDALVKILNSLDQQTQSNVLNYLDSQ
FT                   DPELAEEVRKKMFTFDDLILLDDRAIQRILREVDTKDLALALKGASEQVKEKMFKNMSQ
FT                   RAREMLQEEMDFMGPVRLRQVEEAQSKIITVVRRLEEAGEIIIFRGGEEIVT"
FT   gene            300520..301185
FT                   /locus_tag="COPRO5265_0318"
FT   CDS_pept        300520..301185
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0318"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17418"
FT                   /db_xref="InterPro:IPR018035"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y7D8"
FT                   /protein_id="ACI17418.1"
FT                   /translation="MVRKLSRKLYRLEKPSQEDVLGFRRGYLRGYKEGYERGYKEGFDN
FT                   GFKELYEIKEQWEKDLQEYIGQLSTLVSRLNEEKERLQKEYEEAIETYKRGIEEELAEV
FT                   VSVAASNYLNRSLEHDATLITGILEKCLQRFSGDYPLEIHVDERFVGEVEKFLQSSELL
FT                   SRNLKSVQIVKDNRIGFGVLIDSEEGRVDARVETLSRNLRTLVESSLHDNPEDQLYKG"
FT   gene            301151..302467
FT                   /locus_tag="COPRO5265_0319"
FT   CDS_pept        301151..302467
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0319"
FT                   /product="flagellum-specific ATP synthase"
FT                   /EC_number="3.6.3.14"
FT                   /note="identified by match to protein family HMM PF00006;
FT                   match to protein family HMM PF02874; match to protein
FT                   family HMM TIGR01026; match to protein family HMM
FT                   TIGR02545; match to protein family HMM TIGR03496; match to
FT                   protein family HMM TIGR03497"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17654"
FT                   /db_xref="GOA:B5Y7D9"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005714"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR022425"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032463"
FT                   /db_xref="InterPro:IPR040627"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y7D9"
FT                   /protein_id="ACI17654.1"
FT                   /translation="MTTPKISYIKDKVANVDLFEVYGKVLNVSGLSIEALTPASFVGEL
FT                   CSVNRFDGKPMFAEVVGFKEGKTLLMPIGDVQGIGPNSLIRAMGRPLWIKVSDGLVGRV
FT                   VNAIGEPLDDKGPVYGEKRSVYQDPPHPLKRKIITEPLQTSIKAIDGLLTVGKGQRVGI
FT                   FAGSGVGKSTLLGMIARNSSADVNVIILVGERGREVRKFIEEDLTEEGAKRSVVVVATS
FT                   DQPALLRVKAVLTGMTIAEYFRDQGKDVLVMMDSVTRLAMAQREVGLSIGEPPTTRGYT
FT                   PSVFALLPKILERAGNSDKGSITAFITVLVEGDDMNEPVADAVRSILDGHIVLSRALAH
FT                   RAHYPAIDVLQSISRVMNDVVSAKHLKLANRMRELLAVYTEAEDLINIGAYQRGNNPKI
FT                   DEALDYIDAINHFLLQQVKESYTLEQTVSLMEEVLGTVS"
FT   gene            302451..302858
FT                   /locus_tag="COPRO5265_0320"
FT   CDS_pept        302451..302858
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0320"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17742"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y7E0"
FT                   /protein_id="ACI17742.1"
FT                   /translation="MALSAKKAARILRVRKIEEDIAKNDFFLAVKQYRLAAEQARDVGR
FT                   SWLEVRAAQVNDRVVTYDAYFHAREKAKETVKGTYRLVLEKRELLLQKAVSRRSGEKLL
FT                   EYAKREAQTKAFRQELSLLDEIGSRKKGGEL"
FT   gene            302855..305173
FT                   /locus_tag="COPRO5265_0321"
FT   CDS_pept        302855..305173
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0321"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17089"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y7E1"
FT                   /protein_id="ACI17089.1"
FT                   /translation="MTSGAANLSFLTQFWDSDFSAMPPKLKKQNSGVFEQTSEQAVDFS
FT                   AMLALISGLAPDLVECLSCVQGSPEAGENGFQSAVSIEAVVPYESNTHVCFTASMEKLL
FT                   ADAEPLLDVPEPTTSETKEVATLSDKPEYGIHTNYAISYEQSSDVDLTVASEITASHSG
FT                   ASSEDDLGFKHASMQERGLGKERELPVMDQYADQRISEFQVGDSRSTGGMAKNAAQEET
FT                   SNWTWPNKEVDSKVVNYYGVITNRDGGVLAGDGPKNDELKEEHFYSEEAADPKVDLVKS
FT                   KVPEGIDFLSGVQTQSLSQENVSSLAEPDRFGIGTSPNAEEVVELSASTGKWLAGCESD
FT                   ADADSVSAMEPKHLQFGKAVDFLKEQAASIQVQEAVEVFGSTSGSMQLMDVEGLNPAYD
FT                   LDAIVGRENTFPVDPKKEVNLAAQGVEARSKQDGNDELSKGQSLKGSEVIEASSNKAPI
FT                   TDDDVPRSVLLGAERSEKSAEGSEGKSVSSTDEVNKVAEMPAFPSGGSVKETATTTDQL
FT                   RKGEVFNITYPEMTENVALRVPYQEDAAADETARMSQDQTAKNVKAKDKAPDEAKQVTD
FT                   ETLFVDKNALETLHSREEVSGQMRESGGTAFEQHDVLVAEESLSGKAEKQTQLSKEKDE
FT                   TSAVQRALESFPRSVEDAAHQDISSSLRPEGQYSPGKLSSDATNVKLSNEALLEQKSSL
FT                   AMRLAELPLRFGIDVRGGELLLTIMANSDQDASHLKEHSGYIKQRLARKGYEFDAVNVV
FT                   NSSQVTVQDYKVYHYDMVV"
FT   gene            305200..305493
FT                   /locus_tag="COPRO5265_0322"
FT   CDS_pept        305200..305493
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0322"
FT                   /product="basal-body rod modification protein FlgD"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17554"
FT                   /db_xref="InterPro:IPR005648"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y7E2"
FT                   /protein_id="ACI17554.1"
FT                   /translation="MYVPPTSSSQGATGSEQKVPGLNRDDFLKLLLAELKAQDPLSPMD
FT                   TNTMTTQITLLNVLQELIEIKTMLQNLVSAKSQEGTESSTTDGAEEVAGDGS"
FT   gene            305483..305845
FT                   /locus_tag="COPRO5265_0323"
FT   CDS_pept        305483..305845
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0323"
FT                   /product="putative flagellar hook associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ACI16938"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y7E3"
FT                   /protein_id="ACI16938.1"
FT                   /translation="MDLRIGPTSGVNQVSNLKKAPAKSSVDFTEALLNGYGIKLSNHAN
FT                   SRLVSREVSLDEERIQKIAQGIEELSKKGIREGVIILKDLAVVVGVPSRTIVTFKTPPF
FT                   TKGGVFSQIDGAVILE"
FT   gene            305933..307492
FT                   /locus_tag="COPRO5265_0324"
FT   CDS_pept        305933..307492
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0324"
FT                   /product="flagellar hook protein FlgE"
FT                   /note="identified by match to protein family HMM PF00460;
FT                   match to protein family HMM PF06429"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18250"
FT                   /db_xref="GOA:B5Y7E4"
FT                   /db_xref="InterPro:IPR001444"
FT                   /db_xref="InterPro:IPR010930"
FT                   /db_xref="InterPro:IPR011491"
FT                   /db_xref="InterPro:IPR019776"
FT                   /db_xref="InterPro:IPR020013"
FT                   /db_xref="InterPro:IPR037058"
FT                   /db_xref="InterPro:IPR037925"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y7E4"
FT                   /protein_id="ACI18250.1"
FT                   /translation="MLRSFFNGISGLKVHQIRIDVISNNIANVNTTAYKAARATFSDVV
FT                   ALTLKGARAPYGGRGGTNPSQVGLGVGLATIDNIMTQGPTNNTNRASDLAIQGDGFFVV
FT                   SDGQRNWFTRDGAFDIDLTGRLIQLSTGLKVQGWSMIPTQKIRFGGTVGTASTSFGFRV
FT                   YDNEGNEHVFTALVQPTPSGSTAAIHIYEGTDTASPNLVLTQTLGFANGVVQAGQTGVL
FT                   NWNNMSINLDFTSLGMSNATVSALVADPVVEPDTNKVGDIVIPRSLTIPPTPTTNVQFQ
FT                   GNLNANAPEGANVTFTVSNVIDSLGVTHSMLINAVKSASPNTWDVTVSMESASPVQYVV
FT                   TFDSDGRISDVKKDGQSYGTTPTIDFDPGNGAQTRQITLNFSAITQYAADSRVVGLVDG
FT                   NVNGKLLSWFVTDEGKVMGEFDNGQIRELAQIALANFQNPAGLSREGNNLWQNTANSGF
FT                   RGYVEAGDLGSLIIRGALESSNVDLAEEFTNLIITQRGFQASTRVITTSDEVTQDIIGL
FT                   KR"
FT   gene            307499..307693
FT                   /gene="flbD"
FT                   /locus_tag="COPRO5265_0325"
FT   CDS_pept        307499..307693
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flbD"
FT                   /locus_tag="COPRO5265_0325"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17318"
FT                   /db_xref="InterPro:IPR009384"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y7E5"
FT                   /protein_id="ACI17318.1"
FT                   /translation="MIKLTSPKDEEFYLNEDLIEKAEERGDFTVLFLVNGHKYLCKESV
FT                   SEIIKRIVRFKNMVKDQWT"
FT   gene            307684..308481
FT                   /locus_tag="COPRO5265_0326"
FT   CDS_pept        307684..308481
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0326"
FT                   /product="chemotaxis protein PomA"
FT                   /note="identified by match to protein family HMM PF01618"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17625"
FT                   /db_xref="GOA:B5Y7E6"
FT                   /db_xref="InterPro:IPR000540"
FT                   /db_xref="InterPro:IPR002898"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y7E6"
FT                   /protein_id="ACI17625.1"
FT                   /translation="MDIGVLGGLAITFGLIVLSVIADLNSFIDFNSMLVTIGGSFGSTL
FT                   VAVGFDRMKNLPKYVMAAFKKKTFDKAGTIKLLVDLSNKARREGLLALEDSLEELEDPF
FT                   VKRGLQLVIDGVEPESVQNILNLDIEAMQNRHADGKMIFDVWAGFAPSFGMLGTIMGLV
FT                   QMLKRLDDPSTIGPAMALALITTFYGAVLAYGVFQPMSNTLQRKSDMESDFREMIVEGI
FT                   LGIQSGENPRLLEERLVSFLSPAEREQYERTRAQKTEEVAEVA"
FT   gene            308474..309187
FT                   /locus_tag="COPRO5265_0327"
FT   CDS_pept        308474..309187
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0327"
FT                   /product="OmpA family protein"
FT                   /note="identified by match to protein family HMM PF00691"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17517"
FT                   /db_xref="GOA:B5Y7E7"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR025713"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y7E7"
FT                   /protein_id="ACI17517.1"
FT                   /translation="MPKRKESSGPGAPLWCLSYGDLVTNMLVFFVMLFAFSTLNATKFE
FT                   QMAYSFVVALGGGMGVLPSNPTFSPPMPIPPDFIMQGPMTVAELYSNLGGVEKSIQQQY
FT                   GSEAIEVIEGVNEVRVRISGDLLFMPCSASIRPETSQILSALAPELVKAQKEGYRVYIE
FT                   GHAAYTLSTCPGYIDDFHISSDRALNVLERFKSLGLDDSKMALVGYGDNVPVGDVNTPQ
FT                   GQAKNRRVEITIRRD"
FT   gene            309187..309633
FT                   /gene="fliL"
FT                   /locus_tag="COPRO5265_0328"
FT   CDS_pept        309187..309633
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliL"
FT                   /locus_tag="COPRO5265_0328"
FT                   /product="flagellar basal body-associated protein FliL"
FT                   /note="identified by match to protein family HMM PF03748"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17800"
FT                   /db_xref="GOA:B5Y7E8"
FT                   /db_xref="InterPro:IPR005503"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y7E8"
FT                   /protein_id="ACI17800.1"
FT                   /translation="MKKILVYLLVVILLLGAGMALGVYVLAPVVKDMGSNTAAQSKPEP
FT                   VLQPLGKFTTNLSNPKYIIQVTVNLEFYDKKALSEIQKMDPSFLVIQDELLKYFKTLKP
FT                   EDFSTDKGLSQIQDNFVKRINNLYGKTVLSDVLFGADTVITVMP"
FT   gene            309633..310613
FT                   /gene="fliM"
FT                   /locus_tag="COPRO5265_0329"
FT   CDS_pept        309633..310613
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliM"
FT                   /locus_tag="COPRO5265_0329"
FT                   /product="flagellar motor switch protein FliM"
FT                   /note="identified by match to protein family HMM PF01052;
FT                   match to protein family HMM PF02154; match to protein
FT                   family HMM TIGR01397"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ACI16774"
FT                   /db_xref="GOA:B5Y7E9"
FT                   /db_xref="InterPro:IPR001543"
FT                   /db_xref="InterPro:IPR001689"
FT                   /db_xref="InterPro:IPR028976"
FT                   /db_xref="InterPro:IPR036429"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y7E9"
FT                   /protein_id="ACI16774.1"
FT                   /translation="MAETLSQEEIDTLLSAIKAGQAELVQTKEKVVRKYDFRRPDKLSK
FT                   EQLRTIQMLHENFARGASTELAGYLRSAMSISIVSVDQVTYQEYIRSLSDPTFMYLVPI
FT                   IDVTSVIFEMSLDFVFAIIDKLLGGPGKPLREVRELTSVEATLMNRVMDVYLKHWLEAW
FT                   KPIVQWNLGKPTLEYSPGFVQIMPGSDVVIVITYEEKLGEKTAIGTICVPYMAMEGFVQ
FT                   NLTAHRWFGVSKPTPDDWKTTLMEVIEDITVEVSAVLGEASVGIGEILKWNVGDVIELS
FT                   RRSDEEVDLLVEGNLFAKGIPGIYQRRKALLVTGRSEEDRKEEVG"
FT   gene            310620..311483
FT                   /locus_tag="COPRO5265_0330"
FT   CDS_pept        310620..311483
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0330"
FT                   /product="flagellar motor switch phosphatase FliY
FT                   (CheY-Pphosphatase fliY) (Flagellar motor switch protein
FT                   fliY)"
FT                   /EC_number="3.-.-.-"
FT                   /note="identified by match to protein family HMM PF01052;
FT                   match to protein family HMM TIGR02480"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17971"
FT                   /db_xref="GOA:B5Y7F0"
FT                   /db_xref="InterPro:IPR001172"
FT                   /db_xref="InterPro:IPR001543"
FT                   /db_xref="InterPro:IPR012826"
FT                   /db_xref="InterPro:IPR028976"
FT                   /db_xref="InterPro:IPR036429"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y7F0"
FT                   /protein_id="ACI17971.1"
FT                   /translation="MSDFIGSLKRLLSEITNGAVKLGNFYKTENLPSEQGEFVIVDFAL
FT                   GDFGDGFIVLSEDLAKTLGNEMLRIFQLTVDNLNDDLVLSTIGEAINQSVNGAVQENAE
FT                   QFGMIPSVSVGAAQVVTAEALKEKVSGLSFIEVEGGLWFCVPNKLSSILLMGYSDVSER
FT                   ADAVSSEVEKTSASVMQENDVEDVTFPQLRPEGDIQPLPRNLELLLDVKVNVSVELGRS
FT                   RVSIKDLLSLGSGSIITLDKLAGEPVDILVNGKPIAKGEVVVIDESFGVRILDIIAPKE
FT                   RLKAEL"
FT   gene            311500..311868
FT                   /locus_tag="COPRO5265_0331"
FT   CDS_pept        311500..311868
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0331"
FT                   /product="putative chemotaxis protein CheY"
FT                   /note="identified by match to protein family HMM PF00072"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ACI16989"
FT                   /db_xref="GOA:B5Y7F1"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y7F1"
FT                   /protein_id="ACI16989.1"
FT                   /translation="MSKRVLIVDDAAFMRMMIKNVLTQNGYEVAGEASNGQEALVLYEK
FT                   VKPDLVTLDITMPEMDGIQTLKELLKMDPSANVIMVTAMGQQQLVIEAIQVGAKDFVVK
FT                   PFQPDRLIEAVRKALGDE"
FT   gene            311861..312199
FT                   /locus_tag="COPRO5265_0332"
FT   CDS_pept        311861..312199
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0332"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18135"
FT                   /db_xref="GOA:B5Y7F2"
FT                   /db_xref="InterPro:IPR022781"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y7F2"
FT                   /protein_id="ACI18135.1"
FT                   /translation="MSSFWQWFFLLLFFVVLIGVLWFLSRYGRRWLGNFRVPAQGKQLK
FT                   VLDAVSLDFRTRVFLVLVADKQKVLVADNGNHIRIVLLPSDEKDAGTDWQSSTFEKILK
FT                   DADGNTTN"
FT   gene            312174..312830
FT                   /locus_tag="COPRO5265_0333"
FT   CDS_pept        312174..312830
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0333"
FT                   /product="flagellar biosynthetic protein FliP"
FT                   /note="identified by match to protein family HMM PF00813"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17325"
FT                   /db_xref="GOA:B5Y7F3"
FT                   /db_xref="InterPro:IPR005837"
FT                   /db_xref="InterPro:IPR005838"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y7F3"
FT                   /protein_id="ACI17325.1"
FT                   /translation="MQTATPLISINLGSGGLSMVQLIVLLTVFTLAPSFIMFFTSFLRI
FT                   LVVFAFMRSALGLQQFPPAQVFTALALILTFLIMGPVFSQVYQQAWVPYSQGQMDFQQF
FT                   LSAAEKPVGDWMLKQVKPEELNTMASISGTDPKNPNFTTLASAFMVSELKTAFTMGLLL
FT                   YLPFIALDVIIASVLMSLGMFMIPPAMISLPLKILLFVAANGWDTVIMGLVRSFR"
FT   gene            312827..313090
FT                   /locus_tag="COPRO5265_0334"
FT   CDS_pept        312827..313090
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0334"
FT                   /product="flagellar biosynthetic protein FliQ"
FT                   /note="identified by match to protein family HMM PF01313"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17495"
FT                   /db_xref="GOA:B5Y7F4"
FT                   /db_xref="InterPro:IPR002191"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y7F4"
FT                   /protein_id="ACI17495.1"
FT                   /translation="MTDFIFSWFRSSVLQILIIVGPVLLVALVLGIIISILQVLTQIHD
FT                   PSVAFVPKFLVIMLLVLFFGGTVVNVMVRFFNGVVSAWQTLP"
FT   gene            313072..313818
FT                   /locus_tag="COPRO5265_0335"
FT   CDS_pept        313072..313818
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0335"
FT                   /product="bacterial export protein, family 1"
FT                   /note="identified by match to protein family HMM PF01311"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18179"
FT                   /db_xref="GOA:B5Y7F5"
FT                   /db_xref="InterPro:IPR002010"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y7F5"
FT                   /protein_id="ACI18179.1"
FT                   /translation="MADATLGFWPVFFRLLGFVLATPILPTRFFNLRTKAVLSFAISLI
FT                   SVPDFVAVLSLQTSVSWVQIYITEFALGLLLGIFSGIVYWALVFAGDLWDIMSGFQMMT
FT                   AIDPFTSVPQPVMTQFFSLMAAAVFVVGGGLDSFIALVIMSYRLIPAGSFIHLALSEPA
FT                   LFLTRVFSLGLAVAIPIVVLVILLEFIMGVVSKGASGFPVFVVWIPLQTAVALLLLFAM
FT                   LPLMKVFTQNWTRWAVQYLTSLLSAG"
FT   gene            313825..314856
FT                   /locus_tag="COPRO5265_0336"
FT   CDS_pept        313825..314856
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0336"
FT                   /product="flagellar biosynthetic protein FlhB"
FT                   /note="identified by match to protein family HMM PF01312"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17774"
FT                   /db_xref="GOA:B5Y7F6"
FT                   /db_xref="InterPro:IPR006135"
FT                   /db_xref="InterPro:IPR029025"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y7F6"
FT                   /protein_id="ACI17774.1"
FT                   /translation="MPEGERTEPPSPRRLERAIQEGNVPQSPELTGAIGLFVFVLILRV
FT                   YYPRFVSSWQRMWFGVFYSVSPETAAHDLAVVLLSTLPVLLVPLLAVVLATLVLSGVRL
FT                   YPKKMVPKLDGLNPAQNIKRIFSLQSLEQMGIGLLKVILLSVVAYFLAKDRLVGIMSGT
FT                   QDPIQFMSLSASILTDILLYLVAVYLLIGLADYAFQRRRWWNSLKMTKEEVKEEMKSIE
FT                   GDPTVKARLRSRMRQYAMRRSLADVKKATVVITNPTEYAVALRYEKGMVAPELVAKGAG
FT                   WLAQRIKDEARRYNVPVVVRPELARTIFRKVEVGDYITPDLYQAVAAVLVEVMKKKRQS
FT                   SKS"
FT   gene            314853..316868
FT                   /locus_tag="COPRO5265_0337"
FT   CDS_pept        314853..316868
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0337"
FT                   /product="flagellar biosynthesis protein FlhA"
FT                   /note="identified by match to protein family HMM PF00771"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17128"
FT                   /db_xref="GOA:B5Y7F7"
FT                   /db_xref="InterPro:IPR001712"
FT                   /db_xref="InterPro:IPR042193"
FT                   /db_xref="InterPro:IPR042194"
FT                   /db_xref="InterPro:IPR042196"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y7F7"
FT                   /protein_id="ACI17128.1"
FT                   /translation="MSGLYTTLFVIVGIFMLMVPVPSMVLDVLFAFNLVFSLLVLMISL
FT                   YTRSATEFSSFPSLMLFAVFFHLVLIVSSARAILVTGNPGALATAFGKLIMGQGNWVVG
FT                   LVIFVVLLIVQYMVITSGQQRISEVAARFTLDAMPGRQMAIDADLSAGFITPEEARRQR
FT                   DSLRKESDFFGAMDGASRFVRGETMASALAAVVNALGGMVVGLLKGEAAVDALLHYLGV
FT                   AIGVALQIAISSLALSLSAALLVARVSSEQSLGEEITSELMAFPGLVRILGIVLLVTSL
FT                   LPGVPKLLLIPLGVLLIWFGRTPKPAAETALPEQVEAKRLYEQLSEPEAMLGFVGVDAV
FT                   ELEFGYELLPLFDTTSGQDILDSIALLRKNLSEEFGFPIPGIRIHDNLGLKPNQYRIKL
FT                   RGVTAGEGILEMGLLLAMGEGSDLEKVSGVPTKEPVFNLDAKWIPPSDKLKAEAAGLTV
FT                   VDCGTIVITHLGEVLKSSLADLITRQNIKDIVDYVGRSHPAVVEELQQVASLGDVEFVF
FT                   RYLLQERLPVRDVVRVFELITDSLRASRDLREAGELARKACVPYLLETLAEEEGTIKVI
FT                   TLKPDMERALIESYQPGSEIGFALSGENLRKIIDEIKKAWEMSHSYAENAVLVVHPRIR
FT                   RALWELLSRQGLKELTVLSYNEIMDAKYVVVGSVGA"
FT   gene            316868..317863
FT                   /gene="flhF"
FT                   /locus_tag="COPRO5265_0338"
FT   CDS_pept        316868..317863
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flhF"
FT                   /locus_tag="COPRO5265_0338"
FT                   /product="flagellar GTP-binding protein"
FT                   /note="identified by match to protein family HMM PF00448;
FT                   match to protein family HMM TIGR03499"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17952"
FT                   /db_xref="GOA:B5Y7F8"
FT                   /db_xref="InterPro:IPR000897"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR020006"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y7F8"
FT                   /protein_id="ACI17952.1"
FT                   /translation="MEVIKVKDTDIQSALDMVKRQYGSDAMILEIRKKRKYVFGPTYYE
FT                   LLIGIEQSSAKGNLDNLEALEKAIKRLDAAVSALAVKEDELDALSRQTGFSKELLVKAR
FT                   AVPTEDWKNTLRQYLSNKLEFVRLESIKFQTFPKVVVLLGPTGVGKTTTAAKLAGYLLL
FT                   ERNVSSGFVTIDTFRAGAVEQTKLFGKAMNLPVEVVRRPHQMQKVLAKLPDAHYVFVDT
FT                   IGRNPKEIGKLTEIKMYLDELEEWIPVLCLNAGLRKEEMQKAFEYFNKVFHIEYFILTK
FT                   VDEAENISSAVEFMAENGLKTLALTNGQNVPDDLLFPDIENVLGMVGLSL"
FT   gene            317896..318714
FT                   /locus_tag="COPRO5265_0339"
FT   CDS_pept        317896..318714
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0339"
FT                   /product="flagellar biosynthesis protein FlhG"
FT                   /note="identified by match to protein family HMM PF01656"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17301"
FT                   /db_xref="GOA:B5Y7F9"
FT                   /db_xref="InterPro:IPR025501"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y7F9"
FT                   /protein_id="ACI17301.1"
FT                   /translation="MRKTRVIAVSSGKGGVGKTLVALGLSMVLANMKKDVLLVDADLGT
FT                   ANVNVALGIPVEYNLWDVVKGRTDVDNAIMSVEEHLDLLPGVSGVYEATFWRMRDTEKL
FT                   WRELDGVLTRYDYAIIDTGSGIGNTVVQFCIAADEVVVVFTPEATSITDAYALIKTLHK
FT                   EGYDGNIYALENMVRKVQSDLVLAVSLKSMAQRFLNREIEILGTIPFDPQISKQVRYQE
FT                   LGKYLHQSDEFMFYMGTVVKNLLKSGEDLGSYKPSFWSKLKNRLSKMMGT"
FT   gene            318725..319774
FT                   /locus_tag="COPRO5265_0340"
FT   CDS_pept        318725..319774
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0340"
FT                   /product="chemotaxis response regulator protein-glutamate
FT                   methylesterase"
FT                   /EC_number="3.1.1.61"
FT                   /note="identified by match to protein family HMM PF00072;
FT                   match to protein family HMM PF01339"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17561"
FT                   /db_xref="GOA:B5Y7G0"
FT                   /db_xref="InterPro:IPR000673"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR008248"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR035909"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y7G0"
FT                   /protein_id="ACI17561.1"
FT                   /translation="MRSTGRILVVEDSTFVSKVVCDILQKNLNVVCDTASSVKEALVKI
FT                   RLYPYDVILLDYVLPDGTGIDILRKGRDSLKGYVILFSSLAQEGADITVQALSEGAVDF
FT                   ILKPGWGGMLADDFSRELVAKIEVLLSKKPVESTEKVLKQVNTAELKTGIKLVNCPGKA
FT                   EGIVVVASSTGGPQALRKFLGKFERVNVPVVIAQHMPPFFTKSLAEQLCKTTKLDVMEA
FT                   TSTVELEPNRVYVITGGKHGVVSGGVLEIIDGPAVNGVKPAADLLFASAAEAYGTQTLG
FT                   VVLTGMGKDGLEGSKFIKQLGGKVIAESQESAVVWGMPGEVVKCGLADAIDHLEVLPYR
FT                   VEEIIKWWK"
FT   gene            319762..320526
FT                   /gene="cheR"
FT                   /locus_tag="COPRO5265_0342"
FT   CDS_pept        319762..320526
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cheR"
FT                   /locus_tag="COPRO5265_0342"
FT                   /product="CheR methyltransferase, SAM binding domain"
FT                   /EC_number="2.1.1.80"
FT                   /note="identified by match to protein family HMM PF01739"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17358"
FT                   /db_xref="GOA:B5Y7G1"
FT                   /db_xref="InterPro:IPR000780"
FT                   /db_xref="InterPro:IPR022641"
FT                   /db_xref="InterPro:IPR022642"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y7G1"
FT                   /protein_id="ACI17358.1"
FT                   /translation="MVEVNLEPLIALLRKHRDLDLSGYSKSTLGRRITYFMGLNKISSI
FT                   DELGRRLAEDDLLFQEFLDKLTINVTEFFRDPPFWEKLTELLKSLPSNRIKSWSAGCSI
FT                   GCEPYSLAMVFLEHKVFHEPIWATDFDKGALERAKAGVYTQNEIRNVPQRYMKYFTEED
FT                   GNYRVHPRIKALVRFEQHNLLQDDFPVSEMDLILCRNVVIYFGHDVHEYLWQKFAKALK
FT                   PGGILFVGASEIIFDPGKYGLSLISHGFYRRR"
FT   gene            complement(320498..322294)
FT                   /locus_tag="COPRO5265_0341"
FT   CDS_pept        complement(320498..322294)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0341"
FT                   /product="cell division protein FtsA, putative"
FT                   /note="identified by match to protein family HMM PF02491"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ACI16922"
FT                   /db_xref="GOA:B5Y7G2"
FT                   /db_xref="InterPro:IPR003494"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y7G2"
FT                   /protein_id="ACI16922.1"
FT                   /translation="MKRLCLDMGTHKFAAMEVDDTGNIVKYAMQKHKFSLLKNGQIENV
FT                   PMAAKELREFLAENDFDMTLPVVTAVAGKSMIVKTVEGRRRITSDFVQQEDVDDLLAEI
FT                   TEKASLEGYLLSDFDVAKWTLDDMIVENPIGRHGHSLEVTLVMQFFRKDTVLSLIKTLQ
FT                   EAGLKVTSIFSEAVASKEAAVRKELRYFNIALVDAGAGTSDITIFKEGKVCNFASIPMA
FT                   GQYITEHLAQRFMVPLETAEKMKIKPGLKRSVENIVGKRIQVDQNLILTCIQDAASVLA
FT                   SALAAKILEANNGKAPSAVALVGGAALTPKLDEFLAQALEIPNEMVHVAKLSAKGELSK
FT                   PAWAVALGLAMLEPRHNVIHAVVEDKLAFFLTNEHPTVNSALLRAGTDVNRMQQRDVST
FT                   ISIKVGSELQEFAVYEENEIEPYVNGTPASWGTFLTDGDVVRFQLGGRKLKLDLYVIVE
FT                   GEIRQKLPLSLVDEEGHIVTAPEKEKVYRLFPSTKEELEDLLSRKEHRLVRLRGPSLVQ
FT                   PGSLYKKIDYTFVTVTINGGPSLQVPVDEKETVADLLAFLLDKGLIQSKALFITDGHRE
FT                   IGYSEPIAQFLQIIIVYDKIRG"
FT   gene            complement(322291..323850)
FT                   /locus_tag="COPRO5265_0343"
FT   CDS_pept        complement(322291..323850)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0343"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF03961"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18215"
FT                   /db_xref="InterPro:IPR005646"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y7G3"
FT                   /protein_id="ACI18215.1"
FT                   /translation="MIKKDGVAVRCGEQGIELCMEESGMSPTKVLSTLMEMRINVEKPE
FT                   VIVDAIKNPGSWVVITKEPTIPDVMIEITDDEMEAYATYLPGFCSFQLSEEEILKLLKD
FT                   KSLELISDDVAKMLLHAPLERILVAKGVPPVDGEDASLEWVYQKPVNPVAEDAQYVDFK
FT                   EIISKWDYVTAGTVLVEKNPPQRGTPGKTVKGRIIAAKDGRDIDLRKMAGKNTLVTEDG
FT                   LKIIAKIDGVVVKEGTRVSIISQLIVSGDVDYHTGNIEDFVDAVQIMGTVREGFKVKAK
FT                   TSIQVHGVVEGAQLEAGQNIKIDGVVAGNDKAVLVAGNAVMARQITKARVQAPIVIAES
FT                   GVLFSHVECTDLYLTHSKARIAGSTVLAERFIVAPNVGNDLAERVVLQITAPKSLNQEY
FT                   EYVARVLSEKRKEYNEIQELAKKSPTMLKLYEEKMAMTATEIETLDERIKELLTRIQDS
FT                   LKKARIFVREIVYPNVEIRFGSSVYLVRNELSFVTFVFEDGQVKFYPFSSPPPIPRVII
FT                   SR"
FT   gene            complement(323864..324694)
FT                   /locus_tag="COPRO5265_0344"
FT   CDS_pept        complement(323864..324694)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0344"
FT                   /product="small conductance mechanosensitive ion channel"
FT                   /note="identified by match to protein family HMM PF00924"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17032"
FT                   /db_xref="GOA:B5Y7G4"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR011014"
FT                   /db_xref="InterPro:IPR023408"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y7G4"
FT                   /protein_id="ACI17032.1"
FT                   /translation="MFGELNLSEEMLKLLNQIAVKGAYIFVAIAFFIVIQRITASLINS
FT                   SKQKLEGRPGISGISVSFWLSFLYYVIVIVAFLGALRIAGISYTSILAGVSITGLIVGL
FT                   ATQNILSNLFAGMMILAQKPFDIGDSVTVGNYTGTVKAINVLTTTIETLERLEITMPNK
FT                   MLVDGAIVNNTKSPTRMWNFSFYVDCWEKYPDIKAHIVNLLKADKRVLEDPIVFGELTE
FT                   KGIRITVRAVAETSQLLTMSRETQDHIIDLLSELGCKPLGVTEITIQGGKSRSE"
FT   gene            324794..325543
FT                   /locus_tag="COPRO5265_0345"
FT   CDS_pept        324794..325543
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0345"
FT                   /product="zinc (Zn2+) ABC uptake transporter substrate
FT                   binding protein, putative"
FT                   /note="identified by match to protein family HMM PF01297"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17655"
FT                   /db_xref="GOA:B5Y7G5"
FT                   /db_xref="InterPro:IPR006127"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y7G5"
FT                   /protein_id="ACI17655.1"
FT                   /translation="MSCTRRESVSQVAVLGSPAYAVTSEIAAEGEIVNATPLGSDPHYM
FT                   EFTSSVARVLEQSKAVIALGASADRKMVSELSKPKLFLLPEGLEDPHVWLSPKRVLAWV
FT                   PQIQSFLDEQFPNTKNVHAQNAEKFMAALQELDANFEKLRGYCFVTQHPAFTYVEQDYG
FT                   WRVLGTLEVGEAEISPKQLTALMEALKSEQNCLLLLNPYEPSKTAEMLSEQLGLPSVDF
FT                   DILEVATRSYSSIMAENIDGVLHALRQ"
FT   gene            325549..326229
FT                   /gene="zurA"
FT                   /locus_tag="COPRO5265_0346"
FT   CDS_pept        325549..326229
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="zurA"
FT                   /locus_tag="COPRO5265_0346"
FT                   /product="zinc ABC transporter, ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17730"
FT                   /db_xref="GOA:B5Y7G6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y7G6"
FT                   /protein_id="ACI17730.1"
FT                   /translation="MFDDSIILSVENLSVGYEKPLVSNLRFFVREGDCLGIVGPNGAGK
FT                   STLVRTLLGLIPPLSGSVSFLGEKMEEVKPEKRIRLGYVPQRTTVDLSFPVNLRDVIYV
FT                   SLVNKLRLNMLSSSTLDDVIRSVLNRFGFDDPNTPLRKLSGGQLQRLLIARAFVNEPIL
FT                   TIMDEPTSNLDPAFTERFYEILAQEKEKGNAFILVSHDVEGISRIVNKCLTISFEGWEL
FT                   KDHA"
FT   gene            326222..327007
FT                   /locus_tag="COPRO5265_0347"
FT   CDS_pept        326222..327007
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0347"
FT                   /product="ABC-type Mn2+/Zn2+ transport system, permease
FT                   component, putative"
FT                   /note="identified by match to protein family HMM PF00950"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17086"
FT                   /db_xref="GOA:B5Y7G7"
FT                   /db_xref="InterPro:IPR001626"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y7G7"
FT                   /protein_id="ACI17086.1"
FT                   /translation="MLSFDFVQRALLEIMLLSVGLGLLTILVNLRDLGVLGTGIGHAAF
FT                   TGGVIGILLGAPWLWTILTGMLVALLSQRIEGKRVSSANSVIVAFTFILAFGLILSYFV
FT                   PGQVSTVMGLLFGSMLGVDSFDIMLTSVATLLLVVFFVRHYWEILSTTFDEEYSSVVGM
FT                   PVKMLKIVISVLLAFYITVTIRAVGTLMMEALLVIPGAVALQLTDSYHTSWKISMVLIA
FT                   VSGVASLILAFYWNLPVSPLMVVILSLSFLVARFVFPQK"
FT   gene            327112..327825
FT                   /locus_tag="COPRO5265_0348"
FT   CDS_pept        327112..327825
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0348"
FT                   /product="ATP-binding transport protein NatA (Na(+) ABC
FT                   transporter)"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17287"
FT                   /db_xref="GOA:B5Y7G8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y7G8"
FT                   /protein_id="ACI17287.1"
FT                   /translation="MIEVRELRKSFGQVQALKGISFHCEPGKVTGLLGPNGAGKTTTIR
FT                   ILSTILKPLSGTATVNGFDVVRESDKVRASLGVVLENTGLYRRLSGDENVLYFADLADV
FT                   PRGEALERMQFLYKLLEIDYGKRQAGTYSKGMAQKINLVRSVIHDPPVLILDEPTAGLD
FT                   VPSTVAVRTFVEQQKEAGKTVLLSTHLMNEVELLCDYVYIINLGLIVAEGTPEELKKRT
FT                   QSSNLEEAFMKVVKE"
FT   gene            327822..329000
FT                   /locus_tag="COPRO5265_0349"
FT   CDS_pept        327822..329000
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0349"
FT                   /product="putative ABC-type Na+ efflux pump, permease
FT                   component"
FT                   /note="identified by match to protein family HMM PF01061"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18128"
FT                   /db_xref="GOA:B5Y7G9"
FT                   /db_xref="InterPro:IPR032688"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y7G9"
FT                   /protein_id="ACI18128.1"
FT                   /translation="MKSIFAVMKKEIKEAFRDRRTLIMSVLLPAVLVPAIVLGIFYFEG
FT                   RTVEKQNADGFTVAFQGSQELRSFLSQAKLEVIEVQDVEKAVLEKEADVGLIEEYTSSQ
FT                   SKVVVVTSYASGTSGDSAASYLNSILPLYREQRIKDYLSQKGINEDVFSLVVVQSKQVG
FT                   EPMAFAKFFLAYLVSLVMLTSGFVGNVYLGTDIGAGEKERGTLESLLATPVSRFSIAMG
FT                   KWLALSALNCMGTLISLLSFTFSYSYAMTHFDMGLGLATGGSALAIWGAGIWAMIIGAV
FT                   LLSLTGGALQFIISMYSRNMREAQLYLGQMGMVILPFIFILMPAFTNASTMPAWVFFVP
FT                   IVNASAVTYNVIIGSVVWPLVGAALLIDVAVAVLLAFVISKFMNRESVILRM"
FT   gene            329018..329173
FT                   /locus_tag="COPRO5265_1601"
FT   ncRNA           329018..329173
FT                   /locus_tag="COPRO5265_1601"
FT                   /product="6S / SsrS RNA"
FT                   /ncRNA_class="other"
FT   gene            329191..329556
FT                   /locus_tag="COPRO5265_0351"
FT   CDS_pept        329191..329556
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0351"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18169"
FT                   /db_xref="GOA:B5Y7H0"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y7H0"
FT                   /protein_id="ACI18169.1"
FT                   /translation="MLTNWQVFFIAFPLWVFAVTLIVFLFLILQALRKYGDEIKKSLED
FT                   LQVDIKQITSSAATEVPEILRNASETSEEVKQITSNLKQFSAVLPYVVRPNWTTIALKV
FT                   LPSVLSFLHIGKGKKVK"
FT   gene            329576..329791
FT                   /locus_tag="COPRO5265_0352"
FT   CDS_pept        329576..329791
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0352"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17516"
FT                   /db_xref="GOA:B5Y7H1"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y7H1"
FT                   /protein_id="ACI17516.1"
FT                   /translation="MLLGRLMARGDQTVEKRSCSCWGPFFAGLLLGAIIQGALTLLARC
FT                   KMENECLWCEEDEECEECQEHEEEKE"
FT   gene            329841..330119
FT                   /locus_tag="COPRO5265_0353"
FT   CDS_pept        329841..330119
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0353"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17565"
FT                   /db_xref="GOA:B5Y7H2"
FT                   /db_xref="InterPro:IPR024623"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y7H2"
FT                   /protein_id="ACI17565.1"
FT                   /translation="MDDIRDTLRVAGLFAAGVLIGTVCGLLLAPMSGAEMRGVVKEKAL
FT                   SLKEKTLEKAEQLKEKAQELTKKAEDMISEQVVEIEEELAEEEGKED"
FT   gene            complement(330201..331301)
FT                   /locus_tag="COPRO5265_0354"
FT   CDS_pept        complement(330201..331301)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0354"
FT                   /product="chaperone protein DnaJ"
FT                   /note="identified by match to protein family HMM PF00226;
FT                   match to protein family HMM PF00684; match to protein
FT                   family HMM PF01556"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17011"
FT                   /db_xref="GOA:B5Y7H3"
FT                   /db_xref="InterPro:IPR001305"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR002939"
FT                   /db_xref="InterPro:IPR008971"
FT                   /db_xref="InterPro:IPR012724"
FT                   /db_xref="InterPro:IPR036410"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y7H3"
FT                   /protein_id="ACI17011.1"
FT                   /translation="MKDYYEILGVPEDASVDEIKKKYRELVKQYHPDLNKGDEEAAKRM
FT                   AEINEAYQVLTDPKKRAEYDAMRKGGVGFSSEYYRPGQGFDFFDSIFRDFFTDFPFGSS
FT                   FFNRTATKTKPRGTDINLEVTLSLKDVVTGCTKSLRFFRDELCEECHGTGAKDGKTKTC
FT                   ERCHGTGVVENRQSTPFGVFITQTTCPTCHGAGSVPEQVCPVCHGTGVVKRQRTLDLQI
FT                   PPGIENNDVITLKGQGNAVKDGASGDINVTVKIIIPPPWRRKGKDLYTEVHVPYYHAIL
FT                   GGKIKVTTATGEEKELLLEPGTQPDQEYILANEGVPDKSGRYRGDLHVTIKVDLPSKLS
FT                   PQERKFLEEIRKLHEGDNKKRFGLFN"
FT   gene            complement(331301..333121)
FT                   /gene="dnaK"
FT                   /locus_tag="COPRO5265_0355"
FT   CDS_pept        complement(331301..333121)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaK"
FT                   /locus_tag="COPRO5265_0355"
FT                   /product="chaperone protein DnaK"
FT                   /note="identified by match to protein family HMM PF00012;
FT                   match to protein family HMM TIGR02350"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17897"
FT                   /db_xref="GOA:B5Y7H4"
FT                   /db_xref="InterPro:IPR012725"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR018181"
FT                   /db_xref="InterPro:IPR029047"
FT                   /db_xref="InterPro:IPR029048"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y7H4"
FT                   /protein_id="ACI17897.1"
FT                   /translation="MAKIIGIDLGTSNSCAAVMLGGKPTIIPSAEGTTMYGKTVPSVVA
FT                   FTKDGQILVGEPARRQAAMNPEGTITGIKRKMGTRETIQVFGKTYTPEQISAFILQKIK
FT                   KDAEAFLGEPVSKAVITVPAYFNDAQRQATKDAGAIAGLEVVRLINEPTAAAFAYGLDK
FT                   ANQELKIMVFDFGGGTLDVTIMDFGHGVFQVVSTSGDTQLGGRDMDKVLMDYVLEEFQR
FT                   ESGIDLRNDRMAMIRVNEAVEKAKIELSSVLETDISLPFIAMKDGQPVHLQMKVTRAKL
FT                   EQLVRPIVEKTAGPIEQALKDAQLTPNDIDKIILIGGPTRMPIVRDFVEQFMGKPVERG
FT                   IDPMEAVAMGAAIQAGIIEGTVNDIVLVDVTPLSLGVETVGGIMTTLIPRNTPIPVTKS
FT                   EIFTTATDFQTSVQIHVLQGERPLAKDNLSLGQFILDGIPPAPRGVPQIEVTFSIDANG
FT                   ILSVTAKDKATGKSQQITITNSTRLTEEEIERMRKEAEMYADEDRRRKEEIETRNQADT
FT                   YVYQARKLLKENEGKLPDDIVKEITEKVDNLEKALRDNQPAEQLKQLMEDVITAMGKAG
FT                   AYLYQSGGGQQPGGDGSDNTTDQGPQGEVH"
FT   gene            complement(333414..334580)
FT                   /locus_tag="COPRO5265_0356"
FT   CDS_pept        complement(333414..334580)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0356"
FT                   /product="dihydroorotase"
FT                   /EC_number="3.5.2.3"
FT                   /note="identified by match to protein family HMM PF01979;
FT                   match to protein family HMM PF07969"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17253"
FT                   /db_xref="GOA:B5Y7H5"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y7H5"
FT                   /protein_id="ACI17253.1"
FT                   /translation="MKVLITNVQVYTVSHGVIDKGSVLVEDGKISQVSAGDIQVEGANV
FT                   VDGKGLTLMPGFIDAHTHVGISEEGFGWEGADYNEWVDPVTPYLRAIDGINPMEQGVKD
FT                   ALEGGITTICAAPGSANVIGGTACVFKPFGKAIDKMVIKDPVALKAATGENPKRVYRDM
FT                   KKSPVTRMATASLMRQALLKAKSYMEKKEKYANEPEKQPDFDLGMEHLCMVLRKEIPMK
FT                   IHAHRADDILTAIRIAREFDINITIDHCTEGHLVPEEIAESKFPCIVGPNLTNRSKVEL
FT                   MNKSFETPAVLHKHGVLFAIMTDHPVIPIQFLPLTVGLAVKYGLPYDEGIKAITINAAK
FT                   ILGLDERLGSIESGKDADLVLWEGDPLSVDGKPMFVMVNGQIAVNKLQ"
FT   gene            complement(334648..335838)
FT                   /locus_tag="COPRO5265_0357"
FT   CDS_pept        complement(334648..335838)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0357"
FT                   /product="membrane protein, putative"
FT                   /note="identified by match to protein family HMM PF04165"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18078"
FT                   /db_xref="GOA:B5Y7H6"
FT                   /db_xref="InterPro:IPR007294"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y7H6"
FT                   /protein_id="ACI18078.1"
FT                   /translation="MNLALWLLVIFVVIVLLLDKIDLYLLFLGATVFLGFIGGLSFADL
FT                   SKGFLESLFAQRTVAVLLTLYLMSLYEVFLRRSGALARLTHNFIKMLGDYRLTSVVMPA
FT                   IMGLLPSPGGARFSAPLVAETLENSVVSNQEKAFINFWFRHIWEPILPVYPGTLMAAML
FT                   MGITPGHLAQMNWYIPLLMIVVGWVLVFGFSLPSVRFQNPSWKEVILDLGPLLAVIVAG
FT                   VTIKNDFTVPIAILLACAFIYILHAKALPKMGTLLSEALKWKMLAIIPAVYYFANILES
FT                   TGANEAVASSLSALHLPTIVFFIALPFVVSMITGLTQAGVGTSLPLLIGLTTPANRVAM
FT                   LNLAFIFAFIGVMASPTHLCLILSRDYFEARAGALYNKLFMAVFVVGLFPVVLALF"
FT   gene            complement(335943..336311)
FT                   /locus_tag="COPRO5265_0358"
FT   CDS_pept        complement(335943..336311)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0358"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17442"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y7H7"
FT                   /protein_id="ACI17442.1"
FT                   /translation="MRSFVQFEKELAAEFRDKLAKTETTIEVSDLFSQTAQKLLSKILP
FT                   DYSPKAGFQIKFDSTKPPYYIIPEEMKKDERIKELIEGSDFPAILERFATSCYNRKAHL
FT                   DEVDKTKTSKRPPGTPNP"
FT   gene            336400..337020
FT                   /locus_tag="COPRO5265_0359"
FT   CDS_pept        336400..337020
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0359"
FT                   /product="PAP2 superfamily protein"
FT                   /note="identified by match to protein family HMM PF01569"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17962"
FT                   /db_xref="GOA:B5Y7H8"
FT                   /db_xref="InterPro:IPR000326"
FT                   /db_xref="InterPro:IPR036938"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y7H8"
FT                   /protein_id="ACI17962.1"
FT                   /translation="MERAHHTSTLWQVISDFGNPMVWGTFLFVLLMWIKGLSLSHILLS
FT                   LAIFLLTVGVVSAITFNVARSRQFSDTRDLIEREIRSLPYFCTFLAYMVVAAIFNRQDW
FT                   SPKWLVFLTSTMGIGLGICGFINLFWKVSFHTFASSAMATMFFMVTSSWWSLVLLLLVS
FT                   LVIGWSRIRLGVHTPMQVLIGFLLGIFLPILCAMSYLGGFLWT"
FT   gene            337011..337526
FT                   /gene="def"
FT                   /locus_tag="COPRO5265_0360"
FT   CDS_pept        337011..337526
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="def"
FT                   /locus_tag="COPRO5265_0360"
FT                   /product="peptide deformylase"
FT                   /EC_number="3.5.1.88"
FT                   /note="identified by match to protein family HMM PF01327;
FT                   match to protein family HMM TIGR00079"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17260"
FT                   /db_xref="GOA:B5Y7H9"
FT                   /db_xref="InterPro:IPR023635"
FT                   /db_xref="InterPro:IPR036821"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y7H9"
FT                   /protein_id="ACI17260.1"
FT                   /translation="MDIRVIPDKMLRAKAQKVKSFTEEDRRIVEDMFRLMKENEVEGVG
FT                   LAAPQVGISKRFVVIDLDEFHEVLINPRWEPLGKEKEEDIEGCLSVPGVYGPVERFKKI
FT                   KVSFTNLYGEKITLKLDGMLSRVVQHEVDHLDGVLFIDKITDWDRIEVMPLALHYPGVV
FT                   ELLKEHDR"
FT   gene            337523..338437
FT                   /locus_tag="COPRO5265_0361"
FT   CDS_pept        337523..338437
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0361"
FT                   /product="methionyl-tRNA formyltransferase"
FT                   /EC_number="2.1.2.9"
FT                   /note="identified by match to protein family HMM PF00551;
FT                   match to protein family HMM PF02911"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17648"
FT                   /db_xref="GOA:B5Y7I0"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR005793"
FT                   /db_xref="InterPro:IPR005794"
FT                   /db_xref="InterPro:IPR011034"
FT                   /db_xref="InterPro:IPR036477"
FT                   /db_xref="InterPro:IPR041711"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5Y7I0"
FT                   /protein_id="ACI17648.1"
FT                   /translation="MKIAFFSSGTFGLPVLEELKKENHEIVLITKVDAPSGRGLKLQPS
FT                   PPAVVAEALQIPIVKVNSLKNDFIEWYFSQGFDVAIVVDFGFYIPKQLFQADKPVMVNI
FT                   HPSLLPKYRGPNPIRRAICSGELETGVTLIKISEKMDEGDIYLQERVLIDPDDDYVSLT
FT                   PKLQHVSMELLKKFFLELKQGNLRAFPQLGDPSYAPKFTPDELWIDWQKPAHDIQNQVR
FT                   ALADVGAKTTLGSKLVKIFKVRISGMEDSLPPGHYVAEKESLYVGTGQGSLEILSLQQE
FT                   GRKKQDAASFVKGLREKEGVFGG"
FT   gene            338430..339062
FT                   /locus_tag="COPRO5265_0362"
FT   CDS_pept        338430..339062
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0362"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17006"
FT                   /db_xref="GOA:B5Y7I1"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y7I1"
FT                   /protein_id="ACI17006.1"
FT                   /translation="MVNLLAILPGIVLFVYYAAVLLINSGVYNSWSREVVPLAERLSDV
FT                   FPRLLPWNSLVRFKVRPDIVFPYMDPQNDFVYFPERMLMYNNVWNLNLISRAVGEALQM
FT                   RSSFWHVYYKAKPVLRWIFLVGFFCSLFFGATKILYFFAVLGVLLDYTSYILSADALNR
FT                   SKLVLAQYSPEVADRIRLIPPSFIFESLGEPYRILRYVVFHLRWRNL"
FT   gene            339152..339685
FT                   /locus_tag="COPRO5265_0363"
FT   CDS_pept        339152..339685
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0363"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17497"
FT                   /db_xref="GOA:B5Y7I2"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y7I2"
FT                   /protein_id="ACI17497.1"
FT                   /translation="MTLINAPVQLFYLLTHPEVRKNHALEHATIHVLEELVPVKLSGVS
FT                   NPNGFIIQGVSDPYLVLQAAHEAKRRLLSGEKDLAVHPRCGTTTVVTGLVFAILFIVFS
FT                   IVFGLFSFVNLLLSLVLGAILGSVLSPWVQRHVTTDWRVHDVEIENAELIIRGWSVHGV
FT                   FVHTRKGDIKWSIR"
FT   gene            339697..340338
FT                   /gene="pkn"
FT                   /locus_tag="COPRO5265_0364"
FT   CDS_pept        339697..340338
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pkn"
FT                   /locus_tag="COPRO5265_0364"
FT                   /product="putative serine/threonine protein kinase"
FT                   /note="identified by match to protein family HMM PF03793"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ACI16853"
FT                   /db_xref="GOA:B5Y7I3"
FT                   /db_xref="InterPro:IPR005543"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y7I3"
FT                   /protein_id="ACI16853.1"
FT                   /translation="MLFCLLVTLPAGAQNVGRVPTVTGLTVNQALEEIAKAKYAASVEY
FT                   EYATVAPGVVIAQSPDGGILAPAGQQVKLIVSKGLKLVEVPNVVGVVAADAIDKIKDLN
FT                   LRIGTITEVQTGDRFVVKSQDPTSGKLTVVGDVVNITVGIPKLVRVPPLIGLTLEKARS
FT                   SVEAAGLKVGDIKRTATTSTDLEIVKTQNPRSGVYRYEGTPVDIEVWSPK"
FT   gene            340335..341204
FT                   /gene="rsgA"
FT                   /locus_tag="COPRO5265_0365"
FT   CDS_pept        340335..341204
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rsgA"
FT                   /locus_tag="COPRO5265_0365"
FT                   /product="ribosome small subunit-dependent GTPase A"
FT                   /note="identified by match to protein family HMM PF03193;
FT                   match to protein family HMM TIGR00157"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17317"
FT                   /db_xref="GOA:B5Y7I4"
FT                   /db_xref="InterPro:IPR004881"
FT                   /db_xref="InterPro:IPR010914"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030378"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y7I4"
FT                   /protein_id="ACI17317.1"
FT                   /translation="MRALLLGRVLRRERYNVLVSYENSVYLGLVKKKVWEQDKVLVNDR
FT                   VWFEPITDTEVSVERTTGRKNYFLRPPVANLDLLVYVHSFKNPQCDVRYLDLTLGLATL
FT                   QNIPVLVLFHKADLLRDEDIQPWTSLYTSLGYDVMVTSVYYDLSALKERLRGKTVLFSG
FT                   PTGVGKSSLVKALWKDASVRVGDISKVGRGKHTTSWVELLPLDDTYVVDAPGFSLLEMP
FT                   AMNPWDIQRMFPEIETTAKGCFFSDCLHLKEPSCAVKEAVKKGLIAESRYNSYLYFLDK
FT                   QQEEAKKR"
FT   gene            341201..341863
FT                   /gene="rpe"
FT                   /locus_tag="COPRO5265_0366"
FT   CDS_pept        341201..341863
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpe"
FT                   /locus_tag="COPRO5265_0366"
FT                   /product="ribulose-phosphate 3-epimerase"
FT                   /EC_number="5.1.3.1"
FT                   /note="identified by match to protein family HMM PF00834;
FT                   match to protein family HMM TIGR01163"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18147"
FT                   /db_xref="GOA:B5Y7I5"
FT                   /db_xref="InterPro:IPR000056"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR026019"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y7I5"
FT                   /protein_id="ACI18147.1"
FT                   /translation="MRKLVPSLLSADLWCLKDQLDVLKQYQVDTLHVDVMDGNFVPNIS
FT                   MGVPLVESLRKHSDFSLDVHLMIANPERFIETFREAGADLLTVHIEATYHIHRLIQQIR
FT                   NVGCKAGVSLNPGTPLELIKPILHMVDLVLVMSVNPGFGGQDFLPETLSKVKMLHQWKQ
FT                   EREDYKYIVEVDGGINRSNVEQVLNAGAEWIVSGSGVFKGDLKTNLDQLNEILLKYN"
FT   gene            341932..342879
FT                   /locus_tag="COPRO5265_0367"
FT   CDS_pept        341932..342879
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0367"
FT                   /product="erythrocyte band 7 integral membrane protein"
FT                   /note="identified by match to protein family HMM PF01145"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17255"
FT                   /db_xref="GOA:B5Y7I6"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR001972"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y7I6"
FT                   /protein_id="ACI17255.1"
FT                   /translation="MPGTVMGRTGSLFLLGVGIVWLLIWLILAYSSKQKSTLAVLAVFS
FT                   LIWAGLGFWRAMAGDVVSMVILFVILVITLPGMLKVVNQYQRAVLLRFGKFQSVLEPGL
FT                   NVILPWGIDRALYVEMRTTTIDVPKQDIITRDNVPVSVDAVVYFNVFDPKLAVLEVQDY
FT                   RQATTLLAQTILRSVLGSHELDDMLSQREKLNEVLKLDLDKATDPWGVRVTGVEIKAVD
FT                   LPEDMKRAMAKQAEAERERRAKVISAEGEYQASEKLAQAAEVIGSTRVGVMLRMLQTLS
FT                   EIAVEKNSTIVFPLPMEILRYFDVKGEREDETGS"
FT   gene            342863..343063
FT                   /locus_tag="COPRO5265_0368"
FT   CDS_pept        342863..343063
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0368"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17890"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y7I7"
FT                   /protein_id="ACI17890.1"
FT                   /translation="MKQVLKGLLVVGLLVALIFGALYMVGYSHSSGNVTTPSQLDWEHY
FT                   FQEIMKQVTGPGKATPYRPTQ"
FT   gene            343084..344271
FT                   /locus_tag="COPRO5265_0369"
FT   CDS_pept        343084..344271
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0369"
FT                   /product="sugar-binding transport ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005;
FT                   match to protein family HMM PF08402"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17389"
FT                   /db_xref="GOA:B5Y7I8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040582"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y7I8"
FT                   /protein_id="ACI17389.1"
FT                   /translation="MARVYLEHVWKKFGTVVAVKDLTLEVKDGEFFVLLGPSGCGKTTT
FT                   LRMIAGLEDVTEGTIYIGDRVVNDVHPKDRDIAMVFQNYALYPHMSVFDNISFGLKLRG
FT                   LPKEEIKARVDEVAGWLGLKELLNRRPRELSGGQRQRVALARALVRRPQVFLMDEPLSN
FT                   LDAKLRTQARGELLRLHKDFPTTTIYVTHDQVEAMTLGDRVAVMMEGTLQQVDSPQMLY
FT                   LYPANQFVAGFVGTPPMNFLTMDIVTEEGQMYLKHNGLKVPVTADMAVGLKDYPKNKVL
FT                   MGIRPQDVHLADEARMIENSGWVLHCISDVAERLGTETYVHFTLDDFELVGRVSAVRTV
FT                   SMGMEYDIYMDMTGAHLFDLDTGVRVCSGTAPEKMETRLGLKAEPQLRTAEQSEE"
FT   gene            344336..345715
FT                   /locus_tag="COPRO5265_0370"
FT   CDS_pept        344336..345715
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0370"
FT                   /product="acetoacetate metabolism regulatory protein AtoC
FT                   (Ornithine/argininedecarboxylase inhibitor) (Ornithine
FT                   decarboxylase antizyme)"
FT                   /note="identified by match to protein family HMM PF00072;
FT                   match to protein family HMM PF00158"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18071"
FT                   /db_xref="GOA:B5Y7I9"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y7I9"
FT                   /protein_id="ACI18071.1"
FT                   /translation="MEKKEERVSKRSKKTNEKPVVLVADDEPSIRELVQTVLSQQSLEV
FT                   VTASDGEEALKVSEAQVVDCALVDIRMPKVDGLAVLEQLVLKNIPVIVITAYGTSDVTI
FT                   EAMRRGAYDFITKPFDIDDLAEKVRKALDYSKTTEVLPIKGSKETSSLMVGMSAAMQEV
FT                   YKLIGRVASTDVTVLITGESGTGKELVSRAIHYNSPRNKGPFVVVNCAAIPEDLLESEL
FT                   FGYEKGAFTGADERKIGKFELANHGTILLDEIGDMSPMLQAKILRVLQEHVIERIGGTR
FT                   SIPVDVRVLAATNKDLQSLVKSGSFREDLYFRLNVVQIQLPPLRERKEDIPLLADHFIK
FT                   KYAAETSKEVTGVTPEVMAALMAYDYPGNVRELENIIARAVALCSGKVLTLDVLPPQVV
FT                   EPKPALRPLKEVLLEAERRAFRQAVAVAGLDPQAVADLLQVDLDYAKKRLKEWFSSVGS
FT                   N"
FT   gene            345699..346904
FT                   /locus_tag="COPRO5265_0371"
FT   CDS_pept        345699..346904
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0371"
FT                   /product="bacterial sugar transferase family protein"
FT                   /note="identified by match to protein family HMM PF02397;
FT                   match to protein family HMM TIGR03025"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18094"
FT                   /db_xref="GOA:B5Y7J0"
FT                   /db_xref="InterPro:IPR003362"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y7J0"
FT                   /protein_id="ACI18094.1"
FT                   /translation="MWAVIDLLVFLSSYALASLTKFGFPIPPENLESMLIVLPWSALIF
FT                   LFLMYYLDAYATYTRSFEDIAWATVISIAGASLASLVLSFWLRAFAFPRSVILYALLYQ
FT                   LLLFFLITWLKVRFISKEPFPSVFVKGVDESIASLLSSNRAQSIDEAQAIVIAGLDLVE
FT                   ELKKGIEHGKPVIIDPTVEQMALLNGLMVSFDDHPFILIHSWVFDRVQVFLKRVVDIII
FT                   GLLGSAITVILLPFIALAIFIDSPGPIFYTQQRLGQGGRSFKVIKFRTMIPDAEKYTGP
FT                   VLASEDDPRITRVGRFLRKTRLDELPQFFNVLVGDMSVVGPRPERPEFYEKALDEVEDF
FT                   RLRLIVKPGLTGYAQVYASYSVDFKHKFFFDLFYITSPNVLSTDIKILLLTVKSVLKRE
FT                   GT"
FT   gene            complement(346981..347244)
FT                   /gene="hup"
FT                   /locus_tag="COPRO5265_0372"
FT   CDS_pept        complement(346981..347244)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hup"
FT                   /locus_tag="COPRO5265_0372"
FT                   /product="DNA-binding protein HU"
FT                   /note="identified by match to protein family HMM PF00216"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17433"
FT                   /db_xref="GOA:B5Y7J1"
FT                   /db_xref="InterPro:IPR000119"
FT                   /db_xref="InterPro:IPR010992"
FT                   /db_xref="InterPro:IPR020816"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y7J1"
FT                   /protein_id="ACI17433.1"
FT                   /translation="MTKPELVDALAERTGMKKKDAELFLNAFMDVVTETVKSGEPVVLV
FT                   GFGKFMLRERKARKGVNPKTREPIDIPAKKTVVFKPGKELRD"
FT   gene            complement(347397..348365)
FT                   /locus_tag="COPRO5265_0373"
FT   CDS_pept        complement(347397..348365)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0373"
FT                   /product="HD-hydrolase domain containing protein"
FT                   /note="identified by match to protein family HMM PF01336;
FT                   match to protein family HMM PF01966; match to protein
FT                   family HMM TIGR00277"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ACI16818"
FT                   /db_xref="GOA:B5Y7J2"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR006675"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y7J2"
FT                   /protein_id="ACI16818.1"
FT                   /translation="MEYVKRIFSIELKPGMTNVKELFVLQQKTYGSKKKDGSHYANLVL
FT                   SDAKGSIRGFMELNDNGMINIENGQLVCCTGNIGEFNSEVTMYVSHIEQVDLSVIDEKT
FT                   LALLYPSVENLEQLKAELRSLVESVENTEMKLLLEYVLFEKLWDQFIKKPAAKSIHHAR
FT                   IGGLLEHSVHVAEMVSDLSRFYPDVNRDLALTGALLHDIGKVEEMSIPGGDYTDNGKLL
FT                   GHVVHGSLMLAKFMDDLGLDESLKQALLHIVLSHHGEKEWGSPVKPKTLEALLVAMADR
FT                   TDAYLDHAQKIYRETKAKGLKWSHYSEPLDAAIFVLDEDSN"
FT   gene            complement(348370..348924)
FT                   /locus_tag="COPRO5265_0374"
FT   CDS_pept        complement(348370..348924)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0374"
FT                   /product="putative aldolase class 2 protein YgbL"
FT                   /note="identified by match to protein family HMM PF00596"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17639"
FT                   /db_xref="InterPro:IPR001303"
FT                   /db_xref="InterPro:IPR036409"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y7J3"
FT                   /protein_id="ACI17639.1"
FT                   /translation="MNKVEEELLAAVRAINTSMLASDGHTTISIKLENGNILAVVGKKD
FT                   PFVTEEDLLEIEPSGEVLRGNPEEEILVHLDIYRHWDNVKALIHSYPISLVNLALGRVP
FT                   MAENVEPGMLFQDLQIIAAPPLDRKQLIEQIKDIFDVGVALVTTDFGLLLAGESLWEVF
FT                   FRLQQLEELAERITFKSIVGH"
FT   gene            complement(348921..349610)
FT                   /gene="udk"
FT                   /locus_tag="COPRO5265_0375"
FT   CDS_pept        complement(348921..349610)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="udk"
FT                   /locus_tag="COPRO5265_0375"
FT                   /product="uridine kinase"
FT                   /EC_number="2.7.1.48"
FT                   /note="identified by match to protein family HMM PF00485;
FT                   match to protein family HMM TIGR00235"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17877"
FT                   /db_xref="GOA:B5Y7J4"
FT                   /db_xref="InterPro:IPR000764"
FT                   /db_xref="InterPro:IPR006083"
FT                   /db_xref="InterPro:IPR026008"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y7J4"
FT                   /protein_id="ACI17877.1"
FT                   /translation="MQKKYLLLGIAGGTGSGKTTVAKTLHDIVPKDQVTMLSMDSYYRD
FT                   FPDLSLEERRKLNYDHPNAFDFDLLYKHLQMLIQGESIKVPEYSFELYGRTGNYEIVVP
FT                   RPVIIVEGILLFYDERIRNLFDIKIYVDTDADVRILRRLKRDVEKRGRTLDSVIKQYLE
FT                   TVRPMHIQFVEPTKRFADIIVPEGGKNMVAMDIIKAKIQVLLQELYDDKSYKSDNDSSV
FT                   LGEEGDI"
FT   gene            349718..351103
FT                   /gene="lap"
FT                   /locus_tag="COPRO5265_0376"
FT   CDS_pept        349718..351103
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lap"
FT                   /locus_tag="COPRO5265_0376"
FT                   /product="aspartyl aminopeptidase"
FT                   /EC_number="3.4.11.-"
FT                   /note="identified by match to protein family HMM PF01546;
FT                   match to protein family HMM PF02127"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ACI16793"
FT                   /db_xref="GOA:B5Y7J5"
FT                   /db_xref="InterPro:IPR001948"
FT                   /db_xref="InterPro:IPR023358"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y7J5"
FT                   /protein_id="ACI16793.1"
FT                   /translation="MINWKNGHLKVDETTLSEIESFAKDYMQFMAVAKTERETVTQSIK
FT                   EAREKGFRNLDELEGSWRPGEKVYFENRKKSVVFAVLGQKPATEGVNIVVAHVDAPRLD
FT                   LKPRPLKEDEQIAILETHYYGGIKNFHWVSTPLALHGVVVKTDGTVVEIAVGDKDEDPV
FT                   LVIPDILPHLGRKIQMSKTMDEAIPGESLDVVIGSVPLKDEEKEPVKKFILKLLNDTYG
FT                   ITEADFLSAELEVVPALKPREVGLDRALIGAYAQDDRVCGYTAFRALLDLAEVPEKTAV
FT                   VILADKEEVGSMGNTGMRSAFIDKFLSKLIALTKPSFSPLDLYEAWNRTKVLSADVTAA
FT                   VDPIWKSVHEMQNAARMHYGPVLTKYTGSRGKGGANDAHAEFLAQVREAFDKEGVIWQM
FT                   AELGKVDEGGGGTVALFMADRGADVVDIGVALWGMHSLFEVSSKLDVYYAYKANQAFFK
FT                   HLK"
FT   gene            complement(351227..351673)
FT                   /locus_tag="COPRO5265_0377"
FT   CDS_pept        complement(351227..351673)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0377"
FT                   /product="transcriptional regulator, MarR family, putative"
FT                   /note="identified by match to protein family HMM PF01047"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17261"
FT                   /db_xref="GOA:B5Y7J6"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y7J6"
FT                   /protein_id="ACI17261.1"
FT                   /translation="MCMDMDKLSEYLFDLYIQLPRRFKRLFYASMQDQELQLGLSELKI
FT                   LNELDKIGPCKMSDLSDALVVTMGGLTPHVDKLVEKGLVRRFRDEERDRRLVLVEITDQ
FT                   GQRLLKETKEQFLRTLEHHLEKFTNEEKADIAKAVETLRRTFEF"
FT   gene            complement(351712..352230)
FT                   /locus_tag="COPRO5265_0378"
FT   CDS_pept        complement(351712..352230)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0378"
FT                   /product="NADH dehydrogenase (h(2)o(2)-forming nadh
FT                   oxidase)(nadh:oxygen oxidoreductase)"
FT                   /EC_number="1.6.99.3"
FT                   /note="identified by match to protein family HMM PF00881"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17692"
FT                   /db_xref="GOA:B5Y7J7"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y7J7"
FT                   /protein_id="ACI17692.1"
FT                   /translation="MENIYDLIKQRRSVRNFKPDSVDDAVLKRILEAALWAPSAGNTQA
FT                   RMFYLVKNPELKKAVASACFDQDHVELAPVIVVACTDVEAMRALYGKRGTTLYGICDVS
FT                   AAVENLLLAAWSEGLGSCWVGNFSEQELQKALKIPKRFLPVAVVPLGYPAEIPPSPARK
FT                   SFDESVVIL"
FT   gene            352311..352673
FT                   /locus_tag="COPRO5265_0379"
FT   CDS_pept        352311..352673
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0379"
FT                   /product="conserved Archaeal protein, putative"
FT                   /note="identified by match to protein family HMM PF06948"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17091"
FT                   /db_xref="InterPro:IPR027396"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y7J8"
FT                   /protein_id="ACI17091.1"
FT                   /translation="MNSLINENSSKKKVVIVISSGDKQVIMPALNMALKSKRDNLYEDV
FT                   KVQFFGISQKIAAEDPDVQELISELVKAGISPMACRHISDKFEVTVKLDNLGFDNVQIP
FT                   IEIAKLVNEGYIPMVF"
FT   gene            352692..353345
FT                   /locus_tag="COPRO5265_0380"
FT   CDS_pept        352692..353345
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0380"
FT                   /product="nitroreductase"
FT                   /note="identified by match to protein family HMM PF00881"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ACI16862"
FT                   /db_xref="GOA:B5Y7J9"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y7J9"
FT                   /protein_id="ACI16862.1"
FT                   /translation="MNFEELSQLIKSRRSVRNWQDKDVPDEVLKQALELATYAPSGMNY
FT                   QGWKFVVVKNKDMINAIADAVRSRAQKVASWEETARHMENPQAMVERAGFFRKAPVLIA
FT                   VYSQIYPSSRDQIYLERMAHDEEAALMKSWLDLANPSIQSVASGIAYLLLALLAQGLGS
FT                   VWMTGPMQAKGDIEQLLGKPEGFDLVALIATGYHDETPRPKTMKSFDEVVQFVE"
FT   gene            353402..353629
FT                   /locus_tag="COPRO5265_0381"
FT   CDS_pept        353402..353629
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0381"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17683"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y7K0"
FT                   /protein_id="ACI17683.1"
FT                   /translation="MRVKIVGHMAEVLSVPPEGLEVLLDAPITLGELVKRLWNVPFSLF
FT                   MGAKVGDLKVSEEYVVTGHEEEIVLLSNGG"
FT   gene            353635..354375
FT                   /locus_tag="COPRO5265_0382"
FT   CDS_pept        353635..354375
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0382"
FT                   /product="lipoate-protein ligase A family protein"
FT                   /note="identified by match to protein family HMM PF03099"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18096"
FT                   /db_xref="GOA:B5Y7K1"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y7K1"
FT                   /protein_id="ACI18096.1"
FT                   /translation="MKATVIFDTCREGSLNMALDSLLLQQLREEEQVFLRFYTWCPATV
FT                   SIGLFQKWQQQQQHSPYPVVRRPTGGKAVLHLLDVSYSFVGPLSGFGNSVLETYFLVSQ
FT                   GLIKGLELLGIPAEFLPAPLPTKEDPSSCFVHLSGHEVGVAGKKLIGSAQARKPWGFLQ
FT                   HGSIMVEPIYHEMAELFSIEESEIRAHAIALRELLPDITIGVLENALREGFEDALDLHF
FT                   TQAEFSSKELSQAASFSGKYAVCS"
FT   gene            354366..354980
FT                   /locus_tag="COPRO5265_0383"
FT   CDS_pept        354366..354980
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0383"
FT                   /product="conserved protein"
FT                   /note="identified by match to protein family HMM PF04199"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17508"
FT                   /db_xref="GOA:B5Y7K2"
FT                   /db_xref="InterPro:IPR007325"
FT                   /db_xref="InterPro:IPR037175"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y7K2"
FT                   /protein_id="ACI17508.1"
FT                   /translation="MQLEAKSIIDLTQTISENLQVYPGDPPVEVHTVSTLEDGFVLERV
FT                   CMSSHGGTHLDAPWHVLKGGADVSSIALERLILPCVYVDMSALSKKEDRLAKLTGRFTD
FT                   LKDKALLLSTNEKLSANITPEEVEVLITGGVKLLGVDAMSVEHSDDLVVHRQLLSSGVL
FT                   IVEGLANLHMLNEKQEYFLVVAPLKLEGCSGAPVRAFAITL"
FT   gene            354977..355636
FT                   /gene="sfsA"
FT                   /locus_tag="COPRO5265_0384"
FT   CDS_pept        354977..355636
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sfsA"
FT                   /locus_tag="COPRO5265_0384"
FT                   /product="sugar fermentation stimulation protein"
FT                   /note="identified by match to protein family HMM PF03749;
FT                   match to protein family HMM TIGR00230"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18130"
FT                   /db_xref="GOA:B5Y7K3"
FT                   /db_xref="InterPro:IPR005224"
FT                   /db_xref="InterPro:IPR040452"
FT                   /db_xref="InterPro:IPR041465"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y7K3"
FT                   /protein_id="ACI18130.1"
FT                   /translation="MKFPPLLFGTVVERQKRFKLLVDFDDHLDWAYLPNPGRLRELIYP
FT                   GAPVWLKPVHSAKRKLAYEAVLGYDSVLVCLYAALANKLFLESLDLLGLGGNVQVLKEV
FT                   SLGHSRLDFSVDGRLVEVKSVTLVQDGLGLFPDAPTKRGTKHLYELADKGEGLVVFVVQ
FT                   RCDAEAVTFHSAMDEDFASAMKWAKKKGVSFKAVNCIVTKEEIRPWREIPVLFPQD"
FT   gene            355600..356268
FT                   /locus_tag="COPRO5265_0385"
FT   CDS_pept        355600..356268
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0385"
FT                   /product="N-glycosylase/DNA lyase"
FT                   /EC_number="3.2.2.-"
FT                   /EC_number="4.2.99.18"
FT                   /note="identified by match to protein family HMM PF00730"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17512"
FT                   /db_xref="GOA:B5Y7K4"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="InterPro:IPR012092"
FT                   /db_xref="InterPro:IPR023170"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y7K4"
FT                   /protein_id="ACI17512.1"
FT                   /translation="MARNSSALPARLEIANSLEELVSLVKDEAKDLVSQRIAQFKNFPR
FT                   HDVSNLFSELSFCVLTANWSAQGGMRAQELIGEGFLTMPPEDLEDALRSVGHRFAYQRA
FT                   RFILENRQRAHLLPLIVNGNLPSPEARSMLVKNFKGIGWKEASHFLRNVGLLDVAILDK
FT                   HILRLMHHYKLIEDMPKGWTRARYEAHEQLLIPIVQKLHMDLGEMDLYLWYAVKNTVDK
FT                   "
FT   gene            complement(356322..356819)
FT                   /locus_tag="COPRO5265_0386"
FT   CDS_pept        complement(356322..356819)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0386"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17106"
FT                   /db_xref="GOA:B5Y7K5"
FT                   /db_xref="InterPro:IPR002563"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y7K5"
FT                   /protein_id="ACI17106.1"
FT                   /translation="MKEFLTTREDYHLLHPRQVIILVVGSFERANMMPLGWHTILSRNP
FT                   FLVGLAISPKRFSHSMLMDFPFATINLVDKSFEELVENTGKCSGKNVDKFEQFHVNKVL
FT                   AENGSAYIEGIPAYLEATRKGYFETGDHTLFVLEITKSVLKRPFCPLFQIAGDQYQQFL
FT                   VE"
FT   gene            356914..359199
FT                   /locus_tag="COPRO5265_0387"
FT   CDS_pept        356914..359199
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0387"
FT                   /product="putative transketolase"
FT                   /note="identified by match to protein family HMM PF00456"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17413"
FT                   /db_xref="GOA:B5Y7K6"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033247"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y7K6"
FT                   /protein_id="ACI17413.1"
FT                   /translation="MQNDFKYWEKMKDISFELMDIMLNYRQSGHPGGSHSKTQMLLALM
FT                   FGGKMRYDIRRPEYRFSDRFILAAGHTIPMVDAVLAMIGDAFRLRFTDTGDQRFFIAPE
FT                   KIVLPEDLLHFRHRGGLPGHAEFGGKTMFLKFNTGPSAHGLPASVGEALALKKAGLSEF
FT                   KVFAIEGEGALTAGGSHEAKNGAWGYGLGNLYWLVDWNDFGIDDRRTSSVVFGGPDEWF
FT                   ASHGWRVFGTLEGHDWNNIWKVFVDALDHPDELLPTAMYFKTRKGYGYGVYDNKSHGTP
FT                   IKKNAPLFWEIRKGFMEKYGVEYDGFGKPAPEDREEELKQFKNNIDIALSVLRNDRELV
FT                   EYITDRLTEIGESLPKAVPTFKLDVNPYKDPDIYDYTKYPEEMFAKPGEKVPNRAALIK
FT                   WGSYVNAAIGRKYNRPLIIATSADLTESTNLHGFGQGWGDNPGWGWYDRSTNIDGAILP
FT                   SEITEFMNSGLAAGMVTVNMAENPYEEFNGYWVIMSTYGSFAYLKYGPMRLLSQLAQDC
FT                   PLKVGKVIWVLGHSGPETAEDSRTHFGVFAPGVSQLFPKGKIINLYPWEHNEVPVVLGE
FT                   ALSKDVPIVALHLTRPPITIPDRKALGIAHYFEAAKGAYLINDFDPARPKQGTVIVRGT
FT                   STTANLVSILPEIRKAFNVKIIAAISRELFDMQPEHYRMQILPPTDWADSMVITNEALS
FT                   LMQPWLFSKLNEEYSLSSDWDNNWRTGGTVEEVIEEAHLDPQSIFHGIERFVNDREKRL
FT                   ARLKELGW"
FT   gene            359208..359789
FT                   /gene="pncA"
FT                   /locus_tag="COPRO5265_0388"
FT   CDS_pept        359208..359789
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pncA"
FT                   /locus_tag="COPRO5265_0388"
FT                   /product="pyrazinamidase/nicotinamidase"
FT                   /note="identified by match to protein family HMM PF00857"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17711"
FT                   /db_xref="GOA:B5Y7K7"
FT                   /db_xref="InterPro:IPR000868"
FT                   /db_xref="InterPro:IPR036380"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y7K7"
FT                   /protein_id="ACI17711.1"
FT                   /translation="MIDFQPTDGLIVVDIQRDFCPGGTLAVPQGDEIIDVVNRIIKKAE
FT                   EAGSVIVYTRDWHPENHLSFKAYGGIWPPHCVQWTPGAEFHPQLYLSEKGIILDKGTHP
FT                   EFEAYSGFQGTGLHQIFKDRGVNRVFVVGLATDYCVKETAVDALRYRYETFVVADAVKG
FT                   VNVNPDDSQKALQHIEDMGGKVILSQELLP"
FT   gene            359786..360547
FT                   /locus_tag="COPRO5265_0389"
FT   CDS_pept        359786..360547
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0389"
FT                   /product="23S rRNA methyltransferase"
FT                   /note="identified by match to protein family HMM PF00588"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17072"
FT                   /db_xref="GOA:B5Y7K8"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR013123"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y7K8"
FT                   /protein_id="ACI17072.1"
FT                   /translation="MRFIESPKNPKIKEIKKLLSSKKARDEKGQFVLEGPKAIEAYVQS
FT                   GGKVLELLYSKDAKDLPKVNAVVTQCAPGVMEAVSDVAGDQGVIAIAQKRDWTPQQVLK
FT                   RKRIVVLEQLQDPGNLGTILRTAAAFDYGVILTTGSADVYNPKVVRALAGNFLAPFVYV
FT                   TGGEALELCKNLFVVTTYKSSEKPDFKWRQPFAIVLGNEGQGLTESWRRIAKANAWIPS
FT                   KVESLNVSVTSAILMWEGTKIGTAKSSGDLI"
FT   gene            360531..361160
FT                   /gene="nth1"
FT                   /locus_tag="COPRO5265_0390"
FT   CDS_pept        360531..361160
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nth1"
FT                   /locus_tag="COPRO5265_0390"
FT                   /product="endonuclease III"
FT                   /EC_number="4.2.99.18"
FT                   /note="identified by match to protein family HMM PF00633;
FT                   match to protein family HMM PF00730"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17226"
FT                   /db_xref="GOA:B5Y7K9"
FT                   /db_xref="InterPro:IPR000445"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR003651"
FT                   /db_xref="InterPro:IPR004035"
FT                   /db_xref="InterPro:IPR004036"
FT                   /db_xref="InterPro:IPR005759"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="InterPro:IPR023170"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y7K9"
FT                   /protein_id="ACI17226.1"
FT                   /translation="MEILSETHKNDLHFDLEFDSPYELLIAALLAAQASDESVNEITKG
FT                   FFPKFPSAQAVAEADVETLEKAIYPVNFYKTKAKRLKECCQALVEKFHGEVPNNVEDLT
FT                   ELPGVGKKTASMVVLGAFGQPAVVVDRHVLRVLNRLGFSFKDADVAEEEIRKMLAPEYW
FT                   GKLSYSFMRHGKTICLARKPLCDKCPLKDCCPSSNAGSNGNQKDSF"
FT   gene            361163..361633
FT                   /locus_tag="COPRO5265_0391"
FT   CDS_pept        361163..361633
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0391"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18020"
FT                   /db_xref="GOA:B5Y7L0"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y7L0"
FT                   /protein_id="ACI18020.1"
FT                   /translation="MAPLDWITAAIIVYFAVSGLLSGAGALATTLSVFLTVASRSFITT
FT                   QLTHWVFQLISSLGADPSYGQPLSLVLSFLLFFTLARLVLRALLGVILPRAGIGRVIYA
FT                   VGSVIVNGYAYLYLLNALLRSSWQSYIWLMPYFQGTHTFRLLETIFGTVTAV"
FT   gene            361679..362410
FT                   /locus_tag="COPRO5265_0392"
FT   CDS_pept        361679..362410
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0392"
FT                   /product="protein of unknown function, putative"
FT                   /note="identified by match to protein family HMM PF04402"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17206"
FT                   /db_xref="InterPro:IPR007497"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y7L1"
FT                   /protein_id="ACI17206.1"
FT                   /translation="MKKFYSSPLLALAVVAAVLLGAWLLPVGAASTDSQETPTISVNGI
FT                   AKVEVVPDMAVVNFVVEATQQTASLAMAEVTKGANAVVEAVKDIVKDEKNIKTSNVSVY
FT                   PWYDYTEKGTELLGYRAVVQISVKSSVEDLPSIIDEAFTAGATGMSGIAYEYSKTASVM
FT                   DQLIKDAMADARHKAEVALSAEHATPGKLASVQVLESSTPIWRSEASYSKDAQTMAQDI
FT                   NIMPGVQEVSVSVSVSYVINQ"
FT   gene            362489..363250
FT                   /locus_tag="COPRO5265_0394"
FT   CDS_pept        362489..363250
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0394"
FT                   /product="methyltransferase domain family"
FT                   /note="identified by match to protein family HMM PF08241;
FT                   match to protein family HMM PF08242"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17430"
FT                   /db_xref="GOA:B5Y7L2"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y7L2"
FT                   /protein_id="ACI17430.1"
FT                   /translation="MPSFVLQCFYMENGIIDYFGELYYKCFATKLEQRSEQEARLALKL
FT                   LDSPRSILDVGCGWGRHLQYFLRWGLDAWGVEPNPFFVQIFKERNPLWSNRIIHNKLQN
FT                   LNVFKQFSAVVSLWTSIGWDQSDQEEQELFRKLSEFLSPGGLLLLDVDNLKGWQARFCR
FT                   KWWERVDGGYVLDQHALKGSKLTTTRQFLLDAGSTYKVTRQLKLYTLEDLQALAEPYQL
FT                   FLRATYRDLSGNPFYPEAPRIVAVFEKITAA"
FT   gene            complement(363237..363938)
FT                   /locus_tag="COPRO5265_0393"
FT   CDS_pept        complement(363237..363938)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0393"
FT                   /product="biotin-[acetyl-CoA-carboxylase] ligase"
FT                   /EC_number="6.3.4.15"
FT                   /note="identified by match to protein family HMM PF02237;
FT                   match to protein family HMM PF03099; match to protein
FT                   family HMM TIGR00121"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18106"
FT                   /db_xref="GOA:B5Y7L3"
FT                   /db_xref="InterPro:IPR003142"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="InterPro:IPR004408"
FT                   /db_xref="InterPro:IPR008988"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y7L3"
FT                   /protein_id="ACI18106.1"
FT                   /translation="MRIQKFEVVESTNDLARKYILEGNKEPAAFVAEHQTRGKGRLGRV
FT                   WEDEPGKSLLVSFALPGSTYSNPPLLGLATAVFVGEYLDLLPVPWETKWPNDVLIEGKK
FT                   VAGILPEGIWQDGLVGVVVGVGLNVNQDEFPDDTEATSIKHAFGQALPVEQPLMYLIYR
FT                   MEQVYEQIVDFSEILATFKDKFKSMGKKLRVRSNDQVWEGTAVDIEEDGSLILNMEGKL
FT                   VTLGWGEVTLR"
FT   gene            364001..365773
FT                   /locus_tag="COPRO5265_0395"
FT   CDS_pept        364001..365773
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0395"
FT                   /product="oligoendopeptidase F"
FT                   /note="identified by match to protein family HMM PF01432;
FT                   match to protein family HMM PF08439; match to protein
FT                   family HMM TIGR02290"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18098"
FT                   /db_xref="GOA:B5Y7L4"
FT                   /db_xref="InterPro:IPR001567"
FT                   /db_xref="InterPro:IPR011977"
FT                   /db_xref="InterPro:IPR013647"
FT                   /db_xref="InterPro:IPR042088"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y7L4"
FT                   /protein_id="ACI18098.1"
FT                   /translation="MMEWSLSELYPSFDSPEFQGDLKELENRVKEFNDWSQGALKDYTA
FT                   PVSKAEAGIKHTMAIAELYEKLGAFAQLTISVEAYNEQAAKAADRVHTVVADMALGDTR
FT                   FKKWLAGLGNLDEVIGKSELLKEHEYFIKDSVRYARRLLSEQEEELINKLQSTGSLAWS
FT                   RLQGNLTAKLLVDMKKDGKEEKLPLTVVRNMAYHEDRNVRMAAYEAELKAYEKIDEAVA
FT                   SSLNGIKGEFLTISKKRGYKDPLEATLETAKMDRAIFDTLMDVMNESLPVFRRYLKIKA
FT                   EILGHGDRLPWYDLFAPVGRSSRKFSINDARDYIVTNFGKFAPELSDLARTAFDNKWID
FT                   ATPREGKRGGAFCYGLHPIKQSRIMANFDGTFDGVTTLSHELGHAFHNWCQRDESILNA
FT                   DSPMPLAETASTFNETMITEIALSEADPQEQLFILEKSLSGDTQVVVDILSRFLFESEV
FT                   FRRRTQGPLSVSELKEIMADAQKQAYGEALNWDYLHPYMWVNKPHYYYANLHFYNFPYA
FT                   FGQLFSKALYAMYKEQGKDFIPAYENLLRNTGKHDIGELGQLIGVDLTQKSFWEKSIEL
FT                   IEQQVEQFERLAKA"
FT   gene            complement(365882..366277)
FT                   /locus_tag="COPRO5265_0396"
FT   CDS_pept        complement(365882..366277)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0396"
FT                   /product="YvlD"
FT                   /note="identified by match to protein family HMM PF04020"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ACI16917"
FT                   /db_xref="GOA:B5Y7L5"
FT                   /db_xref="InterPro:IPR007165"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y7L5"
FT                   /protein_id="ACI16917.1"
FT                   /translation="MGQPKENRFRMLTYASGGDVMFFLGKWLANFVVLAIVSLIYKGLT
FT                   YANLTAMILGALVLTLAQLTIKPILTLLTLPINILTLGLFSLVINGLIIWLMASIVPGI
FT                   YLKSFGAAIIAWILVSIVGLFVRPLIL"
FT   gene            366346..367950
FT                   /locus_tag="COPRO5265_0397"
FT   CDS_pept        366346..367950
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0397"
FT                   /product="manganese-dependent inorganic pyrophosphatase
FT                   (Pyrophosphate phospho-hydrolase) (PPase)"
FT                   /EC_number="3.6.1.1"
FT                   /note="identified by match to protein family HMM PF00571;
FT                   match to protein family HMM PF02833"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17640"
FT                   /db_xref="GOA:B5Y7L6"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR001667"
FT                   /db_xref="InterPro:IPR004097"
FT                   /db_xref="InterPro:IPR010766"
FT                   /db_xref="InterPro:IPR028979"
FT                   /db_xref="InterPro:IPR038222"
FT                   /db_xref="InterPro:IPR038763"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y7L6"
FT                   /protein_id="ACI17640.1"
FT                   /translation="MDMEMVYVVGHKNPDTDSVVSAVGYAALKPEEYVAFRAGEPNDET
FT                   LEVFQLAGTDVPPLLSSLRLTALDMSKQLTSLDEKATFLEASKLLEKQKVIPVLKSDKL
FT                   LGIVTEKDLFRVIQKELFEEEVTVRLEPEVLIKTIPGRFLTPPRVIEGVPLVLASSTET
FT                   AGNRVRSNNVVIMGDRWDLLPVLLKRRVRAVIFTMGLSPSENDLEQLTDAGIVVFSSSL
FT                   HTYNTIRLMFMAFTVKEAMNVNPVTVSPQDGLDFLRRLSNLHRHRYFPVVEEDGSFRGL
FT                   LELADLASPPRKKVFLVDHNEPGQAVDGLQEAQVMGIIDHHRLGAFTTDEPVKIIIEPV
FT                   GSTSTLVAREYLRQNAHMTRQVATLLLGGLVSDTLNLQSVTTTPLDVDIAQFLEERSFL
FT                   PRDELASRLFHARVQAVLRDPSALTKDFKLFTFGKVRVGIAQIEIPGGSSLAPVMRDAI
FT                   EKVMTEKLEKERLDLALFMLTDITQKGTLLFAFGQRHIAQMVWAKPFKDGTEYLPSVVS
FT                   RKKQIVPLLEQILGGNG"
FT   gene            complement(367969..368100)
FT                   /locus_tag="COPRO5265_0398"
FT   CDS_pept        complement(367969..368100)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0398"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17483"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y7L7"
FT                   /protein_id="ACI17483.1"
FT                   /translation="MDDQSVFYAPTYAGTHKKTAQYDSLLIQLLAIPTKGGEGGKTA"
FT   gene            complement(368022..368918)
FT                   /gene="htpX"
FT                   /locus_tag="COPRO5265_0399"
FT   CDS_pept        complement(368022..368918)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="htpX"
FT                   /locus_tag="COPRO5265_0399"
FT                   /product="heat shock protein, protease HtpX"
FT                   /EC_number="3.4.24.-"
FT                   /note="identified by match to protein family HMM PF01435"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17964"
FT                   /db_xref="GOA:B5Y7L8"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="InterPro:IPR022919"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y7L8"
FT                   /protein_id="ACI17964.1"
FT                   /translation="MRNVRLKTFLLMIWFGALVLALGWVIGYLFGNVSLWMTIALVMAL
FT                   VQIWASYWYSDKIVLTMTGTRLVDPNESVEAQMLYNIVEELSIAAGLPMPKVGIMETME
FT                   PNAFATGRDPDHAVVVATRGILKILNRDELAGVIAHELSHIKHRDILLTSMAATMALMI
FT                   SYLANLSWRMMFWGSFGDSDDRGRNPIIALIGLLLIFLAPLAATLIRLAVSREREFMAD
FT                   AGSAQITRNPEALASALEKLELYGKQMPKSALAKTNPAFAELFIVNHIKGDWMTNLFST
FT                   HPPTQERIRRLRSMTAY"
FT   gene            369101..369424
FT                   /locus_tag="COPRO5265_0401"
FT   CDS_pept        369101..369424
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0401"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17630"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y7L9"
FT                   /protein_id="ACI17630.1"
FT                   /translation="MENGALRAAANRFYTGAMYGVMLFLDEPVQADETIWRLGSRYLRK
FT                   SAKIYKTSLEIRKLRGSIEFSIEHEPSLSDVKRLSKLCHVLSTWCMEQTKEPLWNEKSY
FT                   SVE"
FT   gene            complement(369284..369379)
FT                   /locus_tag="COPRO5265_0400"
FT   CDS_pept        complement(369284..369379)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0400"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ACI16831"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y7M0"
FT                   /protein_id="ACI16831.1"
FT                   /translation="MFHTPRTKHVAQLTEPFNIRQRGLMFDAEFD"
FT   gene            369394..372219
FT                   /gene="uvrA"
FT                   /locus_tag="COPRO5265_0402"
FT   CDS_pept        369394..372219
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="uvrA"
FT                   /locus_tag="COPRO5265_0402"
FT                   /product="excinuclease ABC, A subunit"
FT                   /note="identified by match to protein family HMM PF00005;
FT                   match to protein family HMM TIGR00630"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17354"
FT                   /db_xref="GOA:B5Y7M1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR004602"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041102"
FT                   /db_xref="InterPro:IPR041552"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y7M1"
FT                   /protein_id="ACI17354.1"
FT                   /translation="MEREIILRGVRHHNLKNLSLNIPREKFIVVTGISGSGKSTLAFDV
FT                   LYAEAHRRFIESLSGYARMFLGIMQKPDVDYIEGIPPAISVEQKTASHNPRSIVGTVTE
FT                   IYDYLRLLFAHVGVPYCPEHRIPMLPVTVDEIVDRVLTNYAGERIYVLAPVVRGKKGEQ
FT                   KKLIEQIAKMGYTKVFLDDILYDVDEPVEIDKNQRHTLEVVTDRLTVKAENRSRIADAV
FT                   EQAFKLAEGVVAITTEEGKEYFSQQMACPICGRTLPELSPRLFSFNSPYGACEVCNGLG
FT                   FQTKASEDLVVDHESPLLEAIIPYRDNEFYQQMLHALAREFHIDLKKPFKDLPEDVKEG
FT                   ILRKGFGRVKLPIYLENGREIHVQFRPVLPEIERRIKETASEDVFNWYYRYVEEVPCDA
FT                   CGGARLRPEALWVEIDGLNIYQVSSMDFKHFLGWLESLHITGARSQVAQPIMQELIKRV
FT                   NFVVNIGLDYIQVNRRMDTLSGGEAQRVRLASQLGSGLTGVLYVLDEPSIGLHSRDTER
FT                   LVSILRSLRDEGNTVVVVEHDNDIIESSDHVIDLGPYAGKRGGEVVFQGSPEELKKADT
FT                   LTGQYVSGRRQIQVTQKRRAPQGWVRVQDASLNNLKHIDVGFPLGCFTVVTGVSGSGKS
FT                   SLVIDTLYKALENYQSRRKVTSVRLRNLEIQGDIKHTVLVDQSPIGRTPRSNPATYTGV
FT                   WTPIRELFATLRESKERGYKASRFSFNVPSSRGGGRCEACKGEGQTKVEMALLPDVYVT
FT                   CEVCGGKRFNKETLEVKYKGLSIADVLELTVDEALEVFENIPAIRRGLEVLQAVGLGYI
FT                   ELGQPAPTLSGGEAQRVKLATYLKSRAKDYVFILDEPTTGLHSYDVEMLLQVLHKLVDQ
FT                   GNTVIVVEHNLDVVGNADYIVDLGPEGGDEGGYVIFAGTPEELVKQEHSYTGQYLRLYW
FT                   ERFKPQLILSH"
FT   gene            372227..372973
FT                   /gene="fabG1"
FT                   /locus_tag="COPRO5265_0404"
FT   CDS_pept        372227..372973
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fabG1"
FT                   /locus_tag="COPRO5265_0404"
FT                   /product="3-ketoacyl-acyl carrier protein reductase"
FT                   /note="identified by match to protein family HMM PF00106;
FT                   match to protein family HMM PF01370; match to protein
FT                   family HMM PF08659"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18205"
FT                   /db_xref="GOA:B5Y7M2"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y7M2"
FT                   /protein_id="ACI18205.1"
FT                   /translation="MRYTGKAALVTGGSRGIGAAVVKRLAQEGLKVAFFYRQRMDKVEE
FT                   LLEWARDAQLTVVPIKVDITDPRSLLSAITDAKANVGPIDYLVNNAGVSHYKLLTEEEE
FT                   RELEEVLRTNLESVILLTREIAKGMVIRSFGSIVNISSIWGLYGGSCEAVYAATKGGII
FT                   SFTRSLAKELGPSNVRVNCVAPGVVRTDMMLNHFTEEEIAQLCQRIPLGRLAHPEEVAS
FT                   AVAFLLSDEASYISGSVLEVSGGFIS"
FT   gene            complement(372970..373428)
FT                   /locus_tag="COPRO5265_0403"
FT   CDS_pept        complement(372970..373428)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0403"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18224"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y7M3"
FT                   /protein_id="ACI18224.1"
FT                   /translation="MVSFLNEVGTYGWLLLVTSKPQLWHEQLKDKDIMHRTIITRMSRL
FT                   RSVRSTTLDRVFVIPTPKHLESYLVEAYYLLPENGRVEVLLPFEQQLVERYRKTLMEQS
FT                   SRDSLPLLLKLGFVNPYVILKSVGEESLAVAVGTKKEPTPDFDDEIAY"
FT   gene            complement(373515..374258)
FT                   /locus_tag="COPRO5265_0405"
FT   CDS_pept        complement(373515..374258)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0405"
FT                   /product="putative protein"
FT                   /note="identified by match to protein family HMM PF01904"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17658"
FT                   /db_xref="InterPro:IPR002763"
FT                   /db_xref="InterPro:IPR036520"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y7M4"
FT                   /protein_id="ACI17658.1"
FT                   /translation="MELRVGTSGFSYQDWVGAVYPETLKKTRWFDYYATVFNTVEINSS
FT                   FYAIPSKKTIDSLCRRAPKGFLFTMKVYQEITHKGNTEPLPQMLDAVSTIPENGHGLIL
FT                   LLQFPYSFHKTPENISYLQKVLEAIPFEKAVEMRHPAWFDEDLVRISQDFGFVPVSLDS
FT                   PYLKKIIPTQTLYMRFHGRNTEKWWQHEEAYERYDYLYSEQELTELVKEIKETRSDRYL
FT                   LYFNNHYQGKAFKNAQMLLELWNTD"
FT   gene            complement(374249..375502)
FT                   /locus_tag="COPRO5265_0406"
FT   CDS_pept        complement(374249..375502)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0406"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ACI16834"
FT                   /db_xref="GOA:B5Y7M5"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y7M5"
FT                   /protein_id="ACI16834.1"
FT                   /translation="MYLIMFVTVCIFVMLLPLMDYIPRNSWAVKLSDVPVFAPPPAQEK
FT                   TRIIFTSRVAETAKQESDLESHIRVPITWTKEQTVVNILTGAHAGINNFRSNNSAPYLY
FT                   TLSHLDGYATLSNVPENLGFLNRLAKGEKLEITFAEEVTELKPGDLALEINHGAVNLYG
FT                   LVLVKEKLPAKTSVRMQVYDVMPLVANLAGTPYPPGCIGSVPWEIFPFDMELKAYRNFF
FT                   LLRQKLVLADGFSTYLFGTSNLSDIDSYKPGISYYQGEYEKTFKEEQEMITQAMNQIDS
FT                   TARKKWLLDLSQRWYWFVLGALFLVWRFNVRMIPVSIGLMLLSALLGGFLFKFTPLFLI
FT                   GPALATVPIALLFPDMDTESIFYMSAAVVLIWMGLFGARRTLIVTSSLSMYILWSSFSV
FT                   ALIAGAFTVVRRWQDIWS"
FT   gene            complement(375550..377157)
FT                   /locus_tag="COPRO5265_0407"
FT   CDS_pept        complement(375550..377157)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0407"
FT                   /product="periplasmic sensor signal transduction histidine
FT                   kinase, putative"
FT                   /note="identified by match to protein family HMM PF00512;
FT                   match to protein family HMM PF00672; match to protein
FT                   family HMM PF02518"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18084"
FT                   /db_xref="GOA:B5Y7M6"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y7M6"
FT                   /protein_id="ACI18084.1"
FT                   /translation="MSLRVRFWIVAIVPLLLAVFLITWLFSTNMWNIYLQERETKLQGV
FT                   LNLMVKNFEAVAPQQDKDSLITNALRGDVQLQEEARVRLTAALLPYNQALQNAMPTLGL
FT                   SYSISLLGGPIAEVKNPEAEGKTRVEISAPIYWAGEQIGAARIWETADDLRASFTKTRN
FT                   TILGAVGGILLLAVLLAFLVIESVNRDIVNLVKQLPSLKESQLPVGTFRGEIGLIASTA
FT                   NELAAELKERTQALNAVMENSPVGLALVKNHEIILKNPIMEKLLPDLENRISTDTPDYY
FT                   HENIRTNDKNISLTFLRVSEDELIVVAEDLTDIINMREAMALQERLAALGRFSAGIAHE
FT                   IRNPLTAIRGFSQMILKQGSPEDKAYAEKILREQERVEKLVRDMLVYARPRTAEKKPIN
FT                   LYEFATQHFGENPQITLDIPKNLVWNLDEEYLLQIVSNLVGNAFDAGATQVWVEARREG
FT                   QNLVLRVANNGTPIPQEDLGKIFEPFYTTKSTGTGLGLAIVRSAAEIQGGSISVKQSSG
FT                   KTVFEIIFPNGSGTTGNY"
FT   gene            377325..377864
FT                   /locus_tag="COPRO5265_0408"
FT   CDS_pept        377325..377864
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0408"
FT                   /product="LemA family protein"
FT                   /note="identified by match to protein family HMM PF04011"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17439"
FT                   /db_xref="GOA:B5Y7M7"
FT                   /db_xref="InterPro:IPR007156"
FT                   /db_xref="InterPro:IPR023353"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y7M7"
FT                   /protein_id="ACI17439.1"
FT                   /translation="MWIAIVVLVLVLIVIWIYNRLIQLKNRVQNAWHQIEVQLQRRHDL
FT                   IPNLVETVKGYASHEKETFERVVAARNKAMSANTPGEMGRAEGELTQALGRLFALAESY
FT                   PELKANENFIRLQEELTSTENKVAYARQAYNDTVMMFNQTIQMFPYNLLAGPMNLKPAE
FT                   YFEAEEEAQNVPKVEF"
FT   gene            complement(377984..378433)
FT                   /locus_tag="COPRO5265_0409"
FT   CDS_pept        complement(377984..378433)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0409"
FT                   /product="N-acetylmuramoyl-L-alanine amidase, family 4"
FT                   /note="identified by match to protein family HMM PF01832"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17922"
FT                   /db_xref="GOA:B5Y7M8"
FT                   /db_xref="InterPro:IPR002901"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y7M8"
FT                   /protein_id="ACI17922.1"
FT                   /translation="MWELTPDTKILSESKLTWLELQKGLKGTPMEVLAPTFVCAEKLSK
FT                   VNALLLTSVAVLESGWGKSALSKRTKNLFGFQAYDRNPSGAKVFISYEEGIFFVAEYIR
FT                   TRYATAGGAYYKGGTLKAMGSLWASDPQWTQKVCSVAATLRRRAQ"
FT   gene            complement(378414..378587)
FT                   /locus_tag="COPRO5265_0410"
FT   CDS_pept        complement(378414..378587)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0410"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18003"
FT                   /db_xref="GOA:B5Y7M9"
FT                   /db_xref="InterPro:IPR024419"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y7M9"
FT                   /protein_id="ACI18003.1"
FT                   /translation="MDIIQIVGSLGFPIAVAAYFIVEINKTLAQLLLAIKDLSQEIALL
FT                   KEAVRTNVGIDT"
FT   gene            complement(378694..378909)
FT                   /locus_tag="COPRO5265_0411"
FT   CDS_pept        complement(378694..378909)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0411"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17163"
FT                   /db_xref="InterPro:IPR021321"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y7N0"
FT                   /protein_id="ACI17163.1"
FT                   /translation="MVTLNLSFKTDMDKTMVLRIPDPVMDLTTQQIQEAASAIVVTGVI
FT                   KSEKLGKPVQLVDANYVERTATDMLP"
FT   gene            complement(378945..379109)
FT                   /locus_tag="COPRO5265_0412"
FT   CDS_pept        complement(378945..379109)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0412"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18216"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y7N1"
FT                   /protein_id="ACI18216.1"
FT                   /translation="MWLNSEGKKRLWSLNNIDPTATATSIMELTNALGTLTTRVTTGVQ
FT                   LMVVNNLLP"
FT   gene            complement(379093..379191)
FT                   /locus_tag="COPRO5265_0413"
FT   CDS_pept        complement(379093..379191)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0413"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17661"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y7N2"
FT                   /protein_id="ACI17661.1"
FT                   /translation="MYAYTTTMFTRTGGEFRNGRSEENSKDCVVEQ"
FT   gene            complement(379532..380968)
FT                   /locus_tag="COPRO5265_0414"
FT   CDS_pept        complement(379532..380968)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0414"
FT                   /product="conserved carboxylase domain protein"
FT                   /note="identified by match to protein family HMM PF00682;
FT                   match to protein family HMM PF02436"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17860"
FT                   /db_xref="GOA:B5Y7N3"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR003379"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y7N3"
FT                   /protein_id="ACI17860.1"
FT                   /translation="MGIQLHDQTLRDGHQSLLATRLRTEDMLDVAPLMDEVGFFSVEVW
FT                   GGATFDAAMRYLNEDPWQRLQVLREKFKKTPLQMLLRGMNLVAYRNFPDDVVEEFIRLS
FT                   RKNGIDNFRIFDALNDLRNLEVPIKAVKKYGGHAQGALSYTESPVHTVEYYVENFKKLA
FT                   EMGCDSLVIKDMAGIISPRRAKEIIEGIKAAGIDLPLELHSHCSSGMTEMAYMEAIHAG
FT                   IDILDTCMSPFANGVSQPPTESIVAALQSTQWDTGYDLKLLMRIREKLMVVWNKYSHLH
FT                   EETLLRPDPGVLEYKIPGGMMSNMISQLRNMNALDKLPQILQEVPVVWREFGYPPLVTP
FT                   MSQIVGSQSVANIIGGERYKIVPKETKDYLRGMYGRPPAPIDEDVLQKVFGPNWKDQII
FT                   TVRPADLLEPELERRREELKKMGLLKKEEDVLTYTIFPDVALRFFRGEIQPEFTSKDLP
FT                   LKKKVFEVDIGDTTYKVRLN"
FT   gene            381107..381661
FT                   /locus_tag="COPRO5265_0415"
FT   CDS_pept        381107..381661
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0415"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ACI16912"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y7N4"
FT                   /protein_id="ACI16912.1"
FT                   /translation="MKTKNIVLLIVVFFMVLGAPFSWAASSIDRLALESYPSFKAERVY
FT                   GGTVAEVTREYSTLLNSVPYPGFEALNLRYLYITGQNEPVWKACQNGAMSSFFTSVRFY
FT                   CYDLAWAHDRETAIQMGSAERFYYYDLFVYEQDPREHLTRVMLTAWRNGQIMREAAALA
FT                   RSLNLQDVANLYDHTTQSPAN"
FT   gene            381615..382505
FT                   /locus_tag="COPRO5265_0417"
FT   CDS_pept        381615..382505
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0417"
FT                   /product="O-antigen polymerase family"
FT                   /note="identified by match to protein family HMM PF04932"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17259"
FT                   /db_xref="GOA:B5Y7N5"
FT                   /db_xref="InterPro:IPR007016"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y7N5"
FT                   /protein_id="ACI17259.1"
FT                   /translation="MWQTFTTTLRRALPTKWELLFVLFVACYNTVFSLAPWRTLLFWLL
FT                   VPLVYCFIVFVIAVLPEHVDSRKLAFITGFFLVISFLWTVYKNGGVVNFSGWRTFRLTL
FT                   PFFVSTTSAAFFTYFFLYAYNQHVFWAELFSLVSLLLTQSRGPILGLAMAFLYGGVNLY
FT                   WFIALTAFIVYAIPYTLREFVGPYAFYTQRFHIWRAAWDMFVMRPFSGVGFATFPLALK
FT                   VYSHPFLFQFFPFNHAHNILLQLLAELGIAGPVVFIILLKNIYRTFPPADTKNGLFLRM
FT                   ALVSYLGRNIFDVTP"
FT   gene            complement(382473..382976)
FT                   /locus_tag="COPRO5265_0416"
FT   CDS_pept        complement(382473..382976)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0416"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18060"
FT                   /db_xref="GOA:B5Y7N6"
FT                   /db_xref="InterPro:IPR024529"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y7N6"
FT                   /protein_id="ACI18060.1"
FT                   /translation="MKRLTRLAIFVALAFVFFKLEIPYPVPNYEFLKLDLGEAFLLLGT
FT                   WLFPLEDSLMALTVWAFLGYLTGSNPVGMLFKVVCILATLIPYHYLKGSKSKWILVPAI
FT                   RTGVMVLFNWVFTPMLWGLPTHMLPAYILIGVIPVNLLQAYLNLAVAEMSAKYLRSHIK
FT                   DIAT"
FT   misc_binding    complement(383029..383157)
FT                   /bound_moiety="flavin mononucleotide"
FT                   /note="FMN riboswitch (RFN element)"
FT   gene            383310..383858
FT                   /locus_tag="COPRO5265_0419"
FT   CDS_pept        383310..383858
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0419"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ACI16794"
FT                   /db_xref="GOA:B5Y7N7"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR007848"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y7N7"
FT                   /protein_id="ACI16794.1"
FT                   /translation="MDSVLLPHLIEGRFVTAVELGAGCGIMALQLFAHGKTTLLHLAES
FT                   NPLLFEALRLTTAINALDGFFMLYQTDVENLRVSGDLVYFNPPYGRGKVGKGERWQPFM
FT                   TFLEKNRYKEVAYICPPQLDSIFSQFLGSRMNLRKEVQIWYKHSMRIVKQWTYEKVTPL
FT                   RKALVVPSEETEQMYWDCP"
FT   gene            383887..384234
FT                   /locus_tag="COPRO5265_0420"
FT   CDS_pept        383887..384234
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0420"
FT                   /product="membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17819"
FT                   /db_xref="GOA:B5Y7N8"
FT                   /db_xref="InterPro:IPR003811"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y7N8"
FT                   /protein_id="ACI17819.1"
FT                   /translation="MHIVFACIVGFLSGSILWSYLLGQLFYDVDIRNYGLDRNPGAMNA
FT                   FRAKGFWLGASGGLLDALKGFLPASKHKRASAAVVLDAPSVGALYGFCIAHCGNLKWKA
FT                   GSALSLLEQDK"
FT   gene            384231..384890
FT                   /locus_tag="COPRO5265_0421"
FT   CDS_pept        384231..384890
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0421"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF00590;
FT                   match to protein family HMM TIGR00096"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17210"
FT                   /db_xref="GOA:B5Y7N9"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR008189"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5Y7N9"
FT                   /protein_id="ACI17210.1"
FT                   /translation="MIYLVGTPLGNLEDITLRAIRVLGEADVVACESKERALKLLSHLQ
FT                   IKKPLIYLREASRASDVKRIIELHKQGKTVAVTTDAGMPGISDPGAYLVRELSAQGIPF
FT                   TVVPGPSALCMSITVSGLEEPWAFLGFLPLKEGKRRRELEKFLPLNIGLVIYEGPHRVG
FT                   KLLSLLNELCPQRKVALLRELTKLHEEVQVGYPHELIKDSYKGEFVVVVYPSQEGT"
FT   gene            384853..385491
FT                   /locus_tag="COPRO5265_0423"
FT   CDS_pept        384853..385491
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0423"
FT                   /product="molybdopterin-guanine dinucleotide biosynthesis
FT                   protein A, putative"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17351"
FT                   /db_xref="GOA:B5Y7P0"
FT                   /db_xref="InterPro:IPR013482"
FT                   /db_xref="InterPro:IPR025877"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y7P0"
FT                   /protein_id="ACI17351.1"
FT                   /translation="MWWWSTHHRKVLNMSSSTAVVILCGGVSRRLGVSKALMQVNGKPL
FT                   FKVVEENLSPLGLPVYLVSKVPFESGGVPLILDIFEADTPLAGVLTALTTLQYQNYLFT
FT                   AVDMPILRKEASLSLLKHAYEHESSVFYSINGFLQPFPSLVQGSVAKHILACYHQHLYK
FT                   LTEVFSSIPHVLLPYTGDLNVFLNVNTWKDWESFQASAPYYLPMHDHFA"
FT   gene            complement(385279..385371)
FT                   /locus_tag="COPRO5265_0422"
FT   CDS_pept        complement(385279..385371)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0422"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18068"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y7P1"
FT                   /protein_id="ACI18068.1"
FT                   /translation="MRNRGEDFSELVKVLVVACQNVLGHAALYK"
FT   gene            385567..386025
FT                   /locus_tag="COPRO5265_0424"
FT   CDS_pept        385567..386025
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0424"
FT                   /product="heat shock protein Hsp20"
FT                   /note="identified by match to protein family HMM PF00011"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18181"
FT                   /db_xref="InterPro:IPR002068"
FT                   /db_xref="InterPro:IPR008978"
FT                   /db_xref="InterPro:IPR031107"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y7P2"
FT                   /protein_id="ACI18181.1"
FT                   /translation="MLSRRWIDPFEEMRSIIDEMDRMMEEFWSTGIEPSRPARRGLGRR
FT                   FVPPVEVTEDENNVYVRAAVPGVPKDKLEITVEEDRVYLKGELQEQKKEEKEGVFYSEM
FT                   RYGTFERAIALPTTVKAEEAKAEYRDGVVELTLPKKAPESKGVKIRLE"
FT   gene            complement(386103..387677)
FT                   /gene="mviN1"
FT                   /locus_tag="COPRO5265_0425"
FT   CDS_pept        complement(386103..387677)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mviN1"
FT                   /locus_tag="COPRO5265_0425"
FT                   /product="integral membrane protein MviN"
FT                   /note="identified by match to protein family HMM PF03023;
FT                   match to protein family HMM TIGR01695"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17850"
FT                   /db_xref="GOA:B5Y7P3"
FT                   /db_xref="InterPro:IPR004268"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y7P3"
FT                   /protein_id="ACI17850.1"
FT                   /translation="MRYNEFVASKLNLSKKQSVVALSVSTMWSKVFGFFREMLTAFYFG
FT                   AGVVKDAFNVSQAIPTRIGSAFFGAINSSLLPYLIHLRNQEGEEAFWKAYSSIYRWLVT
FT                   LLLLFTALMMIVPQPFIAILAPGFYNDPQRLSLTVFFIRFTALIFLFQVLSSMQITLLQ
FT                   IFENFLPQIGINLFASASGVLVLALAGALHGATPTALALSALTTGFATFAIAYYMSLPY
FT                   RANLKPSGLWNRYVSDYLKFLLPILAGQVVIISFTLVDQLMASFLPVGNISALNYASLL
FT                   YNLPITLFAVPITSVLYPAISSASAKMDWPEQASAVSRGIQLIWLIVLPSAVGLASLAL
FT                   PIVKLVYMRGAFDIAAATLTSGALLFYALGVPFLGLQNLLAIVFLSEKDNITPLKRNIF
FT                   GIVLNAFLNYFFGIRLHMNAAGFAIGTAISWTVLCLWLYISWARRHQIQTLRIVKALWK
FT                   STAAAVLMLLVILVWKLYLPYEGLNLIVLIVVAALVYFAGLLLLKDENMQDLLGMALKK
FT                   VKKYTKT"
FT   gene            complement(387769..388896)
FT                   /locus_tag="COPRO5265_0426"
FT   CDS_pept        complement(387769..388896)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0426"
FT                   /product="capsular polysaccharide biosynthesis protein"
FT                   /note="identified by match to protein family HMM PF00534"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17095"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y7P4"
FT                   /protein_id="ACI17095.1"
FT                   /translation="MKRVLFVATVESHLLNFHIPFMKLLQGKDYEVHVATKLGNRQQEF
FT                   DDIGVIKHNVDFSRSPYSPKVFKSLQQMEKLLKEIRFSLVHVHTPVAAFITRLACQRTN
FT                   THPVLYTAHGFHFYKGAPLKNWLLYYNMEKLAAHWTDGLITINEEDYKAAQKFKLRRNG
FT                   KVFFVPGVGVDIANLEQRGASIDRSEKRKELGISELSTVLITVAELIPRKNHIQVLKAL
FT                   SKLNKTNFHYLVVGNGESEQQLKKAVNELMLQDKVSFLGFRRDVAELMASSDIFILTSR
FT                   HEGLTRALMEAMAVGLPIIATDVRGNRDLVKSGENGYLVPLDDAEQTAIAIERLINSGN
FT                   LRRSMGEKSKELVKQYDLQNIIPQMEEIYDLFLSR"
FT   gene            complement(388893..389837)
FT                   /gene="wlaD"
FT                   /locus_tag="COPRO5265_0427"
FT   CDS_pept        complement(388893..389837)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="wlaD"
FT                   /locus_tag="COPRO5265_0427"
FT                   /product="putative glycosyltransferase"
FT                   /note="identified by match to protein family HMM PF00535"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17228"
FT                   /db_xref="GOA:B5Y7P5"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y7P5"
FT                   /protein_id="ACI17228.1"
FT                   /translation="MEKQPITVDIVIPTYKRPKLLCRAIESAVEQTYPYILQIIVTDDA
FT                   CDIETKQIVESYMNKDSRICYVCNTRYKHGPAGNKDNGMDFVKSDYFLILDDDDSLVPD
FT                   AVERLVSIASQGNFDFVLANCRDSNGNYTGKHCGKSELVHYEDFLCGKFEGEYLWLYPS
FT                   KAIPKLKFDDALYGGEAISIWEAIKGSKVFYLHLPLRKYTTQGVRVSSDYLSKSHLWFP
FT                   IYLRTLDKFGDDLATYCPRRLLYFTLLLFSYGKLSGQIKQVTKYPIKYLKKTKNFAFIL
FT                   PYFVVPVPKAILLQMWKGLRAMRAKRKQRNRIK"
FT   gene            complement(389874..390992)
FT                   /locus_tag="COPRO5265_0428"
FT   CDS_pept        complement(389874..390992)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0428"
FT                   /product="glycosyl transferases group 1"
FT                   /note="identified by match to protein family HMM PF00534"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17277"
FT                   /db_xref="GOA:B5Y7P6"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y7P6"
FT                   /protein_id="ACI17277.1"
FT                   /translation="MEKNRTPDVTFFMPNLQGGGAERVMVNIAKGLSEHALKVDFVLAK
FT                   AEGPYLRELPASINVVDLQCKRTRYAISALSSYLRQREPHVLISALHQANLVAAMAKER
FT                   ASSNVRLVVTIHSQMSEEMIHTPGLAGKFIPLLVRAFYPKADKIICVSNGVAQELINKY
FT                   HLPKNKVQVIYNPVVTEDMFKKAEEPVNHPWFQPGQPPVILGVGRLHPQKDFPTLIKAF
FT                   ALVRKKTEARLMILGEGSERAKLEQLVKQLGLQNDICMPGFVDNPYKYMKHSSVFVLSS
FT                   RWEGFGNVLAEALALGLPVVSTDCPSGPAEILENGKWGRLVPVGAPKALADAILAAMSD
FT                   ETSKGVERAKEFSLDKIVDQYCKLIQTFLQAS"
FT   gene            complement(391060..392193)
FT                   /locus_tag="COPRO5265_0429"
FT   CDS_pept        complement(391060..392193)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0429"
FT                   /product="glycosyl transferase, group 1 family protein"
FT                   /EC_number="2.4.-.-"
FT                   /note="identified by match to protein family HMM PF00534"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ACI16973"
FT                   /db_xref="GOA:B5Y7P7"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y7P7"
FT                   /protein_id="ACI16973.1"
FT                   /translation="MKTIHDPLLNLRQFHIALFLPNLGGGGAERVFANLGNAFVEKGMV
FT                   VDFVLGKAEGPNLSQIDRRINVVDLGTNTVYGWLRPMKSYLKERHPELVLSALHHANLT
FT                   ALWANMLSGKKTRIIVSVHGTMSHDIGKSKKKLAKAIPLLVRAFYPKADKIICVSNGVA
FT                   QELINKYHLPKNKVQVIYNPVVTEDMFKKAEEPLDHPWFQPGQPPVILGVGRLTAAKDF
FT                   ETLIKAFALVRKKTEARLMILGEGSERAKLEQLVKQLGLQNDVCMPGFVDNPYKYMKHS
FT                   SVFVLSSRWEGLPTVLIEALALGLPVVSTDCPSGPAEILEGGKWGKLVPVGSPEALANA
FT                   ILEALNDERGKGAERAKEFSLDRIVDQYVALIKELEQ"
FT   gene            392396..393748
FT                   /locus_tag="COPRO5265_0430"
FT   CDS_pept        392396..393748
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0430"
FT                   /product="udp-glucose 6-dehydrogenase (udp-glc
FT                   dehydrogenase)(udp-glcdh) (udpgdh) (teichuronic acid
FT                   biosynthesis protein tuad)"
FT                   /EC_number="1.1.1.22"
FT                   /note="identified by match to protein family HMM PF00984;
FT                   match to protein family HMM PF03720; match to protein
FT                   family HMM PF03721; match to protein family HMM TIGR03026"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17801"
FT                   /db_xref="GOA:B5Y7P8"
FT                   /db_xref="InterPro:IPR001732"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR014026"
FT                   /db_xref="InterPro:IPR014027"
FT                   /db_xref="InterPro:IPR017476"
FT                   /db_xref="InterPro:IPR028357"
FT                   /db_xref="InterPro:IPR036220"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y7P8"
FT                   /protein_id="ACI17801.1"
FT                   /translation="MKITVIGGGYVGLTTGICFSYVGHDVDIVEKDHARFSALELGKLP
FT                   IYEPGLDDLLQKSRSRITFSNKVNRALLNGSELIVIAVGTPPKDDGDADLTFLHAAVEE
FT                   VISYLDRSAQAVVAIKSTVPVGTNDMLAEKFGLILAGHRVQFVSNPEFLREGHAVYDTL
FT                   YPDRIVVGARDRDAVGVLREAYGPILQRSFVKPDFITDGTEKDLPYFIVTTPKSAELVK
FT                   YASNAFLALKISYINEIAMLCEKVGANVRDVALGMGTDSRIGRSFLNAGIGWGGSCFPK
FT                   DTSALIRTSEKHGSELSIVRAAVKVNDNMKDYFVKNVESTLGDLQGKTVAVLGLSFKPN
FT                   TDDVRDSPAMELVDRLVKKGAVVKATDPIAIENARKVLPESDKVIYEEDVYKALEDVDC
FT                   VLITTEWPHWSKLNFERMARIVRQKLIFDGRNCLDKELLEGLGFFYKGVGR"
FT   gene            393675..393788
FT                   /locus_tag="COPRO5265_0431"
FT   CDS_pept        393675..393788
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0431"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17616"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y7P9"
FT                   /protein_id="ACI17616.1"
FT                   /translation="MTGGTVWTKNFLKGLVFFIKEWEDEKSIGDWWRRIYR"
FT   gene            393745..394683
FT                   /locus_tag="COPRO5265_0432"
FT   CDS_pept        393745..394683
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0432"
FT                   /product="dTDP-glucose 4,6 dehydratase"
FT                   /note="identified by match to protein family HMM PF01073;
FT                   match to protein family HMM PF01370; match to protein
FT                   family HMM PF02719; match to protein family HMM PF04321;
FT                   match to protein family HMM PF07993"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ACI16921"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y7Q0"
FT                   /protein_id="ACI16921.1"
FT                   /translation="MKRVLVTGGAGFIGSHLCERLLNEGNEVFCMDNLETGSIRNIETF
FT                   KENPLFHFIQQDVIEPIELRVDEIFNFACPASPPRYQKDPVHTLKTSVLGALNLLELAT
FT                   NTGAKIMQASTSEVYGDPAISPQPETYWGNVNPIGPRSCYDEGKRCAETLFFDYGRQFG
FT                   TKIKVIRIFNTYGPRMDPEDGRVVSNFIAQALKNEPLTVYGDGSQTRSFCYIDDLIEGI
FT                   MSMMQTDESFSGPVNLGNPEEVTVLEVAKLVLELTCSKSEIEFRPLPQDDPKRRKPDIT
FT                   LARQTLGWEPTVKLKEGLITTIQYFRECLRF"
FT   gene            394668..395711
FT                   /gene="pssF"
FT                   /locus_tag="COPRO5265_0433"
FT   CDS_pept        394668..395711
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pssF"
FT                   /locus_tag="COPRO5265_0433"
FT                   /product="putative glycosyltransferase protein"
FT                   /note="identified by match to protein family HMM PF00535"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18105"
FT                   /db_xref="GOA:B5Y7Q1"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y7Q1"
FT                   /protein_id="ACI18105.1"
FT                   /translation="MSAFLGVNPVVNNEKNSLPLVSIIIDNYNYGRFIQDAIESALNQT
FT                   YPNIEVIVVDDGSTDNSREIISRYASAGLVKAVLKENGGQASAMNAGFEVSSGDLVVFL
FT                   DSDDVLKPEAIEVAVKTWHPGVSKVQWRLEAIDGQGSSIELFFPPLNAHLLNGNVQHIA
FT                   KRWFYFGLSPQSGNLYPRDFLEIAMPLPEEEWRICADYPLIAAAVFYGEIISLPDVLGL
FT                   YRLHGGNAVGKKSAKISVVLEQNDKVRRYLHERFCRFAKGIVSSGLDEKRLKLVNAILS
FT                   KENGIPYVSRVRTGFCGALDSLVYPFFTSFSKRVLSFIWFLLVGVLPSSLAKFVAVQGI
FT                   PDGNTVG"
FT   gene            396281..396955
FT                   /locus_tag="COPRO5265_0434"
FT   CDS_pept        396281..396955
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0434"
FT                   /product="UDP-galactopyranose mutase"
FT                   /note="identified by match to protein family HMM PF03275"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17459"
FT                   /db_xref="GOA:B5Y7Q2"
FT                   /db_xref="InterPro:IPR015899"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y7Q2"
FT                   /protein_id="ACI17459.1"
FT                   /translation="MKQWGFKPEQMDADVVGRIPVVLNYDSRYFQDRYQAVPREGYTQM
FT                   ITNMLSNKRIKVMLGTNFMDIAHLQEGKVYIMGQEFRGSVYYTGKVDELAGFVFGLLPY
FT                   RSFKLQFERINVEYFQDVAQVNYPNQYDFTRITEFKHIQPSESKDTVILKEYPLEHVHG
FT                   ENDPFYPVFNKESRGRYEKYAEFLQQYKQIILVGRLAEYKYYDMDDVVARALDVVEQAM
FT                   QG"
FT   gene            397060..397155
FT                   /locus_tag="COPRO5265_0435"
FT   CDS_pept        397060..397155
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0435"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17761"
FT                   /db_xref="GOA:B5Y7Q3"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y7Q3"
FT                   /protein_id="ACI17761.1"
FT                   /translation="MGYNGFNRLVIPISGTVLIMEYFLGFLEVKL"
FT   gene            397156..398295
FT                   /gene="glf"
FT                   /locus_tag="COPRO5265_0437"
FT   CDS_pept        397156..398295
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glf"
FT                   /locus_tag="COPRO5265_0437"
FT                   /product="UDP-galactopyranose mutase"
FT                   /EC_number="5.4.99.9"
FT                   /note="identified by match to protein family HMM PF03275;
FT                   match to protein family HMM TIGR00031"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17601"
FT                   /db_xref="GOA:B5Y7Q4"
FT                   /db_xref="InterPro:IPR004379"
FT                   /db_xref="InterPro:IPR015899"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y7Q4"
FT                   /protein_id="ACI17601.1"
FT                   /translation="MFKYIVVGAGLSGAVVAERIASQLNEKVLVLDRKPHIAGTCFDSK
FT                   DENGILVHRYGGHLFRTENEVVWSYLSQFTDWHYYQHRVLAWVDGKMVPLPFNFNSMDM
FT                   VFSAELASKLKEKLLNAYGLNTKVHVTKLIQSDDEDLRFLGEYVYEKVFIHYTLKQWGR
FT                   RPEEMEPEATINVPVLVGKDDRYYTARFQGVPRQGYTQMVQQMLSHKNIKLMLNTDFLE
FT                   LAEVKADGIYIMGKKYDGTIIYTGSLDELFGYRFGRLPFRSLDFCFETHDVEYYQGAAT
FT                   VHYPNNYDFTRIIEFKHIHPVDVKRTTICFEYPKEYTTENDERYYPVLTKESKATWLKY
FT                   ADLAREYHVIPLGRVGEFKYYNMSEAVESALRAFNDIAK"
FT   gene            complement(398276..398773)
FT                   /locus_tag="COPRO5265_0436"
FT   CDS_pept        complement(398276..398773)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0436"
FT                   /product="nucleoside diphosphate kinase (NDK) (NDP
FT                   kinase)(Nucleoside-2-P kinase)"
FT                   /EC_number="2.7.4.6"
FT                   /note="identified by match to protein family HMM PF00334"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17124"
FT                   /db_xref="GOA:B5Y7Q5"
FT                   /db_xref="InterPro:IPR001564"
FT                   /db_xref="InterPro:IPR034907"
FT                   /db_xref="InterPro:IPR036850"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y7Q5"
FT                   /protein_id="ACI17124.1"
FT                   /translation="MLIAERNAGRCYNIFMAEKTLVIYKPDAVRRNIIGEITTLFQDRG
FT                   LKMVGAKLGWYSREFWEEFYAEHKGKDFFERLVNYMSSGPIFITVWSGDDAVRVGRQLA
FT                   GATDPLQADPGSIRGRYGLPMPMNTVHCSDSLESAEREISLFFKTTKFLNGNKTSFTLL
FT                   CH"
FT   gene            398872..400587
FT                   /gene="polB"
FT                   /locus_tag="COPRO5265_0438"
FT   CDS_pept        398872..400587
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="polB"
FT                   /locus_tag="COPRO5265_0438"
FT                   /product="DNA polymerase beta family"
FT                   /EC_number="2.7.7.7"
FT                   /note="identified by match to protein family HMM PF02811"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17061"
FT                   /db_xref="GOA:B5Y7Q6"
FT                   /db_xref="InterPro:IPR002008"
FT                   /db_xref="InterPro:IPR002054"
FT                   /db_xref="InterPro:IPR003141"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR004013"
FT                   /db_xref="InterPro:IPR010996"
FT                   /db_xref="InterPro:IPR016195"
FT                   /db_xref="InterPro:IPR022311"
FT                   /db_xref="InterPro:IPR027421"
FT                   /db_xref="InterPro:IPR029398"
FT                   /db_xref="InterPro:IPR037160"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y7Q6"
FT                   /protein_id="ACI17061.1"
FT                   /translation="MTNQEVANLLRQIAKILEIKGDSTFRIRAYEEAATRVENLAEPIE
FT                   DIWKRGELTNVPGIGESIAAKIEEYLKTGKSSYLEEISKDIPKGLFEMMEVPGIGPRLA
FT                   WRLYTEAGIQSIEELERALVEHKLQGLRGFGAKMEKKLLDGIQMYRQLSGRIPLYLALP
FT                   IVHNVITYLKGHAKFVDIAPAGSLRRGRADIGDCDVLVATDDPIPVMEAFVKMPGVAQV
FT                   LAKGDTKASVFTGGLQVDLRAVPVESWGAALQYFTGSKAHNIKLRELAIKKGYKLNEYG
FT                   LFKMDTDEKVAGRTEEEIYNALGLPWIPPTMREDRGEIELAMTGKLPRLVEMKDIKGDL
FT                   HVHSTFSDGTDTVETMARKAKEMGYEWLVISDHATGLGVVGGLKPEDLPDYIAAIKEAE
FT                   KKVGIRIFVGLEGNIKADGTFLFTDDRVEVLIAAIHTALNQEKEKILDRYEKTFKEAKP
FT                   HIVAHPTGRILGRRGGLNVTSSEVLQLCNKYDVVPELNCTPMRLDIDDVGVLTAVTQYH
FT                   MPVALGTDSHDAEELVNMELGVIQAQRGWADPDHVINTWSAEKVEEWLRSGHKQ"
FT   gene            400660..401406
FT                   /locus_tag="COPRO5265_0439"
FT   CDS_pept        400660..401406
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0439"
FT                   /product="2,3-bisphosphoglycerate-dependent
FT                   phosphoglycerate mutase (phosphoglyceromutase) (pgam)
FT                   (bpg-dependent pgam) (dpgm)"
FT                   /note="identified by match to protein family HMM PF00300;
FT                   match to protein family HMM TIGR01258"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17738"
FT                   /db_xref="GOA:B5Y7Q7"
FT                   /db_xref="InterPro:IPR001345"
FT                   /db_xref="InterPro:IPR005952"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5Y7Q7"
FT                   /protein_id="ACI17738.1"
FT                   /translation="MYKVVMIRHGESEWNKLNLFTGWTDVDLSDRGVEEAIWAGKKLKE
FT                   EGYTFDVAFTSVLKRAIKTLNLVLEQMNLDWIPVYKHWRLNERHYGALQGLNKAEMTER
FT                   YGEQQVLLWRRSYDVPPPPLEKTDPRWPGNDPRYALVPEDELPLCESLKDTEARVVPYW
FT                   ADMIVPAIKEGKKVLISAHGNSMRAIVKYLDKMSGEEIAKTNIPTGIPLVYELDESMRP
FT                   IRHYYLADEDFLKAKEQEVANQIYKK"
FT   gene            complement(401504..403006)
FT                   /locus_tag="COPRO5265_0440"
FT   CDS_pept        complement(401504..403006)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0440"
FT                   /product="copper amine oxidase N-domain family"
FT                   /note="identified by match to protein family HMM PF07833"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ACI16911"
FT                   /db_xref="InterPro:IPR012854"
FT                   /db_xref="InterPro:IPR036582"
FT                   /db_xref="InterPro:IPR039564"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y7Q8"
FT                   /protein_id="ACI16911.1"
FT                   /translation="MTKRIVRLTASACTLALLMCLVLLTPPPLVAAATLPAKAQLNVPY
FT                   MSQHYNIPIGFSPSRACGITSAAMLFAYYGRIAPFTITGADGNPTDYGWYMTRAYRYKS
FT                   PYHDVMWKYFANQEHRPGLQGWGAWGFIWRNGTDKTIADVIPFLNAHDISAQFIRQPSE
FT                   SYAKKLVMQEIAAGRPLMANTEIIGGHYVVIYGYDNTGEQFKYLVNDPWNGRKTYTYEE
FT                   LMVSQMYRGLILTAPANGFTARVPYSPGMGAAKSYVKPLRSSAAAPSTLYTYQLPLVVP
FT                   EKVTPTVMVYIDGKPHKMQPVEGTTYTGTYQYKTTLEAGNHNYYFVVTTPRYTVWFPPD
FT                   SGVWGQSQALLQFNGPFIEGAKQTTATTLELQIMNDKYLINGVPSFMDMPPIIKSGRTL
FT                   LPISHVVKALGGSTVWDKEKQKVTITMEGTKSATTVELWIGKNYAMVNGVKKPIDLGST
FT                   NVVPIIVNSRTMVPLRFVVETLGAAVTWNDSAKVITITYQKQ"
FT   gene            complement(403031..406240)
FT                   /locus_tag="COPRO5265_0441"
FT   CDS_pept        complement(403031..406240)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0441"
FT                   /product="copper amine oxidase domain protein"
FT                   /note="identified by match to protein family HMM PF07833"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18110"
FT                   /db_xref="InterPro:IPR012854"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR036582"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y7Q9"
FT                   /protein_id="ACI18110.1"
FT                   /translation="MIKSATQDKQNKSFRVIKSILTLLLLVALCLPVGTFGIESNTSTR
FT                   PQMSVAALSSESMIVNNDTATTAKNTPVTIDVLANDSDLEGGMLWLASVSTPSHGTVAI
FT                   NSDFSITYTPEQDWIGTDKFTYTVVKSTGEAGYGEVTVVVIENNPPVAMEDKILTRIGQ
FT                   EVVFSPTANDLDPENDDFYIIEISQPNNGYVQLLTPTTVSYTPYPWYKGTDSFTYTVRD
FT                   TMGATSMSTVTIYVSSEGNMFAAVADAFKTMEETTTVVNPLQNDILAEGQQISISVVEP
FT                   PQHGIISFLEDQRISYTPTTNWYGIDEFSYRLIDSMGRHETATVLVQVLPVQDPPVAIK
FT                   DQVVTTRNTEVVISPLSNDYDPDGDHILLNGFFQPANGTAQDLGDGRVLYTPKSDWIGF
FT                   DSFIYIISDGNGHTAIGTVYIEVTEQNHSPVAVNDRVSTPKNTPITVPVLDNDYDPDGD
FT                   QLVVEEVGSPRYGSAIIDADNNIEYVPPLDWAGEDSFLYTISDGQGGKSVGVVTITVIE
FT                   ETKVLPPVASDDSAATDQNIPVDIRVLANDTDPNGLHLTIYGASKPSHGTIVILAEEGI
FT                   IRYSPENNWFGTDTFTYTVVNAEGLTSQARVTVTVRGVQQEVNRNPVAKNDTATTGKNN
FT                   AIKIYVLANDYDTDGDRLNIGSVTQPQNGKVTINSDRTVTYTPNKDFSGTDTFTYTVID
FT                   GKGGKSVGTVTVQVIAPNSAPTANNDTAYTRINTAVKINVLANDKDPDGDALTVEITLK
FT                   PKNGSARVNTDNSVTYTPNKGFYGTDSFTYTVQDGKGGKATAVVTITVTNPTTSKKNVV
FT                   ITLRVGTTKYYVGEQPKYLDSQPIIKGGRTLLPIRFIVEAMGGSVAWYPQDRRVVVQLG
FT                   SDMIELWIGKNKARVNGKEQAIDPNNPQVVPEIVNSRTMVPLRFVAEKLGAEVGWFDKT
FT                   KHIVVIYGPYKTALFRLGNSEYLANSNMLNSRIPPMMKNNKVFFDPQPVIEHFGGSFTW
FT                   NSASRTLTIRLGSRSLTHTVGTNYAVVNGARTSLDSSNSQVASMVVNQRPLLPADFVAR
FT                   SMNIGFVWDSMTQTLFMFYKK"
FT   gene            complement(406366..407769)
FT                   /gene="gltX"
FT                   /locus_tag="COPRO5265_0442"
FT   CDS_pept        complement(406366..407769)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gltX"
FT                   /locus_tag="COPRO5265_0442"
FT                   /product="glutamyl-tRNA synthetase"
FT                   /EC_number="6.1.1.17"
FT                   /note="identified by match to protein family HMM PF00749;
FT                   match to protein family HMM TIGR00464"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ACI16900"
FT                   /db_xref="GOA:B5Y7R0"
FT                   /db_xref="InterPro:IPR000924"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR004527"
FT                   /db_xref="InterPro:IPR008925"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020058"
FT                   /db_xref="InterPro:IPR020751"
FT                   /db_xref="InterPro:IPR033910"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5Y7R0"
FT                   /protein_id="ACI16900.1"
FT                   /translation="MSVNDSTHIKTRFAPSPTGYLHVGGARTALFNYLFAKKFGGTFLL
FT                   RIEDTDPERSKPEYSEQILISMKWLGLDWDEGPYHQSERMHIYQQYTQKLLEEGKAYRC
FT                   FCTTEELEQMREQQRQQGLPTRYDGRCSRLTQEEIEERLNKGMPFAVRLKVPQDRGIIA
FT                   WDDMVKGHIEINSSELDDFILVRSDGTPTYNFAVVIDDHTMGVTHVLRGEDHIPNTPKQ
FT                   ILIYEALGWETPEFGHVPMILGKDKTKLSKRHGAVGVEAYRDEGFLPEALFNFLALLGA
FT                   SYDPDREVYTKQELIDLFDPKKIGLHPAVFDPDKLYYINREHMKMLPPEELLDRIRPFA
FT                   EAKGFQIEPYHLRLIPLLVERMRTLKDFVELADYIFTDDFTVDEKAQELLAKDLPLGGL
FT                   AEQLDATVWDADHIEAVLRQYAQDKGIKPRDYFPFIRAVISGKSVGPSLFHLMEAMPKD
FT                   MVLRRLRKS"
FT   gene            complement(407766..410396)
FT                   /gene="alaS"
FT                   /locus_tag="COPRO5265_0443"
FT   CDS_pept        complement(407766..410396)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="alaS"
FT                   /locus_tag="COPRO5265_0443"
FT                   /product="alanyl-tRNA synthetase"
FT                   /EC_number="6.1.1.7"
FT                   /note="identified by match to protein family HMM PF01411;
FT                   match to protein family HMM PF02272; match to protein
FT                   family HMM PF07973; match to protein family HMM TIGR00344"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17720"
FT                   /db_xref="GOA:B5Y7R1"
FT                   /db_xref="InterPro:IPR002318"
FT                   /db_xref="InterPro:IPR003156"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR012947"
FT                   /db_xref="InterPro:IPR018162"
FT                   /db_xref="InterPro:IPR018163"
FT                   /db_xref="InterPro:IPR018164"
FT                   /db_xref="InterPro:IPR018165"
FT                   /db_xref="InterPro:IPR023033"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y7R1"
FT                   /protein_id="ACI17720.1"
FT                   /translation="MYMSGDEIRSVYLSFFEEKGHLRLPSSSLLPDDPTLMFTSAGMVQ
FT                   FKPYFLGQAQPPAKRITTVQKCLRTGDLENVGHTSRHHTFFEMLGNFSIGDYFKKEAIL
FT                   WAWELVTQRFKLPPERLWVTIYQDDDESFDIWHNLVGLPENRIVRMGKEENFWGPPGPT
FT                   GPCGPCSEIHYDMGEEWPCDDPSKGPAAEGERFREFWNLVFTQYYQDENGNLSDLPRKN
FT                   IDTGMGLERMAAIMQGKPTNFETDLFQPIIEAIGQLTGKKYEENLVAFRVIADHIRALT
FT                   FAITDGAVPSNEGRGYVIRRIARRSVRYGLQLGKEEPFLYNIVPVVVEHYKNWYPELIG
FT                   GQDLSMKLIKQEEEAFLRTLSSSQRYLDELVQQMKKQGIKEVPAEEVFRLYDTYGLPLD
FT                   IIDDVLQENNLSTDKEKLNQIIEQYKEQSRASWKGGEAVLTDTIFTRLVGNIKTEFTGY
FT                   DQLEDSSTIIATVKDNSRTELHEGDEGAIIVEHTPFYAESGGQEADHGIITTETGTFRV
FT                   DDVQKVLGGNVIVHYGQVTSGVIKEGQQAFLQVDIERRKAMQRAHTATHLLHAALRRVL
FT                   GDHVRQGGSKVGPDWFRFDFSHFESMSPAQIQEVERLVNEQVLENKEVNIFFTSLDEAK
FT                   KMGAMALFGEKYGETVRVVEVPDWSMELCGGTHAKRTGDIGLFHIISESASSQGIRRIE
FT                   AITGKKALEHLWNLEKLVKDVAEELDTSKDMVVQKLQKLNQDLKEKDKEIKHLIERVHT
FT                   AEGKELFTKAEEINGIKFINAVFPPRDPSALIIAVDAMRSFNKPFVAALGTLNNEKPVL
FT                   VLAASPDVAEKVNLREVVNMAASYIGGKGGGRPTLVQAGGTDASRLSVAVQQAIYECKR
FT                   RLGLA"
FT   gene            complement(410497..411471)
FT                   /locus_tag="COPRO5265_0444"
FT   CDS_pept        complement(410497..411471)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0444"
FT                   /product="polynucleotide adenyltransferase"
FT                   /note="identified by match to protein family HMM PF01743"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17083"
FT                   /db_xref="GOA:B5Y7R2"
FT                   /db_xref="InterPro:IPR002646"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y7R2"
FT                   /protein_id="ACI17083.1"
FT                   /translation="MVFTVFPPSINHLVTFTAETAYQIVRSLPDHTNFTIYNNNMDFLV
FT                   GGCLRDIILGKPPKDYDIISDAHVPFEPKVVLGKDVLTYRYIIGGKIVDVSSQLNLQKR
FT                   DFPMNAMALDFQGNYYDPRGGLEDLFNRQLSVEKERLEEDPIRVLRAAKLCAELGLTPV
FT                   GDKVDGLLLLRQVNEGRLYQEYLKMILSPEWLKAIEILKDFFQLPLKVPSTNLPPLAPI
FT                   RTSACEAHHYPELFGLPPKLTNLCWDLEHMDLADPPACLCTHGKKAVWGALVQSKPEVI
FT                   QLYKAWALFRHRAPKTPTTENPHKHYYDQCVAFLREKQELGDA"
FT   gene            411461..411892
FT                   /gene="rplM"
FT                   /locus_tag="COPRO5265_0445"
FT   CDS_pept        411461..411892
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplM"
FT                   /locus_tag="COPRO5265_0445"
FT                   /product="ribosomal protein L13"
FT                   /note="identified by match to protein family HMM PF00572;
FT                   match to protein family HMM TIGR01066"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17236"
FT                   /db_xref="GOA:B5Y7R3"
FT                   /db_xref="InterPro:IPR005822"
FT                   /db_xref="InterPro:IPR005823"
FT                   /db_xref="InterPro:IPR023563"
FT                   /db_xref="InterPro:IPR036899"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5Y7R3"
FT                   /protein_id="ACI17236.1"
FT                   /translation="MKTIMAKPGQVERKWYVVDAAGKPLGRLSAGIARILMGKHKPIWT
FT                   PGVDCGDFVIVINAEKVALSGSKELKKVYYDHSGYLGGQRVTPAWQLRQKKPEQLIYRS
FT                   VKGMLPKNSLGRRQITHLKVYAGPEHPHQAQQPEKIELP"
FT   gene            411919..412320
FT                   /gene="rpsI"
FT                   /locus_tag="COPRO5265_0446"
FT   CDS_pept        411919..412320
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsI"
FT                   /locus_tag="COPRO5265_0446"
FT                   /product="ribosomal protein S9"
FT                   /note="identified by match to protein family HMM PF00380"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18074"
FT                   /db_xref="GOA:B5Y7R4"
FT                   /db_xref="InterPro:IPR000754"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020574"
FT                   /db_xref="InterPro:IPR023035"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y7R4"
FT                   /protein_id="ACI18074.1"
FT                   /translation="MQAQAPVVGRRKRAVARVRLVPGTGRILVNGHDYKEYFHRVTLEK
FT                   VVEKPFEATGTLGQYDVFARVEGGGKSGQADAIRLGIARALVRLNPEWRKPLRQTKLVY
FT                   SLLTRDPREKERKKYGLHGARRARQYRKR"
FT   gene            412353..412431
FT                   /locus_tag="COPRO5265_1603"
FT   tRNA            412353..412431
FT                   /locus_tag="COPRO5265_1603"
FT                   /product="tRNA-Arg"
FT   gene            complement(412518..415868)
FT                   /locus_tag="COPRO5265_0448"
FT   CDS_pept        complement(412518..415868)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0448"
FT                   /product="endoxylanase"
FT                   /note="identified by match to protein family HMM PF00395"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17337"
FT                   /db_xref="GOA:B5Y7R5"
FT                   /db_xref="InterPro:IPR001119"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="InterPro:IPR032812"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y7R5"
FT                   /protein_id="ACI17337.1"
FT                   /translation="MRGKTKKLLVLVLTLSLVATFIAPLPVARGQEEPPDVVWVDDDWK
FT                   EAGTGSTVPVIGGTATIGENATATIQDAINLVAATGTVYVNTGTYIENLTISKPINLIG
FT                   VADENGEKPVITTATDSTNWTTIKLNSGASGTRIENLKLKVPEGLAPTNGKYYHNIDIN
FT                   EGVSDIQIMNCDFDANGFLVPTENNEKYKWGALAIYVPVTNPQAVITIDNCTFTNGYYV
FT                   TIGGYAKELTVRNSSISDVKSGINFENGGKLSIIDTDIEVVPRIVYGDSYAVRFGVNAG
FT                   TDQRNDMLDIEGGSFIVNNENNLSPDSQTDFAAIIISQNTEGTLRVANANIKGEVVNRS
FT                   TSTLYASGNYWGTDEGPFSATLAGPIVIYDWYADEQMTDLVSLDSVATKVPAHGSTGVA
FT                   LNAEVKLVFNYPVEMVSEPSITIGSLSNVSASLADDKKTVVITHPPFAYGTSYTVNVPE
FT                   GTFYAKIEKEEPVPLTALNAVAIDGPTVFNRAFSWSFTTAARPLPPPPPPPEEPTPPGA
FT                   EEPLPDSAIEEAISEAEETGEVVLSAPEGEDTLALTLDQLAIIGETEKPVVVNIGEVQM
FT                   ELPAAVVSNLAELTGAQVEIKVAELSSTAAEELHGQATNADQYKLAGAIFEITMELVKS
FT                   DGSREDITDLGGNVKVYVPVPSDKQELAAAGLLTVARFNENTEAWEEISSSFDQDTKCM
FT                   VFETTHFSKYAVLEKVLDTAAPTVVNTDPVNNATNVPIDKVIKVTFNEDVVSATNFDKI
FT                   TLADAKGATVAVTTTLTASVLTITPSDPLAYSTEYTVTIPAGAVKDTADNPLPKDVSFS
FT                   FTTMAEPDTTAPEVESTDPANGAVDVALDKVIKVTFNEDIVAGDAFADIVLKNAEGKEI
FT                   STKVEISGSDLTIRPNARLEYSTKYTVTIPAGAVKDVAGNPLKEAYTFSFTTVGLPTQT
FT                   FDDIQGHWAQHDIELMAGLGIAKGVGDNKFNPDGSVTRAEFVALLVRSLDVPVEPVSET
FT                   SFKDVPPDAWFAAEVEAAHKVGIAIGFEDGTFRPYAQVTREQIAAFIVRAMNWTVEEEE
FT                   VDALLSRFTDQAKISSWAKKEVAAAVQKGIVLGRPDGTFDPQANATRAEAVVMLKRVLQ
FT                   AAGVIPPNV"
FT   gene            416182..416970
FT                   /locus_tag="COPRO5265_0449"
FT   CDS_pept        416182..416970
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0449"
FT                   /product="conserved hypothetical membrane protein"
FT                   /note="identified by match to protein family HMM PF01925"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ACI16948"
FT                   /db_xref="GOA:B5Y7R6"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y7R6"
FT                   /protein_id="ACI16948.1"
FT                   /translation="MTQLLIVLVGLIAGVVTGLIGASGVMVIVPGLVMLGYGAADAIGA
FT                   SLFADTVASLVVSWTYYQAGNVNLRQGWWIAVGSVLGAQVGSYISPHIAESSLGGSFGI
FT                   FLIITAVIFALRGMGTVIGVNGQQVEAKREPNKLLKILRKNVVLSSLILGFLVGIISGL
FT                   LGAGGGVMILLILVFVLEYSMHEGVGTSTFIMAFTAASGAIGHAFTGNLPLEAAVLSGL
FT                   GTVIGGRFAARFANRVNEKVLSYIVGAIFGILGVAMLFGL"
FT   gene            417155..417724
FT                   /locus_tag="COPRO5265_0450"
FT   CDS_pept        417155..417724
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0450"
FT                   /product="acetyltransferase, gnat family"
FT                   /note="identified by match to protein family HMM PF00583"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17263"
FT                   /db_xref="GOA:B5Y7R7"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y7R7"
FT                   /protein_id="ACI17263.1"
FT                   /translation="MLEGNLVRLRAYERDDLEKARMIYNDPDVNKFLRLDVPYPLKVED
FT                   EVKWYEGLNPFGNGAYTFAIETIADGEFIGSCGIEAVDWKNSHASLGIFLGKKYWNKGY
FT                   GSDALSTLLDFCFSEMNLHRTYIYVFKFNERAIHTYEKIGFKVDATLRDNVFKDGKYQD
FT                   ELVMSILRSEWEEKKRKQTQAHDNER"
FT   gene            417669..418943
FT                   /locus_tag="COPRO5265_0451"
FT   CDS_pept        417669..418943
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0451"
FT                   /product="peptidase family M1, putative"
FT                   /note="identified by match to protein family HMM PF01433"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18252"
FT                   /db_xref="GOA:B5Y7R8"
FT                   /db_xref="InterPro:IPR014782"
FT                   /db_xref="InterPro:IPR034019"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y7R8"
FT                   /protein_id="ACI18252.1"
FT                   /translation="MNGKRRKESKLKHMTMKDDHRETHYNVELTLDPDQGLLHANVELL
FT                   CSSIEQQCSNLEFYLHKSMEVKSITGSVPITYQFDVEQPCSFPFTPDAGTLKIKLTQPM
FT                   EDDKLLRIWFEYEGNIGVPPWEVNRITPGWVELGFYATWFPYNPELKQFCYDVQVQIDP
FT                   GYEVIGLGEVKQLGEGLWYISQKQPSADMVVMASNRFCRLRDAESGLEMELDYVDVAKW
FT                   VIEDVFKKGLQALKWYSEWFGVTSSVDMRIVITPRTEGGGYARTGFIVLPRIGTESYKE
FT                   QEVSYFSNLAHECAHLWWANAPVNSWEDWLNESFAEYSALMAVRELFGTVHFESILAKK
FT                   LKRSEGMPPIKGIKRNEERAFTVLYDKGCLVLYELEQMAGRKKFIEVLRKTFQQKVSST
FT                   AEFVELVGADVSNEAKKKLNRLLSS"
FT   gene            419054..419587
FT                   /locus_tag="COPRO5265_0452"
FT   CDS_pept        419054..419587
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0452"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17336"
FT                   /db_xref="GOA:B5Y7R9"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y7R9"
FT                   /protein_id="ACI17336.1"
FT                   /translation="MKKLLTFLVAFLIVVLVHEGAHALVAAAYGELAAFQVHPYGFEVI
FT                   FKTPVAQRQGIEWGLISGVSNVITVLLGYLLLFFVKPIANMKNSFVSAVGYWLIVMFLL
FT                   LDPLNLSVGPFLYGGDIGGIVAGFGVNQYLVQILSFAIFLINRELVAQVLLPAYGIKTD
FT                   HPLFKPWIKLGSVS"
FT   gene            419595..420035
FT                   /locus_tag="COPRO5265_0453"
FT   CDS_pept        419595..420035
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0453"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18178"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y7S0"
FT                   /protein_id="ACI18178.1"
FT                   /translation="MAEVRKQKFKRGVFPLLLLGMILLFVFGCKGSDSSSVRIGFVGSN
FT                   YSNHMDYEFSTFTGTESNKFKAQKGDLIKPTYDVTLTKGKITIQLISPTKELVWKKDIQ
FT                   QNEQGMTELVLEESGWYTFLVTGKAAGGSFYLSWDVISKAEK"
FT   gene            420150..421022
FT                   /gene="rfbA"
FT                   /locus_tag="COPRO5265_0454"
FT   CDS_pept        420150..421022
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rfbA"
FT                   /locus_tag="COPRO5265_0454"
FT                   /product="glucose-1-phosphate thymidylyltransferase"
FT                   /EC_number="2.7.7.24"
FT                   /note="identified by match to protein family HMM PF00483;
FT                   match to protein family HMM TIGR01207"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ACI16791"
FT                   /db_xref="GOA:B5Y7S1"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR005907"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y7S1"
FT                   /protein_id="ACI16791.1"
FT                   /translation="MKGIVLAAGLNTRLYPVTVAVNKQLLPVYDKPMIYYPLSMLLMAG
FT                   IKDILVIADPYNVSAFQRLLGSGEHLGVKFSYAVQWIPRGIADAFIVGEWFVNGSKCAL
FT                   VLGDNVFFGPSLEKSVAEASQLKEGAVVFGYPVDDPRSFGVVEFDEQGNVISLEEKPQQ
FT                   PKSKYAVPGLYFYDNHVVEMAKALKPSARGELEITDLNKAYLEQGKLRVKVLSDDLQWF
FT                   DTGTHDSLLHASNEVARYQKETGHYVGCLEEVAYRQGFIDRDQLRALGMRYKNTAYGRY
FT                   LQAVADGLV"
FT   gene            421069..421533
FT                   /locus_tag="COPRO5265_0455"
FT   CDS_pept        421069..421533
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0455"
FT                   /product="tRNA-specific adenosine deaminase"
FT                   /EC_number="3.5.4.-"
FT                   /note="identified by match to protein family HMM PF00383"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17627"
FT                   /db_xref="GOA:B5Y7S2"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR028883"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y7S2"
FT                   /protein_id="ACI17627.1"
FT                   /translation="MTILGDDEKYMVEALKEAVKAYNEGEVPVGVVVVFNGVVVGRGYN
FT                   LREQSHDPTAHAEVVALRDAAAHMGRWNLSGATVYVTLEPCLMCCYALVLARVDRVVFG
FT                   ATDQKAGALVTHMDFLSLPFLNHRFEVRGGVLEKSCSKLLSSFFRKLRQG"
FT   gene            421603..421697
FT                   /locus_tag="COPRO5265_1604"
FT   tRNA            421603..421697
FT                   /locus_tag="COPRO5265_1604"
FT                   /product="tRNA-Ser"
FT   gene            421696..421794
FT                   /gene="srpB"
FT                   /locus_tag="COPRO5265_1605"
FT   ncRNA           421696..421794
FT                   /gene="srpB"
FT                   /locus_tag="COPRO5265_1605"
FT                   /product="Bacterial signal recognition particle RNA"
FT                   /ncRNA_class="SRP_RNA"
FT   gene            421891..423459
FT                   /locus_tag="COPRO5265_0458"
FT   CDS_pept        421891..423459
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0458"
FT                   /product="DNA polymerase III, gamma and tau subunit"
FT                   /note="identified by match to protein family HMM PF00004;
FT                   match to protein family HMM TIGR02397"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ACI16997"
FT                   /db_xref="GOA:B5Y7S3"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004622"
FT                   /db_xref="InterPro:IPR012763"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y7S3"
FT                   /protein_id="ACI16997.1"
FT                   /translation="MALYRKYRPQTFEEVVGQSHVTEILTKALDNQKISHAYLFAGPKG
FT                   SGKTSCARIFAKGLNCETGITSKPCNECESCKLINEGHSLDVIEIDAASNRGVDEIREL
FT                   RERVKYRPAQSRYKVYIIDEAHMLTREAFNALLKTLEEPPEYVVFILATTDPQKIPPTV
FT                   LSRCQRFRFKKLTSDEVFQILENVCKSEGFSYQREALELIAEVSDGAVRDALNLLEQIS
FT                   VVDEGKVSIKTARFLLNVVEDEVILDLLKTAFADMDEAVERLAELMESGVEPMELFRTM
FT                   KSLVRRSVFRNKPWPRDVALEMFRVLESYNFIMERTEFPAVALVALLNELRSKANLGTP
FT                   KGGESAPLSEKNADKEKTRVAEKPQEPAAETQKENKHSEKREELANDVEAEAVKEATES
FT                   ESKREVSDAAATTVTAVEEKESSQDATDLQSWIENVRSEYFPLYVVLREGKARIEGDRL
FT                   ILSFPGLLHMYGRFMELPQVQKVLHNYGHFKVELQTEAEEKDESVLEIFKQVFPEAQIE
FT                   EVKNN"
FT   gene            423456..424061
FT                   /gene="recR"
FT                   /locus_tag="COPRO5265_0459"
FT   CDS_pept        423456..424061
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recR"
FT                   /locus_tag="COPRO5265_0459"
FT                   /product="recombination protein RecR"
FT                   /note="identified by match to protein family HMM PF01751;
FT                   match to protein family HMM PF02132; match to protein
FT                   family HMM TIGR00615"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17798"
FT                   /db_xref="GOA:B5Y7S4"
FT                   /db_xref="InterPro:IPR000093"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR023627"
FT                   /db_xref="InterPro:IPR023628"
FT                   /db_xref="InterPro:IPR034137"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y7S4"
FT                   /protein_id="ACI17798.1"
FT                   /translation="MNLEELSKQFRRLPGVGPRTAEKMAYYWLTLEDDEAERFLRTLEN
FT                   FRRQITLCKRCHNLAVGSDLCNICQDNRRDKAIVVVETPQDVENIEQAGIYHGYYHVLH
FT                   GLISPRKGVTPEQLFISDLFDRIVDEGITQVIIATSFTMEGDITADYLAKQLKTLQPNI
FT                   PIYRLGTGLPVGGELNYADKATLRAAFITKQKVGEEND"
FT   gene            424054..425601
FT                   /locus_tag="COPRO5265_0460"
FT   CDS_pept        424054..425601
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0460"
FT                   /product="R3H domain protein"
FT                   /note="identified by match to protein family HMM PF01424"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17919"
FT                   /db_xref="GOA:B5Y7S5"
FT                   /db_xref="InterPro:IPR001374"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036867"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y7S5"
FT                   /protein_id="ACI17919.1"
FT                   /translation="MTKRVITDNLDEVLGILPPWIAEKLRMNPMLSDLVDIVLDLKRPV
FT                   VIRFSSSQEVWESDLVSEDDIQYVVQHIGTFGKDNRAGLEGTLHRISCIRNRQGRIIGL
FT                   SIRIGRAIYGVVDPLTPYFTQEKSVLLMGKPGVGKTTLLREVARLLSVDYQKRVIVVDT
FT                   SNEIAGDGDVPHPAIGLARRMQVPVPEQQHDVMIEAVENHMPEVIIVDEIGRKEEVDAA
FT                   RTIAERGVQLIATAHGNTLENILVNPTLSDLVGGVQVVTLSDEEAHRRGTQKTILERKT
FT                   SPTFDILIEIRARGVYAIHEDVERAVDSLLRGIPPNPLVLRVKDDGTVESGYEQTLPPA
FT                   VEVASEEIGAGRKRGRRGGEIRILPLGLSRSKLEKAIANLGVPAVIVEEVDDADMVLTL
FT                   RSHMNKGYQRLREAKAKNVPIKTIKSNTMSQMEDFLTTLFSLTPEQMEAEVEEALREAE
FT                   EAAMHTVEDQKRRELRPAPHRIRRLQHELIAKYGLLSFSVGEEPYRRVVVIYPGAEE"
FT   gene            425603..426184
FT                   /gene="tmk"
FT                   /locus_tag="COPRO5265_0461"
FT   CDS_pept        425603..426184
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tmk"
FT                   /locus_tag="COPRO5265_0461"
FT                   /product="thymidylate kinase"
FT                   /EC_number="2.7.4.9"
FT                   /note="identified by match to protein family HMM PF02223;
FT                   match to protein family HMM TIGR00041"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17900"
FT                   /db_xref="GOA:B5Y7S6"
FT                   /db_xref="InterPro:IPR018094"
FT                   /db_xref="InterPro:IPR018095"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR039430"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5Y7S6"
FT                   /protein_id="ACI17900.1"
FT                   /translation="MFIVVEGIDGCGKSTVASLLAAEIGKKRPVFHTFEPGHVRDGLYR
FT                   ELIMENVDNPFVVAALFTIDRAEHVKKMIKPALAKGEWVVCERYADSTLAYQGYGMGLD
FT                   KELINRMNEEAIDGLWPDKIFYLDIEPHLALARLQNKEKDALEGQGLEFLQRVREGYEE
FT                   IARTRGYIYMDATLPPEIIVKRILEEVKLQ"
FT   gene            426181..426507
FT                   /locus_tag="COPRO5265_0462"
FT   CDS_pept        426181..426507
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0462"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ACI16907"
FT                   /db_xref="InterPro:IPR010375"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y7S7"
FT                   /protein_id="ACI16907.1"
FT                   /translation="MKLFITILQEEDYRVLAERLTEKGIYHTRIAGEGGFLGGRKVVLL
FT                   SAVEDDAVNTMLAIIKESCSEREETILAEAPSGFIGMSIPIPMKVHTGGAVVMILPLDQ
FT                   IIKV"
FT   gene            426504..427202
FT                   /locus_tag="COPRO5265_0463"
FT   CDS_pept        426504..427202
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0463"
FT                   /product="DNA polymerase III, gamma subunit-related
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17673"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y7S8"
FT                   /protein_id="ACI17673.1"
FT                   /translation="MSDLPSALVYSLVTRMSAPVALVGPDWQEAYEVIREKIGRVSPQD
FT                   LLEIQGETLGIDAVRTIEEFLAFVPGSGVKYVLVLGGDNLTPEAQNAFLKTLEEPPRYA
FT                   RVLLFCQRWSNLLPTVRSRVVNIPLPAKTRTELRTKSAWEYLMSSGSKNALEQLRNNYD
FT                   WALKVADKELLFSKDIDSYKLAAFYLLLMEQKASVMLLKDMLELEAALHYNVNTEMIFD
FT                   RMLMTGVKVK"
FT   gene            427199..427996
FT                   /locus_tag="COPRO5265_0464"
FT   CDS_pept        427199..427996
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0464"
FT                   /product="PSP1"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17429"
FT                   /db_xref="InterPro:IPR007557"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y7S9"
FT                   /protein_id="ACI17429.1"
FT                   /translation="MKYLVRTMFSQKPGFIETDVPLEKGLRIKVVKEYGEVPAVVVGAW
FT                   RYECDTLWGYGGSLEGVDLAALESDVRESLEFLRHEGKNSLNIAIFAAEETVDRQTLQA
FT                   YFVAEGRVDFRDLVRNFQKQFNKRLRLWQVGVRDRSQMVGGIGVCGQLLCCHAFLKDFE
FT                   SISVNMAKEQGLLLNPDKITGTCGRLLCCLRYEHHWYCEAFANLPEQGSRVKVKKDGQV
FT                   KEVRIVTRNAVLRTAYVSDDEGNMFWVDFEEIDTTCGMTQKGE"
FT   gene            complement(428005..428094)
FT                   /locus_tag="COPRO5265_1606"
FT   tRNA            complement(428005..428094)
FT                   /locus_tag="COPRO5265_1606"
FT                   /product="tRNA-Leu"
FT   gene            428237..428656
FT                   /locus_tag="COPRO5265_0466"
FT   CDS_pept        428237..428656
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0466"
FT                   /product="conserved protein"
FT                   /note="identified by match to protein family HMM PF04472"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ACI16784"
FT                   /db_xref="GOA:B5Y7T0"
FT                   /db_xref="InterPro:IPR007561"
FT                   /db_xref="InterPro:IPR023052"
FT                   /db_xref="InterPro:IPR038594"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5Y7T0"
FT                   /protein_id="ACI16784.1"
FT                   /translation="MAEGGFWKKLTNFFTASEEDEDIIEEDYMDEGYEAEEGTGFVPVQ
FT                   TRAVPVGSTIWVYQPSSFSFDVDSSFIGARIKDGYIIILNLQDLDDLSAQRLIDFVSGA
FT                   LYSVEGKLKAISSSVFLLVPKNVRVESFNEGFGTE"
FT   gene            428634..429086
FT                   /gene="smpB"
FT                   /locus_tag="COPRO5265_0467"
FT   CDS_pept        428634..429086
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="smpB"
FT                   /locus_tag="COPRO5265_0467"
FT                   /product="SsrA-binding protein"
FT                   /note="identified by match to protein family HMM PF01668;
FT                   match to protein family HMM TIGR00086"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17321"
FT                   /db_xref="GOA:B5Y7T1"
FT                   /db_xref="InterPro:IPR000037"
FT                   /db_xref="InterPro:IPR020081"
FT                   /db_xref="InterPro:IPR023620"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5Y7T1"
FT                   /protein_id="ACI17321.1"
FT                   /translation="MKVLAQNRRARHDYQILETYEAGIVLSGDEVKSAKEGNVQLRDAF
FT                   VRVENGEAWLYNMHIAPYEKTGEPFRGDSKRKRKLLLHKREINKILGYLTQKGLTAIPL
FT                   SMYVNDRGFIKVSIGVAKGKKMVDKRQTIKERDIERELRREGKIRY"
FT   gene            429109..429461
FT                   /locus_tag="COPRO5265_1608"
FT   tmRNA           429109..429461
FT                   /locus_tag="COPRO5265_1608"
FT   gene            429109..429460
FT                   /gene="ssrA"
FT                   /locus_tag="COPRO5265_1607"
FT   tmRNA           429109..429460
FT                   /gene="ssrA"
FT                   /locus_tag="COPRO5265_1607"
FT   gene            429716..430084
FT                   /locus_tag="COPRO5265_0470"
FT   CDS_pept        429716..430084
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0470"
FT                   /product="alpha/beta hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18031"
FT                   /db_xref="GOA:B5Y7T2"
FT                   /db_xref="InterPro:IPR025438"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y7T2"
FT                   /protein_id="ACI18031.1"
FT                   /translation="MAQFDIVEKSGVKIAVVKDKTTLITDEQSALDFMSEVLEKTGCDR
FT                   VIVDKCIAPEEFYDLSSGLAGSILQKFVNYRVKIAFVGDFSVYESKSLRDFIYESNKGS
FT                   NVFFLPTQQEAIDKLSLL"
FT   gene            430169..430639
FT                   /locus_tag="COPRO5265_0471"
FT   CDS_pept        430169..430639
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0471"
FT                   /product="5-nitroimidazole antibiotic resistance protein"
FT                   /note="identified by match to protein family HMM PF01243"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17869"
FT                   /db_xref="GOA:B5Y7T3"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="InterPro:IPR024747"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y7T3"
FT                   /protein_id="ACI17869.1"
FT                   /translation="MRRSDREVKDSARIDEIIRMCDCCRLGLVDGDGVYIVPLNFGFKS
FT                   ENGRRTLYFHGAKEGKKIEVIKAHPFVGFELDTNHAVTAGEKACDYSFLYSSVIGKGVG
FT                   AVVEDIEEKRAALQLIMEHYSGKGNWSLPDEAVEGVAVIRLEVVELSCKEHA"
FT   gene            430671..431138
FT                   /locus_tag="COPRO5265_0472"
FT   CDS_pept        430671..431138
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0472"
FT                   /product="acetyltransferase, gnat family, putative"
FT                   /note="identified by match to protein family HMM PF00583"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17225"
FT                   /db_xref="GOA:B5Y7T4"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y7T4"
FT                   /protein_id="ACI17225.1"
FT                   /translation="MIIETERLVVRNISLGDTASLSSILSDSEVMKHIERPYTYEQAEE
FT                   VVKEARLSPQPVIYALQIEDTGELIGHVIYHPFSGEDCYEIGWVIAKEWWGKGFAEEIT
FT                   RALIHKAMRDGLKCLVIECDQNQEASKKIALKSGFSYSGRLDNLDVYRLKL"
FT   gene            431479..432333
FT                   /locus_tag="COPRO5265_0473"
FT   CDS_pept        431479..432333
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0473"
FT                   /product="phosphoesterase"
FT                   /EC_number="3.1.-.-"
FT                   /note="identified by match to protein family HMM PF00149"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17672"
FT                   /db_xref="GOA:B5Y7T5"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y7T5"
FT                   /protein_id="ACI17672.1"
FT                   /translation="MEPQKKKFISYVVLIVAIVALLTVALWNGLVVKSYVLSSKKLTDP
FT                   VRLLILSDLHSSMNGKNQSLLLAKIRELKPDLVFLVGDVVDDKRPQEGALQLLEAIAPE
FT                   YPCFYVTGNHEFWSGRADNIKNTIRSYGIEVLEGNCETVTVGGQRIQVCGVDDPDGFEQ
FT                   ENFFGQEISPEWDEQFERCKKQLNTDTFSILLSHRPERVSYYDGSGFDLVVSGHAHGGQ
FT                   IRVPWLLNGLYAPNQGFLPKYAGGVYDLGSSTMIVSRGLAKSFIPRIFNPPEIVLVSVE
FT                   PRE"
FT   gene            complement(432346..433398)
FT                   /locus_tag="COPRO5265_0474"
FT   CDS_pept        complement(432346..433398)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0474"
FT                   /product="nickel transport protein"
FT                   /note="identified by match to protein family HMM PF00892"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18193"
FT                   /db_xref="GOA:B5Y7T6"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y7T6"
FT                   /protein_id="ACI18193.1"
FT                   /translation="MNAKEKRASLLAVLAAALYSLTSPFSKILLSDIPPTLMAALLYLG
FT                   AGVGVLILMIIRGAVGGGKTETHIAKSDFPYVMGMVALDIAAPILFMYGLENSNPATVS
FT                   LLGNFEIVATAFIAFILFSEHISRRLWAAIFFITISCILLSVELGANYTLSLGSLLALG
FT                   ATMCWGLENNCTRMLSMRDPMEVVVIKGFCSGIGSLCIAALFGQMSSSLSHITVALLLG
FT                   FVAYGLSIFFYVSAQRYLGAARTSAFYAVGPFIGVALSFFLFGTPPNVLFPIALPLMIV
FT                   GTYLSSTKPHEHAHTHEPVTHNHWHRHNDGHHNHIHNGTVLGWHKHMHAHEPLGHSHEH
FT                   CSFEHHHELN"
FT   gene            433584..434264
FT                   /locus_tag="COPRO5265_0475"
FT   CDS_pept        433584..434264
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0475"
FT                   /product="conserved Archaeal protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17715"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y7T7"
FT                   /protein_id="ACI17715.1"
FT                   /translation="MTLAEKDKLDEVLEYFHLKSSELKMTASETVEDEIKVLQDVIKFA
FT                   QRKLEESTGEVKEKIQQVIDFSEEKIEELQLKTSLGSDEAKEVVASIADQMEELIDELR
FT                   KSDVMKRVGDVAKSVGDLLGTLGKKVGKSASELSRVIALRTDLSRLNSKRRELVTQIGE
FT                   MVHKRLSETGSLVLTEELLKLSKEVEKLDMEIKAKKEELKRVGKEEDLSEEQINTIIKE
FT                   ADQG"
FT   gene            434313..434822
FT                   /locus_tag="COPRO5265_0476"
FT   CDS_pept        434313..434822
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0476"
FT                   /product="chain A, Rubrerythrin From Pyrococcus Furiosus"
FT                   /note="identified by match to protein family HMM PF00301;
FT                   match to protein family HMM PF02915"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ACI16854"
FT                   /db_xref="GOA:B5Y7T8"
FT                   /db_xref="InterPro:IPR003251"
FT                   /db_xref="InterPro:IPR009040"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="InterPro:IPR024934"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y7T8"
FT                   /protein_id="ACI16854.1"
FT                   /translation="MHEMTKKFLEDAFAGESMAHMKYMIFAEDAEQKGLTKLANLWKAI
FT                   AYAEFVHAKNHFKALGKFGEVPANLQSSIDGETFEVNEMYPVYNNAAEFQGEKEAVRTT
FT                   HYALEAEKIHAGMYTKALDLAKQGKDYDADKILICPICGYTVEGEAPDRCPICGAPKEK
FT                   FAEFSV"
FT   gene            434815..435549
FT                   /locus_tag="COPRO5265_0477"
FT   CDS_pept        434815..435549
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0477"
FT                   /product="protein of unknown function"
FT                   /note="identified by match to protein family HMM PF01904"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17932"
FT                   /db_xref="InterPro:IPR002763"
FT                   /db_xref="InterPro:IPR036520"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y7T9"
FT                   /protein_id="ACI17932.1"
FT                   /translation="MCKGKQQVFIGTSGYSYGHWKGTFYPDNMKGEQMLPFYASKFNSV
FT                   EINSTFYHMPRSATVEKWLDCSPDDFVFSLKAPKTITHIKRLSDVEEVVNRFYEAASVL
FT                   AHKLGVVLYQLPPSLKKDLTLLEGFLKLLDRKPGKKAVELRHVSWVGDDVFELLKQHNV
FT                   AFVVSHGDNYPLVTTPTADFMYVRLHGYPELYRSSYSVDELQTWANLIRTWLEQDKMVY
FT                   VYFNNDAEGHAVKNALALKSLI"
FT   gene            435562..436368
FT                   /locus_tag="COPRO5265_0478"
FT   CDS_pept        435562..436368
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0478"
FT                   /product="glutamate racemase, putative"
FT                   /note="identified by match to protein family HMM PF01177"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17088"
FT                   /db_xref="GOA:B5Y7U0"
FT                   /db_xref="InterPro:IPR001920"
FT                   /db_xref="InterPro:IPR004391"
FT                   /db_xref="InterPro:IPR015942"
FT                   /db_xref="InterPro:IPR033134"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y7U0"
FT                   /protein_id="ACI17088.1"
FT                   /translation="MSGFLKTAAAIIVRVKSYLVYDSGIGGAWFSLELLRRKKAHRVVF
FT                   YADTLNFPLGLKSETELYNILDQFFGYASVAATKPAEVFDGIFLACNTISSVYLRYWPV
FT                   FKKKVPFPIVHTYAYHNGLIGLPKPLILATEATVRARIYTYFTAGRGVEMPATDLIEAL
FT                   QQDDTQRAKGLVKQTATFARKERFSHVVLGCTHLSEVAALFEEEGLPVYDPLAQILGNL
FT                   KLDNDEGVGANTQQLILHATGDYGDVVNYVRRKAALLPEEVLLDAD"
FT   gene            436358..436783
FT                   /locus_tag="COPRO5265_0479"
FT   CDS_pept        436358..436783
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0479"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18092"
FT                   /db_xref="GOA:B5Y7U1"
FT                   /db_xref="InterPro:IPR027981"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y7U1"
FT                   /protein_id="ACI18092.1"
FT                   /translation="MPIDNIYIFYGLWGIAIVLIVVNVWLVIRLSKIKGFEKLSHQVDD
FT                   VLRDMEDVKWRLESLEGEEQNDFYYSKVVRYDAFQDAKGRQSGSILVLNRKGTGFIITI
FT                   INSRDRSATFLKEVVEFKPIQALSPEEQVLLNEARKA"
FT   gene            436764..437660
FT                   /locus_tag="COPRO5265_0480"
FT   CDS_pept        436764..437660
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0480"
FT                   /product="peptidase, M23/M37 family"
FT                   /note="identified by match to protein family HMM PF01551"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17776"
FT                   /db_xref="GOA:B5Y7U2"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y7U2"
FT                   /protein_id="ACI17776.1"
FT                   /translation="MKPEKLSGENCKAVTINLVFNQRKIELHFTRRGYRWLCRTLLVMF
FT                   LLLGVTFFHVQQSKGLAALTLQKQDVQQTKELVEQYQAEMALLQQQNELLMKFKEEQMQ
FT                   QLEKKLQDVVNTAADTLKKPSLKNLVASAAGPTAYRGTDDIDKEIQSLQAKMDEVEKTL
FT                   EKYADALNAFPDKWPTWGNITSTFGWRRWSSGWVDFHTGLDIANSCGTPVYAAGKGVVI
FT                   QAGRDGSYGLSVIISHGNGYTTRYAHLSSIAVKVGQTVLKGDYVGAIGQTGFATGCHLH
FT                   FEVKLNGTLIDPYKVLP"
FT   gene            complement(437795..438403)
FT                   /locus_tag="COPRO5265_0481"
FT   CDS_pept        complement(437795..438403)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0481"
FT                   /product="methenyltetrahydrofolate cyclohydrolase"
FT                   /EC_number="3.5.4.9"
FT                   /note="identified by match to protein family HMM PF04961"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ACI16851"
FT                   /db_xref="GOA:B5Y7U3"
FT                   /db_xref="InterPro:IPR007044"
FT                   /db_xref="InterPro:IPR036178"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y7U3"
FT                   /protein_id="ACI16851.1"
FT                   /translation="MIEQQPIKDFLDSLASDSPTPGGGTAAALSAAMSCSLMAMALRVS
FT                   QKKVQDPTMQEAAAKLDQIRSELLNLADKDAEAFEAYMSARRLPKDTESQKQERKQAMT
FT                   KALIQATQVPLNTMKAIEQAVKTVAGKTAENVLPSVASDLYSGIKLAQAAMQCAFANVK
FT                   INSTKEETQPLYEEAVDLLNNFEEIVTELEQTAKSLLGM"
FT   gene            438461..439474
FT                   /locus_tag="COPRO5265_0483"
FT   CDS_pept        438461..439474
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0483"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ACI16978"
FT                   /db_xref="GOA:B5Y7U4"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y7U4"
FT                   /protein_id="ACI16978.1"
FT                   /translation="MQKSKQKDQKKDHQKAITIVIIVVAVLVLGLVVWWSWTQLHGALS
FT                   VPSEGFKFVAEGQKISVPCLSDGLLTTEEVLLYSANPDTLMKYLALQQVKTCSAPLACL
FT                   AKGFDGNKLYLDPNCYVDAENAEVHGDVFEALSRYFGEGNVMIGSRPLEANPLSRVIPL
FT                   TAYYFIDTEEGVQLVHRDGVSLDQFWKELAVEQQPEVRVEGTTAYVTLSLPSYDDHLAY
FT                   AIALNVEHFMKVKSVVLTINGLEVYRHQVPYALKLAKSNEGFLVTGEALSVDELESFLR
FT                   GVSITDKGSSVLVKIDADMSTEDYNLVIAVLDTLSGKTVKIVAGPYSALGSFPSQF"
FT   gene            complement(439438..440751)
FT                   /locus_tag="COPRO5265_0482"
FT   CDS_pept        complement(439438..440751)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0482"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17518"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y7U5"
FT                   /protein_id="ACI17518.1"
FT                   /translation="MRLGGTKTIVSWKQKLALRLMGITHDINKLSQDFIRAKSINNPST
FT                   DFHAVQIMESRFLNKRFWETTGNIPLFRFDLPSPLPLWYLVLSHHTKNNDEFLRTFQRA
FT                   EVYTTAMSSYAVPYGRKQLDNILVFNNVIWTGQGLEKLRWEIFQRLPIIKETNMPSEEE
FT                   ARYLYYNLEAVICLLKQVPADTRELSISYAEHIRNIEQYFQGIVNPVNAVQLQTYRTLL
FT                   TVGSSFQSLLAGFTDFFFSLQYHYRTFLEEHIRKIEKHCQNVKDEQCFQRLRLLNTEKT
FT                   FLDDLQTKGRYYSTDELFCFFKDFYQQEKPKSLYTIAADLLATYKLCNGNLSDILVHSG
FT                   FLVKTKVCTFNGVYNGCEVKDALLLELSSHSLKLPKRLLLLMSAVSNTQHSELDIPYKD
FT                   QFLTPIPFLKKGETIALHVPERWLLGFQNCEGKEPKAE"
FT   gene            440786..441739
FT                   /gene="phoH"
FT                   /locus_tag="COPRO5265_0484"
FT   CDS_pept        440786..441739
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phoH"
FT                   /locus_tag="COPRO5265_0484"
FT                   /product="phosphate starvation-induced protein"
FT                   /note="identified by match to protein family HMM PF02562"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ACI16885"
FT                   /db_xref="GOA:B5Y7U6"
FT                   /db_xref="InterPro:IPR003714"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y7U6"
FT                   /protein_id="ACI16885.1"
FT                   /translation="MKTYELKEEEWTEFSPFLTGSEEQLKLMERFFKVNVVSSPEGIAV
FT                   TAEDESRINDFLAFLRSLSNTLRRGETIKTEDLQRFLSSYKEFGRLVLGDVITLNAQGK
FT                   PVRPKTRGQEIFIQAMRQKDLVFAVGPAGTGKTFLAVAYGVALLKEKSVQRLVISRPIL
FT                   EAGEKIGFLPGDIYQKVDPFFRPLYDALFDLLGPEKTQRYIERGIIEVAPLAYMRGRTF
FT                   DNAFIILDEAQNTGNEQMKMLLTRMGLGSKMVVTGDITQIDLPKPKESGLIRALEILKG
FT                   FEEIAIVYLKESDIVRHRLVQKIVKAYKDYEEQNQE"
FT   gene            441741..443549
FT                   /locus_tag="COPRO5265_0485"
FT   CDS_pept        441741..443549
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0485"
FT                   /product="metal dependent phosphohydrolase"
FT                   /note="identified by match to protein family HMM PF01966;
FT                   match to protein family HMM TIGR00277"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18109"
FT                   /db_xref="GOA:B5Y7U7"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR006675"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y7U7"
FT                   /protein_id="ACI18109.1"
FT                   /translation="MVLILFILGAAILFVGLLPLRAPIKDGRFTRSVVTDRNLSIRFGD
FT                   QIQGTLLVSDEMTVKSYVNTLSRLGEQNADPELRQALALLSQYVKEKGIYETEIPISAG
FT                   WVQNTLNLSAETSKKLATLVSGIVVKPTWVERPLDVITAITTAESVVIPAGTLVARDGD
FT                   EVVEEQVRALSLMGLWIPGEAFYPVAYWVFIFLVPAVWLIVTWRSQVYKSYSPIFYFFY
FT                   GVLGALMFFYVYRFSSLLLGLPLFLFGFLVLSLKMAEKGLWSMLIPMSVLSFLAVPMAA
FT                   YNWVSLILVGLLIYGLGNKFFQYETVLTAAGLSVLALIGLEILWCFGSGVRNLSLVWNG
FT                   LTYTVMGCLAVGLLLVGAFWWEERKGYLTPLTIVKLSNLRHPLLQRLAIESPGSYHHSM
FT                   VLAQMCEEAASAIGANRILARLGAMYHDIGKTKQPQYFIENNPEANDLHEKMSPSLSML
FT                   ILLSHVKEGLALAEQYKLPYSVREFIATHHGTSVASFFYHKAKTNGAEVSESEFRYPGP
FT                   LPKSKEASILMLADGCEAAVRSLSEKNESTIRSTVSSIIDSRLEDGQLENSELTCRDLT
FT                   IIENVFVRVLLGLYHPRVPYPGGAET"
FT   gene            443546..443992
FT                   /locus_tag="COPRO5265_0486"
FT   CDS_pept        443546..443992
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0486"
FT                   /product="putative metalloprotease"
FT                   /EC_number="3.4.24.-"
FT                   /note="identified by match to protein family HMM PF02130;
FT                   match to protein family HMM TIGR00043"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17461"
FT                   /db_xref="GOA:B5Y7U8"
FT                   /db_xref="InterPro:IPR002036"
FT                   /db_xref="InterPro:IPR020549"
FT                   /db_xref="InterPro:IPR023091"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y7U8"
FT                   /protein_id="ACI17461.1"
FT                   /translation="MIDVGKEVPVPRGAIKLTKNTLKFLLSKFGLENKDVSVYFCNERT
FT                   IIDLNTQYRFNEEPTDVLSFTGEGDFLGEIIICVPVALRQAEESGVDWQVEFAMLIVHS
FT                   FLHLLGYDDETEEGFAEMVEVQNKLLKELGYEESSIGRLIPNSR"
FT   gene            443949..444398
FT                   /locus_tag="COPRO5265_0487"
FT   CDS_pept        443949..444398
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0487"
FT                   /product="diacylglycerol kinase (dagk) (diglyceride
FT                   kinase)(dgk)"
FT                   /EC_number="2.7.1.107"
FT                   /note="identified by match to protein family HMM PF01219"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17115"
FT                   /db_xref="GOA:B5Y7U9"
FT                   /db_xref="InterPro:IPR000829"
FT                   /db_xref="InterPro:IPR036945"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y7U9"
FT                   /protein_id="ACI17115.1"
FT                   /translation="MKNLRLADSFRIAVKGLKNAFLREYHIRVAFFLVLALFLYSLVLG
FT                   LTLREWLVLVTFSSLVVCLEMINSALEKLADAVHPDWSEQVGFAKDLAAGAVLVSIGAA
FT                   AAAGLPVYVSAFSRRFSVSWTYSLFVNLGLLILGIVLLFVWDFRR"
FT   gene            444408..444821
FT                   /gene="cdd"
FT                   /locus_tag="COPRO5265_0488"
FT   CDS_pept        444408..444821
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cdd"
FT                   /locus_tag="COPRO5265_0488"
FT                   /product="cytidine deaminase"
FT                   /EC_number="3.5.4.5"
FT                   /note="identified by match to protein family HMM PF00383"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17209"
FT                   /db_xref="GOA:B5Y7V0"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y7V0"
FT                   /protein_id="ACI17209.1"
FT                   /translation="MTNEELIRKYDDLISAAKSARENAVAPFSNFRVGAALLGKSGKVY
FT                   LGANMEPAVMNLGLCAERTALFSALAQGEKEFEAIAVYAGTEQPGYPCGGCRQVFSDLA
FT                   PNVLWLLVGDKEVKIETLESMLPNRFVLEDLRR"
FT   gene            444818..445717
FT                   /gene="era"
FT                   /locus_tag="COPRO5265_0489"
FT   CDS_pept        444818..445717
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="era"
FT                   /locus_tag="COPRO5265_0489"
FT                   /product="GTP-binding protein Era"
FT                   /note="identified by match to protein family HMM PF01926;
FT                   match to protein family HMM PF07650; match to protein
FT                   family HMM PF08477; match to protein family HMM TIGR00231;
FT                   match to protein family HMM TIGR00436; match to protein
FT                   family HMM TIGR00650"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17426"
FT                   /db_xref="GOA:B5Y7V1"
FT                   /db_xref="InterPro:IPR004044"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005662"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030388"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y7V1"
FT                   /protein_id="ACI17426.1"
FT                   /translation="MSTLSKSGIVSLVGRPSVGKSTLINNLVKQKVSIVTPRAQTTRRP
FT                   IRAILNTEDGSQIVFVDLPGAKKPYDALGEYLLDSVWRNVGDSDLALFVVDGSSVPPGP
FT                   GDIFVARNLMKTGVPALLVMNKSDLICDDQVEERLRMFESLGDFVGSVAISALNGSNLD
FT                   RLVNLVLDHLDEGPQFYPEGMQTDQPLEQFIGEIIREKIMLLTSDEIPYAVESQVDFLD
FT                   EQEDIIRINATIYVERESQKPIIIGANGQMIKQIGTLARKELEVVLGKHVFLGLWVKVK
FT                   ENWRNNKEALYYFGYHVE"
FT   gene            445707..446372
FT                   /locus_tag="COPRO5265_0490"
FT   CDS_pept        445707..446372
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0490"
FT                   /product="endonuclease V"
FT                   /EC_number="3.1.21.7"
FT                   /note="identified by match to protein family HMM PF04493"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17521"
FT                   /db_xref="GOA:B5Y7V2"
FT                   /db_xref="InterPro:IPR007581"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y7V2"
FT                   /protein_id="ACI17521.1"
FT                   /translation="MWNKERFQRAQLALRSIKEDFSLNQCVHTVAAFDVSFQAGLGVGV
FT                   VALFNYQSVQLMECEIVVKEPYVPYVPTYLAFREMPYILALYKKLHEEPDLLLIDGHGK
FT                   SHPRGMGIATQAGLSLRKPSIGVAKRLLFGDLLETADGSSLVVHPETREPLAVAYKEKP
FT                   RFKPVFISVGAGVSNLSEAVSLVLPLFKGHREPEPLRYVHNVSLQEGRRMRDGVQQVN"
FT   gene            446350..447009
FT                   /gene="deoC"
FT                   /locus_tag="COPRO5265_0491"
FT   CDS_pept        446350..447009
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="deoC"
FT                   /locus_tag="COPRO5265_0491"
FT                   /product="deoxyribose-phosphate aldolase"
FT                   /EC_number="4.1.2.4"
FT                   /note="identified by match to protein family HMM PF01791;
FT                   match to protein family HMM TIGR00126"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17205"
FT                   /db_xref="GOA:B5Y7V3"
FT                   /db_xref="InterPro:IPR002915"
FT                   /db_xref="InterPro:IPR011343"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR028581"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5Y7V3"
FT                   /protein_id="ACI17205.1"
FT                   /translation="MEYNRLIDHTLLKADATVEQIEKLCKEALQYNFFSVCVNSAFVPL
FT                   AKSFLEGSDVKVATTIGFPLGASATAVKAFEVEQALKEGADEFDMVINVGWLKSKLYRL
FT                   VHEDIAEVVKAAGGKVVKVIIETCYLTDDEKKIASSIAAAAGAHYVKTSTGFGTGGATV
FT                   EDVQLIRSVVGPNIGVKASGGIRDAATLKAMVDAGANRIGASASVKIMEELRIEGN"
FT   gene            447026..447658
FT                   /locus_tag="COPRO5265_0492"
FT   CDS_pept        447026..447658
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0492"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18030"
FT                   /db_xref="InterPro:IPR037278"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y7V4"
FT                   /protein_id="ACI18030.1"
FT                   /translation="MERIPYRETDLLLSVLGEHIGKELLTVRSGRKIPNRWKSSFLEGS
FT                   ILLGRILQVKNHHVLTGVITEKYVPYEKYSPFMILALEMFSKTPSVDRSSFQLLEKFLT
FT                   SEQTARDFDQFLVSFMVKESLQPSLNSCVVCGEKREQFPISASVYLGGYVCPRCGSGDV
FT                   ELTDVDYESLLKTYRKVGELTENMRAYWLDVLESQLSTKFVSREGLK"
FT   gene            447655..448530
FT                   /gene="glyQ"
FT                   /locus_tag="COPRO5265_0493"
FT   CDS_pept        447655..448530
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glyQ"
FT                   /locus_tag="COPRO5265_0493"
FT                   /product="glycyl-tRNA synthetase, alpha subunit"
FT                   /EC_number="6.1.1.14"
FT                   /note="identified by match to protein family HMM PF02091;
FT                   match to protein family HMM TIGR00388"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17775"
FT                   /db_xref="GOA:B5Y7V5"
FT                   /db_xref="InterPro:IPR002310"
FT                   /db_xref="InterPro:IPR006194"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5Y7V5"
FT                   /protein_id="ACI17775.1"
FT                   /translation="MTFQELITNLTDFWIKQGCILAQPYDVEVGAGTMNPNTFFRVLGP
FT                   EPWRVVYVEPSRRPADGRYGENPNRLYMHHQMQVILKPAPFNVQDLYLQSLEAIGISLS
FT                   EHDVRFVEDNWESPTLGAWGIGWEVWLDGMEITQFTYFQQAGGYDLSVVPAELTYGLER
FT                   IAMYLQRVENVFDLKWSEDITYGEMRKTEEYQHCVYAFEESDVNKLRSWFDSYEDEAMR
FT                   LIDKGLTLPAYDYVLKCSHTFNLLDARGGFSAAERSSYVLRIRKLSSRIAKQWLKEREE
FT                   KEFPLMGRWN"
FT   gene            448530..450539
FT                   /gene="glyS"
FT                   /locus_tag="COPRO5265_0494"
FT   CDS_pept        448530..450539
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glyS"
FT                   /locus_tag="COPRO5265_0494"
FT                   /product="glycyl-tRNA synthetase, beta subunit"
FT                   /EC_number="6.1.1.14"
FT                   /note="identified by match to protein family HMM PF02092;
FT                   match to protein family HMM PF05746; match to protein
FT                   family HMM TIGR00211"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17969"
FT                   /db_xref="GOA:B5Y7V6"
FT                   /db_xref="InterPro:IPR006194"
FT                   /db_xref="InterPro:IPR008909"
FT                   /db_xref="InterPro:IPR015944"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y7V6"
FT                   /protein_id="ACI17969.1"
FT                   /translation="MDLLFELGFEEMPPSHLKALKQQVMERLEPTFKDYGLSFETVKTF
FT                   LTPRRFALLLGGLPEKQAVVEKMIKGPPKSACYMPDGSIKPALEKFMQSNGVSSDNIRI
FT                   IEENGKSYVYAFKTEGGKDACEVLPALLEDLFTDLWFPKSMRWGQGYVFGRPVRWIVAL
FT                   VDDQVLHIELFGVKSNRVSRGLRVFGSDVEIDIPGHYEQLEKEKGLIIADENKRRDLIR
FT                   NQAEKLAAELNGKPHLPEELLEELTFINEYPTGFVGHFEDRFLQLPKKVLETVMIHHQR
FT                   YVAVENEQGQLLPYFIGFRNGPSENIQQVIVGNERVIRARFYDALFFVEEDLKTPFADR
FT                   VQGLERISFLGNYGTLLDKVNRVKRLLALFNKENDLLLQSLAELYNADLTTLMVQELPE
FT                   LHGYMGTFYAKRSGVEEPLANLIEEVVTEPRVENSAIIKVLDALDTIFAGFDMGFVPSG
FT                   SSDPMGLKGLAFDVLDLICKFFPERSVKDLVLGAASILGKENLVAAVEEFFLDRLDSWI
FT                   ECKEIRVKNAIMDRALDKPIGMFPIMVEVLGQFWTGTMVQNIALAHRRIRNIIRNQEAH
FT                   ASFDPAIGSENDLRLHESFLNNGIRIDSLNVVTKDGLMKVLEYLTALSDDVHEYFDKEL
FT                   VMAEDVKVRQNRVALLMAVDNLFSRFAYFGDLVL"
FT   gene            450557..453223
FT                   /gene="ppdK"
FT                   /locus_tag="COPRO5265_0495"
FT   CDS_pept        450557..453223
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ppdK"
FT                   /locus_tag="COPRO5265_0495"
FT                   /product="pyruvate, phosphate dikinase"
FT                   /EC_number="2.7.9.1"
FT                   /note="identified by match to protein family HMM PF00391;
FT                   match to protein family HMM PF01326; match to protein
FT                   family HMM PF02896; match to protein family HMM TIGR01828"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17884"
FT                   /db_xref="GOA:B5Y7V7"
FT                   /db_xref="InterPro:IPR000121"
FT                   /db_xref="InterPro:IPR002192"
FT                   /db_xref="InterPro:IPR008279"
FT                   /db_xref="InterPro:IPR010121"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018274"
FT                   /db_xref="InterPro:IPR023151"
FT                   /db_xref="InterPro:IPR036637"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y7V7"
FT                   /protein_id="ACI17884.1"
FT                   /translation="MAKRIYFFDDPEPVGRELLGGKGAGLAEMTRIGLPVPYGFTVTTE
FT                   VCREYYRLGGRLPDGLKEEVIQSMHKLEDKAGKKFGDPSNPLLISVRSGARVSMPGMMD
FT                   TILNLGLNDETVLGLARLTNNERFAWDSYRRFITMFSDVVLGISKDEFEKVLDEVKEKE
FT                   HVKYDAEVSAEGLKEVALKSKELVQKITGNPFPMDVWEQLFMAIEAVFRSWNNPRAILY
FT                   RQLNNIPDDWGTAVNIVQMVFGNMGDDSGTGVAFTRNPATGEKELYGEYLTNAQGEDVV
FT                   AGIRTPKPIKEMAQEWPNTYAELTHVAALLEKHFKDMQDMEFTVEKGKLYMLQTRSGKR
FT                   TAQAAVTIAVDMVHEGLIDKETAVLRVSPEDVNHLLHKRIDPSAKGNPIAVGLAASPGA
FT                   AVGTLVFSAEEAVAEASAGKSVILCRPETTPDDLHGMVAAQGILTTRGGMTSHAAVIAR
FT                   GMGKPAVTGTESLKLDLDNGVVTAPGGVTIKRGDVVTIDGGTGEVFLGALPLVEPEVSA
FT                   HFEELLSWADEFRRLGVKANADTPEDAALARKFGAEGIGLTRTEHMFLGHERTQIVQDM
FT                   ILAETTEERMVPLQKLLELQRSDFIGILKAMDGLPVTIRLLDPPLHEFLPEPHEAAKEL
FT                   EQAKRNGAPAEEIERLERLYRRTVQFQEHNPMMGFRGCRLGIIYPEIYEMQIRAVAEAA
FT                   VELKKQGYNPRFQIMHPLVGTEEEMKFLAEMTHKVVNEVLGNNGIELDYKVGTMVEVPR
FT                   AALVAGDLAKYAEFFSFGTNDLTQLTFGYSRDDAEGKFLGAYVQKGILPEDPFISLDRN
FT                   GVGRLVELGVTEGRATRPELEVGICGEHGGDPKSIEFCHQVGLDYVSASPYRVPLARLA
FT                   AAQAALKEKRGEIFKDK"
FT   gene            complement(453299..455068)
FT                   /locus_tag="COPRO5265_0496"
FT   CDS_pept        complement(453299..455068)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0496"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ACI16874"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y7V8"
FT                   /protein_id="ACI16874.1"
FT                   /translation="MKNFSVKKILACTLLVVALFGLCFFAVRRENKPTLAFTDFRQVAS
FT                   LTDKVSTVWWSDNLLLQLSKSGELFSTDLRAKTSTLLIENASLFTANAYEGNAKAAIAT
FT                   NVGRIYLLEQTQGESLFDPILNYEGMSVVYSLDLSADNQVLLFSLSPLPSVREMGTVQG
FT                   TYLLSIPSGRLERVFPNTGRACLNANGSKIYFSPFSYAQKENGLQAYDIITHETKDISK
FT                   ATITNLSCSKKESLVAFTSELGALTRVYVYDEETQSMTIAYELPQYIGSVQDIWWSPTD
FT                   GKALYVTVQTNESTKVNRITMGRSQEHLAWIQALGLAFQFDDEGFVTPLINKNMGSPCT
FT                   EQDSSQRTISDLQFQVTPMSSKLWSVNMQFAERYPEQPSQCNWSLQFFLDMTDNSIEYR
FT                   NVKHEQPEYYVITDRNLVKEDAQGTLTTLASLDRLLSLQTLTSSSAIALQNKIPNAILM
FT                   QPDKQKLLVAYAGEDSDLLMFDMSATHKGVENSFKLPGEVVSVSYAAGKYVVYYIDNLE
FT                   HTGNVLILGDNDLTSEVNNLLRKTIASGSSVEVPFCANETLYVPLVNTFSNVELITYLE
FT                   VDLSSGLITYNFP"
FT   gene            455238..455732
FT                   /gene="coaD"
FT                   /locus_tag="COPRO5265_0497"
FT   CDS_pept        455238..455732
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="coaD"
FT                   /locus_tag="COPRO5265_0497"
FT                   /product="pantetheine-phosphate adenylyltransferase"
FT                   /EC_number="2.7.7.3"
FT                   /note="identified by match to protein family HMM PF01467;
FT                   match to protein family HMM TIGR00125; match to protein
FT                   family HMM TIGR01510"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ACI16893"
FT                   /db_xref="GOA:B5Y7V9"
FT                   /db_xref="InterPro:IPR001980"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5Y7V9"
FT                   /protein_id="ACI16893.1"
FT                   /translation="MTKVVYPGTFDPITKGHLDILVRAAQVFDQVTLLVLSNLQKKSLF
FT                   SLEERVRLAKSAIEESNAPSNIIVDSYEGVTVHYLEEHGIRLIIRGLRAVSDYEYEIQL
FT                   FLANKYLNSQVETVLMPTSLRYQFVSSSLVKEMVSFGLDVSEFVTPTVERALKEKLEVK
FT                   Q"
FT   gene            455729..456931
FT                   /gene="ackA"
FT                   /locus_tag="COPRO5265_0498"
FT   CDS_pept        455729..456931
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ackA"
FT                   /locus_tag="COPRO5265_0498"
FT                   /product="acetate kinase"
FT                   /EC_number="2.7.2.1"
FT                   /note="identified by match to protein family HMM PF00871;
FT                   match to protein family HMM TIGR00016"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17617"
FT                   /db_xref="GOA:B5Y7W0"
FT                   /db_xref="InterPro:IPR000890"
FT                   /db_xref="InterPro:IPR004372"
FT                   /db_xref="InterPro:IPR023865"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5Y7W0"
FT                   /protein_id="ACI17617.1"
FT                   /translation="MKILVLNAGSSSLKFQLFDMEDESVMAKGIVERIGLDKPFLSYSK
FT                   GTDKIKFDKEEPINHKDALQWVLNTLTSHEYGVITTLQEIGAVGHRVVHGGEEFTGSVL
FT                   ITEEVIEALERNKNLAPLHNPPNLTGIYATKAVLPEVPMVGVFDTAFHATMPERAYLYA
FT                   LPIELYEKYKVRRYGFHGTSHRYVAMEAARRLGKTLSELRIISAHLGNGASVCAIQGGK
FT                   SIDTSMGFTPLEGLVMGTRSGDLDPAIPIWMMRELGMSFDEVDNLLNKKSGVFGLVRGR
FT                   SFDMRDIEDWMAAGDEEAKKAMEVYCYRLKKYIGGYAAVMGGVDVLIFTAGVGENSPIV
FT                   REMVCEGLEFLGIKLDKEKNNSRGDAIISAADSKVVVMSIKTNEELMIARDTYEIVRGL
FT                   T"
FT   gene            457060..457416
FT                   /locus_tag="COPRO5265_0499"
FT   CDS_pept        457060..457416
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0499"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17468"
FT                   /db_xref="InterPro:IPR003772"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y7W1"
FT                   /protein_id="ACI17468.1"
FT                   /translation="MEQWEFAKFDLRVDGSVDVRVPCDRCGEMFWQHIELGSEEVFIIG
FT                   REPVPTGEEKRLSEEDISTFYTPNGQVNVIELLSEYILSSLPTKVICRDECPGPVELLG
FT                   ELQFVEFILDEGGK"
FT   gene            457420..457611
FT                   /gene="rpmF"
FT                   /locus_tag="COPRO5265_0500"
FT   CDS_pept        457420..457611
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmF"
FT                   /locus_tag="COPRO5265_0500"
FT                   /product="ribosomal protein L32"
FT                   /note="identified by match to protein family HMM PF01783;
FT                   match to protein family HMM TIGR01031"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18165"
FT                   /db_xref="GOA:B5Y7W2"
FT                   /db_xref="InterPro:IPR002677"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y7W2"
FT                   /protein_id="ACI18165.1"
FT                   /translation="MGAPKKKPTRMKRDQRRAHFKATVPNLIECPHCHELIPSHTVCPN
FT                   CGWYGGEEKIKIEKEEKG"
FT   gene            457618..458613
FT                   /gene="plsX2"
FT                   /locus_tag="COPRO5265_0501"
FT   CDS_pept        457618..458613
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="plsX2"
FT                   /locus_tag="COPRO5265_0501"
FT                   /product="fatty acid/phospholipid synthesis protein PlsX"
FT                   /note="identified by match to protein family HMM PF02504;
FT                   match to protein family HMM TIGR00182"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17320"
FT                   /db_xref="GOA:B5Y7W3"
FT                   /db_xref="InterPro:IPR003664"
FT                   /db_xref="InterPro:IPR012281"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y7W3"
FT                   /protein_id="ACI17320.1"
FT                   /translation="MKIALDLMGADQPPGVLLEGVYRYAHDHRDEDELLVLVSKGEVVR
FT                   DSSSVRVVYCDEVVKQEDEPTVVLRKRNSSMCKGLEMVASGEVEGLISFGNTGALVIGG
FT                   VAYVKRLEAHIRPAICVAMPSVQGSTWVFVDAGANADVDPADLLDFAAYGCAYYKSLEG
FT                   HDAESVALLNVGKERHKGSKLIQEAAKLMTDVPEFVGFVEPDQLLLPAVNVVVTWGLLG
FT                   NVFLKTAEGVLEVVKHTLKDISQKGLKEKIGLGLVKGSLYQTFKKFDYRTYGVSPILGL
FT                   KGNVLKGHGKSDPEAVYNALRTGKLLMERNTIGAVKEELVRWREKRSSRS"
FT   gene            458583..458831
FT                   /locus_tag="COPRO5265_0502"
FT   CDS_pept        458583..458831
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0502"
FT                   /product="acyl carrier protein"
FT                   /note="identified by match to protein family HMM PF00550"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18221"
FT                   /db_xref="GOA:B5Y7W4"
FT                   /db_xref="InterPro:IPR003231"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5Y7W4"
FT                   /protein_id="ACI18221.1"
FT                   /translation="MEREKIFQELKNILKDTVTVEEEEITMESDLVNDLNLDSLDLVDL
FT                   ALSVEQVFGFEFSDEQLQQIKTVKDVVDIIESNLYTK"
FT   gene            458828..459604
FT                   /locus_tag="COPRO5265_0503"
FT   CDS_pept        458828..459604
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0503"
FT                   /product="oxygen-independent coproporphyrinogen III
FT                   oxidase"
FT                   /EC_number="1.-.-.-"
FT                   /note="identified by match to protein family HMM PF04055"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17458"
FT                   /db_xref="GOA:B5Y7W5"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR032432"
FT                   /db_xref="InterPro:IPR039661"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y7W5"
FT                   /protein_id="ACI17458.1"
FT                   /translation="MRIYPVFLSHAGCRQRCVFCNQRAAERIKPWKESIEEAFHYIQKS
FT                   NLVYDEIAFYGGTPTSSENLLKDILQPFQTFLKIGKIKGIRISTRPDEINESIIQILVD
FT                   YGVSTVEIGVESFSDEVLRLSKRGHTEEDVKRAHELLKGRFREVFQLMVGLPGETDRHR
FT                   EETISKTVSLKPWGVRYFPTLVLRGTELQKMYESGTYQPLSMEEALYWSRRAYESFMAA
FT                   GIAVLQIGLHSSEFLSEELVAGPYCGNFGELVRGVM"
FT   gene            459606..460475
FT                   /locus_tag="COPRO5265_0504"
FT   CDS_pept        459606..460475
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0504"
FT                   /product="cell division protein FtsY"
FT                   /note="identified by match to protein family HMM PF00448"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17906"
FT                   /db_xref="GOA:B5Y7W6"
FT                   /db_xref="InterPro:IPR000897"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004390"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042101"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y7W6"
FT                   /protein_id="ACI17906.1"
FT                   /translation="MGLLDGFKAFFHQTVLKMQGKALTPEQEEELLSKLIMADFSLKKA
FT                   QALLEQIKEKGNNVDVIREVLLSEAPPFEPLRDTSVPSVFFIIGVNGVGKTTTVAKLAH
FT                   MYAKQGKNVVVVGADTFRAAAQDQLSTLVNRMPVTYVGGERGSDSGSILYKALLENPQA
FT                   SVFLVDTAGRIHTSRALIDELSKLIKVGKKFSEEFPQEVLLVLDGTQGIQGYRQAMSFV
FT                   QGTPITGLVLTKMDSTAKGGMIFSIWDELKIPVKLVCFGQQLDDIDFYSPQRVVDAILG
FT                   NNGGGNND"
FT   gene            460435..461235
FT                   /locus_tag="COPRO5265_0505"
FT   CDS_pept        460435..461235
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0505"
FT                   /product="inositol-1-monophosphatase (IMPase)
FT                   (Inositol-1-phosphatase) (I-1-Pase)"
FT                   /EC_number="3.1.3.25"
FT                   /note="identified by match to protein family HMM PF00459"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17910"
FT                   /db_xref="GOA:B5Y7W7"
FT                   /db_xref="InterPro:IPR000760"
FT                   /db_xref="InterPro:IPR020550"
FT                   /db_xref="InterPro:IPR020583"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y7W7"
FT                   /protein_id="ACI17910.1"
FT                   /translation="MPSLGITAVVIMTEQSVETVMLRAVNLALDEIGEYWCSAVSWEPK
FT                   GVDDRVTFLDKQIEKKLQSFLQGYSSYGFMGEEYGVKSRGERLWVLDPIDGTVNFTVRL
FT                   PMVAVSLALMEGDKAVLGAVGEAVSKRIYWSDGKHLFLDNAVVSNSRKVSTLEEAFVGL
FT                   GTPRKDDPFAAGYGKFLSAVQKKAMRLRMLGSAALGLTYVASGALDAFLLPRFELWDVA
FT                   AGRLLVEVSGGSYWQEGPNSILIAARNEALLEDLKQIWYGVNSL"
FT   gene            461494..461570
FT                   /locus_tag="COPRO5265_1609"
FT   tRNA            461494..461570
FT                   /locus_tag="COPRO5265_1609"
FT                   /product="tRNA-Gln"
FT   gene            461582..462229
FT                   /locus_tag="COPRO5265_0508"
FT   CDS_pept        461582..462229
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0508"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17667"
FT                   /db_xref="GOA:B5Y7W8"
FT                   /db_xref="InterPro:IPR010397"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y7W8"
FT                   /protein_id="ACI17667.1"
FT                   /translation="MGLGKSISKARTLGEIGSILYVISLVIPNAILLIGGVVLLLLSVL
FT                   DIVRDTEYKGSGNSFIIAMILDIVWLYVAAFAVALTLGAYKAYVERPGADCMGPMCDRL
FT                   FPNPFGPGGAGRTVVMAALGAAIIAYVINIITGILYRNIYKNVGKITGVSYFERSANWI
FT                   FWGRILSIVLVGLVVDLVGRVMLAISFFHLPDFLPSNEEEAQSIQEKDSGPE"
FT   gene            complement(462144..462266)
FT                   /locus_tag="COPRO5265_0507"
FT   CDS_pept        complement(462144..462266)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0507"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17075"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y7W9"
FT                   /protein_id="ACI17075.1"
FT                   /translation="MAYATTQKRWEKSTQVQNPFLVLTEPLLHYLVRNPVDGKS"
FT   gene            complement(462306..464696)
FT                   /locus_tag="COPRO5265_0509"
FT   CDS_pept        complement(462306..464696)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0509"
FT                   /product="ribonucleoside-diphosphate reductase,
FT                   adenosylcobalamin-dependent"
FT                   /EC_number="1.17.4.1"
FT                   /note="identified by match to protein family HMM PF00317;
FT                   match to protein family HMM PF02867; match to protein
FT                   family HMM TIGR02504"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ACI16813"
FT                   /db_xref="GOA:B5Y7X0"
FT                   /db_xref="InterPro:IPR000788"
FT                   /db_xref="InterPro:IPR008926"
FT                   /db_xref="InterPro:IPR013344"
FT                   /db_xref="InterPro:IPR013509"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y7X0"
FT                   /protein_id="ACI16813.1"
FT                   /translation="MELEWSETALRVLEQRYLLRDENGNIVETPEQLMHRVAHGLAQIE
FT                   TVWGATSEQISSVEQDFFDILWKRDFLPNTPTLFHAGLPKDPKYRGRRFMSACIVLPIE
FT                   DSIDGIFKTLWDAAKIMQAGGGVGYAFSRLRPKGSLVKSSGGKSSGPVSFMHIYDVMVD
FT                   VVAQGGKRRGAQMGVLNVHHPDILEFIDAKKENTSGQGPLHNFNISVAVTEEFVQAYKE
FT                   DTTFKLVAPHTGEVVGELNAREVMHKIAENAWRTGDPGIIFIDRINQLDYLDDGRIEAT
FT                   NPCGEQPLPPYGSCNLGSINLKHMLKKTDSGYQWDWEKFQRTIRLAVRFLDNVIEANDY
FT                   PIPELEDYAKKARRIGLGVMGWADALSLLGIPYDSEEALEEARKVGAFLKEKSHLASQE
FT                   LAQERGVFEFYDQSKWKELGIPMRNAAVTTIAPTGTLSILANVNSGIEPYFALAFERKI
FT                   TAGTFHEVQPTLLDVLKERELYSEELVQRIIENEGKLRDLEDLPEDIRNAFPTAMEVAP
FT                   EWHVRMQAAWQENIDSSISKTVNLPYQSTVEDIENIYLLAYELGTKSITVYRDKSLELQ
FT                   VLNVPSTSPKERSSEETQEPRPKRIFPKRPEVLTGFTKKFRTGTGTLYVTVNVDENGRP
FT                   IEVFTNASGSVAPAEIEAVARLVSIALQYGIPLDEIVDQLVQPVDPVSYKLSPEGLRST
FT                   AHGIALALKEAVSKGLNILGNGLKSATSFSLTLEETNASKKTTAPPKLDKEQIDTMKAV
FT                   YGDERVQELLNSMGVTLCPVCGTPMVSAEGCLMCPNCGYSKCG"
FT   gene            complement(464703..465164)
FT                   /locus_tag="COPRO5265_0510"
FT   CDS_pept        complement(464703..465164)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0510"
FT                   /product="YqeY family protein"
FT                   /note="identified by match to protein family HMM PF02637"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17070"
FT                   /db_xref="GOA:B5Y7X1"
FT                   /db_xref="InterPro:IPR003789"
FT                   /db_xref="InterPro:IPR019004"
FT                   /db_xref="InterPro:IPR023168"
FT                   /db_xref="InterPro:IPR042184"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y7X1"
FT                   /protein_id="ACI17070.1"
FT                   /translation="MSLKEKLQEDLKNAMKAKDSVKLEVVRSVVTGTKNLEVQKMGEAD
FT                   DNDVLQVIKQEVKKRREAIEMYQKAGRTDLLEQEKAELSVLESYLPPLMSEEEIRQVVR
FT                   NHIEKLQPKSMKERGKIMGSLMQELKGKADGNTVGSILDEELEKLFGGG"
FT   gene            465270..466898
FT                   /locus_tag="COPRO5265_0511"
FT   CDS_pept        465270..466898
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0511"
FT                   /product="uridine kinase"
FT                   /EC_number="2.7.1.48"
FT                   /note="identified by match to protein family HMM PF00485"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17712"
FT                   /db_xref="GOA:B5Y7X2"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR006083"
FT                   /db_xref="InterPro:IPR018163"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y7X2"
FT                   /protein_id="ACI17712.1"
FT                   /translation="MTHYLSVEGLFKLEVTHGGPFWEAIKAKQDCLTLLEKEEAVAIHV
FT                   GEDILPLQAPVLSDGALRLVRRGTVLGQRIAERSSMFVVGMAAYRLFGKKYMEVKYSYG
FT                   SGIFCSMDEPLKDEEIKALKQEVQKLIEEDIPIKWSVVNVGAEIPSSMFVRGVKSLTKY
FT                   RNVKHQLFYGEDYGEVSWLPLLPSTGMVKGINLINYAPGFVVVPEDRQFEEIPKLFQAF
FT                   FEYDQWLKVLGISDVGDINALTQGREITELIKVAEALHEKRVSYIADEIKKKEAKLILV
FT                   AGPSSSGKTSFSHRLAVQLRVNGLRPINMGTDDYFLPRELTPRDEAGNYDFDSLEAVDL
FT                   ETLVQDINQLLNGEEIEVKKYDFVRGARITQEKKLKLPENGVLILEGIHALNPRTTQGV
FT                   PAHVKYKVYVSALAHLNLDEVNRTYTTDARLIRRMVRDSFYRAYLAEETLRQWPSVRRG
FT                   EDKYIFPYQQEADAFFNSALPYELLVLKPFADPLLSQIPETVKEYPDAWRLKTLLSYFE
FT                   TCPSAYVPSTSILREFIGGSAFDVY"
FT   gene            466976..467074
FT                   /locus_tag="COPRO5265_0512"
FT   CDS_pept        466976..467074
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0512"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18191"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y7X3"
FT                   /protein_id="ACI18191.1"
FT                   /translation="MPNSVSFHMCVFVGFDVNCVHDLYALKVGGGG"
FT   gene            467082..467696
FT                   /locus_tag="COPRO5265_0513"
FT   CDS_pept        467082..467696
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0513"
FT                   /product="redox-sensing transcriptional repressor rex"
FT                   /note="identified by match to protein family HMM PF02629;
FT                   match to protein family HMM PF06971"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17548"
FT                   /db_xref="GOA:B5Y7X4"
FT                   /db_xref="InterPro:IPR003781"
FT                   /db_xref="InterPro:IPR009718"
FT                   /db_xref="InterPro:IPR022876"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y7X4"
FT                   /protein_id="ACI17548.1"
FT                   /translation="MIPWVVLERLYLYYSYVESLPPEINWVSSQMLGEALGISPDLVRK
FT                   DMTYCDIKGKPRQGYPVQELKSYLRKLLKLDVNVKSVIVGAGRLGSALANYDGLRKNNM
FT                   QVLALFDVDPEKVGKNLGDIPILALSELEGFVKEKHVQCGVITVPANSAQQVCDLLVSA
FT                   GVRAIWNFAPAALKVPHHVQLRNENIVQGFVLLRIRMLEVN"
FT   gene            467761..468231
FT                   /locus_tag="COPRO5265_0514"
FT   CDS_pept        467761..468231
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0514"
FT                   /product="ferredoxin domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17500"
FT                   /db_xref="InterPro:IPR019224"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y7X5"
FT                   /protein_id="ACI17500.1"
FT                   /translation="MLTAPKALGRDSIDVKLIEDRETLSTILDEAKKFQDKWPFYSRDA
FT                   KTLEDKDFILLLAYAEDKKPANLNCGLCKMDCDSARQGKTFCVFSALDLGIGLGVAVDV
FT                   FNDFGVDNRIQWTLGEACKSLGLCPEGSVAIAVPMHVSSKNVFFDRFWWDRK"
FT   gene            468242..469387
FT                   /locus_tag="COPRO5265_0515"
FT   CDS_pept        468242..469387
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0515"
FT                   /product="exonuclease SbcD"
FT                   /note="identified by match to protein family HMM PF00149"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17676"
FT                   /db_xref="GOA:B5Y7X6"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y7X6"
FT                   /protein_id="ACI17676.1"
FT                   /translation="MRVLVTGDWHLGAVTWRRKPQDRTPEIQACLNEILDFLSQERVDL
FT                   IAVTGDFTHYWVPLEGEKQRWLMDYLYALSEHAPVVGVLGNHDWRGLVSFDKFARKKDV
FT                   YIVDKFGQLELNLNGTKVCIVILPYFDARKVLQPYQKLTSNGVKDTAKQVVLNDLSPRS
FT                   CSWDANYRILITHGVVEGLAYSELGGNDVPIPKSALSQFDFALLGHIHNAQVIKDDSTG
FT                   RIVGCYPGGVAKLDFGEMGSTQGFWIVDLSPKGPDCKLIQFSSQKPLKRVEVAGPVTPE
FT                   VREEIMRTNGYVKAVLKEGDLVTVQKLYDLEPVVVVELKSAVSSGNEGSTGEGESKVRF
FT                   SSLEEAYGLYLNHYPELAEDKRDELLRRFSSYLRKAKENKS"
FT   gene            469384..472302
FT                   /locus_tag="COPRO5265_0516"
FT   CDS_pept        469384..472302
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0516"
FT                   /product="probable DNA double-strand break repair Rad50
FT                   ATPase, putative"
FT                   /note="identified by match to protein family HMM PF02463"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ACI16988"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038729"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y7X7"
FT                   /protein_id="ACI16988.1"
FT                   /translation="MKPKKLEVTNFLGLKNLSLEFPEQGVFVITGPNGSGKSSILEAMY
FT                   FALYGKTMRLPGDVKNTAVINRNAQHSSDNPARAVVSFTFVQQGKEYLVRRELVRGVHK
FT                   KDDVSHNAWLYDLSGHAGLVPETGVVKVNNKVEDILGLTPEVFAATVFLGQGKITELVE
FT                   AKPDKRRKIFDAILETDHLVKMQELVRGDLRELQTKVKALLERKEILEQGPSAKDLEKE
FT                   LQDVEENMKQVIERVQVFEQAAKELEEVQRIKGDMENTEADIAALRSEIEKLKEAAERD
FT                   TRIRLIKELRSKYAELEQWQIQLEELTKNKDKLGKDLSNWSERINELKLRVVQIEGQLN
FT                   SLEDDVHLSKEKEILAQSLEDLKALRSYLEEAWNAIVQCRLTSEEVLQLVLEERKLKSE
FT                   INKLEHFVEVVSSSDGLINSYFSAKQNMEKVEKEKQEVEKELFILEQSQATLKERISIL
FT                   SQDYPNLEQDFLVSRLAEPLHVGDTCPVCGSEITKLREIPLPEDVLMEFSQLEMERYHL
FT                   EQQQRIINERKAKLDKEEIELREVIKECESRLDLAVLEKMGSVKSFDAFQMWLSAQREA
FT                   LLERNQRVSQLEEQIQSKRDRLKSTYCSTLKRLCNQKEIKEALLKGSVEEQLSQADQGI
FT                   AEMERRKKELEAFSQQVREQRQDLMLALAETNVELRKTQEREEDIRNTLQETIHRMKQL
FT                   SGQVSTLLSELKEELSRAHISYEDYELLKSEQESGAADQLRALKGKLDVLEKRLEEQRK
FT                   KYLSLLENRDVASEELPVQLEQAKSEYEVLLGERGRLQASIEQALQKEAELNQVEVQLD
FT                   ALEKELNILSRLSDDLKADRFPDFYRGEMMNEIVSSASSLLWEMSGGQFNLTFDSDSFR
FT                   FDVVFDDGLSSDISSLSGGEKVLVALSLAFAISQHFAGSLESIFLDEGLAWLDKENNTK
FT                   LAQYLQNLEDGAILVGIVTHSEEFAINFQRRLYVNGGKAQWL"
FT   gene            472326..473333
FT                   /locus_tag="COPRO5265_0517"
FT   CDS_pept        472326..473333
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0517"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18236"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y7X8"
FT                   /protein_id="ACI18236.1"
FT                   /translation="MFKMLSLHQGVERSYYDSEFAMWDNLPPLPEDFSGLNVVSCTPVL
FT                   QGEEVLTRLSVEQMNRPIVIVDGVQRLMRRKLQKDGNWVYLVGLAAGAVEVWPKADLLL
FT                   PTLRRELVLFVPEGLLEMPFEDEYYNIPFRSVAYNPRDERRPLNTIVSEKRSALELSAL
FT                   NQAVSELGGKGILLRDGPLKFGDPLTRANGPVGLVKTLEPRSNVDIFTNFVKKLDLGQV
FT                   SCLLEMEDRNDTEEIGKRRYFSYLRIMDVGDPFSLEGIVRLDMVGQEGSGEELAKTAFM
FT                   AAETVFSLSRVGPYSRSPYNLMTVDWLEKHLRALLPDPSVVSIEVAREVNKLGG"
FT   gene            473323..475356
FT                   /locus_tag="COPRO5265_0519"
FT   CDS_pept        473323..475356
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0519"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17902"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y7X9"
FT                   /protein_id="ACI17902.1"
FT                   /translation="MADNIIGIVSGIEKNTPTEFYVNLFSEDGKSIRVRIGDVVRVSVF
FT                   YNDQEVIYYGTVYDILSRWDNDVDSGFKEKAVFEQVVPGNRFYMAAVAVTRAFYKGREV
FT                   FDEPLSVPAPGTPAFLVTEKEEVEKALRFDELKRRKSHLPVGVMINGQPAYIDLGFVLG
FT                   ENGAHINISGQSGVAAKTSYATFLMAAMLQRGQGEDRYASALREGRYIVFNMKGESLFF
FT                   LDCDSEDWLKADEADRQMWSSMYAAMGLDPEWKFPLDNILYCGIPKGVTARLLEEPDIK
FT                   SRSDAGDNLRVYGWDFIDVIRYRLLELALDQEEMSMSQNMQLLLFSVQEKMEELLERLV
FT                   FDVDAVVTEFTRKGTIGNRTVGRAGDKRDIFIRALQNIKCSIPDNVYERVRLVLYACNE
FT                   GPEQILGSYGIPQTVDDLTDYLRGAVLGDKAEVSEGQEGALKEWSKAITENEVGSATVF
FT                   AFIRRLKLAKKEGLSKLWRAFPHTLQGEVTEAPSFNYSVGSAWDRKGGITVIDLSKLHS
FT                   SMQAFVVGAVLRQVLEAKMAHPKATEEPVFIFLDELNKYAPRTEGGAMVKLFRDVAERG
FT                   RSFGVILVGAEQTASQVDFRVVTQSSTTVVGHQKAAELSHDEYKHLLPRQREMASSVGP
FT                   GVVFVDQPFLRVPIMVKFPMTRWSTKETKVTTQGFGLTDIFG"
FT   gene            complement(475245..475346)
FT                   /locus_tag="COPRO5265_0518"
FT   CDS_pept        complement(475245..475346)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0518"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ACI16817"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y7Y0"
FT                   /protein_id="ACI16817.1"
FT                   /translation="MSVKPNPCVVTLVSFVDHLVIGNFTMMGTLRNG"
FT   gene            475423..475893
FT                   /locus_tag="COPRO5265_0520"
FT   CDS_pept        475423..475893
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0520"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17272"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y7Y1"
FT                   /protein_id="ACI17272.1"
FT                   /translation="MNADLHVELIKEIPEPQKVSNWNDFLEGAESFMTALEARYEEEGL
FT                   YFSAEMRLYSGMEAGDLIMASTLYEVELVKAKDLVLALDAWARENGFTLGEVSLEFRSE
FT                   QDVVPRLNVPRLLAETGVKMEVEKGKVALVFTPGSMKDFSSLFTTVIEDLSK"
FT   gene            complement(475968..476525)
FT                   /locus_tag="COPRO5265_0521"
FT   CDS_pept        complement(475968..476525)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0521"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17199"
FT                   /db_xref="GOA:B5Y7Y2"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y7Y2"
FT                   /protein_id="ACI17199.1"
FT                   /translation="MYYPERPQNRKTVSGVLLFAIGLFLGALLILAGRPNINNSTCVPE
FT                   RVVETVTVVKEVCTATTTPGTATGSAPVVSYGFPTPSQATTASKTLSLQLSYPTADEIK
FT                   ADWVVFSGKVTKGNKGGAYYVTFWSNNRLIMVLRTDFNGTFSYKFTRLPAERSSNMNVT
FT                   VYAVDSDGRGVSNIISKVISPP"
FT   gene            476589..477200
FT                   /gene="rdgB"
FT                   /locus_tag="COPRO5265_0522"
FT   CDS_pept        476589..477200
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rdgB"
FT                   /locus_tag="COPRO5265_0522"
FT                   /product="non-canonical purine NTP pyrophosphatase,
FT                   RdgB/HAM1 family"
FT                   /note="identified by match to protein family HMM PF01725;
FT                   match to protein family HMM TIGR00042"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18053"
FT                   /db_xref="GOA:B5Y7Y3"
FT                   /db_xref="InterPro:IPR002637"
FT                   /db_xref="InterPro:IPR020922"
FT                   /db_xref="InterPro:IPR029001"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y7Y3"
FT                   /protein_id="ACI18053.1"
FT                   /translation="MVLATGNLGKVREISQLIGDVVELIPYEGALPEETGTTYAENAYI
FT                   KAKAAFDKYHLPSLADDSGLEVDFLGGQPGIHSNRFLGLKSDQEKYMRILELLEGVPWQ
FT                   KRTARFRCLVCYVDRTGAAHYFEGVAEGYIATEPAGEGGFGYDPVFYYPPLQKTFAQLP
FT                   AQVKNQISHRSQAFLKFKEYYLSTIESMRTPRRGGEDKHE"
FT   gene            477193..479793
FT                   /gene="valS"
FT                   /locus_tag="COPRO5265_0523"
FT   CDS_pept        477193..479793
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="valS"
FT                   /locus_tag="COPRO5265_0523"
FT                   /product="valyl-tRNA synthetase"
FT                   /EC_number="6.1.1.9"
FT                   /note="identified by match to protein family HMM PF00133;
FT                   match to protein family HMM PF08264; match to protein
FT                   family HMM PF09334; match to protein family HMM TIGR00422"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ACI16878"
FT                   /db_xref="GOA:B5Y7Y4"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002303"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR019499"
FT                   /db_xref="InterPro:IPR033705"
FT                   /db_xref="InterPro:IPR037118"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y7Y4"
FT                   /protein_id="ACI16878.1"
FT                   /translation="MNDGKFEAQYDATAELKWAKKWKEDKVFHSEIDKAKPRFSIVIPP
FT                   PNVTGSLHIGHALDLSLQDAIVRYKKMNGFNVCWVPGTDHAGIATQNVVERALLQQGIR
FT                   RQDLGREVFLEKVWEWKERYGNTILDQITRLGCGVDWDRLRFTMDPVCARAVRRAFKEL
FT                   FDRGLIYKGHYMINWCPRCGTAISDLEVTYEEEDSHLWFIRYPFEDQKGFIVVATTRPE
FT                   TMLGDTAIAVHPDDERYKNVVGKHVILPLVGRKIPVIADESVDPEFGTGAVKVTPAHDP
FT                   TDFAIGQRHNLEPIQVIGLDGSMTEEAGIFSGMDRFDARKQIVQALEEQGYLEKVEPYK
FT                   HAVGHCQRCHTVVEPMLSDQWFVKLTAMADEAKRVVETGEVQIIPERWIKVYQDWMDNI
FT                   RDWCISRQIWWGHRIPVYTCEECGYVFASEEETVEQCPKCGGPVKQEDDVLDTWFSSSL
FT                   WPFEVFGWPEETEDLKYYYPTSLLITGYDILFFWVARMIFMATTLTGQIPFEEVFLHGL
FT                   VLDEHGQKMSKSKGNTVDPMDMIDEYSADALRYALVSAMSLGGQDVNFSESRVEHGKNL
FT                   TNKIWNSARYVLSVLEGKQLDTTPNQFSIADRYILSRLEQTKQFVSECFEAYDFGAALR
FT                   EIESFYWSEYCDWYIEMSKVDPNYSTYWTLKEVLEQSLKLFHPFLPFVTQEIWDRMGHS
FT                   NYLVEESWPKLSEHVVDEEAIEKVATMKEAVRGLRNLRAELGLKPSQRIPSVFLQGNME
FT                   EWEEFFPYIKFLARVSEIEHSSQTISNAYSVVVGNTVFFVPLEGLVDIDRERKRLQKQQ
FT                   ADLENRIAIYDKRLQNEDFIKKAPQEVVEKQREERKALEESLSKVIKRLSELGG"
FT   gene            479872..480561
FT                   /locus_tag="COPRO5265_0524"
FT   CDS_pept        479872..480561
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0524"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0524"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18090"
FT                   /db_xref="GOA:B5Y7Y5"
FT                   /db_xref="InterPro:IPR004183"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y7Y5"
FT                   /protein_id="ACI18090.1"
FT                   /translation="MQKTIDALKLAASEVEKFNPEVTLIMSPHAVALNGEKVPVQVTDK
FT                   YTGDFGDFGAPHVTMRYDCSSKDAYALNGCGALAIRYGLMDHGSMVPLYYLRPSSPLVI
FT                   MGYAFLLSTKGYITFGSCMRQLFEGRRVLFIASGDLSHRLLPDAPAGYHPDAKRFDLKL
FT                   VEAVKDWSLDKYLLLEDFRDSAGECGYWSIATLFGFMGPKAESDVLSYEGPFGVGYAVA
FT                   VVKESGE"
FT   gene            480567..481097
FT                   /locus_tag="COPRO5265_0525"
FT   CDS_pept        480567..481097
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0525"
FT                   /product="putative 3,4-dihydroxyphenylacetate
FT                   2,3-dioxygenase"
FT                   /note="identified by match to protein family HMM PF01871"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17564"
FT                   /db_xref="GOA:B5Y7Y6"
FT                   /db_xref="InterPro:IPR002733"
FT                   /db_xref="InterPro:IPR023473"
FT                   /db_xref="InterPro:IPR027485"
FT                   /db_xref="InterPro:IPR027623"
FT                   /db_xref="InterPro:IPR036071"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y7Y6"
FT                   /protein_id="ACI17564.1"
FT                   /translation="MAEKMHHPYVELAKKALETFVLTGKVIPAPEPLPELFSGRAGCFV
FT                   TLMENGELRGCIGTIEPVYDNLALEIINNAIAAGTEDPRFPPVRADELPYLDYTVEVLG
FT                   PLELVRDLSELDPRVYGVVVQSSVRPLRKGVLLPDIEGVDTVDEQIRICRLKAGISGSE
FT                   PIILYRFRTEKFK"
FT   gene            481094..482086
FT                   /locus_tag="COPRO5265_0526"
FT   CDS_pept        481094..482086
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0526"
FT                   /product="MoaA/nifB/pqqE family protein"
FT                   /note="identified by match to protein family HMM PF04055"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ACI16880"
FT                   /db_xref="GOA:B5Y7Y7"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR016431"
FT                   /db_xref="InterPro:IPR027596"
FT                   /db_xref="InterPro:IPR034457"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y7Y7"
FT                   /protein_id="ACI16880.1"
FT                   /translation="MKLYVETDKGIICLACPRACNLSSGRGYCGVRSVKDGKFSCDVCE
FT                   LVSSIANDPIEKKPVFHYLPGSTVLSVGTLGCNMRCIGCQNWEIAHADLDTYRWNLQRI
FT                   TASELVALAKRVSDGLAWTYNEPTVWAEYVYDGASLAKEEGLYTVVVTNGYYSLQTFKL
FT                   WEPVVDVFRIDLKGFTDETYDKFAPDVKVSVILGNIERAVSSGKHVEVVTNVMPGVNDV
FT                   DLEAIADFIKSLNPEIPWHLTRFFPQFKMQNVPPTPVSLLTRARQMALEKGLKYVYLGN
FT                   VNLPGMENTVCPRCGNLLIERKGLFTVENYVEQGSCPRCGNKIYGRFGG"
FT   gene            482067..482231
FT                   /locus_tag="COPRO5265_0527"
FT   CDS_pept        482067..482231
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0527"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17285"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y7Y8"
FT                   /protein_id="ACI17285.1"
FT                   /translation="MEDLEVEGETEAYFTTHLEHFYRFVSRNIPRILAWEVHSFFQSCV
FT                   EFPAGTFGS"
FT   gene            482221..482331
FT                   /locus_tag="COPRO5265_0528"
FT   CDS_pept        482221..482331
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0528"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18199"
FT                   /db_xref="GOA:B5Y7Y9"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y7Y9"
FT                   /protein_id="ACI18199.1"
FT                   /translation="MALDLGFMAAQFNLSLGINAMSLLGVLFMLYVYLVQ"
FT   gene            482363..483370
FT                   /gene="mreB"
FT                   /locus_tag="COPRO5265_0529"
FT   CDS_pept        482363..483370
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mreB"
FT                   /locus_tag="COPRO5265_0529"
FT                   /product="cell shape determining protein MreB"
FT                   /note="identified by match to protein family HMM PF02491;
FT                   match to protein family HMM PF06723; match to protein
FT                   family HMM TIGR00904"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18055"
FT                   /db_xref="GOA:B5Y7Z0"
FT                   /db_xref="InterPro:IPR004753"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y7Z0"
FT                   /protein_id="ACI18055.1"
FT                   /translation="MPIDIGIDLGTANSLVAVKGKGIVVSEPSVVGLDRVTHKVLKVGN
FT                   EAFEMAGKTPENIVVIRPLKSGVIADDYTTEIMVKYLISKAKGHVGFSVFPQRLRVVVG
FT                   VPTGATPVERRAVEDACRNAGARDVWVVQEPLAAAVGAGLPITEPRGNMIVDVGGGTTE
FT                   AAVISLGGLVSWKSVPVAGDAFTERIIEFVKSEYNLFIGERTAEMIKINIGSAYPMEKM
FT                   QMEVTGRDLLTGLPKRITISSDAVRDAFKDLLGSIVDAVKGTLEATPPELISDIMETGF
FT                   YLTGGGSLLKGLDRLLSERTGVPVHTVEDPLTAVARGAGVIAGNMHLLKEILQA"
FT   gene            483377..484060
FT                   /locus_tag="COPRO5265_0531"
FT   CDS_pept        483377..484060
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0531"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17888"
FT                   /db_xref="GOA:B5Y7Z1"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y7Z1"
FT                   /protein_id="ACI17888.1"
FT                   /translation="MKVNLARVIEWTIAALLILAVFTTISWNTFFSYVSKPFLWIRTGI
FT                   YRVGETFSDFWWWNTEGKVVYEKKLMENEKALAQSVTDSVRFGEVKVIGLRWDQKHIEL
FT                   IATGGKVQVGDLITTDTDIVVGQVSEVVGNEFVIRTIFDESFSVPGLISRTGAVGRLFY
FT                   KGGELSFQPVGYEDILPGDYVVVPTATPLLAAVVTDVSDKQYIKANPVLVDLRAYGLKL
FT                   WSKTW"
FT   gene            complement(484020..484124)
FT                   /locus_tag="COPRO5265_0530"
FT   CDS_pept        complement(484020..484124)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0530"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17428"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y7Z2"
FT                   /protein_id="ACI17428.1"
FT                   /translation="MTRITTKGGKNIVPVIKKNMLSTMFYSIVSGHML"
FT   gene            484105..484383
FT                   /locus_tag="COPRO5265_0532"
FT   CDS_pept        484105..484383
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0532"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17038"
FT                   /db_xref="GOA:B5Y7Z3"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y7Z3"
FT                   /protein_id="ACI17038.1"
FT                   /translation="MVVMRVKALLSSYGFWSWLLVFFLALGFDGAFMHPFCVCTVGLLL
FT                   LADIFEWSWKKLAVSMSIMLVLWGFIINWWTLLVLPLIVVEAWADAE"
FT   gene            484373..486097
FT                   /locus_tag="COPRO5265_0533"
FT   CDS_pept        484373..486097
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0533"
FT                   /product="penicillin-binding protein, putative"
FT                   /note="identified by match to protein family HMM PF00905;
FT                   match to protein family HMM PF03717"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ACI16850"
FT                   /db_xref="GOA:B5Y7Z4"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR005311"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR017790"
FT                   /db_xref="InterPro:IPR036138"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y7Z4"
FT                   /protein_id="ACI16850.1"
FT                   /translation="MRNRAFYALGLLVVLIAGGFIWRLHFLQIQQYDYYATREKNNYTR
FT                   YVTEEPIRGRILDTKGRVLAYDQTAYNVAVVPALSKNATTTKENLFKLGAKAEDVEAAF
FT                   ENSKLYPFQPMVVIQDISESNRLKVLEVENHDPAIKLVLGSKRVYPYGQLGAFITGYVG
FT                   MASKEDLQRDENLRPSSIVGKMAAEKVFDSYLRGQPGITEVLVDVTGRVVKEKLVSTPV
FT                   KGYDVYLTVDMDLQKVAWDAVANEVGGVIAANPRDGSIYALVSKPSFDPNVFVKGIDSA
FT                   TWKEYEKNSSLVNRMTMSQIPPGSTFKVVTGLAGLYYHAITPDFTINDPGYLQLGSARV
FT                   WNYRHRSWGKVDFEKGLAVSNNVYFGTVGLRTGIDKIYEVAKTMGLTDYPWIEYDAVSK
FT                   GIIPNQQWKKEVVGEPWYPGDTVNTSIGQGYVAVSPMLMAQVYQQIINDGELYKFRFLK
FT                   EVRDGKTVVFKAEPESRPQSTIYKNWFPVIRNGMEAGVDWGLLTGLKSSMYTAAGKSGT
FT                   AETERANKYHKWLIAYANRNNPEIMVVSLRLYTTDTEPVKITKTVMEGYFRGKSAVR"
FT   gene            486075..486776
FT                   /locus_tag="COPRO5265_0534"
FT   CDS_pept        486075..486776
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0534"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17878"
FT                   /db_xref="GOA:B5Y7Z5"
FT                   /db_xref="InterPro:IPR016098"
FT                   /db_xref="InterPro:IPR036145"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y7Z5"
FT                   /protein_id="ACI17878.1"
FT                   /translation="MENQQYVKLTGLRDGYLVEYQGDNPEELSTILAKYLQSYADLLQG
FT                   HNLFVKSALDEKALITVGKKLSALGFRTSLVKYEEKQKENKKEMMYGNASRSATGHRVT
FT                   AQDSKKKGIPNTTGDVVFRVVVGPLRSGKSINLGEGVLLWGDLHKDAVIKALCVIVMGK
FT                   ASGKVIVPEGSFVLMKQSEGASVQVGDVLYVDISSPAWILITDADPDAVEVFSDEKQVG
FT                   RRMSQWLGSVL"
FT   gene            486755..487558
FT                   /gene="minD"
FT                   /locus_tag="COPRO5265_0535"
FT   CDS_pept        486755..487558
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="minD"
FT                   /locus_tag="COPRO5265_0535"
FT                   /product="septum site-determining protein MinD"
FT                   /note="identified by match to protein family HMM PF01656;
FT                   match to protein family HMM TIGR01968"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17457"
FT                   /db_xref="GOA:B5Y7Z6"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR010223"
FT                   /db_xref="InterPro:IPR025501"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y7Z6"
FT                   /protein_id="ACI17457.1"
FT                   /translation="MAGQCIVVTSGKGGVGKTTITANVGYALASLGKKVLLIDGDIGLK
FT                   NLDSVLGLERRVVYDLFDVITNRIELEDALVKDKRLPDNLFLLAASQSHFKEDVPEEKF
FT                   SEVVEEAKALFEYVLVDSPAGIEHGFRISSRFADRAVVVTVPEVPSIRDVDRVVGLLEN
FT                   YRVSVDGVVVNRLNQTLVRQGNMLSPQDILDLLEIPLLGVVPEDTLIVQAVNQGDPLVY
FT                   KYPNSAVARAYTNIAHKLLDPEYVPQETKKSRGFWSLFGFLRGEG"
FT   gene            487558..487815
FT                   /locus_tag="COPRO5265_0536"
FT   CDS_pept        487558..487815
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0536"
FT                   /product="septum site-determining protein"
FT                   /note="identified by match to protein family HMM PF03776"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18134"
FT                   /db_xref="GOA:B5Y7Z7"
FT                   /db_xref="InterPro:IPR005527"
FT                   /db_xref="InterPro:IPR036707"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y7Z7"
FT                   /protein_id="ACI18134.1"
FT                   /translation="MSWFTDLFGRHTKNDAKQRLEVMLIHDRGIFDNADLEQMEKEILT
FT                   VVKRYADIETGAAEICTDKLDNGRLLLSIRVPVRGQKSRR"
FT   gene            487812..488897
FT                   /locus_tag="COPRO5265_0538"
FT   CDS_pept        487812..488897
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0538"
FT                   /product="Rod shape-determining protein RodA"
FT                   /note="identified by match to protein family HMM PF01098"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17164"
FT                   /db_xref="GOA:B5Y7Z8"
FT                   /db_xref="InterPro:IPR001182"
FT                   /db_xref="InterPro:IPR018365"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y7Z8"
FT                   /protein_id="ACI17164.1"
FT                   /translation="MKIRLVFGLICVVSAFALVFFGLVGISAATQPGYEFSGFMTDYVR
FT                   TQLIAFAAGLLVGLIILYVGFAYVLKVAPYLAVVSVILLLITLVMGEEAYGAQRWISFG
FT                   SFQFQPSELAKLSLPLLLVWINGRFSGVKKWAISLVGAMSYVVLVLVQPDLGTSIVLLV
FT                   EFIAYLVIEGVNWGILLSGLYMVILAFPILWDKALKEYQKRRLLSFLNPFDDPSGSGYN
FT                   LIQAWTAIGSGGLKGKGLDNAYFLYYGYLPVDHADFIFATISYVLGFWGAVSLLALMCS
FT                   FVLGGVGFAFFVPDSKQKEFCFIVLCAWLIQFAVNIGMNLGLMPITGIPLPFISYGGSA
FT                   LLMNMVMLFTFLSYRPEPETH"
FT   gene            complement(488894..490102)
FT                   /locus_tag="COPRO5265_0537"
FT   CDS_pept        complement(488894..490102)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0537"
FT                   /product="zinc protease, putative"
FT                   /note="identified by match to protein family HMM PF00675;
FT                   match to protein family HMM PF05193"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17051"
FT                   /db_xref="GOA:B5Y7Z9"
FT                   /db_xref="InterPro:IPR001431"
FT                   /db_xref="InterPro:IPR007863"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="InterPro:IPR011765"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y7Z9"
FT                   /protein_id="ACI17051.1"
FT                   /translation="MNIETLNTEFPSLYVKRDTSVFSITIAIPGGAMAEEEGQYGYAHL
FT                   LEHMLFRGTRTYATSKDLAMEIEGVGGRYNGFTTYDAIYLTATVPANYWQNAVKVLFSL
FT                   AYEPLLEETALSTEKQVVISEIQMAQDQPEERAYSHLQKTMWNGHRLREDVIGRRKDIE
FT                   NATKTKLYIFWEKLIYQKPCVAIAGPIDGKVLESFLRNVYIPSPLVDPIKHMERPEFTP
FT                   GSSRIKEDTQQTYYRLALQACEAARDDIFVYQLISNILGGSSFSQLFLRIREEEGLSYS
FT                   VYSTVEATSVAGALIVSCDLKPKGLDRTKSIIQEEIERLSQAKLTVDELDRFKRFTVGA
FT                   YTMSLESTSSISLLLADRFVTRNRVWDPQSEIQYINSISVDLISENLKHSMEAGSAEVI
FT                   LGP"
FT   gene            complement(490154..490402)
FT                   /locus_tag="COPRO5265_0539"
FT   CDS_pept        complement(490154..490402)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0539"
FT                   /product="heat shock protein 15"
FT                   /note="identified by match to protein family HMM PF01479"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17862"
FT                   /db_xref="GOA:B5Y800"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR025490"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y800"
FT                   /protein_id="ACI17862.1"
FT                   /translation="MRLDKFLKESGIIKRRTLAQRIIQAGYVKINGKLAKQSDPVKVDD
FT                   MIEVDTPVAYTRYVVINVERPSKAELQERIKKTDDFS"
FT   gene            complement(490389..491447)
FT                   /locus_tag="COPRO5265_0540"
FT   CDS_pept        complement(490389..491447)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0540"
FT                   /product="MazG family protein"
FT                   /note="identified by match to protein family HMM PF03819;
FT                   match to protein family HMM TIGR00444"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ACI16819"
FT                   /db_xref="InterPro:IPR004518"
FT                   /db_xref="InterPro:IPR011551"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y801"
FT                   /protein_id="ACI16819.1"
FT                   /translation="MKRYKVIKGLDVCVETETEAEGTSKEKCGQIRLPREVIDWQQVLE
FT                   DVWKGLLTNKDGTVVVTSNLENALFFSNLFLQSLGYTPQRAALELQSVFELPEPPSFGS
FT                   SDCHCTLPKTVGFQFMRFKKIVENLRERCPWDREVTPYQLVTLSREELSELMEAISNQD
FT                   MDNYAEELGDLWLHLLLHSVIAEENDAFELADVLTKASEKAISRHPHVFASDHDADAAT
FT                   VLSKWQERKGKNSDDESVPPNVFTWALRLQDEAHHHGLDWEDPMQLKDKLEEEFEELRC
FT                   AFESGQTQSMKDEVGDLLFTVVNLARLLNVDPEDALLHSSKKFQRRLKYVTEHQAENDL
FT                   ETLWEESKNEAG"
FT   gene            491532..493532
FT                   /locus_tag="COPRO5265_0541"
FT   CDS_pept        491532..493532
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0541"
FT                   /product="V-type H(+)-translocating pyrophosphatase"
FT                   /EC_number="3.6.1.1"
FT                   /note="identified by match to protein family HMM PF03030;
FT                   match to protein family HMM TIGR01104"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17653"
FT                   /db_xref="GOA:B5Y802"
FT                   /db_xref="InterPro:IPR004131"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y802"
FT                   /protein_id="ACI17653.1"
FT                   /translation="MLEFFAVAVLLLLTVILNARWILGIKVENALAAQISGHIHDGAKA
FT                   FLSSEYKVMFPWIVVLFIVLALLTGYKSAIAFLAGALFSIAAGYIGMQIATLANVRTTE
FT                   AARRGSGDALSVAFSAGSVMGMTVVAFGLLGLGLVVFVFGGFEKAGGIVSSFSLGASFV
FT                   ALFARVGGGIFTKAADVGADLVGKVEANIPEDDPRNPAVIADNVGDNVGDVAGMGADLY
FT                   ESYVGSIVACIVLALAEKNMVGLSFVLWAVSLGALSSWFTILLVRGISSRSHMEPANVF
FT                   RMGSILVTLLAVGFVCLIPMWTGASWSYVVSTVAGMIVGIAIGFITDYYTMGAPIKEIA
FT                   KASETGAATNILSGMAIAMQSTFLPVLLVGLATIVAYLSAGLFGIALAGVGMLCTLAYS
FT                   LSVDAYGPVADNAGGIAEMAHFSPQVREVTDGLDALGNATAAMGKGFAIASAALTALAL
FT                   FAAFNSAVGIKALDVSDPKVLTGVMVGAASPFLFSSIVINAVSRTAFVIVKEVRRQFKE
FT                   IPGLLSGQANPDYVVCVSISTSHALKNMVVPALLALILPLASYFLLGVEGVGGVLIGQT
FT                   VSGFVMAVYMANAGGAWDNAKKLIEGGFLGGKGSEAHHAAVIGDTVGDPLKDTAGPSIN
FT                   ILMKLSTVVSLILIPIFVQMGLPVLIDLFAK"
FT   gene            complement(493628..493958)
FT                   /locus_tag="COPRO5265_1610"
FT   ncRNA           complement(493628..493958)
FT                   /locus_tag="COPRO5265_1610"
FT                   /product="Bacterial RNase P class A"
FT                   /ncRNA_class="RNase_P_RNA"
FT   gene            complement(493920..494303)
FT                   /locus_tag="COPRO5265_0544"
FT   CDS_pept        complement(493920..494303)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0544"
FT                   /product="iojap protein family"
FT                   /note="identified by match to protein family HMM PF02410;
FT                   match to protein family HMM TIGR00090"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18022"
FT                   /db_xref="GOA:B5Y803"
FT                   /db_xref="InterPro:IPR004394"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y803"
FT                   /protein_id="ACI18022.1"
FT                   /translation="MEAIQRLLDEKKAENIKIVDIRALDTIADYFIICTANSLTHSQSL
FT                   ADSLEELLDKKNITYRVEGYTPGDWVLVDIGDIVVHIFTQRAREYYDIESHWTSMVEYV
FT                   KSRRGSRNQKVEESPSSTEQDAG"
FT   gene            complement(494349..494930)
FT                   /gene="nadD"
FT                   /locus_tag="COPRO5265_0545"
FT   CDS_pept        complement(494349..494930)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nadD"
FT                   /locus_tag="COPRO5265_0545"
FT                   /product="nicotinate (nicotinamide) nucleotide
FT                   adenylyltransferase"
FT                   /EC_number="2.7.7.18"
FT                   /note="identified by match to protein family HMM PF01467;
FT                   match to protein family HMM TIGR00125; match to protein
FT                   family HMM TIGR00482"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17187"
FT                   /db_xref="GOA:B5Y804"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR005248"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5Y804"
FT                   /protein_id="ACI17187.1"
FT                   /translation="MIKPLKSSRTGLLAGVFDPVHIGHLFMAHLAMEAANLDRVWFVPT
FT                   HIPPHKDSAKVPYFHRVNMLEMALKEEPKFVLMELEREARPTYSYETILSVKHVLGEKP
FT                   YFILGSDEWEELHNWRRYDLLVKNAIFIVVPRKPITVARPEAEAIFTDMTPINVSSTYI
FT                   RQRVAKGKPITYLVPKTVETYIHENHLYYP"
FT   gene            complement(494905..496164)
FT                   /locus_tag="COPRO5265_0546"
FT   CDS_pept        complement(494905..496164)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0546"
FT                   /product="Spo0B-associated GTP-binding protein"
FT                   /note="identified by match to protein family HMM PF01018;
FT                   match to protein family HMM PF01926; match to protein
FT                   family HMM PF09269; match to protein family HMM TIGR00231;
FT                   match to protein family HMM TIGR02729; match to protein
FT                   family HMM TIGR03595"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18082"
FT                   /db_xref="GOA:B5Y805"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR006074"
FT                   /db_xref="InterPro:IPR006169"
FT                   /db_xref="InterPro:IPR014100"
FT                   /db_xref="InterPro:IPR015349"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031167"
FT                   /db_xref="InterPro:IPR035101"
FT                   /db_xref="InterPro:IPR036346"
FT                   /db_xref="InterPro:IPR036726"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5Y805"
FT                   /protein_id="ACI18082.1"
FT                   /translation="MIFIDTAEIIVYGGKGGDGAASFRREKFIEKGGPDGGDGGKGGDV
FT                   YLVTDPALLTLYDFKYQKEFRAEDGEPGRSQKQFGKDGKDLFIRIPVGVIVADLETQTV
FT                   VDMDKPGMKLLVARGGRGGKGNARMATATRRAPRFRELGHEGEMRRLRLELKLVAHVGL
FT                   VGLPNAGKSSLISVISKAKPEIAPYPFTTRSPVLGIVKKAEQSFVVSDVPGLIEGAHEG
FT                   KGLGLTFLRHVERTKVLAIVIDAAAIDGYEPMQAYETIIGELRAYNPNLLEKPRVLVLN
FT                   KIDLLQPEHIDQLKVQFADKESHVVLTSAATGEGTNQLVDVLFELISPTLSTEEPTAEF
FT                   MTMELPPLPEDFSIRREDEYWVVEGRWARYISRYDTTQPWDFQYVQREIRRKKLEEMLR
FT                   QMGAKEGETVVIHDKAFEIL"
FT   gene            complement(496164..496424)
FT                   /gene="rpmA"
FT                   /locus_tag="COPRO5265_0547"
FT   CDS_pept        complement(496164..496424)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmA"
FT                   /locus_tag="COPRO5265_0547"
FT                   /product="ribosomal protein L27"
FT                   /note="identified by match to protein family HMM PF01016;
FT                   match to protein family HMM TIGR00062"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17224"
FT                   /db_xref="GOA:B5Y806"
FT                   /db_xref="InterPro:IPR001684"
FT                   /db_xref="InterPro:IPR018261"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5Y806"
FT                   /protein_id="ACI17224.1"
FT                   /translation="MAHHKGGGSSRNGKDSNPQYLGVKAYGGEKVKPGSIIVRQRGNHF
FT                   WPGKNVGQGKDFTLFALAEGVVQFEKKGGKKFVSVIPNEQK"
FT   gene            complement(496431..496751)
FT                   /gene="rplU"
FT                   /locus_tag="COPRO5265_0548"
FT   CDS_pept        complement(496431..496751)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplU"
FT                   /locus_tag="COPRO5265_0548"
FT                   /product="ribosomal protein L21"
FT                   /note="identified by match to protein family HMM PF00829;
FT                   match to protein family HMM TIGR00061"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0548"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17855"
FT                   /db_xref="GOA:B5Y807"
FT                   /db_xref="InterPro:IPR001787"
FT                   /db_xref="InterPro:IPR028909"
FT                   /db_xref="InterPro:IPR036164"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5Y807"
FT                   /protein_id="ACI17855.1"
FT                   /translation="MYALLEIRGKQYKVKENSTILVPGWEEIKPEEVKVLMVKDEANTV
FT                   VGTPFVEGAEIELEPVKQIRTKKIKVRRFKAKVNYHRKKSHRIRYTILRINGIKTSVLT
FT                   EG"
FT   gene            complement(496782..496871)
FT                   /locus_tag="COPRO5265_1611"
FT   tRNA            complement(496782..496871)
FT                   /locus_tag="COPRO5265_1611"
FT                   /product="tRNA-Ser"
FT   gene            complement(496947..497570)
FT                   /locus_tag="COPRO5265_0550"
FT   CDS_pept        complement(496947..497570)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0550"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF02660;
FT                   match to protein family HMM TIGR00023"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18042"
FT                   /db_xref="GOA:B5Y808"
FT                   /db_xref="InterPro:IPR003811"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y808"
FT                   /protein_id="ACI18042.1"
FT                   /translation="MNYYYLLGLVGAYLYGAMPFGYLIALSKGVDIRKIGSGNIGTTNV
FT                   YRALGVVFGAMTLLLDLSKGFIPSYLAFHYFSGLTPLQQWLLFLAPIIGHCFSVFLRFK
FT                   GGKGVATSVGALLGFDIRLVLMFVAVWLVTFLPTRWVSLGSILGIWSVFIFAFAILPFF
FT                   PWALLFLAFFITWRHKDNIRRLMAGSENKTFLPWEQKKAAAGNS"
FT   gene            497765..499108
FT                   /locus_tag="COPRO5265_0551"
FT   CDS_pept        497765..499108
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0551"
FT                   /product="carboxyl-protease"
FT                   /note="identified by match to protein family HMM PF00595;
FT                   match to protein family HMM PF03572; match to protein
FT                   family HMM TIGR00225"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17357"
FT                   /db_xref="GOA:B5Y809"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR004447"
FT                   /db_xref="InterPro:IPR005151"
FT                   /db_xref="InterPro:IPR012854"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="InterPro:IPR036582"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y809"
FT                   /protein_id="ACI17357.1"
FT                   /translation="MVRKNGNKLAFFLLLAVLLSVAPALSYSNHTLELFPNSSTAIFDG
FT                   KSYKLTASPVLVQGRLLVPVRDISELIGVDVRWDNQARKAIVTFPYVPDLVSENQTLRD
FT                   NLQDSLSYLQVLDNPEMQALVTTIKTIKEEYLYPEKTSTVVYAAAKGAVNSLQDPYSSF
FT                   YDPSEAKQILEALQGAFVGIGVYLQESANGVVVVKVVPGSPAQKAGMQAGDLIIKVDDV
FT                   DVSSAPIEVISSLLKGEEGTYVKVTVKRADKTLTFTIQRLRIVVPTVSLIMNTTTVAVL
FT                   QIDQFTETTPSEFRQVMGSVKAPKLVIDLRGNPGGLVESLVDVAGMLMGTKPVFLYRDN
FT                   EQTTVIDAETPQIYTGRLYVLVDKYSASAAEMLAGALQDNKRATIVGERTFGKGVGQTL
FT                   FDLEDGSLLYLTTFEFRTPNGKVINNYGIDPDIKVDPATALEYVLRLP"
FT   gene            499178..499942
FT                   /locus_tag="COPRO5265_0552"
FT   CDS_pept        499178..499942
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0552"
FT                   /product="glutamine-binding protein"
FT                   /note="identified by match to protein family HMM PF00497"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18209"
FT                   /db_xref="GOA:B5Y810"
FT                   /db_xref="InterPro:IPR001320"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR018313"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y810"
FT                   /protein_id="ACI18209.1"
FT                   /translation="MKRTFVLLLVVGAILLGCSSQQSANTLVVGTAADFPPLEFIDENG
FT                   NFAGFDIELMNAIAEKIGYEVKWENADFAGLVASLQTGKYDAVISAMTITASRQEEVDF
FT                   SRPYFRSDQAVVVQESNVGILSREDLADKTIGVQLGTTGELLARELVSDKGGVYTYESP
FT                   DQAFLDLNTGRLDAVVNDLPVSSYFLLRNPNLPLKVAFTIETEEYYGIAVKKGNTELVE
FT                   KINNALIQLKEEGKYAELYQKWFETEPPADIP"
FT   gene            500020..500670
FT                   /locus_tag="COPRO5265_0553"
FT   CDS_pept        500020..500670
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0553"
FT                   /product="glutamine ABC transporter, permease protein"
FT                   /note="identified by match to protein family HMM PF00528;
FT                   match to protein family HMM TIGR01726"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17662"
FT                   /db_xref="GOA:B5Y811"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y811"
FT                   /protein_id="ACI17662.1"
FT                   /translation="MDFRWELLVTIFPILWSGFLTTLGLTLSSLLVGLVFGLILALMKI
FT                   STNWILKGISIAYIELIRGTPALMQIMLVYFGLPALGLNIDRLTAAVVALGLNSAAYSG
FT                   EIFRAGIESIDRGQMEAARAIGMTGSMAMRLIVLPQAFRVVIPPLVNEFVALLKDTSLV
FT                   SVIGVADLMLRSRNMISYTANVFTPLLGASILYLLATIPGSQLSAYLERRFKF"
FT   gene            500673..501413
FT                   /locus_tag="COPRO5265_0555"
FT   CDS_pept        500673..501413
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0555"
FT                   /product="glutamine transport ATP-binding protein GlnQ"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0555"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17829"
FT                   /db_xref="GOA:B5Y812"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030679"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y812"
FT                   /protein_id="ACI17829.1"
FT                   /translation="MMPILEAKNIVKRFGKHEVLKGVSLAIHQKEIVVIMGPSGGGKTT
FT                   LLRTLNLLEEPSDGEIYFRGKKIDPRSRDANELRKKVSMVFQLFNLFNHLNVLQNVTIG
FT                   PIKVLGKSPQEAEAQAMEILHRVGLAEKAKALPSSLSGGQKQRVAIARALAMEPDVILF
FT                   DEPTSALDPEYTKEVLDVMKELAEEGMTMVVATHEMGFAKEVSTRIVFLEDGRVIEDTD
FT                   AHKFFVEGPQTERARQFLSKILKA"
FT   gene            complement(500966..501259)
FT                   /locus_tag="COPRO5265_0554"
FT   CDS_pept        complement(500966..501259)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0554"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF07673"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17045"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y813"
FT                   /protein_id="ACI17045.1"
FT                   /translation="MATTMVMPSSANSFITSKTSLVYSGSRAEVGSSNKITSGSMASAL
FT                   AIATLCFWPPDKDEGRAFAFSAKPTRCKISMAWASASWGDLPKTFMGPMVTF"
FT   gene            501478..502698
FT                   /locus_tag="COPRO5265_0556"
FT   CDS_pept        501478..502698
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0556"
FT                   /product="aminotransferase, class I"
FT                   /note="identified by match to protein family HMM PF00155"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0556"
FT                   /db_xref="EnsemblGenomes-Tr:ACI16994"
FT                   /db_xref="GOA:B5Y814"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y814"
FT                   /protein_id="ACI16994.1"
FT                   /translation="MEPKDFISKRGASLKPSAIREIFKYSGDPSFISFAGGYPDPDVFP
FT                   VEELKEVSVEALDKYAKKALQYSATEGVPELRQYLVKFMEEEENVKGLGEENIIITTAS
FT                   QQSLFLVGLVLIDPGDVVMVEAPTYLGALSAFDPFEPDYVSVPTDDDGIIPEKLEEMVI
FT                   DLKKKGKKVKFLYVIPTFQNPAGYTLSLERRKRIVEIAEEQDFLIVEDDPYSYLVYEGE
FT                   RPPCVKSFDNSDHVIYLSTFSKTFVPGFRLGWIVAHKDIIRRIAISKQAADLCTGAYMQ
FT                   YITYLYMQKGHFMKHIEAMRDIYKVKHAAMLEALDKYMSDIPGVYWSKPKGGFFVWLVL
FT                   PETVDCDQLFDKAIEHKVVYVRGSAFFADGQGKNTARLNFSQPKVEDIDKGIKILADVI
FT                   KETMGVK"
FT   gene            complement(502700..502813)
FT                   /locus_tag="COPRO5265_0557"
FT   CDS_pept        complement(502700..502813)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0557"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0557"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17767"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y815"
FT                   /protein_id="ACI17767.1"
FT                   /translation="MEMTAANLRKEGASPERGPKKEERKEREKYLSNFPVV"
FT   gene            502900..503649
FT                   /locus_tag="COPRO5265_0558"
FT   CDS_pept        502900..503649
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0558"
FT                   /product="glucose 1-dehydrogenase II"
FT                   /EC_number="1.1.1.47"
FT                   /note="identified by match to protein family HMM PF00106;
FT                   match to protein family HMM PF08659"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0558"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18246"
FT                   /db_xref="GOA:B5Y816"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y816"
FT                   /protein_id="ACI18246.1"
FT                   /translation="MLLKDKVAIITGGGSGFGRATSLLFAKEGAKVAVVDYVEEAAKMV
FT                   ANEIKSMGAEAIYVKADVSSEEDVMRFVDVTVKAFGKLDIIFNNAGIYVPGNAEQQKVE
FT                   DWDRILNVNLKGVFLGCKYAIPHMKQNGGGAIINTASAAALIGFPEAIAYAASKGGVVS
FT                   LTRAVALDYAKFGIRANCICPGTSETAITKDVLADPQLRAMFLAPIPLGRFGQPEDVAN
FT                   AALFLASDLSAYITGAVLPVDGGWTMA"
FT   gene            complement(503740..504369)
FT                   /locus_tag="COPRO5265_0559"
FT   CDS_pept        complement(503740..504369)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0559"
FT                   /product="phosphate transport system regulatory protein
FT                   PhoU, putative"
FT                   /note="identified by match to protein family HMM PF01895"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0559"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17586"
FT                   /db_xref="GOA:B5Y817"
FT                   /db_xref="InterPro:IPR026022"
FT                   /db_xref="InterPro:IPR028366"
FT                   /db_xref="InterPro:IPR038078"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y817"
FT                   /protein_id="ACI17586.1"
FT                   /translation="MKSTTKLLEERLIYLSSLARDTCRAVLDAVERKSPANANAVLALD
FT                   QKVDELNKDIQETVLQVAMECPDDIASVIIIGKIAQDIERLVDHSMNVARIAIDPTVPS
FT                   ESYDFYALTFKRMGEIVIEMLDEAIDAFINRDPEIAKQVAKKDDVLDTIYADLKKRLRS
FT                   GQENLKLEETIDLMLAAKHLERMGDYVTNICEYTTMLTTGVQADLN"
FT   gene            complement(504406..505479)
FT                   /locus_tag="COPRO5265_0560"
FT   CDS_pept        complement(504406..505479)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0560"
FT                   /product="signal transduction histidine kinase"
FT                   /note="identified by match to protein family HMM PF00512;
FT                   match to protein family HMM PF02518"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0560"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17335"
FT                   /db_xref="GOA:B5Y818"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y818"
FT                   /protein_id="ACI17335.1"
FT                   /translation="MGGADLALLVVVLCALASVVVLFQTVSTQDRRSEENMAKDLLENL
FT                   PVPVFVLDDDFRIIRYNGLFESLVGKAPLERFLYEVFRDHKVIDALQTCKKEGTASTPF
FT                   YLTPSAEKRSYYMILKRTNGEIIGTIEECSHGSTKEDVELYQKMLHELKTPLSSVRLML
FT                   ELLEEEEDPVQRKDLTTRIIDEMDRLNQLTSDLALLIKMDRGLVERMDKVNIVNLLSEV
FT                   IWQMSVLADNKRVSIEAEIPSHSIFVEGSKSLLKSLFLNLLDNALKYSPERTKITVTLQ
FT                   EQEENVLITVADEGEGIPEEQREKVFQDFYRATSKADGLGLGLGIALEVVKFHDGRLWL
FT                   EPNEPHGLKVNVALRKA"
FT   gene            complement(505484..506194)
FT                   /gene="yycF"
FT                   /locus_tag="COPRO5265_0561"
FT   CDS_pept        complement(505484..506194)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yycF"
FT                   /locus_tag="COPRO5265_0561"
FT                   /product="DNA-binding response regulator YycF"
FT                   /note="identified by match to protein family HMM PF00072;
FT                   match to protein family HMM PF00486"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0561"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18183"
FT                   /db_xref="GOA:B5Y819"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y819"
FT                   /protein_id="ACI18183.1"
FT                   /translation="MENQSETILVVEDDRNILDAIERKLTKEGFKVIKAMNGKEALEKF
FT                   YAHQPNLVLLDLMLPLVDGKEILKEIRSQYDTPIIVVTAREEEVDRILGLELGADDYIT
FT                   KPFSLPELVARVRAVLRRTYGMKKTVGERRLVCDDIALDLRGHELRVNNRSYLLPKKQF
FT                   ELLRILMSRAGEVLTREYLLNEIWGADYYGDKRTLDVHIKWLRDKIEPNPNEPKYILTV
FT                   RGVGYKFNGDVRKE"
FT   gene            506303..507040
FT                   /locus_tag="COPRO5265_0562"
FT   CDS_pept        506303..507040
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0562"
FT                   /product="putative NAD-dependent deacetylase 2"
FT                   /EC_number="3.5.1.-"
FT                   /note="identified by match to protein family HMM PF02146"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17229"
FT                   /db_xref="GOA:B5Y820"
FT                   /db_xref="InterPro:IPR003000"
FT                   /db_xref="InterPro:IPR026590"
FT                   /db_xref="InterPro:IPR026591"
FT                   /db_xref="InterPro:IPR028628"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y820"
FT                   /protein_id="ACI17229.1"
FT                   /translation="MLSDYEAVAKLLKNSGHAVVLTGAGISTESGIPDYRGPQGLWRKY
FT                   DPIKYVSRSTFETDPKTFWEFNLPMWMQYKAAKPNKAHFLVAELERLGFIKAVITQNID
FT                   GLHKRAGSKNVYEVHGNLETVTCLRCHKEYPLEEAWKQFNDCNIPQCSCGGLLRPNVVL
FT                   FEDPMPDTFFQAVREVESSDLMIVMGSSLEVYPVAQLPAMVSKLVVVNLLPTPYDDRAD
FT                   YVFHESTGEFSEKLASVLGIKLS"
FT   gene            507154..507924
FT                   /gene="surE"
FT                   /locus_tag="COPRO5265_0564"
FT   CDS_pept        507154..507924
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="surE"
FT                   /locus_tag="COPRO5265_0564"
FT                   /product="5'/3'-nucleotidase SurE"
FT                   /EC_number="3.1.3.5"
FT                   /EC_number="3.1.3.6"
FT                   /note="identified by match to protein family HMM PF01975;
FT                   match to protein family HMM TIGR00087"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0564"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17560"
FT                   /db_xref="GOA:B5Y821"
FT                   /db_xref="InterPro:IPR002828"
FT                   /db_xref="InterPro:IPR030048"
FT                   /db_xref="InterPro:IPR036523"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y821"
FT                   /protein_id="ACI17560.1"
FT                   /translation="MRKILVANDDGIFAEGINILVTHLLKWGKAEITVVAPDRTKNATS
FT                   HSLTLDSILRLRKVFMPNGYEGYTVVDGSPADCVLVALNDLVPDTDLVIAGINHGTNCG
FT                   IDVLYSGTVGAASEGVVNGKPSIAISSESPEREHLEITAQVLISLLDQGLLNATSSDWV
FT                   LNINVPALKLEEIKGVAWATMSRHGWTNRVQRREDPRGQIYYWVTGERSKPEQSNNGDY
FT                   QLLSQGFVTLTPVGLDLTDHESLKELSSRFVFQL"
FT   gene            complement(507898..508857)
FT                   /locus_tag="COPRO5265_0563"
FT   CDS_pept        complement(507898..508857)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0563"
FT                   /product="tRNA (guanine-N(7)-)-methyltransferase
FT                   (tRNA(m7G46)-methyltransferase)"
FT                   /EC_number="2.1.1.33"
FT                   /note="identified by match to protein family HMM PF02390"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0563"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18005"
FT                   /db_xref="GOA:B5Y822"
FT                   /db_xref="InterPro:IPR003358"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5Y822"
FT                   /protein_id="ACI18005.1"
FT                   /translation="MLIKPQSTSSFPLNWDAIFPEKNPLAVEIGFGNGKFLKTLETTGT
FT                   NVVGFEVSLLSVEKAMKVIDHTKTALLLMDGIWGLRELFSERSVDALYINFPLPWPHKK
FT                   HASRRLFTLPKLQIYASRLVDNAILQLQTDVKEYAEEAIRNSEESGLFSLADYAVRNEV
FT                   QVGTKYEQKWVSQGKKIYKVVLRKKRHVSVPNYLDKEVIMPHAIVHDSHGTLKAGTYRT
FT                   TFGTIKLWEPFSNNQAMLLIPAIVSDDDFIGVSLQQRVYISVSPHREGFIVKLDNHADV
FT                   FKTENVKSLIWLIANQISNGNIKRINVQPPSKLEYEPA"
FT   gene            complement(508867..509547)
FT                   /locus_tag="COPRO5265_0565"
FT   CDS_pept        complement(508867..509547)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0565"
FT                   /product="rhomboid family protein"
FT                   /note="identified by match to protein family HMM PF01694"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0565"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17448"
FT                   /db_xref="GOA:B5Y823"
FT                   /db_xref="InterPro:IPR022764"
FT                   /db_xref="InterPro:IPR035952"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y823"
FT                   /protein_id="ACI17448.1"
FT                   /translation="MFPLFDINRRRTFPVRTILIIVINIIVYAFVQPLLPDSFYISPQK
FT                   FLSMISVNPLNLTPWGLLFLSMWLHGNLYHLISNMWFLFIFGDNIEGDFGKFYIPFYLI
FT                   GGMVAGLAHIYMMPQSAEFFVGASGAISAVMGAYLVFYPHAYIATLIFLIFFVTVVNIP
FT                   AWFWLLIWFFQGNVLPTLLNSMSYVAYWAHIGGFVFGVIVAFMVLPIVRRRRRSEPYST
FT                   PYYW"
FT   gene            complement(509522..510316)
FT                   /locus_tag="COPRO5265_0566"
FT   CDS_pept        complement(509522..510316)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0566"
FT                   /product="periplasmic serine protease"
FT                   /note="identified by match to protein family HMM PF01972"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0566"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17731"
FT                   /db_xref="GOA:B5Y824"
FT                   /db_xref="InterPro:IPR002825"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y824"
FT                   /protein_id="ACI17731.1"
FT                   /translation="MSPAVHQHYLQAARQTLIRAWEKKRHSRLITLIHRQESVALWGLP
FT                   IARYITMEDSEAVLTAIRSTPPDTPIDLVLHTPGGLVLAAEQIARALYMHPAKTTVIIP
FT                   HYAMSGGTLIALAADQIIMDKHAVIGPLDPQINGLPAASILQAVKDKGVQNVDDQTLIL
FT                   ADISRKAIDQVKDTVKWFLRKHMDEEKAEEVATLLCEGYYTHDNPIFAEEAKQLNLNID
FT                   TSMPKEIYDLLMLYPQPAGSQRAVSYSKNVEAPTDVSVIRYK"
FT   gene            510420..510749
FT                   /locus_tag="COPRO5265_0567"
FT   CDS_pept        510420..510749
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0567"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0567"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17818"
FT                   /db_xref="GOA:B5Y825"
FT                   /db_xref="InterPro:IPR032820"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y825"
FT                   /protein_id="ACI17818.1"
FT                   /translation="MLRKLSVDVLSWQKMFYNLGMPRRFRKIRKQRKPVEAGSGRFWAA
FT                   FSDAYTFGATLLVSMGIFGVAGYYLDQWLGTLPTFTVALLLIGIYLSFRVFIKDVLKRG
FT                   RVRNG"
FT   gene            510742..511380
FT                   /gene="atpB"
FT                   /locus_tag="COPRO5265_0568"
FT   CDS_pept        510742..511380
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpB"
FT                   /locus_tag="COPRO5265_0568"
FT                   /product="ATP synthase F0, A subunit"
FT                   /EC_number="3.6.3.14"
FT                   /note="identified by match to protein family HMM PF00119;
FT                   match to protein family HMM TIGR01131"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0568"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17276"
FT                   /db_xref="GOA:B5Y826"
FT                   /db_xref="InterPro:IPR000568"
FT                   /db_xref="InterPro:IPR023011"
FT                   /db_xref="InterPro:IPR035908"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y826"
FT                   /protein_id="ACI17276.1"
FT                   /translation="MGNELTLSVNSFYWSFVVTGLLWLLCWYISLKAKEEGTWKYAVMA
FT                   LWNWLVSYGKELLGDYAEEVMPFLATFFVYILTANWLGLLPGFVAPTRDLSVTVGLALL
FT                   LLIWIHAYAIRKMGWKKYLAVFFSPAWWMFPLNLMEHITRLLSLSVRLYGNVSGEHLAV
FT                   AVISLLVPLIAPIPLLGLSMFTGFIQAYIFMTLGMAYTAEFLEEGGLLT"
FT   gene            511377..511616
FT                   /gene="atpE"
FT                   /locus_tag="COPRO5265_0569"
FT   CDS_pept        511377..511616
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpE"
FT                   /locus_tag="COPRO5265_0569"
FT                   /product="ATP synthase F0, C subunit"
FT                   /EC_number="3.6.3.14"
FT                   /note="identified by match to protein family HMM PF00137;
FT                   match to protein family HMM TIGR01260"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0569"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17913"
FT                   /db_xref="GOA:B5Y827"
FT                   /db_xref="InterPro:IPR000454"
FT                   /db_xref="InterPro:IPR002379"
FT                   /db_xref="InterPro:IPR005953"
FT                   /db_xref="InterPro:IPR020537"
FT                   /db_xref="InterPro:IPR035921"
FT                   /db_xref="InterPro:IPR038662"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y827"
FT                   /protein_id="ACI17913.1"
FT                   /translation="MSNVVAAILSAGWPLGIAAGLAALGMGIAAGKAFEAISRQPDASG
FT                   DIRSLTLIAFAFIESLVIYVLAVAFLMLFVRPGV"
FT   gene            511646..512380
FT                   /locus_tag="COPRO5265_0570"
FT   CDS_pept        511646..512380
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0570"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0570"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17476"
FT                   /db_xref="GOA:B5Y828"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y828"
FT                   /protein_id="ACI17476.1"
FT                   /translation="MTFNWFSLAAAVVNLLILYWILQRYLFGPLLKTIKDQQEQWLQKE
FT                   KELQQKELEIASREEQLEHERQELEYEVRTYYEQAMKEIEAFKENEQADARKKAETVYQ
FT                   QIVNAARTEADRIKKEALQQIDDTIKDVVTNVYKAFFQGLNHNGDFVALLLEGRIDEIK
FT                   PLLGQGRSYIFTSSHPLDDKQKARVEHVLQEKAGVGVSSFEVDEELVLGFQLSWKAEMI
FT                   EYSLAQQIREYVKIEEAEGIGS"
FT   gene            512370..513851
FT                   /gene="atpA"
FT                   /locus_tag="COPRO5265_0571"
FT   CDS_pept        512370..513851
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpA"
FT                   /locus_tag="COPRO5265_0571"
FT                   /product="ATP synthase F1, alpha subunit"
FT                   /EC_number="3.6.3.14"
FT                   /note="identified by match to protein family HMM PF00006;
FT                   match to protein family HMM PF00306; match to protein
FT                   family HMM TIGR00962"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0571"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17663"
FT                   /db_xref="GOA:B5Y829"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR000793"
FT                   /db_xref="InterPro:IPR005294"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR023366"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036121"
FT                   /db_xref="InterPro:IPR038376"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y829"
FT                   /protein_id="ACI17663.1"
FT                   /translation="MEVKRELPFRIVVQPQRLEKKFYGRVVAYRDGIATVEGLGNIGYY
FT                   ETVQFEEGAKGIVMDVDPQLSYVVTTSGEVHIGEMCLATGEVPAIPVGYDVLGKVLDPL
FT                   GNVLEGDTFTPAQVYPVERPAKPLYERSRVNEPVETGIAAIDMLIPVGHGQRELILGDR
FT                   QVGKTTLATDILINQKGKDVIGVYVSIGQKVSDTAAIINSFKVNDVMDQVVMVVAAASD
FT                   PAIVRFLAPYAGASIAEYFMEQGRKVIIVFDDLSKHAVSYRELTLLLRRPPGREAYPGD
FT                   IFYAHSRLLERAAKLTNGGSITAFPICETQLGDFSAYIPTNLISITDGQLFLDSGLFNA
FT                   GRRPAINIGLSVSRVGGAAQYPAIRKLSSGLRSTLARYEELSEFTRFGGKLDDASQKIL
FT                   SRGERTIKLLVQAAHELYSSLEQAALLVLLNNGYFDAADVGNVKEVWNSVREYLRTEVP
FT                   QLKSVDLHEPLDDETTRLILMAGERAMKIGKLNGA"
FT   gene            513829..514659
FT                   /gene="atpG"
FT                   /locus_tag="COPRO5265_0572"
FT   CDS_pept        513829..514659
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpG"
FT                   /locus_tag="COPRO5265_0572"
FT                   /product="ATP synthase F1, gamma subunit"
FT                   /EC_number="3.6.3.14"
FT                   /note="identified by match to protein family HMM PF00231"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0572"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17955"
FT                   /db_xref="GOA:B5Y830"
FT                   /db_xref="InterPro:IPR000131"
FT                   /db_xref="InterPro:IPR035968"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y830"
FT                   /protein_id="ACI17955.1"
FT                   /translation="MASLMELRRRLNTIQGLSRISRGLRIINSYYMAGVRRDFEQMEAY
FT                   DEALLDSVGAILGLLPSEVIQSSRFINAPSLAPRVVLAFFSDGGLCGNYNELVTEGLVS
FT                   LKLTQNDRVYGIGTLAPDKLSDLGIKPVDYIGGLYQSKNTPLLVDFFLGITEELFSELW
FT                   LVFVRSVPGKEGQYVTQKASPITLEVQARHGELIGEPEEIIDQVLSSYLTATMLRAFYS
FT                   AAFSEFYMRWSAMTHAEDKAKELADSVKLKISQTRQERVTRELQDIVGGMNYGR"
FT   gene            514649..516004
FT                   /gene="atpD"
FT                   /locus_tag="COPRO5265_0573"
FT   CDS_pept        514649..516004
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpD"
FT                   /locus_tag="COPRO5265_0573"
FT                   /product="ATP synthase F1, beta subunit"
FT                   /EC_number="3.6.3.14"
FT                   /note="identified by match to protein family HMM PF00006;
FT                   match to protein family HMM PF00306; match to protein
FT                   family HMM PF02874; match to protein family HMM TIGR01039"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0573"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17110"
FT                   /db_xref="GOA:B5Y831"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005722"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR024034"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036121"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5Y831"
FT                   /protein_id="ACI17110.1"
FT                   /translation="MEGKVIGIHGPVLDLQFTDYTPFERELIKVRDILVECRALLGEGK
FT                   VRTVALGPTEGIRRGDKATALGKPMTIKVGEQLIGRVLSGIGAPLDQKEEPEGEERSVF
FT                   NVPPQVTAVLPVSTVLETGIKALDLLAPFPRGGKIGLFGGAGVGKTVLVMELIHNVAIK
FT                   HRGYSVFAGVGERTREGQELWEEMRESGVMDHLVMIFGQMNEPPGVRAITPYAAATVAE
FT                   YLRSQYGGEILLFMDNIFRYAQAGMEVSTLLGRMPSAMGYQPTLFSEVAQIEERINSLA
FT                   EGAITSVQAVYVPADDITDPAPATIFGHLDSSVVLSRALTEVGIYPAVDPLQSSSKMLD
FT                   PEVVGYNHVQVAGRVKEFLQRYEELKDIIALLGMEELSPEDREVVLRARKIQMFLSQPF
FT                   FVAEAFSGAPGKYVPLERTVEGFKAIIDGKLDHVPESALYMIGDISEAGVDV"
FT   gene            515973..516341
FT                   /locus_tag="COPRO5265_0574"
FT   CDS_pept        515973..516341
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0574"
FT                   /product="ATP synthase epsilon chain (ATP synthase F1
FT                   sectorepsilon subunit)"
FT                   /EC_number="3.6.3.14"
FT                   /note="identified by match to protein family HMM PF02823"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0574"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17959"
FT                   /db_xref="GOA:B5Y832"
FT                   /db_xref="InterPro:IPR001469"
FT                   /db_xref="InterPro:IPR020546"
FT                   /db_xref="InterPro:IPR036771"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y832"
FT                   /protein_id="ACI17959.1"
FT                   /translation="MTLARLVLMFRVNIISSDQMLLFEAKSVILPLVDGYMGVLPRHSP
FT                   FVATLDVGLVTIKTAEDEEKNYAVAGGVASFSSGFLRIITPAVYETDDLNTFVEKLDEE
FT                   YKRAHEASQRYRSIKLNP"
FT   gene            516419..517633
FT                   /locus_tag="COPRO5265_0575"
FT   CDS_pept        516419..517633
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0575"
FT                   /product="molybdenum cofactor biosynthesis protein MoeA"
FT                   /note="identified by match to protein family HMM PF00994;
FT                   match to protein family HMM PF03453; match to protein
FT                   family HMM PF03454; match to protein family HMM TIGR00177"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0575"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17308"
FT                   /db_xref="GOA:B5Y833"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="InterPro:IPR005110"
FT                   /db_xref="InterPro:IPR005111"
FT                   /db_xref="InterPro:IPR036135"
FT                   /db_xref="InterPro:IPR036425"
FT                   /db_xref="InterPro:IPR036688"
FT                   /db_xref="InterPro:IPR038987"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y833"
FT                   /protein_id="ACI17308.1"
FT                   /translation="MAFLNLFDQRKLWELAEKIPLEPLSERKSIYDALGLVCAEDVLAP
FT                   EDIPPKARSEVDGYAVRSRDVKGASVERPSLLTRVGSIVVDEVPQFELNPGECAYIPTG
FT                   AILPKGADAVVMIEYVEESGNYVEVFKPAAPLENVVSPGEDMKQGDIVLKRGQRITPQV
FT                   VGLLSYLGKLEVQVYRPLKVFVAATGNEIVEPTQVPNLGQYRDANSLTVWSMLKERGFY
FT                   AHRGSIIRDELENIHEVINKATQNYDVIVLTGGSSAGIRDLVVRAVEEAGGTVLAHGFT
FT                   IKPGKPTVIGIVKEKLFVGLPGHPMSCFVSASLIVMPLLRRLQGENVKPMPLLKARLRT
FT                   AVFSRIGVEEWIPVRLSYEEELWAEPVFSKSGMVSSMVRNEGFLRIPPECEGMEPGEVV
FT                   EVLLL"
FT   gene            517630..519474
FT                   /locus_tag="COPRO5265_0576"
FT   CDS_pept        517630..519474
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0576"
FT                   /product="molybdenum cofactor biosynthesis protein"
FT                   /note="identified by match to protein family HMM PF00994;
FT                   match to protein family HMM PF03453; match to protein
FT                   family HMM PF03454"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0576"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17713"
FT                   /db_xref="GOA:B5Y834"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="InterPro:IPR005110"
FT                   /db_xref="InterPro:IPR005111"
FT                   /db_xref="InterPro:IPR024370"
FT                   /db_xref="InterPro:IPR036135"
FT                   /db_xref="InterPro:IPR036425"
FT                   /db_xref="InterPro:IPR036688"
FT                   /db_xref="InterPro:IPR038987"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y834"
FT                   /protein_id="ACI17713.1"
FT                   /translation="MRKIYYEVRELGEAKAILRNMCPPLKVETIPVRQALGRVTAEEIL
FT                   ANRSVPHYIAAAYDGYAVDALVTYGASEGHPLELTNYRVVSTGDALEFRETCVIPLEDV
FT                   VDSGGKKLIFKAFAEGTNVRQVGEDIIKGDLVVPARHWLEPMDIALLLAAGVYEVPVLK
FT                   KPLVLLIPTGDEVRSPEEVLKEGEIPETNSVFIVNELKDYFDFIVLPPVPNNVDALRSV
FT                   IDSYYNDVDIIATIAGSSYGERDVTANLLMGQGSDPDLQQQLYVHGINIKPGKPTILAS
FT                   YREKPFIGFPGFPVSTWVVAKFVLDSLVESYYGLLPQCWQQGKALSGRKIPSEGGSIEF
FT                   VRGVVGAASSQKGLVFMPLNRGAGAMSSVVRANAVLTIPANSEGFTEGSELELLMRYVG
FT                   WPLLVASDDIALKFLLSDLRKMGVFLNYVFTGSSTALELLRKNLAAAAGAHLLCPDGSY
FT                   NTCMAPANAIKVPFVKREQGFMVQRGNPKGIKSVEDLERSDVVFVNRDRGSGTRILLDY
FT                   LLQQKGLEPDHIKGYDHEEFSHLRVGMCVASGLADVGLGIKFAADVLGLDFVPVAEEEY
FT                   DLFFLSEYSNLADTISDFIKSKQFRARLSNMGGYRLVE"
FT   gene            519571..520509
FT                   /locus_tag="COPRO5265_0577"
FT   CDS_pept        519571..520509
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0577"
FT                   /product="molybdenum cofactor biosynthesis protein MoaA"
FT                   /note="identified by match to protein family HMM PF04055"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0577"
FT                   /db_xref="EnsemblGenomes-Tr:ACI16890"
FT                   /db_xref="GOA:B5Y835"
FT                   /db_xref="InterPro:IPR000385"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010505"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y835"
FT                   /protein_id="ACI16890.1"
FT                   /translation="MKDSFGREINYLRISVTDRCNFDCLYCSHPVEMLPRERVLRFEDI
FT                   VVLVQAAKELGIKKVRLTGGEPLLRRDIDKLVAMLHELDVTVHTTTNGFMLARLAEPLK
FT                   EAGLDGLNVSLDFVDAEKFRQITGGGDLATVVQGIDKALEVGLPVKLNAVFTTMHETKD
FT                   LKELLNFGKERNLPIRFIELMPKNLGSFSSLFRPIGDAQSMIESFTQLRPVGTNAVSGG
FT                   PAEYYLTDDGVEVGFIGFFSLNQCKQCNRIRVTSSGAIYPCLLRNVKVEAFESIKQGKE
FT                   ATKEALLKAVSIKPVAGNPEEVGPDMSEIGG"
FT   gene            520569..521822
FT                   /locus_tag="COPRO5265_0578"
FT   CDS_pept        520569..521822
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0578"
FT                   /product="folylpolyglutamate synthase/dihydrofolate
FT                   synthase"
FT                   /note="identified by match to protein family HMM PF02875;
FT                   match to protein family HMM PF08245; match to protein
FT                   family HMM TIGR01499"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0578"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17559"
FT                   /db_xref="GOA:B5Y836"
FT                   /db_xref="InterPro:IPR001645"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y836"
FT                   /protein_id="ACI17559.1"
FT                   /translation="MLDAYERISEELNQAPWFGRTPDLTRMDALLDELGLPQANTKNII
FT                   VTGTDGKGSVCSYLHSILGRRYKVGRFISPHLEEWTERITVGKDDISKEDFARLYVKVM
FT                   EGAKKACRVSGEMPTVFERLLAMALLYFEEQGTEWNVIEVGIEGHYDSTNLLPAKAVVV
FT                   TSVGMDHMRLLGNTIEEIADAISAAFRPHAVAVIGKTDPAAMNILEVNARRKKATVYRY
FT                   GRDFWYDGKFLSYSGSLDFQLALRGVHQWYNASAAIQTVLALSSTELNNIDASDIQEGL
FT                   REAFWPGRMETVRENPLIILDGAHNPHAAQSLRTSLDLLYPGKKWNIFFAAMKDKDWRS
FT                   VLTQFLDLANHVYVVRMPYERAESPETIVEFLKEKGTSSSVCEEQDVIKCDEDALVFGS
FT                   LYLVGDVRRLTRNAVHSF"
FT   gene            521803..522321
FT                   /locus_tag="COPRO5265_0579"
FT   CDS_pept        521803..522321
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0579"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0579"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17054"
FT                   /db_xref="GOA:B5Y837"
FT                   /db_xref="InterPro:IPR002820"
FT                   /db_xref="InterPro:IPR036522"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y837"
FT                   /protein_id="ACI17054.1"
FT                   /translation="MRFTHFENGQAIMVNIGEKSLSHRVTKAVLFGTRFSVPLARKAMT
FT                   LTHEFIPMAHPLPIAPLNSSFKRKAQVIEVQVSCDYKTGLELEAIMAAAGFMKEIPYLG
FT                   FAAITHKEGGKSGTLERRAQIYREGFSFQKGIWYRVVGKGWLKATEHGLEKVPDFQLEA
FT                   GDVILCSLQ"
FT   gene            522306..522875
FT                   /locus_tag="COPRO5265_0580"
FT   CDS_pept        522306..522875
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0580"
FT                   /product="molybdopterin cofactor biosynthesis MoaC region,
FT                   putative"
FT                   /note="identified by match to protein family HMM PF01967"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0580"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17098"
FT                   /db_xref="GOA:B5Y838"
FT                   /db_xref="InterPro:IPR002820"
FT                   /db_xref="InterPro:IPR036522"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y838"
FT                   /protein_id="ACI17098.1"
FT                   /translation="MQLTVTAQGTVAFRPDKFDLVSSEKLPKGPFLETARLAAFLAAKR
FT                   DSFFGSRVFITHMEIKHHWGPSELSFTVRLVADGDDEKEIMRRAWFSAFVCCLTTYDMV
FT                   KAVDPDAVIEDVGIVSINDEDLPEVDLSHADLSDFQDGYYCGFSPTLIVERGQIRSAFN
FT                   APWSNSNVRLRWLTAGKKFKGGFSGE"
FT   gene            522868..523362
FT                   /locus_tag="COPRO5265_0582"
FT   CDS_pept        522868..523362
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0582"
FT                   /product="molybdenum cofactor biosynthesis protein B"
FT                   /note="identified by match to protein family HMM PF00994;
FT                   match to protein family HMM TIGR00177"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0582"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17267"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="InterPro:IPR036425"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y839"
FT                   /protein_id="ACI17267.1"
FT                   /translation="MSKLTPVITCSILICSDRCFRGEREDKTGPVLKETLERLGYHVHD
FT                   VKVVPDELDVIVDQLKEWVRLGMDLIITSGGTGVGPRDVTPEATIKVIEREIPGMSFAA
FT                   LMLSLQKTPHAVLSRAKAGVAGTTLIINLPGSTKGAQEIIEYLDPALKHAVPIIHGEVI
FT                   E"
FT   gene            complement(523352..524221)
FT                   /gene="glcK"
FT                   /locus_tag="COPRO5265_0581"
FT   CDS_pept        complement(523352..524221)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glcK"
FT                   /locus_tag="COPRO5265_0581"
FT                   /product="glucokinase"
FT                   /EC_number="2.7.1.2"
FT                   /note="identified by match to protein family HMM PF00480"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0581"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17747"
FT                   /db_xref="GOA:B5Y840"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y840"
FT                   /protein_id="ACI17747.1"
FT                   /translation="MEILAIDVGGTKVDMGIVKDGKLIARDRFLNSPSENIVNLISSYI
FT                   KDKDIDGVGIGVAGQVDYETGTVIFGGNIGWENFPLGRLLQEELNVPVFVENDANIFAL
FT                   GVWKYELGSKPESVLGVTLGTGIGGGFVYEGDLLRSKRGATLEIGHMVIEAEGPACTCG
FT                   SHGCLESLAGGWALEKWYSERTGEKLTGAQIHERARSGDKEAIFLYQRLGYYLGIACAS
FT                   LANILNPDIIVLGGSISATFPLWQDIYEAEIRRRAVPPVKDTPTVVSTLKEAALLGASA
FT                   LVEQALTR"
FT   gene            complement(524263..525462)
FT                   /locus_tag="COPRO5265_0583"
FT   CDS_pept        complement(524263..525462)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0583"
FT                   /product="malate oxidoreductase"
FT                   /note="identified by match to protein family HMM PF00390;
FT                   match to protein family HMM PF03949"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0583"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17927"
FT                   /db_xref="GOA:B5Y841"
FT                   /db_xref="InterPro:IPR001891"
FT                   /db_xref="InterPro:IPR012301"
FT                   /db_xref="InterPro:IPR012302"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR037062"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y841"
FT                   /protein_id="ACI17927.1"
FT                   /translation="MEITPSFLHKLYRGKWELRVRVPLARNLHVFYTPGVAEPCQSIAA
FT                   DSALVWDMTNRWNTIGVISNGTRILGLGNIGPEAGLPVMEGKAVLYKYYAGIDAIPLCI
FT                   RAETEEAILAFLSAIEPSLGGINLEDIKQPDAFNVLTEARKFLRIPIIHDDMEGTGIIM
FT                   LAAVLASSSMAGLKLESEKIVLLGAGSANMGFLQLLDELLLGNIGNVIVVDRDLVYNSE
FT                   NSQQHWMGNILSKTNKLGSSNLEEALKGASFLIAASRPGPGVFPLEYLRNMKKPNTVLS
FT                   LANPVPEVSREEACAMGVTIYGSGRSDDPNQVNNSLIFPGLMLGLLVTQQQYNTAVGIE
FT                   VAKALSELAMKKQRIVPQMDSEVHQFVARTVVEHFSKKCASKENASMWAEELNWRMNRK
FT                   "
FT   gene            complement(525453..526631)
FT                   /locus_tag="COPRO5265_0584"
FT   CDS_pept        complement(525453..526631)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0584"
FT                   /product="oxaloacetate decarboxylase beta chain"
FT                   /EC_number="4.1.1.3"
FT                   /note="identified by match to protein family HMM PF03977;
FT                   match to protein family HMM TIGR01109"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0584"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17991"
FT                   /db_xref="GOA:B5Y842"
FT                   /db_xref="InterPro:IPR005661"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y842"
FT                   /protein_id="ACI17991.1"
FT                   /translation="MDSLLWSQIGLMALGLLLIYLSYRFDLEPLLLIPIGFFMFMVNIP
FT                   NSPLAEQGGLMDQMFNALIKTELLPLIIFIGVGAMMDFGPLIANPSYMILGLFSQLGIF
FT                   IAFFVAILFGFDIPSAASIASIGTADGPTSIYVASKLKPDLVGTISMAAYSYVSIVPLL
FT                   IPPLLKGLVTRNEIKAQTTARGDISKNARLLFPFIVTLTAGFIAPMSLPLLGFLVFGYF
FT                   LKENEKTPSLKEAAEEILAPVATIFVGMLIGSSIRAESFFQLQTLAIMGIGLFAFIMNI
FT                   AAGILVAKVMHIVNRSFNPALGAAGNSAFPMAARVVHRYVQKMEPSTFLLLPAVSANVA
FT                   GQLGSVFAGTFLLQTVLSGLDNPLQIAGVAFGRSLLAMLVLVIIFTGVRKWK"
FT   gene            526693..527424
FT                   /locus_tag="COPRO5265_0585"
FT   CDS_pept        526693..527424
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0585"
FT                   /product="nucleotidyl transferase"
FT                   /note="identified by match to protein family HMM PF00483"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0585"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17417"
FT                   /db_xref="GOA:B5Y843"
FT                   /db_xref="InterPro:IPR025877"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y843"
FT                   /protein_id="ACI17417.1"
FT                   /translation="MKFVILAAGEGKRLKPLTSDRPKAMVEVLGKPLVQWQLEALSNLG
FT                   VPRDEVVVIGGFGYDKLKEFLTGKVQVLYNPYWSAANNVLTVYYALEQLNDDIAIINSD
FT                   VIAEEAVYALFHPDNEPYAVVDGGVDAAEEEMKVKLENGKIVLFSKRIDPSESVGEYIG
FT                   LSYIPRRLRGKMLSIIEGMWNRGELDRWYEDAFNILCETVPMTPVFCTGMLWTEIDTHE
FT                   DLERAKQIAAQLQKEKVEGDV"
FT   gene            527417..528463
FT                   /locus_tag="COPRO5265_0587"
FT   CDS_pept        527417..528463
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0587"
FT                   /product="glycerol-1-phosphate dehydrogenase [NAD(P)]
FT                   (sn-glycerol-1-phosphate dehydrogenase) (G-1-P
FT                   dehydrogenase)(Enantiomeric glycerophosphate synthase)"
FT                   /EC_number="1.1.1.261"
FT                   /note="identified by match to protein family HMM PF01761"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0587"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17828"
FT                   /db_xref="GOA:B5Y844"
FT                   /db_xref="InterPro:IPR016205"
FT                   /db_xref="InterPro:IPR032837"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y844"
FT                   /protein_id="ACI17828.1"
FT                   /translation="MFSKAVSLPIFWMIGENIMGDIKDVLSQYNMVFHRPLVVTGSGVT
FT                   SELGENYFSSYKRVSINSNHISDVEKVKAQARSVGSDLLIGFGGGKVIDVAKMAATELN
FT                   LPFLSVPTATSNDAVASPVAVINFGDYVKSMGAMAPIGVVADLNILRNQPRKQFLAGVG
FT                   DLFSNISALADWQLAADRGFERVDPVAAYLSRNAVENLFRAIENGSDLYATLVEGLVVS
FT                   GVAMVLAGNSRPSSGAEHLISHALDRFPIHDLHGLQVGVAAFFTLRLHGMDHLRYKKLL
FT                   SQIGFPCSWQELNVDRETFMKAVQLAPQTRSGRYTILSEVTPELLQEAYDEVYGVSVSG
FT                   DGEFSIQD"
FT   gene            complement(528389..529174)
FT                   /locus_tag="COPRO5265_0586"
FT   CDS_pept        complement(528389..529174)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0586"
FT                   /product="transglycosylase SLT domain protein"
FT                   /note="identified by match to protein family HMM PF01464"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0586"
FT                   /db_xref="EnsemblGenomes-Tr:ACI16937"
FT                   /db_xref="GOA:B5Y845"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y845"
FT                   /protein_id="ACI16937.1"
FT                   /translation="MVRGKFFHIVLSVIMALILIGSFYVEYTIQRNWNVMDHSIMVSFL
FT                   SPVISRTLKPTNLDNFPNYAFPVLRVEEIDKLIKTRIDKSTFKVAMNKNLSDKDRETIS
FT                   ACIIQYSYLYHVDPLLITAVIEQESGFNPKVQSIQGAVGLMQIMPALYNELKPQLGLSD
FT                   DPTSICDNIKAGTFYLSKRIQRWNDNVYWGLVAYFAGDGGVAKIKEQGKELYDKTGTST
FT                   QQYAVAILGKLYENYLILNREFPVPANTYSINFVVRFLQ"
FT   gene            complement(529141..530685)
FT                   /locus_tag="COPRO5265_0588"
FT   CDS_pept        complement(529141..530685)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0588"
FT                   /product="2',3'-cyclic-nucleotide 2'-phosphodiesterase,
FT                   putative"
FT                   /EC_number="3.1.4.16"
FT                   /note="identified by match to protein family HMM PF00149;
FT                   match to protein family HMM PF02872"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0588"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17002"
FT                   /db_xref="GOA:B5Y846"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR006179"
FT                   /db_xref="InterPro:IPR008334"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="InterPro:IPR036907"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y846"
FT                   /protein_id="ACI17002.1"
FT                   /translation="MPSVRMVVATDLHGQILPFDYVHAKPFPGGLSKVSTFLKKQRQEA
FT                   PTLFFDNGDAFQGSPLTFYAHRFFGNKVNPVVEAYNEMGLNGMCIGNHEFNYGLRYLTE
FT                   IEKQAKFPLLSANIQEQLTGQTKWLPFKVYRFGDWSVGVIALTTPAIEDFDLPWKWKGL
FT                   KFENPIKVAKNLVSQLKDQKVDVIVVLAHSGIEYDPLKRRRVSESSKENFVYSLATKVP
FT                   NIDVIVFGHTHRAFGPYKLNNTVLVQPPSYGKGVALIEIADGKVTRVQNVDLYGIEDDP
FT                   EILDMFWSDHRKTNDWINEVIGIAAEDFVSDTWKLAAEPVSNLYLDVLRYATENEIAMH
FT                   PPSPFEPITIKKGWLTRRDAFSLYPFDNEPVVLKITGHTLKKALEWNARYYYLVSATPS
FT                   GSIRPIRHPFVKTYNFETIGGLEVIYDLTEPWGNKVKKAKYMGSELHSRQNYWVSLTSY
FT                   RASGAGGFTMLKNQPIEFYSPQLLRDYFEKYLSEKGTITPRKERNWWFVANSFTLC"
FT   gene            complement(530688..531494)
FT                   /locus_tag="COPRO5265_0589"
FT   CDS_pept        complement(530688..531494)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0589"
FT                   /product="DegV family protein, putative"
FT                   /note="identified by match to protein family HMM PF02645;
FT                   match to protein family HMM TIGR00762"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0589"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17589"
FT                   /db_xref="GOA:B5Y847"
FT                   /db_xref="InterPro:IPR003797"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y847"
FT                   /protein_id="ACI17589.1"
FT                   /translation="MFHIVIDSAIDHLQDYPSFTVIPLYLRVGEKFLKDRVEITRDKFY
FT                   SIMSSVIDTFTTSQPSPEDFKKVFQSIPEQDILVLTVASSLSGTMQSALAAARETTKNV
FT                   KVLDTLNASIASGLLAHIAVQLREQGKTIEETYEELMQIREKISLVAVIATLKNLVRLG
FT                   RLPAFAGWVGGLLKTVPFIRIKGGEIKPLKNERGSPFTIFKKNVDKIMNLVEPRYPIAM
FT                   AYTDLSGDIVQYAQEKGAYLVQVSPIVGAFAGNNAYGFAFVEGGNL"
FT   gene            complement(531548..532372)
FT                   /locus_tag="COPRO5265_0590"
FT   CDS_pept        complement(531548..532372)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0590"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF02645;
FT                   match to protein family HMM TIGR00762"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0590"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17141"
FT                   /db_xref="GOA:B5Y848"
FT                   /db_xref="InterPro:IPR003797"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y848"
FT                   /protein_id="ACI17141.1"
FT                   /translation="MFHVIIDSAIDLPEGSTFDDFSLVPLYVKIDTQYYKDVVDISRDE
FT                   FFRILPNEYDRISTSQPNMEDFLAAINSSKHEDVLVMTISSKISGTYNSALSAAQESDK
FT                   KNVVVFDTWNLSMGAGVLALMALNMRNQGLPLEDVVNKLYELRERTRFWAVIATLKNLM
FT                   RTGRISRFTGLVGEILRVKPVVELKEGYIVPMRNERGKPFNILQKLVEEAEGNADRSYP
FT                   FIVGYTDYVPEIEQLVKEHNALLARGNPIVGAYTGNNTFAVAYVEKEREQKE"
FT   gene            complement(532407..533693)
FT                   /gene="asnS"
FT                   /locus_tag="COPRO5265_0591"
FT   CDS_pept        complement(532407..533693)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="asnS"
FT                   /locus_tag="COPRO5265_0591"
FT                   /product="asparaginyl-tRNA synthetase"
FT                   /EC_number="6.1.1.22"
FT                   /note="identified by match to protein family HMM PF00152;
FT                   match to protein family HMM PF00587; match to protein
FT                   family HMM PF01336; match to protein family HMM TIGR00457"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0591"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17460"
FT                   /db_xref="GOA:B5Y849"
FT                   /db_xref="InterPro:IPR002312"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR004522"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y849"
FT                   /protein_id="ACI17460.1"
FT                   /translation="MVSIRDIGKHEGEQVELRGWIHTKREKGKIIFIVMRDGSGFMQVV
FT                   LEQERLKPDQWEQAKEASLESSIVVKGVAKSEPRAPGGYEIHADHFEAFHITKDWPLGR
FT                   KEHGIEFLEENRHLWIRSRKQSAILRIRHTIENAMIDFLNENGFYRFDTPIITTAAAEG
FT                   TTTLFEVDYHGDKAYLSQSGQLYAEAGALALGKVYTFGPTFRAEKSKTRRHLLEFWMIE
FT                   PEAAWFEYEDNLQLQEQFVSYIVKRVLEENEDDLAILERPLEPLMKVEPPFPRITYTEA
FT                   VDLLNKNGFDITWGDDLGAPEETFLSNQYEKPVFLTHFPAKIKAFYMQPDPENPEVVLA
FT                   ADLLAPEGYGEIIGGSQRIHDYDLLLQKIREFGLNEEYYQWYLDLRRYGSVPHSGFGIG
FT                   LERTVAWICKLEHIRETIPFPRMLHKLTP"
FT   gene            complement(533758..534186)
FT                   /locus_tag="COPRO5265_0592"
FT   CDS_pept        complement(533758..534186)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0592"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0592"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18114"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y850"
FT                   /protein_id="ACI18114.1"
FT                   /translation="MVTPGIINEYLRILNLQFQFNGFQWDIPFHQDNVEINLVLTLSRD
FT                   FLRFEVPLMAEEKVSSELLNQLFEMNYRIAMAKFAMADDGMVRLVCDFPTVNMSFEEFQ
FT                   VSMQIVVSAAFDFIPQIRAIKAKPIGFEIPKNPKNQIM"
FT   gene            534299..534850
FT                   /locus_tag="COPRO5265_0594"
FT   CDS_pept        534299..534850
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0594"
FT                   /product="phosphodiesterase YfcE"
FT                   /EC_number="3.1.4.-"
FT                   /note="identified by match to protein family HMM PF00149;
FT                   match to protein family HMM TIGR00040"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0594"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17252"
FT                   /db_xref="GOA:B5Y851"
FT                   /db_xref="InterPro:IPR000979"
FT                   /db_xref="InterPro:IPR024654"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y851"
FT                   /protein_id="ACI17252.1"
FT                   /translation="MKILIASDLHGSVAAFQKVLENEPDSEMVLLLGDYLYHGPRNPLP
FT                   EGYNPRAMADLINSLSNAVLVKGNVDAPIDEELIKWPMSPLVHLVFHDGGNNRNDIHIL
FT                   AHHGHNADPTKLYKTQMVVSGHTHIKVLEYDAKEGVFRLNPGSPSLSKDGTPSYAVILS
FT                   DFRAQLKSLDGQVIKEIQIS"
FT   gene            complement(534843..535895)
FT                   /locus_tag="COPRO5265_0593"
FT   CDS_pept        complement(534843..535895)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0593"
FT                   /product="L-asparaginase, thermolabile"
FT                   /EC_number="3.5.1.1"
FT                   /note="identified by match to protein family HMM PF06089"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0593"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17925"
FT                   /db_xref="GOA:B5Y852"
FT                   /db_xref="InterPro:IPR010349"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y852"
FT                   /protein_id="ACI17925.1"
FT                   /translation="MEDYANPPTLGALVLRNELTESVHYADAVVVDYKGRLIASAGSPQ
FT                   RVTFLRSASKPLQAIPMLMDKLDIQYGFTMEEIAVMCASHSGTLEHVELVRSALKKIGL
FT                   DESYLQCGVHEPFDKSTAEFIKLNNIELTPAFHNCSGKHTGMLAQCVYHKWPLQTYFLL
FT                   DHPVQQRILKIVSEFFEMPPEKVEIGIDGCGVPVFGVPLYNAALAFAKLGTPEILPEEY
FT                   KEPASKVAMAMTRYPHLVAGKGRFDTEFMLFFQGAFLSKGGAEAVQLVSVLNRGLGIAV
FT                   KVVDGSSRALGAITLEVLRQLGLVTDEDIHGEALKNQYQPPVKNHRQEVVGIIKPVIKL
FT                   KVDPGWKVLS"
FT   gene            536130..536864
FT                   /locus_tag="COPRO5265_0595"
FT   CDS_pept        536130..536864
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0595"
FT                   /product="radical SAM domain protein"
FT                   /note="identified by match to protein family HMM PF04055"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0595"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17036"
FT                   /db_xref="GOA:B5Y853"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR040084"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y853"
FT                   /protein_id="ACI17036.1"
FT                   /translation="MENRLSLGEQKQSLIYGPVSSRRFGTTIGISLIPLKVCSFDCVFC
FT                   ELSVHTNVLTLERHTYVSVNEVLKELRNFPTQGVDYIALSGAGEPTLAANMGEVIDALH
FT                   QKYSVPVLVLSNGSTVFMKDVQEELRKADAVKLTFSSLKEESFKRLNQPAEGVTASKVA
FT                   RGIEEFASSYAGTLYFEVVVVKGINDDLSEVRKTVEFLAQFKPYHIDINRPARPGTARY
FT                   LELPDKELYMPLEREFPAVRVF"
FT   gene            complement(536888..537403)
FT                   /locus_tag="COPRO5265_0596"
FT   CDS_pept        complement(536888..537403)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0596"
FT                   /product="prokaryotic N-methylation motif domain protein"
FT                   /note="identified by match to protein family HMM PF07963;
FT                   match to protein family HMM TIGR02532"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0596"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17822"
FT                   /db_xref="GOA:B5Y854"
FT                   /db_xref="InterPro:IPR000983"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y854"
FT                   /protein_id="ACI17822.1"
FT                   /translation="MKLRARKGFTLMEIMVVLAVIALLTATLYPSYALARQRANVSTLL
FT                   SSSPKVLQYLELYRIDHQLYPTGNVVLDESQTGTDMLKAYYERSTPWPWDKEKKLENFF
FT                   AYSSEETPAGSIFYICWPVDKSANKAAEAMATTASIEALPVDSLTLLGYDYAVCATSTV
FT                   DPVLVKLR"
FT   gene            537669..537809
FT                   /locus_tag="COPRO5265_0597"
FT   CDS_pept        537669..537809
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0597"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0597"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18116"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y855"
FT                   /protein_id="ACI18116.1"
FT                   /translation="MRLAGYQCEQSGSHDMWQWVRILSPTFLIEEVEEHKHFEGFRVQG
FT                   E"
FT   gene            537802..538353
FT                   /gene="infC"
FT                   /locus_tag="COPRO5265_0598"
FT   CDS_pept        537802..538353
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="infC"
FT                   /locus_tag="COPRO5265_0598"
FT                   /product="translation initiation factor IF-3"
FT                   /note="identified by match to protein family HMM PF00707;
FT                   match to protein family HMM PF05198; match to protein
FT                   family HMM TIGR00168"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0598"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17437"
FT                   /db_xref="GOA:B5Y856"
FT                   /db_xref="InterPro:IPR001288"
FT                   /db_xref="InterPro:IPR019814"
FT                   /db_xref="InterPro:IPR019815"
FT                   /db_xref="InterPro:IPR036787"
FT                   /db_xref="InterPro:IPR036788"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y856"
FT                   /protein_id="ACI17437.1"
FT                   /translation="MNEQIRAPKVRVVDENGKQLGVFITAEAIRMARSRGYDLVEVAPT
FT                   ADPPVCRFIDYDKFRYEMAKKAKEAKRNQTIIEVKEIRLRLGTDVHDMETKMKKIREFL
FT                   EEGNKVKVTLRPRGRERALEEQIRQKLLSIAEKLSDVGQVEQDVRAEGRNFYFMIAPKK
FT                   KKEATKDGKTEEQQDSSQEV"
FT   gene            538376..538504
FT                   /gene="rpl"
FT                   /locus_tag="COPRO5265_0599"
FT   CDS_pept        538376..538504
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpl"
FT                   /locus_tag="COPRO5265_0599"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0599"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17544"
FT                   /db_xref="InterPro:IPR037229"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y857"
FT                   /protein_id="ACI17544.1"
FT                   /translation="MYRSAMNHLRRHKSASRLRRLKAPKVIDETYLGHVQDLLPRP"
FT   gene            538519..538872
FT                   /gene="rplT"
FT                   /locus_tag="COPRO5265_0600"
FT   CDS_pept        538519..538872
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplT"
FT                   /locus_tag="COPRO5265_0600"
FT                   /product="ribosomal protein L20"
FT                   /note="identified by match to protein family HMM PF00453;
FT                   match to protein family HMM TIGR01032"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0600"
FT                   /db_xref="EnsemblGenomes-Tr:ACI16930"
FT                   /db_xref="GOA:B5Y858"
FT                   /db_xref="InterPro:IPR005813"
FT                   /db_xref="InterPro:IPR035566"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y858"
FT                   /protein_id="ACI16930.1"
FT                   /translation="MRVKTSVAKRARHKKVLKEAKGYFGASHRVYRKAHEAVLKAGEDA
FT                   FAGRKQRKRDMRSLWITRINAAARNHGMNYSNFMHGLKVAGIQIDRKMLAELAVTDPEG
FT                   FSALVEKAKEAVG"
FT   gene            538872..539891
FT                   /gene="pheS"
FT                   /locus_tag="COPRO5265_0601"
FT   CDS_pept        538872..539891
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pheS"
FT                   /locus_tag="COPRO5265_0601"
FT                   /product="phenylalanyl-tRNA synthetase, alpha subunit"
FT                   /EC_number="6.1.1.20"
FT                   /note="identified by match to protein family HMM PF01409;
FT                   match to protein family HMM PF02912; match to protein
FT                   family HMM TIGR00468"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0601"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17140"
FT                   /db_xref="GOA:B5Y859"
FT                   /db_xref="InterPro:IPR002319"
FT                   /db_xref="InterPro:IPR004188"
FT                   /db_xref="InterPro:IPR004529"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR022911"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y859"
FT                   /protein_id="ACI17140.1"
FT                   /translation="MMKEVEEVEQVARDFESDLQELPPDQLKIKYLSRKGLVSKLLEKI
FT                   PTLPPEQRRDFGKYVNDLKRHIEEQIKQKEEQLLSIGSKHLAQEPLFLNDLTLEGKRPP
FT                   LGNVHVLFKARDELLSIFKFMGFSFFDGPELETDFYNFEALNFPPYHPARDMQDTLVVG
FT                   DRVLRTHSSAMQVRAMEAWGVPIKVILPGRVYRREEVSARKYPVFYQFDCLAVGENIGV
FT                   GHLKWTLETFLSAYFEKNVTVRFRPSYFPFVEPGNEVDVKCVFCDGQGCSVCGGTGWLE
FT                   ILGAGLVHPRVLEYAGVDPNRYSGFAFGVGVDRMAMLKYGINDIRLLYEGDVSFLRSL"
FT   gene            539913..542306
FT                   /gene="pheT"
FT                   /locus_tag="COPRO5265_0602"
FT   CDS_pept        539913..542306
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pheT"
FT                   /locus_tag="COPRO5265_0602"
FT                   /product="phenylalanyl-tRNA synthetase, beta subunit"
FT                   /EC_number="6.1.1.20"
FT                   /note="identified by match to protein family HMM PF03147;
FT                   match to protein family HMM PF03483; match to protein
FT                   family HMM TIGR00472"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0602"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17632"
FT                   /db_xref="GOA:B5Y860"
FT                   /db_xref="InterPro:IPR004532"
FT                   /db_xref="InterPro:IPR005121"
FT                   /db_xref="InterPro:IPR005146"
FT                   /db_xref="InterPro:IPR005147"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR020825"
FT                   /db_xref="InterPro:IPR036690"
FT                   /db_xref="InterPro:IPR041616"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y860"
FT                   /protein_id="ACI17632.1"
FT                   /translation="MKFSFNQLKKFWQEKDQVTWQQVKSYLEKHLEVEVEEEVPIDIPD
FT                   SWWLKEVAPANEKNSRAEVHLENGSVIPVYLPEEVSHSNSSGTSICVLVDTKSGTLLSR
FT                   GDLGPLQELLGFATVSSNGSEAGSPKEAGTSAGRDDLSDLVLLRNAPEGPLKEVLELPD
FT                   MLIKLSVLPNRGDLSHLFGLAREIACGMGLTLVVPTFQHKLEKRNGLVSIQTDGCLVYV
FT                   GMLLENLRVEESPWWLKLELMRFGQRCINNVVDLTNYFLFNYGQPMHAFDFDTLTDHRI
FT                   VVRQAKPGEKLVLLNNEEVTLDEDCMVIADAVKPVGVAGVMGGRDASVSSQTKRVLLEV
FT                   AAFAPSSVAMSSRKLGVRTDASMLYERGVAPFGQVDMALLFADFVEQMGCAQATALWFA
FT                   GEERRYRLVDYNPQRIVKLSSVKDQDLVDMISTKQWEVITEEGNNDGKKKIRIPAYRWD
FT                   ITRTEDLVDELVKFVGYDRIPSLPLMDYIPFREKESITKENKLREASSLYFQEVFMVSL
FT                   ISDKDVQNISAHMGIDAKNVLAVDNPVSRELAYLRPNLLISLIKAALLNQNRFHDDVHL
FT                   FEIGSVFTRVSKDANSTEVEERRHIAYLSKGLYWENALDKDLWSYREFKGALENIFERC
FT                   SLTLGWENAFVSWAESQFSGIIKYEGREVGQVGMLKPSLLKAYDLKGPVFAAELDLDVL
FT                   PLVTGREPVFPLKFPQSWRDLSVVMPVEVPVSELAKLFEGEPLVKDWKVVDLYRGEKLS
FT                   PSEKSVTVRVWLGAEDHTVSSEEVDQVVERVLGRLTEAGWHLRT"
FT   gene            542303..544651
FT                   /locus_tag="COPRO5265_0603"
FT   CDS_pept        542303..544651
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0603"
FT                   /product="MutS2 protein"
FT                   /note="identified by match to protein family HMM PF00488;
FT                   match to protein family HMM PF01713; match to protein
FT                   family HMM TIGR01069"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0603"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17319"
FT                   /db_xref="GOA:B5Y861"
FT                   /db_xref="InterPro:IPR000432"
FT                   /db_xref="InterPro:IPR002625"
FT                   /db_xref="InterPro:IPR005747"
FT                   /db_xref="InterPro:IPR007696"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036063"
FT                   /db_xref="InterPro:IPR036187"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y861"
FT                   /protein_id="ACI17319.1"
FT                   /translation="MKDDLESLEYGKILAQIKSHASSEYGQRYLETHLPSSDIQQVEKW
FT                   LKETEEAWELVRKNVDPFTFFVSDVDAVVDLLNKQGYVPVEDFLNFVKAADVLVQLRRK
FT                   LSAETGVLGSLAKRIVPLDAWLNDVRSKVDESGYVKDDASRKLSDIRRDQKRLSNEIQD
FT                   KLQREMDRYQRFISDRLVVKRGNRYAIPVKSSNVPQVKGIVLDWSGSGQTAYVEPFSVV
FT                   DMNNRLEELRFMEEQEIYRIFQELCSQLYPIAEEIRISLRILGEIDAAYAKAKWGSSMR
FT                   GTLPKISQNGLINIKGARHPLIPQDRVVPVDIVVPEGRIGVILSGPNTGGKTVTLKTIG
FT                   LFAALLKIGAPVPAVDAQLPLYNRILMDIGDQQSIESSLSTFASHIARLKVIVEEADSG
FT                   DLVLIDELGSGTDPDEGAAIAEAVVDFLVRRNVQFFIATHLWRLKTLAADRKEIINASV
FT                   DFDTEKLKPLYKLNMGVPGRSYALEIAQKWGMPELFISTARSKLSEDHERVEKLIEQLQ
FT                   ERVKSYEDLQREAARLRDELREKNNQLDKALSQLDAKRTKILDETRAKAKRILEEADEE
FT                   SKRLLKELSQQSKANQRAYQIREQIKNMLEEVVKEDDEMMEKQRGGPEPIPVQIREGDT
FT                   VYVTKFKQLGLVLKLSEDTAEVQIGPLRATVAKTELSKVDASAMEHRRGVSSVIKGGSG
FT                   VEINVTQDVPMKLEVHGLSVDDALEKVDKYLDQAYAAGLPYVYIIHGRGTGALLRAIHE
FT                   YLSTHPHVSRFRFAEPSEGGTSVTMVYFS"
FT   gene            complement(544682..545044)
FT                   /gene="panD"
FT                   /locus_tag="COPRO5265_0604"
FT   CDS_pept        complement(544682..545044)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="panD"
FT                   /locus_tag="COPRO5265_0604"
FT                   /product="aspartate 1-decarboxylase"
FT                   /EC_number="4.1.1.11"
FT                   /note="identified by match to protein family HMM PF02261;
FT                   match to protein family HMM TIGR00223"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0604"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17740"
FT                   /db_xref="GOA:B5Y862"
FT                   /db_xref="InterPro:IPR003190"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5Y862"
FT                   /protein_id="ACI17740.1"
FT                   /translation="MLITVLKSKIHNARVTVCNVDYEGSLSLDEELIKQANLRPYEKVL
FT                   VANVTNGERFETYIIPAPANSREVGLNGAAARSAVVGDRVIVMAFAMKEPDEEVDTTVL
FT                   IMDEENNIKEVKKLKA"
FT   gene            complement(545052..545915)
FT                   /gene="panC"
FT                   /locus_tag="COPRO5265_0605"
FT   CDS_pept        complement(545052..545915)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="panC"
FT                   /locus_tag="COPRO5265_0605"
FT                   /product="pantoate--beta-alanine ligase"
FT                   /EC_number="6.3.2.1"
FT                   /note="identified by match to protein family HMM PF02569;
FT                   match to protein family HMM TIGR00018"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0605"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18189"
FT                   /db_xref="GOA:B5Y863"
FT                   /db_xref="InterPro:IPR003721"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR042176"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5Y863"
FT                   /protein_id="ACI18189.1"
FT                   /translation="MEIVRDIKTMREKVAEMKRQGKSVGLVPTMGYLHEGHLALIDTAR
FT                   KENDVVVVSDFVNPLQFGPNEDYLVYPRDMDRDAQLCSEHGVDFLFVPTVEEMYPKKGN
FT                   QVDVFVDVKHLDENLCGRFRPGHFRGVVTVVTKLFNIVSPNRAYFGMKDIQQLRIIEEM
FT                   VNDLNMNIEIVPVPTVREPSGLALSSRNTYLSAEEREKAASIYKSLLMAKDLILEKGVI
FT                   STAEVIGTCTRFLSQQGFKVQYFQLVDYDTLELLPKIEPPQKIIIATAVFLGKVRLIDN
FT                   LVIEVR"
FT   gene            complement(546171..546929)
FT                   /gene="panB"
FT                   /locus_tag="COPRO5265_0606"
FT   CDS_pept        complement(546171..546929)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="panB"
FT                   /locus_tag="COPRO5265_0606"
FT                   /product="3-methyl-2-oxobutanoate hydroxymethyltransferase"
FT                   /EC_number="2.1.2.11"
FT                   /note="identified by match to protein family HMM PF02548;
FT                   match to protein family HMM TIGR00222"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0606"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17680"
FT                   /db_xref="GOA:B5Y864"
FT                   /db_xref="InterPro:IPR003700"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y864"
FT                   /protein_id="ACI17680.1"
FT                   /translation="MNATQFKKLKGSKKIIMLTCYDFSFASALEEAGVDALLVGDSLGN
FT                   VVQGKETTLPVTLDQIIYHTEMVKRGAPNTFVVADMPFLSYQISVEEALRNCGLVMKET
FT                   NCDAVKLEGGEEVAHLVRRLTEIGIPVMGHIGVTPQSAKLMGYGKRGKDISDAEYLKRS
FT                   AKALYEAGAFSLVLENMAATLAKEITELVQIPTIGIGAGPECDGQVLVLHDFMGLTKDR
FT                   PPFAKPYFDLRAELKKAVSSYKNDVEQGKL"
FT   gene            complement(546934..547737)
FT                   /locus_tag="COPRO5265_0607"
FT   CDS_pept        complement(546934..547737)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0607"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0607"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17153"
FT                   /db_xref="GOA:B5Y865"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR018931"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR037108"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y865"
FT                   /protein_id="ACI17153.1"
FT                   /translation="MDIVLIGAGRVAGAFAPFLMKMGSLRVWNRTFENASILAKKVGAV
FT                   AISDPTQVKGDFAFVAVSDKALKNVAEQFSQSFTVALHTSGFHPSSVIEPMANYVGSLH
FT                   PWLPIPEQDHNLLVNALATFEGNREAEQIAAELASIVPLRLHRIDSQKKTTYHTAAVLL
FT                   SNYVDVLMIKGGELLREAGVTPAYDDDDAPSNEHSSGELDAEKLFVKEIVETTLRNYLK
FT                   LGKDSLTGPAVRKDMEVIDAEASTLSEKWSLVYRLLAEIIMEGGI"
FT   gene            548254..549435
FT                   /locus_tag="COPRO5265_0608"
FT   CDS_pept        548254..549435
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0608"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0608"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18034"
FT                   /db_xref="InterPro:IPR018977"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y866"
FT                   /protein_id="ACI18034.1"
FT                   /translation="MLALVDEPFDFQTGFTELPMGLVEDLLSQSSKLAEHVRKQIQEMQ
FT                   QVKKEVREQLKREGVLRRDGDFGYYDVPTSCGVDGAYATERLLALDFGVAAAVAVEGII
FT                   PPSARSYWSDPQHKAHADAYAHSDDTPVILRALMMEFELELAEQAPHDVVFLDGSMATP
FT                   IILMDQAINRLIEQTKQGTYHALAVKVLEGFPTYLRDYLSISSGKRSDKIWVASPKYSS
FT                   NREFGKVLQWRIPLDDRAVFTYVLEAGEFAGPVQVQRPARMWHLSPPDENDEVTKQQIE
FT                   KLINQLTSLQVLYYRPTAMVPAMRLEVPAPVATNDTRLAMLLQAVKHQCMTPGVMEPFP
FT                   LYMADRMVKHIGAAMPALRQNATTALTEDGIEAFDMDNVFFSLHGYRSESGGY"
FT   gene            549874..551616
FT                   /locus_tag="COPRO5265_0609"
FT   CDS_pept        549874..551616
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0609"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0609"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17721"
FT                   /db_xref="InterPro:IPR002789"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008571"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y867"
FT                   /protein_id="ACI17721.1"
FT                   /translation="MQRAERVGTLGSPSSTGTLSVEILETAVSKKLVGEMILFNFIQDS
FT                   KEHFGLGQINEVILKNKWLEDPTMRALARRRGNVNQVSGMQDTHRADVMVSAVFGLGEK
FT                   GFEPSVLGTVPPTGTMLHLVNDEILDLLLNRYKNEIFYLGRIYGSETKLPMWFKHFGTG
FT                   PAGAGEAYHIGVFGRTGSGKSVLAKMITLAYARHADMGIFILDPQGEFALGLGDGAPGI
FT                   KSMGNVLCKPVLRKLGREAVVYDIENILLQDWYLFTHFLKEFGFFSDLGIKYEDYQEIA
FT                   ADYLEDFLRDSGTVSFQNLSEETLLPVLDYLYRVAEKIYAGKAGYDRVRSNVDELKQKM
FT                   EEGTFSRTQRTWNTVIRFFKWSSGKKTPAQIINDHVLTPEKKPVVVIDLSKKAEGVSEI
FT                   SWNESIKPLIIGTFLGALVREAENHYKEGKSLNTLVVIDEAHRFVPSGRLENRNSESVR
FT                   RTLIDAVRTTRKYGLGWMFISQTLSSLDREIVEQLRISFFGFGLSMGSELRSLTEIIGG
FT                   SQSAMNLYQSFRDPHSSFDLESRQYSFMTVGPVSPLSFAGTPLFFNAFNDVGEFLRANN
FT                   LEIY"
FT   gene            551787..551987
FT                   /locus_tag="COPRO5265_0610"
FT   CDS_pept        551787..551987
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0610"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0610"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17139"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y868"
FT                   /protein_id="ACI17139.1"
FT                   /translation="MGTDMVHVIAVSRVSKTKSFNDYQNCVVLFPLEGDARPFGIIWEL
FT                   VNRTYLLSALMLCIPQCTTKN"
FT   gene            552029..555418
FT                   /locus_tag="COPRO5265_0611"
FT   CDS_pept        552029..555418
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0611"
FT                   /product="modification methylase, type III R/M system"
FT                   /note="identified by match to protein family HMM PF01555"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0611"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17610"
FT                   /db_xref="GOA:B5Y869"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR002295"
FT                   /db_xref="InterPro:IPR002941"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y869"
FT                   /protein_id="ACI17610.1"
FT                   /translation="MKNEKVRSNGANNEVLGKLQNLLKQLFEIDASSDLDFGIYRILNF
FT                   RRREINKFIEERLPQRVNEAFAHFAAHTEEEINRRMAELRRKIRENFGEQAVDANGTLK
FT                   QEFRNTPLGQEYEQLSKQQADAVAVEDMKTRVYNDLYTFFSRYYEDGDFVPRYRYSIRG
FT                   HKYAIPYNGEEIKLYWVNSGQYYTKTGTLFRDYTFVAGNTRIVFRLSEATEELGSNKAT
FT                   NDRFFVLDSEEPIVFETGPKGEDGKSRTVVVRFNYRELYEGDAWFQHIQGLSAKPSNAS
FT                   SNNESSGKVEEVESWEEENYDEDEGTQLGSGTARTTVRIKQDNLTPLLEEAIIDAVAKE
FT                   DKMLADWLAEPVQRNAGPDRRQEGDQQQNRSLLGYHLRRFTSKNNRDYFIHKNLRAFLN
FT                   DQLDYFIKAEVLDTSTLLEPNEVNKHLSRAGAVKELGTAIIDFLAQVEDFQKRLWEKKK
FT                   FVIKTDYVITLNRLAQWTNPEFMKYVEEAVLGNQEQLSEWNTMLALNPETTRWTRKSLL
FT                   RGGSANDSELWSAGVGSDALRPEMYKPLPLDTAYFDSEFKWRVLAEISKSVGLDDALDG
FT                   LLVKSENFQALNTLLGKYKAKVQTIYIDPPFNKEQDADFLYNVKYKDSTWASMLENRLR
FT                   LGREMLSERGSIFVRCDYNGNWIVRPLMNEIFGAENFRNEIVISRISKQDPKVKRFNTA
FT                   TDSLFFYSKTIGSPFNLLFKKLAKNKEERWHAMDSQGKGQPLYIFGYLLSPPNNRHWTY
FT                   GQEKIKQMEREKTIRLKCKKCGYIHTSGIWKGCPECKNREDVKVEYLLAPTEVKQIDSN
FT                   WTDVPGYSFVTDFATENSEILLKRVIESTSNRGDLVMDFFLGSGTTTAVAHKLGRKWIG
FT                   VEMGEHFWTVVLPRMKKVLAYDKSGISKEQDVKETYNEKTAGGFFKYQILEQYEDVLDN
FT                   LELSPNDNYLSLFQDEYLLKYFLTEESKNSPYLLQIEQLSKPFSYKLKVNLKEVGDPQE
FT                   LVIDLPETFNYLLGLNVKCMVMKTMGGDGEAVSEIGDAVATPLIGNKYLFVLGLEQESQ
FT                   QKVAVIWRDWHSKSWKKTDYDADKTFIVESLKEITGENLTLKTVYVNGQSTLTHSDVSG
FT                   AVVMAIEPEFKRLMESTGVSLP"
FT   gene            555415..558834
FT                   /locus_tag="COPRO5265_0612"
FT   CDS_pept        555415..558834
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0612"
FT                   /product="conserved protein"
FT                   /note="identified by match to protein family HMM PF04851"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0612"
FT                   /db_xref="EnsemblGenomes-Tr:ACI16873"
FT                   /db_xref="GOA:B5Y870"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y870"
FT                   /protein_id="ACI16873.1"
FT                   /translation="MSNVEKYLVLSKYFMREVLGVPSLKNVREVLLRAKPGVDSDGVTY
FT                   FCRKLIDELDTTLKIQPDMLMAYDKNIQEYVDYINKRRNNVSLKYFQYLALLVTEIYLD
FT                   RLTNDTNRFVSDLNEFLHTYSNEVKFKKELSNFTSEDLKKLAFWMATGSGKTLIMHMNY
FT                   LQFMRYKPFEPSNIILLTPNEGLSTQHHEELRISGIPATLYHENLLAATGSTVIPGQVL
FT                   VIEITKLKEEKRGSGVTLPVDAFEGRNLVFVDEGHKGKGSEERVWARLRDALGSNGFTF
FT                   EYSATFGQILSEKDWTTMEEYAKSIVFDYSYKFFYNDHYGKDFRVMNVKKAPSLAQTDY
FT                   SRVMFTANLLSFYQQLLSYQKNRDLAILHNLEKPLWIFVGATVQGESSDVALVTRFFRE
FT                   AVDGSLKDVARRILSGDYLDDEGNDLFGDRFDELRKNFIEPRQMESEHGSGNWLDALWD
FT                   DLMQRVFHGRGSLRVVQLSNAPGEFGLRVGENPYFGLINVGQDSGLVRALKNNGFELEK
FT                   DVITSSLFEQIKETDSRINVLLGSRKFIEGWDTWRVSSMGLLNMGRGQGPQIIQLFGRG
FT                   VRIKGKNMTLQRSGHPDLSNLETLFIYGIKANYLEQFLEAIRKEGVDYEEILVPIQARH
FT                   QERWKELVVPVRSTSKPFEECVVLVLGAEENIMDDYYGETVAGGKEEEQEDEEHGGVAG
FT                   DSGTTTVTLDLSPQISTYDGYRPRDLSSTTEAIAGGQVKLGKGSTSPLLWDEYADYVDW
FT                   EAVFLEMLRFKASRGYWNLVFDVDSLKRIWKDNRLTIYYPGFEVRSMKDVADLRGVVTQ
FT                   GLKKYVDVFYSKQERHWKTKNMKPATLEEATGTSRQLSLFTVNEEQPSYYVVKVPSDNK
FT                   TAIQRLNSLVMNMTTMVTTNTQLNGAATTPTGVGGNATNNGKSDDNSNPLLVLNELVIV
FT                   PLLSQRALNNLVKKAQQDEDWEAHPAPLNEGEEKFLRDLHHFVSENDVPGGFTPYVMRN
FT                   QSRTGIGFQLEWAGFYPDFIIWLVKPGEQIIVFVDPHGLVHAHGLDDEKIKFCCSGIKT
FT                   IEKQLRKRMRSSKAATLAPPPGTAPVPAKVTLDAFIISTTPYDVLIKQRPDMDKPKALY
FT                   EQKHVLFLEDKSWPGKMLIKVVFGDDSSKNVL"
FT   gene            558883..560190
FT                   /locus_tag="COPRO5265_0613"
FT   CDS_pept        558883..560190
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0613"
FT                   /product="acetamidase/formamidase"
FT                   /EC_number="3.5.1.49"
FT                   /note="identified by match to protein family HMM PF03069"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0613"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18063"
FT                   /db_xref="GOA:B5Y871"
FT                   /db_xref="InterPro:IPR004304"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y871"
FT                   /protein_id="ACI18063.1"
FT                   /translation="MADKDFKPVVFVDKFTEGVLDPNEEMEYFVQDGGYIVANTAPGCW
FT                   GPMLTPKLKGGHEVTKPVYVEGAEVGDSVAIYIKDLQVTSIATSSGKDVVIEGRYEGDP
FT                   FVAKRCPSCGTERPETRIEGTGPDAIRCAVCGADVAAFKFENGYTIVFDHEKGIGITVS
FT                   EEIARAIGENPRYYMQTPANSVQNPVVVLAPHDLVGTVARMRPFLGQLGSTPSIPFPDS
FT                   HNAGDFGQLLIGATHEYGMTKEQLDEHRTDGHMDVNMTRKGAVVIVPVKVKGAGIYLGD
FT                   MHAMQGNGEIAGHTTDVAGIATVQVKVLKGVTVEGPIIVPNEDDLPPMAKPFTDEEMDA
FT                   AYVLAEQWGQNQIEESYPLCFVGTGATLNEATDNGLMRASRFLGIPYAEVLNRATITGA
FT                   IGIGRLPGVATVTFLVPMELLDKKGLLDLVQDKYGG"
FT   gene            complement(560283..561107)
FT                   /locus_tag="COPRO5265_0614"
FT   CDS_pept        complement(560283..561107)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0614"
FT                   /product="carbohydrate esterase, family 1"
FT                   /note="identified by match to protein family HMM PF00756"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0614"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17241"
FT                   /db_xref="InterPro:IPR000801"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y872"
FT                   /protein_id="ACI17241.1"
FT                   /translation="MPERLMTIRAHMPQLNRDRNVRIYLPPDYFVNLSRRYPVLYMHDG
FT                   QNLFEPSKLSGFSWEVNQTLDRLFELDPQRYAFIVVGIDSSTVGTRRLDEYCPWQCSIY
FT                   ETPENPWNYTLVDGEGDKYSEFIVETLKPVIDSEFRTLPGKEHTMIAGSSLGGLISLYM
FT                   GLKYNNVFSTVGAFSTALLFTYDRMVEFISRLDLQSKVKVWLYVGGNEITDPQRPEEAL
FT                   AFLSTNTKLCEVLQKKLGRENVTFVVDKDATHSEEYWRIYFEKFIKWAALSS"
FT   gene            561293..562210
FT                   /locus_tag="COPRO5265_0615"
FT   CDS_pept        561293..562210
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0615"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0615"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18141"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y873"
FT                   /protein_id="ACI18141.1"
FT                   /translation="MPLYEIKDGKLKPIKEEDFKLEKDLQKLCDDNLETLFSLELVKSQ
FT                   FAIENFRIDTLAFDEETKAFVVIEYKKGENFSVIDQGYTYLSLVLNNKAECVLAYQEAF
FT                   DKSLRKTEVEWSQTRVIFVSPYFTTYQINSINFKDLPIELWKVKRYSNNTVLVEQVEPA
FT                   RANESIKVIAKEGSTARPTAPEEVRTYTEEDLLARASESTKELYERLKERILQLGDVKV
FT                   KVTKLYIAFVAATNFADVEVQRKGLKVFLNMRKGELNDPMSKARDVSTIGHWGNGDYEI
FT                   RVDTDTDLDYVMYLIKQSYERNRA"
FT   gene            562357..562641
FT                   /gene="rpsF"
FT                   /locus_tag="COPRO5265_0616"
FT   CDS_pept        562357..562641
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsF"
FT                   /locus_tag="COPRO5265_0616"
FT                   /product="ribosomal protein S6"
FT                   /note="identified by match to protein family HMM PF01250;
FT                   match to protein family HMM TIGR00166"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0616"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17502"
FT                   /db_xref="GOA:B5Y874"
FT                   /db_xref="InterPro:IPR000529"
FT                   /db_xref="InterPro:IPR014717"
FT                   /db_xref="InterPro:IPR020814"
FT                   /db_xref="InterPro:IPR035980"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y874"
FT                   /protein_id="ACI17502.1"
FT                   /translation="MNRKYELMVIYRAEDDNGYQEGNDWVTEKVQSYQGQVTKLDPWGL
FT                   RRLAYPIEKRTQAYYSVFQIELPVENLDEFSQDLKVDERILRFMITRGE"
FT   gene            562645..563133
FT                   /gene="ssb"
FT                   /locus_tag="COPRO5265_0617"
FT   CDS_pept        562645..563133
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ssb"
FT                   /locus_tag="COPRO5265_0617"
FT                   /product="prophage L54a, single-stranded DNA binding
FT                   protein"
FT                   /note="identified by match to protein family HMM PF00436;
FT                   match to protein family HMM TIGR00621"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0617"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17754"
FT                   /db_xref="GOA:B5Y875"
FT                   /db_xref="InterPro:IPR000424"
FT                   /db_xref="InterPro:IPR011344"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y875"
FT                   /protein_id="ACI17754.1"
FT                   /translation="MLNKVLLIGRLTTDPVIKALPSGKRVANFTLAIDNPGKDQSGAPL
FT                   PADFIDCVAYSDNLVRLLDLYVRKGRLIFAEGRLRIRSYTDRNGIRRRTSEVVLSTIQF
FT                   LDSKKDAQQSSTGVSTGSSVKGTEDVDAMDILNEVESKLQEQDSDDLVDLDENFDVPF"
FT   gene            563226..563450
FT                   /gene="rpsR"
FT                   /locus_tag="COPRO5265_0618"
FT   CDS_pept        563226..563450
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsR"
FT                   /locus_tag="COPRO5265_0618"
FT                   /product="ribosomal protein S18"
FT                   /note="identified by match to protein family HMM PF01084;
FT                   match to protein family HMM TIGR00165"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0618"
FT                   /db_xref="EnsemblGenomes-Tr:ACI16996"
FT                   /db_xref="GOA:B5Y876"
FT                   /db_xref="InterPro:IPR001648"
FT                   /db_xref="InterPro:IPR018275"
FT                   /db_xref="InterPro:IPR036870"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5Y876"
FT                   /protein_id="ACI16996.1"
FT                   /translation="MPVQRKRRIKLCPLCADGVREVDYKDVNRLRRFTSDRGKILPRRV
FT                   TGVCAFHQRSLSRAIKRAREMALLPYVMQ"
FT   gene            563584..564582
FT                   /locus_tag="COPRO5265_0619"
FT   CDS_pept        563584..564582
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0619"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0619"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17842"
FT                   /db_xref="GOA:B5Y877"
FT                   /db_xref="InterPro:IPR018710"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y877"
FT                   /protein_id="ACI17842.1"
FT                   /translation="MRQDSTKAIVESGLMSALAVILVLMGWYLPVVGALISLIAPLPFL
FT                   VVSAKHGLRYGAITVAVSALISYFLTGDPLIIVSVVLSLGSIGLALGWAVSHGYSAERT
FT                   LLLGAAVFVIVTTLILYGSQLILHQNILKEMADVMRQSASMLESRFAGTGTATGGMTAT
FT                   TATTATGATSTATSSLKGIAESYKQYADTLESGLMTPALILLGSVLLAFYNYIILKPFA
FT                   QRLGVALPNLPTMQEIRLPALGVWFIPAALLLMVIKSSYTAFLGFNLYVIGLYYLIFCG
FT                   MFYLCRILLGEKDNKFVKALFIIGLVFPYFPQVYFLFGIYDCIMRLLRREG"
FT   gene            564589..565035
FT                   /gene="rplI"
FT                   /locus_tag="COPRO5265_0620"
FT   CDS_pept        564589..565035
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplI"
FT                   /locus_tag="COPRO5265_0620"
FT                   /product="ribosomal protein L9"
FT                   /note="identified by match to protein family HMM PF01281;
FT                   match to protein family HMM PF03948; match to protein
FT                   family HMM TIGR00158"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0620"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17302"
FT                   /db_xref="GOA:B5Y878"
FT                   /db_xref="InterPro:IPR000244"
FT                   /db_xref="InterPro:IPR009027"
FT                   /db_xref="InterPro:IPR020069"
FT                   /db_xref="InterPro:IPR020070"
FT                   /db_xref="InterPro:IPR020594"
FT                   /db_xref="InterPro:IPR036791"
FT                   /db_xref="InterPro:IPR036935"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5Y878"
FT                   /protein_id="ACI17302.1"
FT                   /translation="MKVYLLQDLPGTGKKGQIVDVAEGYARNYLFKNNLAILADEKLIE
FT                   QVKKREEREQRKEEERYQKALDLKKELEGKAVVVKAPGGETGKLYGAVTTRQIAHALKE
FT                   QLKLEVDSKDINMPDPIKSVGVYDVDIHLFKDVWATVKVKVEKE"
FT   gene            565054..566424
FT                   /gene="dnaB"
FT                   /locus_tag="COPRO5265_0621"
FT   CDS_pept        565054..566424
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaB"
FT                   /locus_tag="COPRO5265_0621"
FT                   /product="replicative DNA helicase"
FT                   /EC_number="3.6.1.-"
FT                   /note="identified by match to protein family HMM PF00772;
FT                   match to protein family HMM PF03796; match to protein
FT                   family HMM TIGR00665"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0621"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17689"
FT                   /db_xref="GOA:B5Y879"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR007692"
FT                   /db_xref="InterPro:IPR007693"
FT                   /db_xref="InterPro:IPR007694"
FT                   /db_xref="InterPro:IPR016136"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036185"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y879"
FT                   /protein_id="ACI17689.1"
FT                   /translation="MINESSFGMPYSHEAEVSVLGSCLINKDALAEVAGSLLPEDFYEE
FT                   RHKILFQVMTQMYEEGIPVDLVTFVERLKRDNLLDVVGGQEYVAQVASSVYTAANVGTY
FT                   AKLVKERSLQRSLIRVGTEIARLGYTGKNIEEDLDKAQQLVFSLSMWKYMKSATPVSEL
FT                   VKRYYSLIEERYAQRSRVTGYPTGLQKLDELLTGFQRSDLLILAARPGMGKTAFALNVA
FT                   TYMSMEEEIPVLFFSLEMSATQLVQRLLSAVSNVPSQKLKTGYLATEDFDALRIAMSRL
FT                   EDAPLWIDESPGLSVLEIRSRARRAVAELGIKMIIIDYLQLIRLGQNVDNRVQEVSEIT
FT                   RSLKNLARELDIPLLVLSQLSRAVEQRADKRPQLSDLRESGSIEQDADVVMFLYSEDYY
FT                   KQQKGLRPENSTVELVVAKHRNGPTGEVKLMFRKDIGRFYSLEENVWGDEGAAVSEE"
FT   gene            566396..568912
FT                   /gene="leuS"
FT                   /locus_tag="COPRO5265_0622"
FT   CDS_pept        566396..568912
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="leuS"
FT                   /locus_tag="COPRO5265_0622"
FT                   /product="leucyl-tRNA synthetase"
FT                   /EC_number="6.1.1.4"
FT                   /note="identified by match to protein family HMM PF00133;
FT                   match to protein family HMM PF08264; match to protein
FT                   family HMM PF09334; match to protein family HMM TIGR00396"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0622"
FT                   /db_xref="EnsemblGenomes-Tr:ACI16987"
FT                   /db_xref="GOA:B5Y880"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002302"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR025709"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y880"
FT                   /protein_id="ACI16987.1"
FT                   /translation="MKVRQSAKNNESNGSTEYDFKKAEERWSKYWQERGLFKANGTLGT
FT                   KPKQYVLEMFPYPSGKLHMGHVRNYSLGDVVARYNRMRGFDVLHPMGWDAFGLPAENAA
FT                   IERGIHPENWTLSNIGYMREQMKKLGFSYDWDREVATCLPDYYKWTQWLFLKLYENGLA
FT                   YKKRAKVNWCPHCKTVLANEQVIDGKCWRCHSPIEKREIEQWFFKITAYAEDLLNDLDN
FT                   LDWPEHVKAQQRNWIGRSEGALVKFAIEGTDKVIEIFTTRLDTIYGATFMVLAPEHPLA
FT                   MELVQGTALKELYDEYLKRISLKSEIDRLSTEKEKEGFFLGKYAVNPFNGERIPIYAGD
FT                   YVLTEYGTGAIMAVPAHDERDYAFAVKYNIPIRPVVVPKDGEEIKNGEVFTEYGVLVNS
FT                   GPYTGKTSEEAQKLMAEYLEEHNLGQKSVTYRLRDWLVSRQRYWGAPIPVVYCEHCGTV
FT                   PVPEDQLPVILPREVDYLPGDLVSPLATDEEFVHTTCPKCGGPARRETDTMDTFVDSSW
FT                   YYLRYVDPHNEQAPFDKELAQYWMPVDIYIGGVEHAVLHLLYSRFITKALKDMGYVTIS
FT                   EPFSKLFTQGMVTLGGSAMSKSKGNIVDPDDILRDYGADAARMYTLFVAPPEKDFEWSQ
FT                   QGLEGIVRFIRRIWNFYCKYADEVKEAVAAPMGKLFEGMSEYDEKALRAVNRLVYRVTE
FT                   DIEDNYRFNTAIAAMMEFLNEVTDYDEKVSSAVMKTLLETFAKVLAPFVPFLAEELWAM
FT                   LGNAPSVHEQSWPQWDESMLQENTVEVAVQINGKFRGTVVVRNGASEEEVREAVMSSGN
FT                   FSKYLSKEGGYKKCFYVPNKIINFIV"
FT   gene            568870..569583
FT                   /locus_tag="COPRO5265_0623"
FT   CDS_pept        568870..569583
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0623"
FT                   /product="ComEA protein"
FT                   /note="identified by match to protein family HMM PF00633;
FT                   match to protein family HMM TIGR00426"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0623"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17262"
FT                   /db_xref="GOA:B5Y881"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR004509"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR019554"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y881"
FT                   /protein_id="ACI17262.1"
FT                   /translation="MFLRSEQNNKFHSLAGGWKKAATWLAAFFLVGAICFEMGYRFGVS
FT                   SLLSSKDAQASVSPSVETSSAAANSTSTALEPELVSVYIVGAVDRPGVYTAKPTQRIGD
FT                   VISMAGVKGDADLTRLNLASHVADEMMVYVPTKAEQQNVDGSQGIPSSTAQNSGGVVIG
FT                   SSESAGSSKSSLININTADEKQLDALPGIGPTLAARIVEYRQANGPFKSIEEVKNVSGI
FT                   GEKRFADIKDLITVR"
FT   gene            569589..571343
FT                   /locus_tag="COPRO5265_0624"
FT   CDS_pept        569589..571343
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0624"
FT                   /product="competence protein ComEC/Rec2, putative"
FT                   /note="identified by match to protein family HMM PF03772"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0624"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17966"
FT                   /db_xref="GOA:B5Y882"
FT                   /db_xref="InterPro:IPR004477"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y882"
FT                   /protein_id="ACI17966.1"
FT                   /translation="MILTALAVVFALWFYPWGAVLFVPLFVFLKKKRWIAIVGVVVVLL
FT                   AYTSIYRSVSMDGQVFKGTVVVDSDGKGYYRGLVPVCSSDVGVLSGTFQMNWHKYHCAV
FT                   PVKVNTLETPLFRVRSAMENRLGSLQSGSLLNALVLGNPLPLRIQEQAIKTGILHVFAI
FT                   SGLQTTLLMGYVYRWSKNKIATMLLGLVLIIFYGFSASVLRSVLMYGVMLSIPKGRKLG
FT                   LGGVAAAGLAASCLDPLFFTRTASLLSLLGAAAVVYWGDSKWSSVKISLTLLPASLLFF
FT                   HSISLLGAFFTVLLVPVFTLLYALGILYVIMPLRLLSYLVDMVGMAILSLHELVELLPA
FT                   WVLLNFGSREVLVILVGVVLTALLRRWWLPVLTCIALLLLPAQSRVIFLDVGQGSATLV
FT                   QKGSYGLLIDTSDRAVVLRDVRWYGIRHLGLIISHDDKDHNGMQEQVMLSFHPKIMDPY
FT                   KGDMISFGPIRAETVWPPPAMVGTDNELSKVIYLPEFNGLITGDVPAAYLPNGDYSFFT
FT                   VPHHGAKLTELSLTSSVAVISVGKNAYGHPNKDTLKVLESKHMKVYRTDYCGDIIYEQG
FT                   RVSCPSNR"
FT   gene            571443..572906
FT                   /locus_tag="COPRO5265_0625"
FT   CDS_pept        571443..572906
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0625"
FT                   /product="probable PBP 5 synthesis repressor, putative"
FT                   /note="identified by match to protein family HMM PF03816;
FT                   match to protein family HMM TIGR00350"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0625"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17901"
FT                   /db_xref="InterPro:IPR004474"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y883"
FT                   /protein_id="ACI17901.1"
FT                   /translation="MKMSVNVKKVLIAIGFLLIFLVSFVGGVFAQKVIMPQGEGVNLAD
FT                   LVSSAAERFSSITGSKGDQVWLIAGLDTVGEMKGAGSVGHNDTLILAFIRGSTINLLYI
FT                   PRDSLVAIPDKGVTKVGHTFLYGGVRKLAETIKQNFGVAVDHYVVVNFSTVIEMVDLMG
FT                   GLKVDVPQRYCYQGVGVPRYTCIDKGTHTLNGTEFLVYWRIRDYGRTHVSDLTRIQRQI
FT                   DLLLGTDLKDQVISKLSPSFVSSAVDVWSKYVLSDVSLMEIASLANKWKDAHIEADVLS
FT                   GDSFISRVFDLGVPVSVYQWDADWLKSWYIEKFGPMGQTLANGVNPPKLSVPRPTDSSS
FT                   SKETSGNKNSTSGGKTSTASNSGSNSSGSTGGTATQSPTPSSTTTTTTTTSTTTQNSSQ
FT                   SNATTNVNDTATQSVPELPPEVENNTTVATGAVNGEIPGPVITPTTATPPEENYNDSWE
FT                   GSGYDSKNNENETLTVTNAYTETPTEGGH"
FT   gene            572962..573408
FT                   /locus_tag="COPRO5265_0626"
FT   CDS_pept        572962..573408
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0626"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0626"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17356"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y884"
FT                   /protein_id="ACI17356.1"
FT                   /translation="MKRAFDLLGGNEKLFWFLEVSRKWDSLDTWLKDLVFPSALQGTVV
FT                   VMDYYSPVGRMKLLYNKDDVLTELKRFLPFAEDVKVGKARKKESFSHLSEKLSRSKKIE
FT                   KQILELSDVDADGVCTDGIKDKELAELFGKFVKVRRAWQEWKKA"
FT   gene            573393..575306
FT                   /gene="gyrB"
FT                   /locus_tag="COPRO5265_0627"
FT   CDS_pept        573393..575306
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gyrB"
FT                   /locus_tag="COPRO5265_0627"
FT                   /product="DNA gyrase, B subunit"
FT                   /EC_number="5.99.1.3"
FT                   /note="identified by match to protein family HMM PF00204;
FT                   match to protein family HMM PF00986; match to protein
FT                   family HMM PF01751; match to protein family HMM PF02518"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0627"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17293"
FT                   /db_xref="GOA:B5Y885"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR034160"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y885"
FT                   /protein_id="ACI17293.1"
FT                   /translation="MEKSLKTKNYGAEQIKVLGDLEGVRKRPAMYIGSTDKNGLHHLIW
FT                   EIVDNAIDEAMAGFCDHIKVVLYKDGSVLVEDNGRGIPVEIHPQEGRPTVEVVLTKLHA
FT                   GGKFGGQAYKASGGLHGVGLSVVNALSEWLEITVKRDGTVYWQRYEFGKPVTEVKEIGQ
FT                   YDDTESSATIVQFKPDKSIFADTRFDYEVIRQRLRELAFLNSEVTIELQREGSEPEFFH
FT                   FESGLAGLLEEVANSSEKIIDVLRFSGAQQDVQVEVAFTYVDDFDENIVSFVNSVRTVD
FT                   GGTHVQGLRSAISKTLAEVGRRKGLLKDNNVSSDDFRQGLRAVVAVRVPEPEFEGQTKG
FT                   KLGSKYVRNIVEDVVSKAFESYLETQNDVTKTLIQRALASAEMRETFKRTREMMKNRLR
FT                   VESTVLPGKLSDCSSRDVEKRELLIVEGESAGGSAKQGRDRTIQAVLPLRGKILNVEKA
FT                   SWKRVLDNEEIQALIAAIGTGVGEHFNFAKLRYGKIIIMTDADVDGAHIRTLLLTFFFR
FT                   MMRPLVEEGHIYIAQPPLYKIERKKSKDIIYLYSDEDLQAFLREHEGENFEIQRYKGLG
FT                   EMNAEQLWETTLNPETRNLYMVTVEDAEKADELFSVLMGEKVQPRKEFIFANANLVKNL
FT                   DV"
FT   gene            575321..577597
FT                   /gene="gyrA"
FT                   /locus_tag="COPRO5265_0628"
FT   CDS_pept        575321..577597
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gyrA"
FT                   /locus_tag="COPRO5265_0628"
FT                   /product="DNA gyrase, A subunit"
FT                   /EC_number="5.99.1.3"
FT                   /note="identified by match to protein family HMM PF00521;
FT                   match to protein family HMM PF03989"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0628"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17976"
FT                   /db_xref="GOA:B5Y886"
FT                   /db_xref="InterPro:IPR002205"
FT                   /db_xref="InterPro:IPR006691"
FT                   /db_xref="InterPro:IPR013757"
FT                   /db_xref="InterPro:IPR013758"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR035516"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y886"
FT                   /protein_id="ACI17976.1"
FT                   /translation="MAGIHEREITEELKQSYIDYAMSVIVGRALPDVRDGLKPVQRRII
FT                   YSMSETGSTYNNPYKKSARIVGDVLGKYHPHGDASVYDALVRMAQDFVMRYPLVDGHGN
FT                   FGSMDGDPPAAMRYTEVRLTRLSEYLVQDLDKDTVNWVPNFDGSLKEPEVLPAVFPQLL
FT                   VNGSSGIAVGVSTYIPPHNLGEIIDATLHFLHNPEATSRQLMRFVKGPDFPTGGQIINP
FT                   QDLVKVYEEGKGVIRVRGRAKLEEGHGQKRRLVIYEIPYMVNKAELVSQIAQLIRDRKL
FT                   SGVDEVRDESNRQGVRVVLELKKGASFHHILNQLYEQTALENSFAINMVALKDGAPVQL
FT                   TLRDYIASFVDFRKETILRRTRYLLDKASKRREVVEGILKALDNIDLVIEIIRNAETTD
FT                   QAKRRLMSQIGLTEVQAEAVLEIKLRSLVHMEKEKVEQELESLLKAIAEYTEILNSETK
FT                   LLEVIAEELKHVKKLFADQRRTLIGFSDQQTETVQAAEETFFIELLEYGIIRRSKTQTN
FT                   LVDFIEVQGSDPVMFLTNFGKIFCISAYEIPESQRGVALNALFPMGNDEKVLLLGTQNQ
FT                   ELIAISEKGKGKRFRLDVEKIPSRGGYYFLLDPGDMVSVIVPVTSKELVVISAQGKALR
FT                   LDVESIPERGLRTGGVKVMRTYEGDRVVGATCLKQKYIVTMTENAYAKRTDIDEIPKRN
FT                   RGAAGVFIHKANETTGPVIGVSCNENMLYRSGREWLPLSMSDIPVCSKASMGKKVLRTL
FT                   INRLV"
FT   gene            577617..578000
FT                   /locus_tag="COPRO5265_0629"
FT   CDS_pept        577617..578000
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0629"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0629"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17055"
FT                   /db_xref="InterPro:IPR002804"
FT                   /db_xref="InterPro:IPR023572"
FT                   /db_xref="InterPro:IPR036820"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y887"
FT                   /protein_id="ACI17055.1"
FT                   /translation="MSYRFLDHTADLGVEVSGESTEELFQSCLDALREWSFHEVGSSEV
FT                   KHNVELSADTETELWFKFLNEVVFYMDKNEAPLTLSLREYHLGCNCYLRAELTMAEQSK
FT                   RKQAVKAFTLHNFGFTAQMIFDV"
FT   gene            578043..579476
FT                   /locus_tag="COPRO5265_0630"
FT   CDS_pept        578043..579476
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0630"
FT                   /product="replication factor C subunit"
FT                   /note="identified by match to protein family HMM PF01139"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0630"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17780"
FT                   /db_xref="GOA:B5Y888"
FT                   /db_xref="InterPro:IPR001233"
FT                   /db_xref="InterPro:IPR036025"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y888"
FT                   /protein_id="ACI17780.1"
FT                   /translation="MWKQVDKFVYEIPLGAKEGMRVPGRVFASETIFKQAEADKALEQV
FT                   VNVATLPGILRYSLAMPDIHWGYGFPIGGVAAFDVDHGVITPGGIGFDINCGVRLLVTP
FT                   LTEEQVRPKLGALLDVLYKEVPSGVGSEGFIKLSVRELDKVLEMGAKWAVEQGYGTFED
FT                   LERLESQGQLKGADASKVSKRAKERGLEQLGTLGSGNHFLEVQKVDEIFDEAVAKQMGL
FT                   SLGQVTIMLHTGSRGLGHQVATDYIDVMLKASKKYGIKLVDKQLAAAPFKSEEGQDYWA
FT                   AMQCAANFAWANRQVITDYIRKAFAKVFGNEIKDKITVIYDVAHNIAKLEKHMVDGMER
FT                   EVVVHRKGATRSFPAHHPELPSIYENTGQPVIIPGSMGSSSFLLVGLPGSMEQSWGSTC
FT                   HGAGRVMSRKEAIRKGNYGTLMDSLGEKGILVRSAERETLLEEAPEAYKDVDEVVHVVE
FT                   ELGLNRKVARMRPMGVVKG"
FT   gene            579473..579889
FT                   /locus_tag="COPRO5265_0631"
FT   CDS_pept        579473..579889
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0631"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF02367;
FT                   match to protein family HMM TIGR00150"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0631"
FT                   /db_xref="EnsemblGenomes-Tr:ACI16966"
FT                   /db_xref="GOA:B5Y889"
FT                   /db_xref="InterPro:IPR003442"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y889"
FT                   /protein_id="ACI16966.1"
FT                   /translation="MIKACTPEETVEAGSTFANNLKKGDLVLLFGVLGAGKTTFIRGVA
FT                   RLLAPGAKVSSPSFNLLKIYNMPDGGHLYHLDFYRVSSTKELWDIRIEEFLEDGLVVVE
FT                   WPGRFPDLLSLPHWKVIFKVLEDDCRCITFTKCS"
FT   gene            579862..580419
FT                   /locus_tag="COPRO5265_0632"
FT   CDS_pept        579862..580419
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0632"
FT                   /product="glycoprotease family"
FT                   /note="identified by match to protein family HMM PF00814"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0632"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17612"
FT                   /db_xref="GOA:B5Y890"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR022496"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y890"
FT                   /protein_id="ACI17612.1"
FT                   /translation="MHNIHKVLVIQTAFPNEVAGIYEPEKRFPFKWFFLQGKTLEALCD
FT                   IEIPEDLDAVAVAVGPGRFTSTRVGVGFALGLGMSRELPLIPLNVFDLIDSEGAEGWYL
FT                   IMSRKDEYYGSYRANFREVKREIFSDIPKTDVARVLDQDHPLTFADLEQFLQKRGLPDG
FT                   TSWETLKVEYMKEVAEEYKLWK"
FT   gene            580410..580883
FT                   /gene="rimI1"
FT                   /locus_tag="COPRO5265_0633"
FT   CDS_pept        580410..580883
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rimI1"
FT                   /locus_tag="COPRO5265_0633"
FT                   /product="ribosomal-protein-alanine acetyltransferase"
FT                   /EC_number="2.3.1.128"
FT                   /note="identified by match to protein family HMM PF00583;
FT                   match to protein family HMM TIGR01575"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0633"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17065"
FT                   /db_xref="GOA:B5Y891"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR006464"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y891"
FT                   /protein_id="ACI17065.1"
FT                   /translation="MEIIEFEITEATEEDLDAIYDVDKKAFSYPMSRSSIERDLRDRRL
FT                   SKYFVARLLPFNEVVGYIGLWCIFPEAHIVSIAVDPDYQGKGIGNKLLQQALAWLVNSG
FT                   FKHVFLEVRVDNEVAINLYDKHGFEKVSVRKNYYQDGSDAFVMVKDLTKKEEQ"
FT   gene            580899..581849
FT                   /gene="gcP"
FT                   /locus_tag="COPRO5265_0634"
FT   CDS_pept        580899..581849
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gcP"
FT                   /locus_tag="COPRO5265_0634"
FT                   /product="O-sialoglycoprotein endopeptidase"
FT                   /EC_number="3.4.24.57"
FT                   /note="identified by match to protein family HMM PF00814;
FT                   match to protein family HMM TIGR00329"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0634"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17726"
FT                   /db_xref="GOA:B5Y892"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR017861"
FT                   /db_xref="InterPro:IPR022450"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y892"
FT                   /protein_id="ACI17726.1"
FT                   /translation="MGYRILAIETSCDETAVACLNGDKVVQSKVFSQIDLHEAFGGVLP
FT                   EAAARRHLEVLPVLLKDVAKPDLIAVTAGPGLLPALLTGVSVALGLSRGWQVPVMGINH
FT                   VVAHVAAAALERRIELPVLGLVVSGGHTSFYLIEKWSDPKVLGWTYDDAAGECLDKVGR
FT                   ALGMKYPAGAEIDNLALTIKERVTMPLPLKNEDSFNFSFSGLKTAALKYKGKISNEVLA
FT                   ASLMEAVVNHLLDRIEKVLKKYPYPLVVGGGVSASKFLRQRMHEHFGERVIFPSAQLST
FT                   DNADMVAVYAALLLQEGIVPGSCVTPDPNMEQGWC"
FT   gene            581920..582216
FT                   /gene="groS"
FT                   /locus_tag="COPRO5265_0635"
FT   CDS_pept        581920..582216
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="groS"
FT                   /locus_tag="COPRO5265_0635"
FT                   /product="chaperonin GroS"
FT                   /note="identified by match to protein family HMM PF00166"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0635"
FT                   /db_xref="EnsemblGenomes-Tr:ACI16960"
FT                   /db_xref="GOA:B5Y893"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR018369"
FT                   /db_xref="InterPro:IPR020818"
FT                   /db_xref="InterPro:IPR037124"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5Y893"
FT                   /protein_id="ACI16960.1"
FT                   /translation="MEIKPLGDRVLLKPMEEEEKTKSGIVIPDTAKEKPQKGKVLAVGT
FT                   GRTLDNGTRVPLEVQVGDIVVFSKYAGTEVKVDGEEYLIVSERDILAVVGHEN"
FT   gene            582234..583847
FT                   /gene="groL"
FT                   /locus_tag="COPRO5265_0636"
FT   CDS_pept        582234..583847
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="groL"
FT                   /locus_tag="COPRO5265_0636"
FT                   /product="chaperonin GroL"
FT                   /note="identified by match to protein family HMM PF00118;
FT                   match to protein family HMM TIGR02348"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0636"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17539"
FT                   /db_xref="GOA:B5Y894"
FT                   /db_xref="InterPro:IPR001844"
FT                   /db_xref="InterPro:IPR002423"
FT                   /db_xref="InterPro:IPR018370"
FT                   /db_xref="InterPro:IPR027409"
FT                   /db_xref="InterPro:IPR027410"
FT                   /db_xref="InterPro:IPR027413"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5Y894"
FT                   /protein_id="ACI17539.1"
FT                   /translation="MAAKLIAFDEEARSKLLTGVLKLSKAVKATLGPKGRYVVLERKFG
FT                   SPLITNDGVTIAKEIDLEDPYENLGAQLAKEVASKTNDVAGDGTTTATVLAEAMVREGM
FT                   KNVTAGANPIALRRGIEKAVEAVTEEIKKLSRPVSGKRDITEVATISAKDQQIGSIIAE
FT                   AMEKVGKDGVVTVEEGKSLGMELEFVEGMQFDRGYVSPYFVTDPERMETVLEDPLIVIT
FT                   DKKISNVQEFLPLLEKIVQYGRSFLLIADDVEGEALATLVVNKLRGTFNCVAVKAPGFG
FT                   DRRKEMLQDIAIVTGGQVISEELGVSFESVTPDMFGHARSVKVDKESTTIVGGKGSSEE
FT                   IEKRIAQIRKQLETTESEYEKEKLQERLAKLAGGVAVIKVGAATETEMKEKKHRVEDAV
FT                   SATKAAMEEGIVAGGGVTLVKASTVLDKLPLENDELIGATIVKKALMEPARVIAENAGF
FT                   AGEVVVEELKKREYPVGFDAVKGEYVDMFEAGIIDPTKVTRSALQNAASIAAMVLTTEA
FT                   LVVEKPEQEKAQPGMPPEEY"
FT   gene            583995..584957
FT                   /locus_tag="COPRO5265_0637"
FT   CDS_pept        583995..584957
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0637"
FT                   /product="oligopeptide transport system permease protein
FT                   AppB"
FT                   /note="identified by match to protein family HMM PF00528"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0637"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18161"
FT                   /db_xref="GOA:B5Y895"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y895"
FT                   /protein_id="ACI18161.1"
FT                   /translation="MNYLIRRILQLIPTFIIATMIAFILFSLVGDPFEGMRQDPRLASQ
FT                   VERLRKIYGYDKDPLTRYVLWLYNFFTGEWGYSIMAKRSVFSVVTERIPVSLALGIGQT
FT                   VLATLFGLLLGIYSALHLYSTADYVATALVFFGMSMPSFFFGVVALFFFVITWPLFNVG
FT                   LMTPGFHPEAATLFEKTIEYGRHLMLPLMLLVILGMGGFVRYARSSMLEVLNMDYIRTA
FT                   RAKGLPESVVVRKHALRNALIPIVTLLALSLPGILGSAPITETIFSINGLGKLYIDALG
FT                   ANDQMTLMANLVLTISLVIVGNLLADILYSVVDPRVRLG"
FT   gene            584971..586257
FT                   /locus_tag="COPRO5265_0638"
FT   CDS_pept        584971..586257
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0638"
FT                   /product="dipeptide transport system permease protein DppC"
FT                   /note="identified by match to protein family HMM PF00528"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0638"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17484"
FT                   /db_xref="GOA:B5Y896"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR025966"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y896"
FT                   /protein_id="ACI17484.1"
FT                   /translation="MADKDQEKKVNNNTNNSATNNDYEVAQESYSFWGAVWRRFRRHKL
FT                   AIVGLWILVFVFIFSFIGPVFYTLDPSENIFEEDVANFYMYKINQAIKQDPGLKEYLGT
FT                   MLTDFEQTLARANDLKAKAAAGDYQALSELSWSRSDLASAGMQIISMVASYTDSNGNQP
FT                   FASYMDLTRYLSPPGLPVGAPGHPLGTDDQGRDLLARIMFGGKVSFAIGIASALIAVIL
FT                   GSLVGLVAGYVGGIVDSLLMRFVDIMLSIPTMPLLLALSPLLRRWTKSLTEGMGLGVFG
FT                   SILPMVLVLALFGWMGLSRLVRGQVLSLKEQQFIEAAQAIGVPTSRVLSKHLFPNVIAP
FT                   VVVAASLAVAGNILSEASLSFLGFGIQPPATSWGQILNVAVNFINSPQQIVRYWNMIFI
FT                   PGALLFFTVLSFNFAGDGLRDAVDPRMKL"
FT   gene            586268..587287
FT                   /gene="appD"
FT                   /locus_tag="COPRO5265_0639"
FT   CDS_pept        586268..587287
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="appD"
FT                   /locus_tag="COPRO5265_0639"
FT                   /product="oligopeptide transport ATP-binding protein AppD"
FT                   /note="identified by match to protein family HMM PF00005;
FT                   match to protein family HMM PF08352; match to protein
FT                   family HMM TIGR01727"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0639"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17973"
FT                   /db_xref="GOA:B5Y897"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y897"
FT                   /protein_id="ACI17973.1"
FT                   /translation="MEKGNILEIKNLQVTFYTEDGIVRALQGVSYEVPDNETLGVVGES
FT                   GCGKSVTALTVMRLLPKPQARVEGGEIWFKDKETGQEINILEQSEEHMRHIRGNKISMI
FT                   FQEPMTALNPVYTVGDQIMEAIMVHNPDISKKEARERAIEMLKVVGIPAPEKRVDDYPH
FT                   QMSGGMRQRVMIAMALSTNPEILIADEPTTALDVTIQAQILDLMNRLQEQFGMSIILIT
FT                   HNLGVVAQNADRIAVMYLGRIVEKAAVRDIFHNPKHPYTEGLLASVPRLDKGGLKEHLP
FT                   GITGNLPSPYNPPPGCKFHPRCPYAFDRCRVEEPPEVEVSPGHIVCCWLHTKEETNHE"
FT   gene            587280..588251
FT                   /locus_tag="COPRO5265_0640"
FT   CDS_pept        587280..588251
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0640"
FT                   /product="oligopeptide transport ATP-binding protein AppF"
FT                   /note="identified by match to protein family HMM PF00005;
FT                   match to protein family HMM PF08352; match to protein
FT                   family HMM TIGR01727"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0640"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17286"
FT                   /db_xref="GOA:B5Y898"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y898"
FT                   /protein_id="ACI17286.1"
FT                   /translation="MSNNDILLEVHDLVKWFPIRRGLFGTVQGYVKAVDGVSFNIRAHE
FT                   TLGLVGETGSGKTTIGRLVLRLIPQTRGKVIFDGVDITALDYKSFRPMKKDMQIIFQDP
FT                   YSSLNPRMTIGEIIAEPLIVHTNMTTQEREKRVYELLELVTLRPEHARRYPHEFSGGQR
FT                   QRIGIARALALNPRFIVADEPISALDVSIQAQITNLLIDLQKELGLSFLFIAHDLSVIK
FT                   HMCDSVLVLYLGKVMEYGSNADVFQHSRHPYTQALLSAVPVPDPDYKRERILLQGEIPS
FT                   PIDPPPGCVFHTRCPYATEKCRTDKPELREVEPGHMVACHYA"
FT   gene            588425..588943
FT                   /locus_tag="COPRO5265_0642"
FT   CDS_pept        588425..588943
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0642"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0642"
FT                   /db_xref="EnsemblGenomes-Tr:ACI16822"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y899"
FT                   /protein_id="ACI16822.1"
FT                   /translation="MNFIDYSTALWPAFGCTGIVLNNDFPWCRQLTFGHEVLSLRRAMN
FT                   FIRKNADAVGGIVLLGQGEEVEPLTSLARDLVKPIRWVLDSTSPCSEMALGFNNVLLMF
FT                   SGELNPEWEPFSGRITLGIWKREHLEKGLEIASQLQLPMETPFEVKGTNYPRVTTFQWL
FT                   WGSLSCEKY"
FT   gene            complement(588904..589779)
FT                   /gene="lipA"
FT                   /locus_tag="COPRO5265_0641"
FT   CDS_pept        complement(588904..589779)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lipA"
FT                   /locus_tag="COPRO5265_0641"
FT                   /product="lipoyl synthase"
FT                   /EC_number="2.8.1.8"
FT                   /note="identified by match to protein family HMM PF04055;
FT                   match to protein family HMM TIGR00510"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0641"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17693"
FT                   /db_xref="GOA:B5Y8A0"
FT                   /db_xref="InterPro:IPR003698"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y8A0"
FT                   /protein_id="ACI17693.1"
FT                   /translation="MDYEQIRKPAWIKTNLKDSETAKGVRQALEGLSLNTICVEGRCPN
FT                   IGTCFNHGTATFLIMGSICTRHCLYCNVQSGKPMPVDETEPQRVAEAVKRLRLKYVVLT
FT                   SVTRDDLEDGGSAFFRQVVEEVKKVNPNTKVEALVPDFKKNEEHWKAFITPQLDVFAHN
FT                   VEVVRPLFPKLRPAGDLDVSLSMLKYFKSKGFLTKTGFMVGVGESMEDIVNMLEELLNT
FT                   GVDIVTIGQYLQPSKKHWPVHKYYTPEEFKQLSEIGQSLGIPAVVSGPMVRSSYLADQY
FT                   FSQLSEPHNH"
FT   gene            589832..590413
FT                   /locus_tag="COPRO5265_0643"
FT   CDS_pept        589832..590413
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0643"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0643"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17937"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y8A1"
FT                   /protein_id="ACI17937.1"
FT                   /translation="MFPVFSWYADYVDEVSKPWVIPDPDPREVTFGKYTVHYAYSYYGQ
FT                   VKSLVKQWKFQGDHALGFRLGELMGITYNHLLCGKVVSYVPRYGESYPYFGNHLFSFLA
FT                   GLQKTGNCAVVPAYVKTRATMPQKTLSRSARMVNLHDAFVPTGTCADIVVDDVMTTGAT
FT                   SRVLYKCSPFKVWLVLARVELDLSSDFRKA"
FT   gene            590433..590526
FT                   /locus_tag="COPRO5265_1612"
FT   tRNA            590433..590526
FT                   /locus_tag="COPRO5265_1612"
FT                   /product="tRNA-Ser"
FT   gene            590749..590823
FT                   /locus_tag="COPRO5265_1613"
FT   tRNA            590749..590823
FT                   /locus_tag="COPRO5265_1613"
FT                   /product="tRNA-Val"
FT   gene            590831..590905
FT                   /locus_tag="COPRO5265_1614"
FT   tRNA            590831..590905
FT                   /locus_tag="COPRO5265_1614"
FT                   /product="tRNA-Gly"
FT   gene            590939..591015
FT                   /locus_tag="COPRO5265_1615"
FT   tRNA            590939..591015
FT                   /locus_tag="COPRO5265_1615"
FT                   /product="tRNA-Thr"
FT   gene            591170..592750
FT                   /gene="argS"
FT                   /locus_tag="COPRO5265_0649"
FT   CDS_pept        591170..592750
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argS"
FT                   /locus_tag="COPRO5265_0649"
FT                   /product="arginyl-tRNA synthetase"
FT                   /EC_number="6.1.1.19"
FT                   /note="identified by match to protein family HMM PF00750;
FT                   match to protein family HMM PF03485; match to protein
FT                   family HMM PF05746; match to protein family HMM TIGR00456"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0649"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17331"
FT                   /db_xref="GOA:B5Y8A2"
FT                   /db_xref="InterPro:IPR001278"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR005148"
FT                   /db_xref="InterPro:IPR008909"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR035684"
FT                   /db_xref="InterPro:IPR036695"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y8A2"
FT                   /protein_id="ACI17331.1"
FT                   /translation="MTDVIRTAITESTQKVFGLSTEDMPALDIQFTPDITMGDYAVPIG
FT                   FVLAKKLRTAPEKIAQTIAENLQGPFRAEAVKGYVNVTMDDDWWLDRLSQGFISYPQYS
FT                   GKVLVEYVSANPTGPIHIGHGRGAVVGSVLANLLDRVYDFADSEFYVNDAGEQIRKFCK
FT                   SVEIRIRELKGEDVELPEDAYHGDYVVDIAKSILDRYNWDALSEDEQWNVLWNDAVDMM
FT                   RKWHKETLEKLGVTMKVWTSERLIRQEGWPERVIQLLQDKGYAYEQDGALWFKSTIFGD
FT                   DKDRVLVKSNGEYTYYLVDIAYHMEKIHRGYNVLINVWGADHIGHVPRMNAALTALGFP
FT                   DCLTVVLVQTVRFWRQGVAVAMSKRKGEFLTLDELIDEIGKDAARIMFITRSVDATIDF
FT                   DIEVAKQKAMDNPVYYIQYAYVRAKNILTRTEERQFGSSVGFDPHERTLLRLLNAFQER
FT                   MVLAVRKLDPFVIESYAWELSDAFHKFYQFDRVIGSEYENARWKLVERFTEVMEELFTL
FT                   LGIEKLERM"
FT   gene            592755..594368
FT                   /gene="pyrG"
FT                   /locus_tag="COPRO5265_0650"
FT   CDS_pept        592755..594368
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyrG"
FT                   /locus_tag="COPRO5265_0650"
FT                   /product="CTP synthase"
FT                   /EC_number="6.3.4.2"
FT                   /note="identified by match to protein family HMM PF00117;
FT                   match to protein family HMM PF06418; match to protein
FT                   family HMM TIGR00337"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0650"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17896"
FT                   /db_xref="GOA:B5Y8A3"
FT                   /db_xref="InterPro:IPR004468"
FT                   /db_xref="InterPro:IPR017456"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR033828"
FT                   /db_xref="UniProtKB/Swiss-Prot:B5Y8A3"
FT                   /protein_id="ACI17896.1"
FT                   /translation="MTNTKFVFVTGGVLSSVGKGIAAASMGMLFKARGYKVTAIKMDPY
FT                   LNVDAGTMSPYQHGEVFVTEDGAETDLDLGHYERFLDENLSGKNNITSGKIYSQVITKE
FT                   RKGDYLGSTVQVIPHVTDAIKESILYGAQGADLAVVEIGGTVGDIESLPFLEAVRQLRR
FT                   ELGPNGSVVVHVTYVPILETTHEAKTKPTQHSVKELRSIGLQPDAIVLRSHTPLEKHVL
FT                   EKTSLFCDVPLEGVINSYDVESVYDVPLLLEQEKLISVLEERLFGTTTEADLKKWKEML
FT                   SRQSERTLKVALVGKYVVLPDAYLSVIEAIRHAAMKLGVAAHVSLMSSDELEKCDDEQL
FT                   SEKLSNMDALVVPGGFGARGIEGMVKVLRYARENKMPTLGLCLGMQVMSIEFARNVLGL
FT                   KDANSTEFDPNTTYPVISLLPEQMQVRDLGGSMRLGAYPCTLVEGTRVHALYNKPVVFE
FT                   RHRHRFEFNNEFREAFENNGFQVSGLYEPKDLVEVLELKDHPFYVGVQYHPEFKSRPMV
FT                   PHPLFLGLLSEAVAKASPVL"
FT   gene            594378..594452
FT                   /locus_tag="COPRO5265_1616"
FT   tRNA            594378..594452
FT                   /locus_tag="COPRO5265_1616"
FT                   /product="tRNA-Pro"
FT   gene            594478..595719
FT                   /locus_tag="COPRO5265_0652"
FT   CDS_pept        594478..595719
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0652"
FT                   /product="putrescine aminotransferase
FT                   (Putrescine--2-oxoglutaricacid transaminase) (PATase)
FT                   (PAT)"
FT                   /EC_number="2.6.1.82"
FT                   /note="identified by match to protein family HMM PF00202"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0652"
FT                   /db_xref="EnsemblGenomes-Tr:ACI18235"
FT                   /db_xref="GOA:B5Y8A4"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y8A4"
FT                   /protein_id="ACI18235.1"
FT                   /translation="MNPDEILQKYHDHINPGLADLLQLGGLAAVDDKAEGAYVWDADGN
FT                   KYLDAVGGYGVFGLGHRPPKVIEKVKETLDKMPLASKIFINSCEAELGEKLSEATGYQY
FT                   FMFLNSGSEAVETALKLARLTTGKTNFIGMTNAYHGVTFGALSVSGRDVYKEPFKPLLP
FT                   GVKIVPFGDAEALANALDDTVAAVIVEPIQGEGGVNVPPPGYLKKVRQLCDEAGCFLIL
FT                   DEIQTGMGRTGKLLAEEWEDVKADIVCLGKALGGGVVPIGAVGATETAWQGFIDNPLIH
FT                   ESTFGGNPLATSAGIAAVDEIVGKQIWNNAHSTGDKLLSALRSEAEKYPHLIKEVRGRG
FT                   LLIGVEMMEEGYGLPMMGFMLEEKTLVAYTLNNPRVIRIEPPLIIGDEEIQWLVNAFQK
FT                   ALAKLDKLAKDLEV"
FT   gene            595726..596163
FT                   /locus_tag="COPRO5265_0653"
FT   CDS_pept        595726..596163
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0653"
FT                   /product="polyketide cyclase/dehydrase superfamily"
FT                   /note="identified by match to protein family HMM PF03364"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0653"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17346"
FT                   /db_xref="InterPro:IPR005031"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y8A5"
FT                   /protein_id="ACI17346.1"
FT                   /translation="MLVEEEIIINAPADKVYQIVKDMGRYPEFIPSLKEVTVLENGPGY
FT                   TVTKWVSKVQSFTLQWTERDTFFDEERRVEYKLVEGAMKKFEGKWIVEPQTDGTTKVHL
FT                   DVDFELAMPALRDFLGPMAKKIMRDSLKSLLQGIKAESERV"
FT   gene            596165..597544
FT                   /locus_tag="COPRO5265_0654"
FT   CDS_pept        596165..597544
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0654"
FT                   /product="NAD(FAD)-utilizing dehydrogenase"
FT                   /note="identified by match to protein family HMM PF01134;
FT                   match to protein family HMM PF01266; match to protein
FT                   family HMM PF03486; match to protein family HMM PF07992"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0654"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17307"
FT                   /db_xref="GOA:B5Y8A6"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR028348"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y8A6"
FT                   /protein_id="ACI17307.1"
FT                   /translation="MSKVVIIGAGPAGIFCGLRLSEVLSGEDITIIEKGKPIDKRHCPL
FT                   LLNGKCVSCEPCSMISGWGGAGAYSDGKLNITGEIGGFLNEILGERRFGSFVPEVLKYF
FT                   YDHGAPKDLDNVAERPEVDDWRKRARLLGMKLITFPIIHLGTDKTKEVLANMYDTLRNR
FT                   GVNIIFDTEVEDILTEDKKVVGVRTSSGDFLKADYVVVAVGRSGADDLTRWVNGLGLHF
FT                   GTNPVDLGVRVEVPAEVLLPMTDVLYEVKLEYYSKAFEDKVRTFCMNPGGEVVKEHLDD
FT                   VITVNGHSYKEKFLPNTNFAVLVSTYFTEPFKDPVAYGKHVAKLANLLSDGIIVQRFGD
FT                   LVNGHRSTPERIKRSIVKPSLEDSIPGDLNAVLPRRHLESIIEFLQVLDQFAPGVGSRD
FT                   TLLYGVEVKFYSMRPEISNVLESEISNLFMAGDGAGITRGLFQAAMAGLVVADTIKERC
FT                   M"
FT   gene            597535..598755
FT                   /gene="purA"
FT                   /locus_tag="COPRO5265_0655"
FT   CDS_pept        597535..598755
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purA"
FT                   /locus_tag="COPRO5265_0655"
FT                   /product="adenylosuccinate synthetase"
FT                   /EC_number="6.3.4.4"
FT                   /note="identified by match to protein family HMM PF00709"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0655"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17949"
FT                   /db_xref="GOA:B5Y8A7"
FT                   /db_xref="InterPro:IPR001114"
FT                   /db_xref="InterPro:IPR018220"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033128"
FT                   /db_xref="InterPro:IPR042109"
FT                   /db_xref="InterPro:IPR042110"
FT                   /db_xref="InterPro:IPR042111"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y8A7"
FT                   /protein_id="ACI17949.1"
FT                   /translation="MHVSADLVCGLQWGDEGKGKAVDYISKNYDVVARFNGGDNAGHTV
FT                   VHQGSTYKFHVIPSGVLRGCLGVIGSGVVLNPSSLEEELRQLSGDEKIVISKRAHLILP
FT                   SYKLLDQKLESLKGDKVGTTGRGIGPAYGFKAFRFGVRVGDLFQDGLEEKLSEIRRLVE
FT                   SLNVEWIQPDVKHWKEVLAPYVGDDYKVLHEAYLEGRRILFEAAQGVLLDLDFGTYPFV
FT                   TSSYTFTNGVHAGSGFNAKELGDIIGVSKAYTTRVGNGAFPSEVFGETADHIREQGAEF
FT                   GTTTGRPRRVGWLDLVALRYAVRVSGCNKVFLTKVDVLSGLDKVGLITSYEVDGQRYSD
FT                   WFDFSQGALELVKPIVEWCNGWGSVLNEGKLNANLLAFMEAVEGAAGAKIQWVSYGPSD
FT                   HETLCML"
FT   gene            598774..598850
FT                   /locus_tag="COPRO5265_1617"
FT   tRNA            598774..598850
FT                   /locus_tag="COPRO5265_1617"
FT                   /product="tRNA-Pro"
FT   gene            598875..600332
FT                   /locus_tag="COPRO5265_0657"
FT   CDS_pept        598875..600332
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0657"
FT                   /product="arginine decarboxylase"
FT                   /EC_number="4.1.1.19"
FT                   /note="identified by match to protein family HMM PF00266;
FT                   match to protein family HMM PF01212; match to protein
FT                   family HMM PF01276; match to protein family HMM PF03711"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0657"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17330"
FT                   /db_xref="GOA:B5Y8A8"
FT                   /db_xref="InterPro:IPR000310"
FT                   /db_xref="InterPro:IPR008286"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036633"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y8A8"
FT                   /protein_id="ACI17330.1"
FT                   /translation="MNDQYRTPYYSGLLAYIAKHRASFHMPGHKRGRGVHPDFKAFLGE
FT                   NVFLLDLTEVQGVDYLHKPTGILREAMDLLADAYGAKESFFLVNGSTVGNQAALMAVGG
FT                   PGKKILIARNSHRSVVGGLILNGSIPVYLPVNVDPELGITTSVSPEVLREYLDKHDVDA
FT                   VFLTNPNYYGVSGNIRELVDIVHEHGLPIVVDEAHGAHFHFHQALPLSAVDAGADLVVQ
FT                   STHKTLSSMTQSSWMHMNGDLVDVELLKAALRTLQSSSPNYVLMASLDVARMQMATEGA
FT                   ELLSSALNVAQYLREAINEIPGLQCFGRERVGKYGIFDVDLTKITITVLGLGLTGYKVE
FT                   QLLNDELGVEVELSDPNNILAFVTIGDDYDNADKLIKAMSNLSERFFGKLPPLETAAVH
FT                   TFPVLPEVVLTPREAFFAEKKVVPFREAVGAISAESVVLYPPGIPVIAPGERITEESFD
FT                   YVMKRKEEGAEVQGTADPELEFIQVLK"
FT   gene            600433..600744
FT                   /locus_tag="COPRO5265_0658"
FT   CDS_pept        600433..600744
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0658"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0658"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17037"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y8A9"
FT                   /protein_id="ACI17037.1"
FT                   /translation="MEEFFEALKSLEQEASDIVSTSSVQARQRVEVARERFAEEFHELE
FT                   ENCRQELERELERLSQEWEQRRQEELESYSKQLSKLGTELDQRAGHLAKELLESFLGE"
FT   gene            600802..602598
FT                   /locus_tag="COPRO5265_0659"
FT   CDS_pept        600802..602598
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0659"
FT                   /product="V-type ATP synthase subunit I (V-type ATPase
FT                   subunit I)"
FT                   /EC_number="3.6.3.14"
FT                   /note="identified by match to protein family HMM PF01496"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0659"
FT                   /db_xref="EnsemblGenomes-Tr:ACI16963"
FT                   /db_xref="GOA:B5Y8B0"
FT                   /db_xref="InterPro:IPR002490"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y8B0"
FT                   /protein_id="ACI16963.1"
FT                   /translation="MGALRKYIFKLSDFHPLELNHNTLGDFATLKDRLERVVSLGSKRK
FT                   PDIYATSVLSEKETISTGYIEIGPVLSEIERLIDEHQLLTNELNNLNKQILGLEPFQWV
FT                   SAPWEDSHNWHWIKVVLVKKSKAVLKILSDLPVAFAEGDNAIVVAYYKDDDETAEVIRE
FT                   YALDDRLLTDIGRELNELKIKKEQLTKHLADVESQLDTLLEENGTQIRKAFDYYSVSLE
FT                   YARLVNGSVDTQFLGVVVGYLPKEHLNDALKEVRALGGDVLQLPPEEDEMYPTKLENSS
FT                   FFEPYESITLMYGPPRYDTYDPTPAVALWWNLFFAFMLGDAGFGLVITLVSLYGLKKIK
FT                   SMEKILRLCLNVGVGTMIVGIITWSWFSTQPLMINGKALGLFYPVNGSDVNTMLVISLV
FT                   IGVMAQFYAMGIKGWWMLRNKDYLGFWSDVFCWWGFLSSLIWLLLGGGSMSTYLALFFA
FT                   INLILFQGRESKNWISRLGMGLIGLYGIISPYGVASFLGDVLSYSRLMALNLTGALMGQ
FT                   VFNSLSFGVMKSGLMGIVFGVLMFVVFQVFNFAISALGAFVHSIRLVFLEMYGRFYEGN
FT                   GELFKPLKRVGRYYRFEEVDYE"
FT   gene            602595..603059
FT                   /locus_tag="COPRO5265_0660"
FT   CDS_pept        602595..603059
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="COPRO5265_0660"
FT                   /product="V-type sodium ATP synthase subunit K
FT                   (Na(+)-translocating ATPase subunit K) (Sodium ATPase
FT                   proteolipid component)"
FT                   /EC_number="3.6.3.14"
FT                   /note="identified by match to protein family HMM PF00137"
FT                   /db_xref="EnsemblGenomes-Gn:COPRO5265_0660"
FT                   /db_xref="EnsemblGenomes-Tr:ACI17578"
FT                   /db_xref="GOA:B5Y8B1"
FT                   /db_xref="InterPro:IPR000245"
FT                   /db_xref="InterPro:IPR002379"
FT                   /db_xref="InterPro:IPR035921"
FT                   /db_xref="UniProtKB/TrEMBL:B5Y8B1"
FT                   /protein_id="ACI17578.1"
FT                   /translation="MTIDGTSVALIGAGLTAGLSAVGSAWGVGLAGKATSAVLSEKPNL
FT                   FGQMLVLQALPGTQGFYGFIAMFLALGRINAATSISIAQALQLIGALLPVMFGELISAY
FT                   WQGVASAGAAQMVAKQPESFGRAVIIPALVETYAILSLLATIILLGGVTL"
FT   gene            603059..603604
FT                   /locus_tag="COPRO5265_0661"
FT   CDS_